F494559

General Info

Members Datasets Scaffolds Average Seq Length
1524 926 970 315

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1016489|Ga0209025_10164892
Length 365
Sequence MTSSALCFPGLRGRQGCCSDWPDLQIHETLRRMSRRSGPNQPPDHSSFLETKEILMASDVFTGTIPALMTPCRADRSPDFDALVRKGKELIAAGMSAVVYCGSMGDWPLLTDEERQEGVARLAAAGVPVIVGTGAQNTQRAAAFARHASEVGAKGLMVIPRVLSRGPSASAQQAHFMAILEAANGLPAVIYNSPYYGFETRAELFFQLRDKFPNLIGFKEFGGAASLTYAAENITGQSDDITLMVGVDTQVFHGFVNCGASGAITGIGNVLPEPVLKLVSLCEQAAKGDVTARQKALELDNALAVLSSFDEGPDLVLFYKYLMVLEGNPEYELHFNASDALSRGQMHYAKTQLELFKTWYAAWSA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231012 Pseudomonas sp. GM33 Isolate Nodule
11 2511231014 Pseudomonas sp. GM48 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231023 Pseudomonas sp. GM80 Isolate Nodule
15 2511231024 Pseudomonas sp. GM84 Isolate Nodule
16 2511231031 Pseudomonas sp. GM16 Isolate Nodule
17 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
18 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
19 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
23 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
29 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
30 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
31 2519103095 Burkholderia sp. KJ006 Isolate Nodule
32 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
33 2534681786 Brucella suis 92/29 Isolate Unclassified
34 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
35 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
36 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
37 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
38 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
39 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
40 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
41 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
42 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
43 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
44 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
45 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
46 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
47 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
48 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
49 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
50 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
51 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
52 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
53 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
54 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
55 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
56 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
57 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
58 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
59 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
60 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
61 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
62 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
63 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
64 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
65 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
66 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
67 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
68 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
69 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
70 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
71 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
72 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
73 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
74 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
75 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
76 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
77 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
78 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
79 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
80 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
81 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
82 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
83 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
84 2643221568 Rhizobium sp. Root564 Isolate Unclassified
85 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
86 2643221582 Rhizobium sp. Root651 Isolate Unclassified
87 2643221599 Rhizobium sp. Root708 Isolate Unclassified
88 2643221607 Rhizobium sp. Root73 Isolate Unclassified
89 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
90 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
91 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
92 2643221693 Rhizobium sp. Root491 Isolate Unclassified
93 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
94 2643221733 Bosea sp. Root381 Isolate Unclassified
95 2643221734 Bosea sp. Root670 Isolate Unclassified
96 2643221736 Bosea sp. Root483D1 Isolate Unclassified
97 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
98 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
99 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
100 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
101 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
102 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
103 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
104 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
105 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
106 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
107 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
108 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
109 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
110 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
111 2738541297 Duganella sp. GV083 Isolate Unclassified
112 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
113 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
114 2738541357 Duganella sp. GV053 Isolate Unclassified
115 2738543003 Duganella sp. GV066 Isolate Unclassified
116 2738543024 Aminobacter sp. AP02 Isolate Unclassified
117 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
118 2738543026 Duganella sp. GV089 Isolate Unclassified
119 2738543029 Duganella sp. GV039 Isolate Unclassified
120 2751185800 Brucella pituitosa AA2 Isolate Unclassified
121 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
122 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
123 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
124 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
125 2765235841 Pseudomonas putida AA7 Isolate Unclassified
126 2773857673 Pseudomonas sp. 443 Isolate Unclassified
127 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
128 2784132063 Pseudomonas sp. 424 Isolate Unclassified
129 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
130 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
131 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
132 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
133 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
134 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
135 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
136 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
137 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
138 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
139 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
140 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
141 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
142 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
143 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
144 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
145 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
146 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
147 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
148 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
149 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
150 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
151 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
152 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
153 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
154 2818991467 Bosea vestrisii 3192 Isolate Unclassified
155 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
156 2821131069 Duganella sp. 1224 Isolate Unclassified
157 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
158 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
159 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
160 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
161 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
162 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
163 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
164 2841760612 Bosea sp. Tri-49 Isolate Nodule
165 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
166 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
167 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
168 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
169 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
170 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
171 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
172 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
173 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
174 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
175 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
176 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
177 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
178 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
179 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
180 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
181 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
182 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
183 2844104063 Bosea sp. Tri-39 Isolate Nodule
184 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
185 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
186 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
187 2851182111 Bosea sp. Tri-44 Isolate Nodule
188 2851246043 Bosea sp. Tri-54 Isolate Nodule
189 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
190 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
191 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
192 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
193 2854911287 Brucella lupini LUP21 Isolate Unclassified
194 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
195 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
196 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
197 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
198 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
199 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
200 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
201 2857564685 Duganella sp. R-74599 Isolate Unclassified
202 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
203 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
204 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
205 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
206 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
207 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
208 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
209 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
210 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
211 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
212 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
213 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
214 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
215 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
216 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
217 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
218 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
219 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
220 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
221 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
222 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
223 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
224 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
225 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
226 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
227 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
228 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
229 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
230 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
231 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
232 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
233 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
234 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
235 2902330777 Methylobacterium sp. 2A Isolate Unclassified
236 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
237 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
238 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
239 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
240 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
241 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
242 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
243 2904424332 Duganella sp. 1411 Isolate Rhizosphere
244 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
245 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
246 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
247 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
248 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
249 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
250 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
251 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
252 2909042592 Labrys sp. LIt4 Isolate Nodule
253 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
254 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
255 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
256 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
257 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
258 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
259 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
260 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
261 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
262 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
263 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
264 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
265 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
266 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
267 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
268 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
269 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
270 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
271 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
272 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
273 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
274 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
275 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
276 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
277 2919476304 Duganella sp. 3397 Isolate Unclassified
278 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
279 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
280 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
281 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
282 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
283 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
284 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
285 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
286 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
287 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
288 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
289 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
290 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
291 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
292 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
293 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
294 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
295 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
296 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
297 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
298 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
299 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
300 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
301 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
302 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
303 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
304 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
305 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
306 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
307 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
308 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
309 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
310 2928163908 Burkholderia sp. 567 Isolate Unclassified
311 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
312 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
313 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
314 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
315 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
316 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
317 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
318 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
319 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
320 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
321 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
322 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
323 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
324 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
325 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
326 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
327 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
328 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
329 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
330 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
331 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
332 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
333 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
334 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
335 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
336 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
337 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
338 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
339 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
340 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
341 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
342 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
343 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
344 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
345 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
346 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
347 2952252522 Salinicola sp. DM10 Isolate Unclassified
348 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
349 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
350 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
351 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
352 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
353 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
354 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
355 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
356 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
357 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
358 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
359 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
360 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
361 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
362 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
363 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
364 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
365 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
366 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
367 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
368 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
369 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
370 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
371 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
372 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
373 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
374 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
375 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
376 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
377 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
378 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
379 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
380 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
381 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
382 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
383 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
384 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
385 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
386 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
387 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
388 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
389 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
390 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
391 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
392 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
393 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
394 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
395 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
396 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
397 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
398 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
399 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
400 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
401 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
402 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
403 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
404 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
405 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
406 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
407 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
408 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
409 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
410 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
411 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
412 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
413 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
414 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
415 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
416 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
417 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
418 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
419 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
420 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
421 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
422 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
423 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
424 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
425 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
426 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
427 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
428 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
429 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
430 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
431 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
432 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
433 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
434 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
435 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
436 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
437 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
438 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
439 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
440 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
441 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
442 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
443 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
444 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
445 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
446 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
447 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
448 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
449 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
450 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
451 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
452 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
453 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
454 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
455 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
456 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
457 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
458 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
459 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
460 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
461 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
462 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
463 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
464 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
465 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
466 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
467 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
468 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
469 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
470 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
471 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
472 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
473 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
474 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
475 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
476 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
477 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
478 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
479 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
480 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
481 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
482 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
483 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
484 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
485 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
486 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
487 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
488 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
489 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
490 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
491 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
492 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
493 2996887358 Rhizobium sp. R711 Isolate Nodule
494 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
495 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
496 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
497 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
498 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
499 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
500 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
501 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
502 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
503 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
504 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
505 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
506 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
507 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
508 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
509 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
510 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
511 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
512 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
513 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
514 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
515 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
516 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
517 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
518 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
519 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
520 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
521 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
522 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
523 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
524 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
525 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
526 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
527 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
528 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
529 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
530 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
531 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
532 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
533 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
534 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
535 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
536 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
537 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
538 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
539 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
540 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
541 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
542 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
543 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
544 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
545 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
546 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
547 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
548 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
549 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
550 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
551 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
552 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
553 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
554 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
555 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
556 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
557 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
558 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
559 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
560 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
561 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
562 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
563 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
564 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
565 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
566 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
567 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
568 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
569 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
570 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
571 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
572 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
573 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
574 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
575 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
576 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
577 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
578 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
579 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
580 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
581 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
582 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
583 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
584 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
585 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
586 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
587 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
588 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
589 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
590 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
591 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
592 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
593 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
594 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
595 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
596 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
597 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
598 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
599 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
600 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
601 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
602 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
603 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
604 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
605 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
606 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
607 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
608 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
609 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
610 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
611 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
612 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
613 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
614 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
615 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
616 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
617 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
618 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
619 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
620 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
621 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
622 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
623 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
624 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
625 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
626 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
627 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
628 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
629 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
630 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
631 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
632 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
633 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
634 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
635 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
636 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
646 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
649 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
652 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
653 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
654 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
655 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
656 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
657 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
659 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
660 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
661 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
662 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
663 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
664 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
665 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
666 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
667 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
668 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
669 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
670 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
671 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
672 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
673 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
674 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
675 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
676 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
677 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
678 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
679 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
680 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
681 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
682 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
683 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
684 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
685 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
686 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
687 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
688 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
689 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
690 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
691 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
692 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
693 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
694 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
695 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
696 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
697 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
698 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
699 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
700 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
701 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
702 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
703 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
704 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
705 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
706 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
707 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
708 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
709 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
710 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
711 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
712 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
713 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
714 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
715 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
716 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
717 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
718 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
719 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
720 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
721 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
722 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
723 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
724 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
725 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
726 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
727 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
728 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
729 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
730 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
731 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
732 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
733 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
734 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
735 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
736 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
737 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
738 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
739 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
740 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
741 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
742 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
743 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
744 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
745 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
746 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
747 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
748 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
749 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
750 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
751 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
752 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
753 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
754 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
755 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
756 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
757 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
758 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
759 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
760 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
761 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
762 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
763 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
764 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
765 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
766 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
767 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
768 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
769 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
770 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
771 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
772 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
773 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
774 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
775 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
776 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
777 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
778 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
779 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
780 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
781 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
782 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
783 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
784 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
785 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
786 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
787 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
788 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
789 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
790 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
791 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
792 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
793 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
794 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
795 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
796 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
797 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
798 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
799 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
800 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
801 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
802 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
803 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
804 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
805 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
806 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
807 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
808 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
809 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
810 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
811 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
812 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
813 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
814 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
815 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
816 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
817 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
818 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
819 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
820 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
821 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
822 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
823 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
824 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
825 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
826 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
827 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
828 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
829 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
830 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
831 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
832 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
833 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
834 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
835 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
836 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
837 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
838 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
839 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
840 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
841 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
842 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
843 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
844 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
845 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
846 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
847 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
848 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
849 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
850 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
851 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
852 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
853 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
854 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
855 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
856 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
857 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
858 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
859 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
860 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
861 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
862 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
863 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
864 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
865 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
866 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
867 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
868 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
869 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
870 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
871 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
872 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
873 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
874 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
875 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
876 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
877 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
878 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
879 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
880 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
881 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
882 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
883 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
884 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
885 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
886 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
887 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
888 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
889 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
890 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
891 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
892 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
893 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
894 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
895 8005258706 Rhizobium sp. R693 Isolate Nodule
896 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
897 8005321885 Rhizobium sp. R72 Isolate Nodule
898 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
899 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
900 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
901 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
902 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
903 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
904 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
905 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
906 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
907 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
908 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
909 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
910 8052494512 Pseudomonas putida LD6 Isolate Unclassified
911 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
912 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
913 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
914 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
915 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
916 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
917 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
918 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
919 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
920 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
921 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
922 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
923 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
924 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
925 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
926 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.71
Metatranscriptomes 0
Isolates 36.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 12.2
Nodule 22.31
Rhizoplane 2.17
Rhizosphere 45.41
Stem 0
Stem Tuber 0
Unclassified 17.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2672424 2162886007 Bacteria 1070
2 SwRhRL2b_contig_2703748 2162886007 Bacteria 1791
3 SwRhRL2b_contig_2894984 2162886007 Bacteria 1205
4 SwRhRL2b_contig_507962 2162886007 Bacteria 6187
5 JGI24740J21852_10000099 3300001979 Bacteria 30439
6 JGI24740J21852_10032415 3300001979 Bacteria 1671
7 JGI24739J22299_10007607 3300001989 Bacteria 4058
8 JGI24739J22299_10029968 3300001989 Bacteria 1888
9 JGI24735J21928_10018021 3300002067 Bacteria 2180
10 JGI25155J39150_1000027 3300002704 Bacteria 123955
11 JGI25156J39149_1000008 3300002705 Bacteria 229035
12 JGI25156J39149_1001201 3300002705 Bacteria 11486
13 JGI25156J39149_1001580 3300002705 Bacteria 9377
14 JGI25162J39368_1000074 3300002737 Bacteria 121066
15 JGI25154J39366_1000050 3300002738 Bacteria 124480
16 JGI25157J39369_1000028 3300002741 Bacteria 147384
17 JGI25157J39369_1000767 3300002741 Bacteria 16640
18 JGI25159J45721_1004247 3300002987 Bacteria 4820
19 JGI25151J46595_10000036 3300003187 Bacteria 188770
20 JGI25165J46597_1000020 3300003214 Bacteria 370477
21 JGI25165J46597_1000201 3300003214 Bacteria 87622
22 JGI25165J46597_1001615 3300003214 Bacteria 10764
23 JGI25153J46596_10000024 3300003215 Bacteria 238285
24 rootH1_10002623 3300003316 Bacteria 12699
25 rootH1_10002623 3300003323 Bacteria 7256
26 rootH2_10051550 3300003320 Bacteria 13941
27 rootH2_10055630 3300003320 Bacteria 2716
28 rootH1_10046512 3300003323 Bacteria 2288
29 Ga0055538_1000062 3300003751 Bacteria 105260
30 Ga0055539_1000011 3300003752 Bacteria 399747
31 Ga0055539_1000093 3300003752 Bacteria 105260
32 Ga0055533_1000014 3300003756 Bacteria 399747
33 Ga0055533_1000070 3300003756 Bacteria 153414
34 Ga0055533_1000105 3300003756 Bacteria 105260
35 Ga0055532_1000009 3300003758 Bacteria 399537
36 Ga0055532_1000011 3300003758 Bacteria 385294
37 Ga0055532_1000230 3300003758 Bacteria 41833
38 Ga0055525_1000016 3300003759 Bacteria 399724
39 Ga0055525_1000137 3300003759 Bacteria 105260
40 Ga0055527_1000009 3300003760 Bacteria 385294
41 Ga0055527_1000042 3300003760 Bacteria 115844
42 Ga0055535_1000008 3300003761 Bacteria 385294
43 Ga0055535_1000066 3300003761 Bacteria 115844
44 Ga0055542_1000014 3300003762 Bacteria 385294
45 Ga0055542_1001483 3300003762 Bacteria 11519
46 Ga0055529_1000010 3300003763 Bacteria 385294
47 Ga0055529_1001530 3300003763 Bacteria 6659
48 Ga0055529_1005106 3300003763 Bacteria 1935
49 Ga0055526_1000209 3300003771 Bacteria 50344
50 Ga0055526_1023065 3300003771 Bacteria 2089
51 Ga0055524_1000018 3300003775 Bacteria 234806
52 Ga0055524_1000748 3300003775 Bacteria 22121
53 Ga0055524_1014052 3300003775 Bacteria 2988
54 Ga0055536_1000013 3300003781 Bacteria 240693
55 Ga0055536_1000035 3300003781 Bacteria 145848
56 Ga0055528_1000299 3300003790 Bacteria 42145
57 Ga0055530_10000212 3300003791 Bacteria 52572
58 Ga0055530_10000534 3300003791 Bacteria 32971
59 Ga0055540_1000008 3300003792 Bacteria 309635
60 Ga0055540_1000042 3300003792 Bacteria 156410
61 Ga0055531_10000002 3300003794 Bacteria 421971
62 Ga0055531_10000150 3300003794 Bacteria 80520
63 Ga0055531_10003120 3300003794 Bacteria 10695
64 Ga0055541_1000008 3300003841 Bacteria 399724
65 Ga0055541_1000063 3300003841 Bacteria 105260
66 Ga0058692_1000668 3300003856 Bacteria 14146
67 Ga0065165_1000362 3300005262 Bacteria 74503
68 Ga0065714_10064524 3300005288 Bacteria 41924
69 Ga0065704_10002196 3300005289 Bacteria 7375
70 Ga0065704_10071779 3300005289 Bacteria 9959
71 Ga0070658_10085570 3300005327 Bacteria 2593
72 Ga0070670_100000277 3300005331 Bacteria 45000
73 Ga0070670_100000837 3300005331 Bacteria 24028
74 Ga0070668_100013859 3300005347 Bacteria 6027
75 Ga0070669_100001853 3300005353 Bacteria 15219
76 Ga0070671_100355327 3300005355 Bacteria 1251
77 Ga0070659_100000038 3300005366 Bacteria 110675
78 Ga0070663_100000558 3300005455 Bacteria 19863
79 Ga0070662_100005634 3300005457 Bacteria 8008
80 Ga0070681_10009242 3300005458 Bacteria 9688
81 Ga0068853_100009469 3300005539 Bacteria 7848
82 Ga0070665_100009039 3300005548 Bacteria 10094
83 Ga0068855_100075336 3300005563 Bacteria 3918
84 Ga0068855_100126350 3300005563 Bacteria 2923
85 Ga0068855_100199532 3300005563 Bacteria 2253
86 Ga0068855_100339440 3300005563 Bacteria 1657
87 Ga0070664_100000861 3300005564 Bacteria 23450
88 Ga0070664_100094179 3300005564 Bacteria 2597
89 Ga0070664_100131815 3300005564 Bacteria 2196
90 Ga0068857_100239574 3300005577 Bacteria 1660
91 Ga0068856_100005571 3300005614 Bacteria 12401
92 Ga0068852_100015462 3300005616 Bacteria 5921
93 Ga0068851_10012475 3300005834 Bacteria 4008
94 Ga0081539_10132905 3300005985 Bacteria 1220
95 Ga0075365_10008792 3300006038 Bacteria 5762
96 Ga0075365_10071991 3300006038 Bacteria 2328
97 Ga0075365_10212790 3300006038 Bacteria 1355
98 Ga0075363_100031537 3300006048 Bacteria 2749
99 Ga0075364_10000309 3300006051 Bacteria 23917
100 Ga0075364_10009737 3300006051 Bacteria 5776
101 Ga0075364_10030304 3300006051 Bacteria 3472
102 Ga0075364_10101485 3300006051 Bacteria 1915
103 Ga0075432_10014173 3300006058 Bacteria 2714
104 Ga0075362_10007557 3300006177 Bacteria 4123
105 Ga0075362_10007635 3300006177 Bacteria 4108
106 Ga0075362_10021049 3300006177 Bacteria 2732
107 Ga0075367_10004732 3300006178 Bacteria 6694
108 Ga0075367_10043833 3300006178 Bacteria 2620
109 Ga0075367_10064999 3300006178 Bacteria 2183
110 Ga0075367_10074090 3300006178 Bacteria 2053
111 Ga0075367_10091479 3300006178 Bacteria 1851
112 Ga0075369_10005032 3300006186 Bacteria 4924
113 Ga0075369_10015202 3300006186 Bacteria 3086
114 Ga0075366_10071103 3300006195 Bacteria 2073
115 Ga0075370_10037803 3300006353 Bacteria 2715
116 Ga0099823_1000102 3300006944 Bacteria 41832
117 Ga0079104_1002790 3300006946 Bacteria 8806
118 Ga0099826_10008333 3300006948 Bacteria 7704
119 Ga0105251_10000476 3300009011 Bacteria 37938
120 Ga0105251_10000877 3300009011 Bacteria 26945
121 Ga0105251_10001557 3300009011 Bacteria 19655
122 Ga0105251_10001803 3300009011 Bacteria 17776
123 Ga0105251_10013303 3300009011 Bacteria 4608
124 Ga0105244_10003371 3300009036 Bacteria 11440
125 Ga0105244_10003390 3300009036 Bacteria 11393
126 Ga0105244_10004115 3300009036 Bacteria 10152
127 Ga0105244_10006154 3300009036 Bacteria 7834
128 Ga0105244_10007082 3300009036 Bacteria 7170
129 Ga0105244_10009624 3300009036 Bacteria 5922
130 Ga0105244_10010494 3300009036 Bacteria 5616
131 Ga0105244_10016205 3300009036 Bacteria 4252
132 Ga0105244_10033265 3300009036 Bacteria 2719
133 Ga0105244_10047099 3300009036 Bacteria 2213
134 Ga0105250_10000041 3300009092 Bacteria 133571
135 Ga0105250_10000058 3300009092 Bacteria 111233
136 Ga0105250_10000155 3300009092 Bacteria 59663
137 Ga0105250_10003365 3300009092 Bacteria 7596
138 Ga0105250_10054190 3300009092 Bacteria 1608
139 Ga0105240_10069968 3300009093 Bacteria 4342
140 Ga0105240_10177754 3300009093 Bacteria 2515
141 Ga0105240_10207805 3300009093 Bacteria 2290
142 Ga0105240_10472910 3300009093 Bacteria 1398
143 Ga0105243_10000736 3300009148 Bacteria 31344
144 Ga0105243_10010726 3300009148 Bacteria 6942
145 Ga0105242_10016807 3300009176 Bacteria 5694
146 Ga0105237_10004461 3300009545 Bacteria 16177
147 Ga0105238_10013098 3300009551 Bacteria 8367
148 Ga0105238_10024559 3300009551 Bacteria 6143
149 Ga0105238_10064040 3300009551 Bacteria 3677
150 Ga0105238_10412598 3300009551 Bacteria 1344
151 Ga0105239_10025754 3300010375 Bacteria 6478
152 Ga0105239_10063548 3300010375 Bacteria 4053
153 Ga0105239_10124942 3300010375 Bacteria 2859
154 Ga0105239_10196744 3300010375 Bacteria 2257
155 Ga0105239_10316980 3300010375 Bacteria 1758
156 Ga0105246_10000357 3300011119 Bacteria 24630
157 Ga0105246_10000699 3300011119 Bacteria 18935
158 Ga0157345_1000001 3300012498 Bacteria 152919
159 Ga0157373_10000039 3300013100 Bacteria 117160
160 Ga0157373_10000193 3300013100 Bacteria 50206
161 Ga0157373_10000225 3300013100 Bacteria 46142
162 Ga0157373_10001827 3300013100 Bacteria 16204
163 Ga0157373_10047616 3300013100 Bacteria 3057
164 Ga0157373_10093927 3300013100 Bacteria 2112
165 Ga0157371_10000005 3300013102 Bacteria 416456
166 Ga0157371_10000262 3300013102 Bacteria 72390
167 Ga0157371_10014295 3300013102 Bacteria 5995
168 Ga0157371_10140454 3300013102 Bacteria 1720
169 Ga0157370_10000146 3300013104 Bacteria 86599
170 Ga0157370_10019164 3300013104 Bacteria 6875
171 Ga0157370_10070977 3300013104 Bacteria 3287
172 Ga0157370_10071884 3300013104 Bacteria 3264
173 Ga0157370_10084869 3300013104 Bacteria 2975
174 Ga0157370_10282385 3300013104 Bacteria 1534
175 Ga0157369_10000236 3300013105 Bacteria 76415
176 Ga0157369_10001402 3300013105 Bacteria 29596
177 Ga0157369_10003028 3300013105 Bacteria 20066
178 Ga0157369_10005269 3300013105 Bacteria 15076
179 Ga0157369_10016893 3300013105 Bacteria 8201
180 Ga0157369_10079725 3300013105 Bacteria 3506
181 Ga0157369_10530863 3300013105 Bacteria 1217
182 Ga0157374_10284715 3300013296 Bacteria 1632
183 Ga0157374_10287320 3300013296 Bacteria 1625
184 Ga0163162_10000392 3300013306 Bacteria 40123
185 Ga0157375_10000139 3300013308 Bacteria 72260
186 Ga0157375_10002380 3300013308 Bacteria 16274
187 Ga0157375_10087900 3300013308 Bacteria 3161
188 Ga0157380_10003627 3300014326 Bacteria 10611
189 Ga0182008_10000202 3300014497 Bacteria 46777
190 Ga0182008_10000704 3300014497 Bacteria 23899
191 Ga0182008_10002912 3300014497 Bacteria 10586
192 Ga0182008_10016440 3300014497 Bacteria 3844
193 Ga0182008_10052400 3300014497 Bacteria 2023
194 Ga0182006_1000107 3300015261 Bacteria 89971
195 Ga0182006_1000257 3300015261 Bacteria 48864
196 Ga0182006_1000654 3300015261 Bacteria 24643
197 Ga0182007_10000237 3300015262 Bacteria 37215
198 Ga0182007_10051204 3300015262 Bacteria 1363
199 Ga0182005_1000016 3300015265 Bacteria 346889
200 Ga0182005_1007215 3300015265 Bacteria 3346
201 Ga0163161_10000066 3300017792 Bacteria 107442
202 Ga0163161_10092213 3300017792 Bacteria 2243
203 Ga0163161_10092731 3300017792 Bacteria 2237
204 Ga0214544_1000130 3300021320 Bacteria 108844
205 Ga0214542_1000014 3300021321 Bacteria 233825
206 Ga0214542_1008629 3300021321 Bacteria 16592
207 Ga0214543_1000018 3300021327 Bacteria 272335
208 Ga0214543_1000146 3300021327 Bacteria 98609
209 Ga0213872_10013982 3300021361 Bacteria 3752
210 Ga0213876_10062142 3300021384 Bacteria 1971
211 Ga0228711_1000005 3300022739 Bacteria 215594
212 Ga0228710_1000141 3300022740 Bacteria 66299
213 Ga0209435_100020 3300025206 Bacteria 229105
214 Ga0209435_102302 3300025206 Bacteria 2249
215 Ga0209784_100021 3300025224 Bacteria 408534
216 Ga0209784_100023 3300025224 Bacteria 399841
217 Ga0209566_100019 3300025225 Bacteria 414836
218 Ga0209566_100119 3300025225 Bacteria 105312
219 Ga0209674_100011 3300025226 Bacteria 997175
220 Ga0209674_100034 3300025226 Bacteria 414903
221 Ga0209674_100036 3300025226 Bacteria 408534
222 Ga0209672_100002 3300025228 Bacteria 1733325
223 Ga0209672_100090 3300025228 Bacteria 119861
224 Ga0209147_100003 3300025229 Bacteria 1733325
225 Ga0209147_100027 3300025229 Bacteria 414610
226 Ga0209147_100132 3300025229 Bacteria 119628
227 Ga0209563_100037 3300025230 Bacteria 414903
228 Ga0209563_100040 3300025230 Bacteria 408534
229 Ga0209563_100549 3300025230 Bacteria 12534
230 Ga0209563_101714 3300025230 Bacteria 5547
231 Ga0209437_100067 3300025233 Bacteria 317685
232 Ga0209437_100104 3300025233 Bacteria 220736
233 Ga0209258_100005 3300025242 Bacteria 1087938
234 Ga0209258_100211 3300025242 Bacteria 116100
235 Ga0209258_100520 3300025242 Bacteria 37049
236 Ga0207425_1000170 3300025245 Bacteria 53604
237 Ga0209646_1000070 3300025246 Bacteria 229105
238 Ga0209646_1000110 3300025246 Bacteria 156257
239 Ga0209646_1005987 3300025246 Bacteria 2072
240 Ga0209646_1007551 3300025246 Bacteria 1771
241 Ga0209026_1000057 3300025250 Bacteria 229105
242 Ga0209026_1000116 3300025250 Bacteria 133228
243 Ga0209677_100021 3300025253 Bacteria 414954
244 Ga0209677_100023 3300025253 Bacteria 408534
245 Ga0209148_1000006 3300025254 Bacteria 1733325
246 Ga0209148_1000443 3300025254 Bacteria 45551
247 Ga0209148_1001181 3300025254 Bacteria 15037
248 Ga0209148_1012580 3300025254 Bacteria 1542
249 Ga0209759_1000006 3300025256 Bacteria 492407
250 Ga0209759_1000047 3300025256 Bacteria 229105
251 Ga0209759_1000153 3300025256 Bacteria 119494
252 Ga0209759_1001415 3300025256 Bacteria 13665
253 Ga0209233_1000018 3300025261 Bacteria 886857
254 Ga0209233_1000047 3300025261 Bacteria 459614
255 Ga0209233_1000088 3300025261 Bacteria 317980
256 Ga0209455_1000003 3300025272 Bacteria 1471893
257 Ga0209455_1000448 3300025272 Bacteria 31707
258 Ga0209455_1000723 3300025272 Bacteria 19152
259 Ga0209455_1001297 3300025272 Bacteria 11652
260 Ga0209455_1003801 3300025272 Bacteria 5184
261 Ga0209673_1000054 3300025273 Bacteria 279116
262 Ga0209673_1019757 3300025273 Bacteria 2409
263 Ga0209130_1000226 3300025284 Bacteria 73970
264 Ga0209675_1002312 3300025291 Bacteria 9863
265 Ga0209675_1002774 3300025291 Bacteria 8745
266 Ga0209675_1007013 3300025291 Bacteria 4399
267 Ga0209675_1016744 3300025291 Bacteria 2121
268 Ga0209676_1000002 3300025292 Bacteria 1732948
269 Ga0209676_1000020 3300025292 Bacteria 617256
270 Ga0209676_1019241 3300025292 Bacteria 2354
271 Ga0209676_1026670 3300025292 Bacteria 1831
272 Ga0209025_1000017 3300025294 Bacteria 768983
273 Ga0209025_1000131 3300025294 Bacteria 198190
274 Ga0209025_1000696 3300025294 Bacteria 57362
275 Ga0209025_1003982 3300025294 Bacteria 13262
276 Ga0209025_1004669 3300025294 Bacteria 11711
277 Ga0209025_1016489 3300025294 Bacteria 4352
278 Ga0209025_1038943 3300025294 Bacteria 2082
279 Ga0209025_1044062 3300025294 Bacteria 1871
280 Ga0209564_1000027 3300025295 Bacteria 518458
281 Ga0209564_1000059 3300025295 Bacteria 328782
282 Ga0209564_1009879 3300025295 Bacteria 4471
283 Ga0209758_1000033 3300025297 Bacteria 469998
284 Ga0209758_1000394 3300025297 Bacteria 75557
285 Ga0209758_1017152 3300025297 Bacteria 3627
286 Ga0209758_1029691 3300025297 Bacteria 2279
287 Ga0209050_1000006 3300025298 Bacteria 1359702
288 Ga0209050_1001073 3300025298 Bacteria 33533
289 Ga0209050_1003209 3300025298 Bacteria 12372
290 Ga0209050_1007519 3300025298 Bacteria 6081
291 Ga0209050_1011286 3300025298 Bacteria 4264
292 Ga0209256_1000030 3300025299 Bacteria 414828
293 Ga0209256_1000032 3300025299 Bacteria 395041
294 Ga0209256_1004982 3300025299 Bacteria 7953
295 Ga0209051_1000001 3300025303 Bacteria 1732974
296 Ga0209051_1000004 3300025303 Bacteria 1155596
297 Ga0209051_1009286 3300025303 Bacteria 5082
298 Ga0209051_1012669 3300025303 Bacteria 4064
299 Ga0209257_1000029 3300025304 Bacteria 695617
300 Ga0209257_1000049 3300025304 Bacteria 441224
301 Ga0209257_1000063 3300025304 Bacteria 359089
302 Ga0209257_1000239 3300025304 Bacteria 128383
303 Ga0209257_1009223 3300025304 Bacteria 5348
304 Ga0207656_10016481 3300025321 Bacteria 2878
305 Ga0207696_1000010 3300025711 Bacteria 534681
306 Ga0207696_1000011 3300025711 Bacteria 530614
307 Ga0207696_1000017 3300025711 Bacteria 491130
308 Ga0207696_1000223 3300025711 Bacteria 82090
309 Ga0207696_1000844 3300025711 Bacteria 19465
310 Ga0207696_1002071 3300025711 Bacteria 10124
311 Ga0207696_1017973 3300025711 Bacteria 2332
312 Ga0207655_1000074 3300025728 Bacteria 232056
313 Ga0207655_1000076 3300025728 Bacteria 226359
314 Ga0207655_1000151 3300025728 Bacteria 127538
315 Ga0207655_1002486 3300025728 Bacteria 14921
316 Ga0207655_1003611 3300025728 Bacteria 11438
317 Ga0207655_1006716 3300025728 Bacteria 7577
318 Ga0207655_1007210 3300025728 Bacteria 7252
319 Ga0207655_1009340 3300025728 Bacteria 6099
320 Ga0207655_1009732 3300025728 Bacteria 5929
321 Ga0207655_1010724 3300025728 Bacteria 5533
322 Ga0207655_1015029 3300025728 Bacteria 4334
323 Ga0207655_1018673 3300025728 Bacteria 3664
324 Ga0207655_1048845 3300025728 Bacteria 1733
325 Ga0207713_1000061 3300025735 Bacteria 209289
326 Ga0207713_1000131 3300025735 Bacteria 114570
327 Ga0207713_1000143 3300025735 Bacteria 107175
328 Ga0207713_1000981 3300025735 Bacteria 25131
329 Ga0207713_1001052 3300025735 Bacteria 23917
330 Ga0207713_1002396 3300025735 Bacteria 13703
331 Ga0207713_1004346 3300025735 Bacteria 9222
332 Ga0207713_1004456 3300025735 Bacteria 9072
333 Ga0207713_1004727 3300025735 Bacteria 8759
334 Ga0207713_1010956 3300025735 Bacteria 4975
335 Ga0207713_1018782 3300025735 Bacteria 3409
336 Ga0207713_1024822 3300025735 Bacteria 2783
337 Ga0207647_10005805 3300025904 Bacteria 9001
338 Ga0207647_10006270 3300025904 Bacteria 8658
339 Ga0207705_10014795 3300025909 Bacteria 5610
340 Ga0207707_10131006 3300025912 Bacteria 2193
341 Ga0207695_10131818 3300025913 Bacteria 2456
342 Ga0207695_10189141 3300025913 Bacteria 1976
343 Ga0207695_10241014 3300025913 Bacteria 1710
344 Ga0207671_10009655 3300025914 Bacteria 8042
345 Ga0207671_10067655 3300025914 Bacteria 2660
346 Ga0207671_10117547 3300025914 Bacteria 2030
347 Ga0207671_10152347 3300025914 Bacteria 1787
348 Ga0207657_10000063 3300025919 Bacteria 100065
349 Ga0207657_10111346 3300025919 Bacteria 2260
350 Ga0207649_10000954 3300025920 Bacteria 17951
351 Ga0207652_10270711 3300025921 Bacteria 1532
352 Ga0207681_10000430 3300025923 Bacteria 29298
353 Ga0207681_10009773 3300025923 Bacteria 5868
354 Ga0207650_10000342 3300025925 Bacteria 45115
355 Ga0207650_10001314 3300025925 Bacteria 17994
356 Ga0207650_10001731 3300025925 Bacteria 15512
357 Ga0207644_10382862 3300025931 Bacteria 1147
358 Ga0207690_10000025 3300025932 Bacteria 179019
359 Ga0207706_10035244 3300025933 Bacteria 4450
360 Ga0207686_10020157 3300025934 Bacteria 3805
361 Ga0207709_10000565 3300025935 Bacteria 31347
362 Ga0207709_10006707 3300025935 Bacteria 6452
363 Ga0207709_10007302 3300025935 Bacteria 6161
364 Ga0207709_10143029 3300025935 Bacteria 1647
365 Ga0207679_10000097 3300025945 Bacteria 75900
366 Ga0207679_10204851 3300025945 Bacteria 1650
367 Ga0207667_10015164 3300025949 Bacteria 8763
368 Ga0207667_10550072 3300025949 Bacteria 1167
369 Ga0207668_10042064 3300025972 Bacteria 3092
370 Ga0207668_10438330 3300025972 Bacteria 1112
371 Ga0207640_10079434 3300025981 Bacteria 2236
372 Ga0207639_10185651 3300026041 Bacteria 1772
373 Ga0207678_10001764 3300026067 Bacteria 19809
374 Ga0207678_10446914 3300026067 Bacteria 1123
375 Ga0209281_1000111 3300027111 Bacteria 215615
376 Ga0209281_1000185 3300027111 Bacteria 144489
377 Ga0209281_1003108 3300027111 Bacteria 5783
378 Ga0209281_1010652 3300027111 Bacteria 2094
379 Ga0209389_1000209 3300027296 Bacteria 41871
380 Ga0209371_1000012 3300027312 Bacteria 748304
381 Ga0209371_1005132 3300027312 Bacteria 5354
382 Ga0209371_1016228 3300027312 Bacteria 1971
383 Ga0209371_1018713 3300027312 Bacteria 1750
384 Ga0209282_1000012 3300027666 Bacteria 215614
385 Ga0209282_1000071 3300027666 Bacteria 81290
386 Ga0207428_10011547 3300027907 Bacteria 7801
387 Ga0268266_10014202 3300028379 Bacteria 6851
388 Ga0307517_10184945 3300028786 Bacteria 1336
389 Ga0307515_10000112 3300028794 Bacteria 195015
390 Ga0268256_1000013 3300030500 Bacteria 752103
391 Ga0268256_1003987 3300030500 Bacteria 6360
392 Ga0268256_1020963 3300030500 Bacteria 1750
393 Ga0316179_1023760 3300030734 Bacteria 2382
394 Ga0316178_1120627 3300030735 Bacteria 7866
395 Ga0316181_1080007 3300030744 Bacteria 4217
396 Ga0265327_10082800 3300031251 Bacteria 1580
397 Ga0307509_10292339 3300031507 Bacteria 1383
398 Ga0307408_100000964 3300031548 Bacteria 22306
399 Ga0307408_100053314 3300031548 Bacteria 2919
400 Ga0307408_100200897 3300031548 Bacteria 1613
401 Ga0307508_10085555 3300031616 Bacteria 2736
402 Ga0316576_10015489 3300031727 Bacteria 5119
403 Ga0316576_10368959 3300031727 Bacteria 1067
404 Ga0307405_10000024 3300031731 Bacteria 127508
405 Ga0307405_10007115 3300031731 Bacteria 5565
406 Ga0307410_10052825 3300031852 Bacteria 2747
407 Ga0307407_10320645 3300031903 Bacteria 1087
408 Ga0307412_10003494 3300031911 Bacteria 8734
409 Ga0307412_10050430 3300031911 Bacteria 2746
410 Ga0307412_10086938 3300031911 Bacteria 2177
411 Ga0307412_10177169 3300031911 Bacteria 1600
412 Ga0307412_10244725 3300031911 Bacteria 1389
413 Ga0315914_1000007 3300031967 Bacteria 215597
414 Ga0307409_100147664 3300031995 Bacteria 2036
415 Ga0307409_100600789 3300031995 Bacteria 1087
416 Ga0307414_10317469 3300032004 Bacteria 1325
417 Ga0307411_10005341 3300032005 Bacteria 6294
418 Ga0307415_100023316 3300032126 Bacteria 3839
419 Ga0307415_100100310 3300032126 Bacteria 2121
420 Ga0307510_10001036 3300033180 Bacteria 29463
421 Ga0315913_1000003 3300033430 Bacteria 215608
422 Ga0315915_1000011 3300033464 Bacteria 215597
423 Ga0373955_0079621 3300035172 Bacteria 1849
424 Ga0316574_0058587 3300035398 Bacteria 2413
425 Ga0373935_0244893 3300035692 Bacteria 1253
426 Ga0373925_0406645 3300037068 Bacteria 1111
427 Ga0395899_0008648 3300037312 Bacteria 7833
428 Ga0395899_0041664 3300037312 Bacteria 3431
429 Ga0395900_0000021 3300037418 Bacteria 351144
430 Ga0395900_0004025 3300037418 Bacteria 15686
431 Ga0395898_0001431 3300037466 Bacteria 33828
432 Ga0395898_0027682 3300037466 Bacteria 5685
433 Ga0395905_0001781 3300037471 Bacteria 24995
434 Ga0395905_0002538 3300037471 Bacteria 20138
435 Ga0395905_0017230 3300037471 Bacteria 6860
436 Ga0395905_0024723 3300037471 Bacteria 5668
437 Ga0395901_0000004 3300038443 Bacteria 657361
438 Ga0395901_0001615 3300038443 Bacteria 23341
439 Ga0395901_0010310 3300038443 Bacteria 9466
440 Ga0395901_0016229 3300038443 Bacteria 7586
441 Ga0400485_09726 3300038735 Bacteria 6524
442 Ga0436365_0648684 3300039437 Bacteria 13254
443 Ga0436361_0148410 3300039447 Bacteria 11149
444 Ga0436361_0778808 3300039447 Bacteria 5113
445 Ga0436361_1083939 3300039447 Bacteria 4429
446 Ga0436362_0072394 3300039453 Bacteria 1087
447 Ga0439438_000367 3300041405 Bacteria 20233
448 Ga0439438_001742 3300041405 Bacteria 9564
449 Ga0439438_005658 3300041405 Bacteria 4554
450 Ga0439447_000821 3300041407 Bacteria 11386
451 Ga0439466_0004223 3300041411 Bacteria 5546
452 Ga0439466_0011487 3300041411 Bacteria 3277
453 Ga0439466_0038793 3300041411 Bacteria 1599
454 Ga0451789_0984162 3300041443 Bacteria 1060
455 Ga0451853_3401237 3300041512 Bacteria 1995
456 Ga0439432_000016 3300042006 Bacteria 63199
457 Ga0439432_002483 3300042006 Bacteria 6948
458 Ga0439432_011051 3300042006 Bacteria 3112
459 Ga0439449_0019179 3300042007 Bacteria 2564
460 Ga0439452_000046 3300042010 Bacteria 130842
461 Ga0439452_000081 3300042010 Bacteria 82231
462 Ga0439452_009073 3300042010 Bacteria 2955
463 Ga0450911_000010 3300042115 Bacteria 149605
464 Ga0450911_000054 3300042115 Bacteria 47325
465 Ga0450911_001511 3300042115 Bacteria 5293
466 Ga0450904_000392 3300042139 Bacteria 9054
467 Ga0450906_000089 3300042145 Bacteria 15146
468 Ga0450910_003545 3300042147 Bacteria 2073
469 Ga0439459_0001682 3300042438 Bacteria 3293
470 Ga0466969_0000044 3300044656 Bacteria 68499
471 Ga0466972_0046804 3300044658 Bacteria 2093
472 Ga0466972_0125339 3300044658 Bacteria 1210
473 Ga0466973_0046713 3300044659 Bacteria 4033
474 Ga0466965_0000720 3300044683 Bacteria 12310
475 Ga0466966_0031238 3300044684 Bacteria 3454
476 Ga0466961_0000032 3300044693 Bacteria 85497
477 Ga0466961_0000318 3300044693 Bacteria 31807
478 Ga0466963_0105508 3300044694 Bacteria 1931
479 Ga0466971_0009600 3300044719 Bacteria 4222
480 Ga0466968_0016062 3300044735 Bacteria 2976
481 Ga0466970_0000013 3300044765 Bacteria 83194
482 Ga0466957_0000261 3300044842 Bacteria 25375
483 Ga0466957_0002377 3300044842 Bacteria 10103
484 Ga0466957_0006587 3300044842 Bacteria 6566
485 Ga0466960_0100614 3300044901 Bacteria 1488
486 Ga0466959_0177961 3300045049 Bacteria 1489
487 Ga0451576_0016127 3300045051 Bacteria 8255
488 Ga0451576_0020127 3300045051 Bacteria 7271
489 Ga0466958_0009268 3300045836 Bacteria 5480
490 Ga0495617_000032 3300046452 Bacteria 148986
491 Ga0495617_000379 3300046452 Bacteria 24623
492 Ga0495627_000101 3300046453 Bacteria 105414
493 Ga0495627_000542 3300046453 Bacteria 31159
494 Ga0495627_003724 3300046453 Bacteria 6594
495 Ga0495592_0016134 3300046454 Bacteria 5666
496 Ga0495592_0022194 3300046454 Bacteria 4828
497 Ga0495591_000032 3300046458 Bacteria 176337
498 Ga0495591_000082 3300046458 Bacteria 107579
499 Ga0495591_000276 3300046458 Bacteria 47822
500 Ga0495591_000801 3300046458 Bacteria 22293
501 Ga0495591_007727 3300046458 Bacteria 4511
502 Ga0495591_017828 3300046458 Bacteria 2425
503 Ga0495629_0058774 3300046459 Bacteria 2688
504 Ga0495638_0000092 3300046460 Bacteria 145060
505 Ga0495638_0001204 3300046460 Bacteria 24721
506 Ga0495638_0009547 3300046460 Bacteria 6799
507 Ga0495638_0010113 3300046460 Bacteria 6572
508 Ga0495638_0016398 3300046460 Bacteria 4963
509 Ga0495638_0019474 3300046460 Bacteria 4490
510 Ga0495638_0095099 3300046460 Bacteria 1790
511 Ga0495653_0000077 3300046463 Bacteria 82295
512 Ga0495653_0004452 3300046463 Bacteria 11315
513 Ga0495653_0006325 3300046463 Bacteria 9718
514 Ga0495653_0013191 3300046463 Bacteria 6737
515 Ga0495650_0000100 3300046471 Bacteria 213752
516 Ga0495650_0000251 3300046471 Bacteria 105577
517 Ga0495650_0001410 3300046471 Bacteria 23440
518 Ga0495650_0003877 3300046471 Bacteria 10589
519 Ga0495650_0005160 3300046471 Bacteria 8609
520 Ga0495650_0025246 3300046471 Bacteria 2789
521 Ga0495650_0032572 3300046471 Bacteria 2329
522 Ga0495582_0051801 3300046473 Bacteria 2263
523 Ga0495605_0000097 3300046474 Bacteria 109966
524 Ga0495605_0000670 3300046474 Bacteria 25905
525 Ga0495605_0002687 3300046474 Bacteria 10893
526 Ga0495664_0005352 3300046477 Bacteria 7044
527 Ga0495584_0000739 3300046491 Bacteria 21572
528 Ga0495584_0003170 3300046491 Bacteria 9137
529 Ga0495585_0000120 3300046492 Bacteria 85123
530 Ga0495585_0000630 3300046492 Bacteria 32592
531 Ga0495585_0001431 3300046492 Bacteria 18733
532 Ga0495585_0068095 3300046492 Bacteria 1945
533 Ga0495607_0000259 3300046501 Bacteria 56558
534 Ga0495607_0000517 3300046501 Bacteria 38004
535 Ga0495607_0002064 3300046501 Bacteria 16791
536 Ga0495607_0004919 3300046501 Bacteria 9715
537 Ga0495607_0039900 3300046501 Bacteria 2800
538 Ga0495583_0000131 3300046506 Bacteria 125393
539 Ga0495583_0000923 3300046506 Bacteria 34538
540 Ga0495583_0053888 3300046506 Bacteria 1823
541 Ga0495606_0000339 3300046507 Bacteria 80460
542 Ga0495606_0000507 3300046507 Bacteria 63148
543 Ga0495606_0000656 3300046507 Bacteria 54383
544 Ga0495606_0000724 3300046507 Bacteria 51037
545 Ga0495606_0000770 3300046507 Bacteria 49201
546 Ga0495606_0001326 3300046507 Bacteria 33799
547 Ga0495606_0002444 3300046507 Bacteria 21594
548 Ga0495606_0007864 3300046507 Bacteria 9411
549 Ga0495606_0012937 3300046507 Bacteria 6641
550 Ga0495606_0015041 3300046507 Bacteria 5993
551 Ga0495606_0028028 3300046507 Bacteria 3980
552 Ga0495606_0044293 3300046507 Bacteria 2960
553 Ga0495608_0025978 3300046511 Bacteria 3996
554 Ga0495610_0000017 3300046512 Bacteria 365675
555 Ga0495610_0000250 3300046512 Bacteria 56512
556 Ga0495610_0000264 3300046512 Bacteria 54880
557 Ga0495610_0000359 3300046512 Bacteria 47594
558 Ga0495610_0001418 3300046512 Bacteria 21195
559 Ga0495610_0002374 3300046512 Bacteria 15892
560 Ga0495610_0011355 3300046512 Bacteria 5453
561 Ga0495610_0018718 3300046512 Bacteria 3898
562 Ga0495610_0021874 3300046512 Bacteria 3509
563 Ga0495610_0056236 3300046512 Bacteria 1892
564 Ga0495616_0000041 3300046513 Bacteria 122413
565 Ga0495616_0000203 3300046513 Bacteria 49328
566 Ga0495616_0000454 3300046513 Bacteria 31292
567 Ga0495616_0000615 3300046513 Bacteria 26805
568 Ga0495618_0005072 3300046514 Bacteria 8045
569 Ga0495620_0000002 3300046515 Bacteria 373737
570 Ga0495620_0000021 3300046515 Bacteria 139145
571 Ga0495620_0000646 3300046515 Bacteria 21714
572 Ga0495620_0007292 3300046515 Bacteria 6021
573 Ga0495620_0067005 3300046515 Bacteria 1478
574 Ga0495628_0089220 3300046516 Bacteria 2388
575 Ga0495628_0111238 3300046516 Bacteria 2106
576 Ga0495630_0009126 3300046517 Bacteria 7132
577 Ga0495631_0000419 3300046518 Bacteria 29233
578 Ga0495632_0000078 3300046519 Bacteria 100643
579 Ga0495632_0000097 3300046519 Bacteria 88746
580 Ga0495632_0002448 3300046519 Bacteria 14118
581 Ga0495632_0010930 3300046519 Bacteria 5328
582 Ga0495632_0043881 3300046519 Bacteria 2233
583 Ga0495637_0000621 3300046520 Bacteria 25075
584 Ga0495637_0000888 3300046520 Bacteria 19276
585 Ga0495637_0012376 3300046520 Bacteria 4082
586 Ga0495637_0035989 3300046520 Bacteria 2159
587 Ga0495643_0000583 3300046522 Bacteria 44498
588 Ga0495643_0000660 3300046522 Bacteria 40679
589 Ga0495643_0004116 3300046522 Bacteria 10343
590 Ga0495643_0084194 3300046522 Bacteria 1650
591 Ga0495648_0000408 3300046524 Bacteria 47397
592 Ga0495648_0002220 3300046524 Bacteria 18185
593 Ga0495648_0002382 3300046524 Bacteria 17457
594 Ga0495648_0002623 3300046524 Bacteria 16383
595 Ga0495648_0004429 3300046524 Bacteria 11998
596 Ga0495648_0017564 3300046524 Bacteria 5109
597 Ga0495648_0021429 3300046524 Bacteria 4474
598 Ga0495648_0025679 3300046524 Bacteria 3983
599 Ga0495648_0026292 3300046524 Bacteria 3920
600 Ga0495666_0002377 3300046526 Bacteria 9378
601 Ga0495666_0004817 3300046526 Bacteria 6825
602 Ga0495652_0068039 3300046529 Bacteria 2984
603 Ga0495654_0000030 3300046530 Bacteria 216715
604 Ga0495654_0000050 3300046530 Bacteria 146814
605 Ga0495654_0000059 3300046530 Bacteria 137056
606 Ga0495654_0001095 3300046530 Bacteria 19641
607 Ga0495654_0013011 3300046530 Bacteria 4458
608 Ga0495654_0014574 3300046530 Bacteria 4182
609 Ga0495654_0018496 3300046530 Bacteria 3650
610 Ga0495654_0060775 3300046530 Bacteria 1815
611 Ga0495654_0069058 3300046530 Bacteria 1678
612 Ga0495665_0004564 3300046531 Bacteria 7475
613 Ga0495640_0006408 3300046533 Bacteria 9306
614 Ga0495586_0020486 3300046535 Bacteria 3521
615 Ga0495587_0004755 3300046536 Bacteria 8913
616 Ga0495609_0000504 3300046538 Bacteria 31406
617 Ga0495609_0000648 3300046538 Bacteria 27101
618 Ga0495609_0008920 3300046538 Bacteria 4878
619 Ga0495597_0000117 3300046542 Bacteria 71911
620 Ga0495597_0000153 3300046542 Bacteria 61233
621 Ga0495645_0018745 3300046543 Bacteria 4976
622 Ga0495622_0000017 3300046557 Bacteria 176313
623 Ga0495622_0000420 3300046557 Bacteria 28044
624 Ga0495622_0005699 3300046557 Bacteria 5777
625 Ga0495622_0009536 3300046557 Bacteria 4492
626 Ga0495633_0000556 3300046558 Bacteria 36606
627 Ga0495633_0013478 3300046558 Bacteria 4307
628 Ga0495668_0000446 3300046616 Bacteria 52728
629 Ga0495668_0000766 3300046616 Bacteria 37601
630 Ga0495668_0006587 3300046616 Bacteria 7578
631 Ga0495634_0000551 3300046642 Bacteria 36662
632 Ga0495634_0008216 3300046642 Bacteria 7782
633 Ga0495634_0016182 3300046642 Bacteria 5338
634 Ga0495611_0000024 3300046648 Bacteria 118898
635 Ga0495611_0033788 3300046648 Bacteria 2258
636 Ga0495625_0000103 3300046660 Bacteria 136109
637 Ga0495625_0000303 3300046660 Bacteria 75996
638 Ga0495625_0000861 3300046660 Bacteria 41279
639 Ga0495625_0022301 3300046660 Bacteria 4857
640 Ga0495625_0059278 3300046660 Bacteria 2716
641 Ga0495625_0081866 3300046660 Bacteria 2246
642 Ga0495635_0000203 3300046663 Bacteria 37524
643 Ga0495635_0045810 3300046663 Bacteria 3017
644 Ga0495661_0000085 3300046665 Bacteria 114501
645 Ga0495661_0013740 3300046665 Bacteria 5434
646 Ga0495588_0003777 3300046674 Bacteria 6632
647 Ga0495588_0063831 3300046674 Bacteria 1910
648 Ga0495657_0034251 3300046675 Bacteria 3528
649 Ga0495599_0173791 3300046678 Bacteria 1329
650 Ga0495623_0000841 3300046679 Bacteria 20754
651 Ga0495623_0005535 3300046679 Bacteria 8251
652 Ga0495646_0001184 3300046680 Bacteria 15267
653 Ga0495646_0003629 3300046680 Bacteria 9628
654 Ga0495646_0024322 3300046680 Bacteria 3814
655 Ga0495613_0004522 3300046689 Bacteria 10425
656 Ga0495624_0001661 3300046690 Bacteria 17058
657 Ga0495624_0027202 3300046690 Bacteria 3746
658 Ga0495670_0000020 3300046691 Bacteria 110171
659 Ga0495671_0000026 3300046692 Bacteria 237110
660 Ga0495671_0000950 3300046692 Bacteria 20380
661 Ga0495671_0001525 3300046692 Bacteria 15437
662 Ga0495671_0017425 3300046692 Bacteria 3824
663 Ga0495649_0001301 3300046694 Bacteria 19082
664 Ga0495649_0001326 3300046694 Bacteria 18813
665 Ga0495649_0012802 3300046694 Bacteria 4863
666 Ga0495649_0014530 3300046694 Bacteria 4509
667 Ga0495649_0015060 3300046694 Bacteria 4410
668 Ga0495649_0101647 3300046694 Bacteria 1527
669 Ga0495589_0000011 3300046794 Bacteria 250370
670 Ga0495589_0000740 3300046794 Bacteria 21033
671 Ga0495589_0005399 3300046794 Bacteria 6742
672 Ga0495600_0001400 3300046809 Bacteria 13306
673 Ga0495660_0000136 3300046810 Bacteria 79750
674 Ga0495660_0001104 3300046810 Bacteria 19276
675 Ga0495660_0003859 3300046810 Bacteria 9164
676 Ga0495660_0005434 3300046810 Bacteria 7629
677 Ga0495660_0016925 3300046810 Bacteria 4198
678 Ga0495660_0087732 3300046810 Bacteria 1622
679 Ga0495660_0097434 3300046810 Bacteria 1518
680 Ga0495581_0001521 3300047315 Bacteria 12918
681 Ga0495604_0002202 3300047317 Bacteria 15620
682 Ga0495604_0012528 3300047317 Bacteria 6745
683 Ga0495604_0029355 3300047317 Bacteria 4374
684 Ga0495604_0097674 3300047317 Bacteria 2165
685 Ga0495604_0270827 3300047317 Bacteria 1150
686 Ga0495674_0003267 3300047319 Bacteria 15751
687 Ga0495674_0025702 3300047319 Bacteria 5393
688 Ga0495674_0118307 3300047319 Bacteria 2240
689 Ga0495672_0003731 3300047320 Bacteria 12850
690 Ga0495672_0003855 3300047320 Bacteria 12611
691 Ga0495672_0005016 3300047320 Bacteria 10591
692 Ga0495672_0005116 3300047320 Bacteria 10465
693 Ga0495676_0001880 3300047321 Bacteria 18431
694 Ga0495676_0004531 3300047321 Bacteria 12713
695 Ga0495680_0012135 3300047322 Bacteria 7603
696 Ga0495680_0022052 3300047322 Bacteria 5318
697 Ga0495683_0000139 3300047323 Bacteria 71403
698 Ga0495683_0004036 3300047323 Bacteria 8430
699 Ga0495675_0004609 3300047444 Bacteria 8367
700 Ga0495675_0005302 3300047444 Bacteria 7852
701 Ga0495675_0044517 3300047444 Bacteria 2827
702 Ga0495679_000233 3300047446 Bacteria 46629
703 Ga0495679_000440 3300047446 Bacteria 30708
704 Ga0495679_000569 3300047446 Bacteria 25611
705 Ga0495679_000780 3300047446 Bacteria 20160
706 Ga0495679_026414 3300047446 Bacteria 1928
707 Ga0495673_0000008 3300047469 Bacteria 752462
708 Ga0495673_0000069 3300047469 Bacteria 218170
709 Ga0495673_0001184 3300047469 Bacteria 21958
710 Ga0495673_0001421 3300047469 Bacteria 19171
711 Ga0495673_0003804 3300047469 Bacteria 9754
712 Ga0495673_0047182 3300047469 Bacteria 1905
713 Ga0495673_0084971 3300047469 Bacteria 1303
714 Ga0495681_0000109 3300047470 Bacteria 71558
715 Ga0495681_0000370 3300047470 Bacteria 35144
716 Ga0495681_0001460 3300047470 Bacteria 17676
717 Ga0495681_0002166 3300047470 Bacteria 14237
718 Ga0495681_0038749 3300047470 Bacteria 2333
719 Ga0495684_0011799 3300047471 Bacteria 6742
720 Ga0495686_0000266 3300047472 Bacteria 93781
721 Ga0495686_0000653 3300047472 Bacteria 47362
722 Ga0495686_0003817 3300047472 Bacteria 12778
723 Ga0495686_0011858 3300047472 Bacteria 6129
724 Ga0495686_0048052 3300047472 Bacteria 2692
725 Ga0495686_0111908 3300047472 Bacteria 1636
726 Ga0495593_0004240 3300047673 Bacteria 8527
727 Ga0495593_0015742 3300047673 Bacteria 4275
728 Ga0495593_0097103 3300047673 Bacteria 1513
729 Ga0495602_0001929 3300048088 Bacteria 20798
730 Ga0495602_0014867 3300048088 Bacteria 7879
731 Ga0495602_0016763 3300048088 Bacteria 7357
732 Ga0495602_0155740 3300048088 Bacteria 1789
733 Ga0495614_0000262 3300048089 Bacteria 20541
734 Ga0495626_0000074 3300048091 Bacteria 132552
735 Ga0495626_0000326 3300048091 Bacteria 50232
736 Ga0495626_0000394 3300048091 Bacteria 45106
737 Ga0495626_0059754 3300048091 Bacteria 1738
738 Ga0496100_0033040 3300048903 Bacteria 3234
739 Ga0496102_0000659 3300048905 Bacteria 34506
740 Ga0496102_0214164 3300048905 Bacteria 1816
741 Ga0496103_0000839 3300048906 Bacteria 22466
742 Ga0496103_0001333 3300048906 Bacteria 16717
743 Ga0496104_0087727 3300048907 Bacteria 2971
744 Ga0496110_0119215 3300048913 Bacteria 2377
745 Ga0496111_0001272 3300048914 Bacteria 14126
746 Ga0496114_0012065 3300048917 Bacteria 6914
747 Ga0496114_0145344 3300048917 Bacteria 2055
748 Ga0496114_0364924 3300048917 Bacteria 1278
749 Ga0496115_0118077 3300048918 Bacteria 2182
750 Ga0496116_0000026 3300048919 Bacteria 450803
751 Ga0496116_0000654 3300048919 Bacteria 45317
752 Ga0496116_0000857 3300048919 Bacteria 38047
753 Ga0496116_0001333 3300048919 Bacteria 28080
754 Ga0496116_0033797 3300048919 Bacteria 3622
755 Ga0496116_0046769 3300048919 Bacteria 2918
756 Ga0496117_0000083 3300048920 Bacteria 218945
757 Ga0496117_0001203 3300048920 Bacteria 38893
758 Ga0496117_0001218 3300048920 Bacteria 38567
759 Ga0496117_0001929 3300048920 Bacteria 27669
760 Ga0496117_0004699 3300048920 Bacteria 14839
761 Ga0496117_0005079 3300048920 Bacteria 14084
762 Ga0496117_0007592 3300048920 Bacteria 10541
763 Ga0496117_0012990 3300048920 Bacteria 7295
764 Ga0496117_0015538 3300048920 Bacteria 6480
765 Ga0496117_0026279 3300048920 Bacteria 4558
766 Ga0496117_0031918 3300048920 Bacteria 4013
767 Ga0496117_0042094 3300048920 Bacteria 3337
768 Ga0496117_0048849 3300048920 Bacteria 3016
769 Ga0496117_0054958 3300048920 Bacteria 2786
770 Ga0496117_0099895 3300048920 Bacteria 1839
771 Ga0496117_0136717 3300048920 Bacteria 1475
772 Ga0496118_0002447 3300048921 Bacteria 24994
773 Ga0496118_0003000 3300048921 Bacteria 21801
774 Ga0496118_0005809 3300048921 Bacteria 13832
775 Ga0496118_0007347 3300048921 Bacteria 11715
776 Ga0496118_0023509 3300048921 Bacteria 5350
777 Ga0496118_0023969 3300048921 Bacteria 5282
778 Ga0496118_0029726 3300048921 Bacteria 4576
779 Ga0496118_0034322 3300048921 Bacteria 4142
780 Ga0496118_0046977 3300048921 Bacteria 3352
781 Ga0496118_0085659 3300048921 Bacteria 2193
782 Ga0496119_0008762 3300048922 Bacteria 8818
783 Ga0496119_0043800 3300048922 Bacteria 2824
784 Ga0496119_0046501 3300048922 Bacteria 2709
785 Ga0496119_0053675 3300048922 Bacteria 2460
786 Ga0496120_0000030 3300048923 Bacteria 226066
787 Ga0496120_0001071 3300048923 Bacteria 36173
788 Ga0496120_0001883 3300048923 Bacteria 23304
789 Ga0496120_0003959 3300048923 Bacteria 12877
790 Ga0496120_0006699 3300048923 Bacteria 8771
791 Ga0496120_0011253 3300048923 Bacteria 6168
792 Ga0496120_0047971 3300048923 Bacteria 2460
793 Ga0496121_0000216 3300048924 Bacteria 127028
794 Ga0496121_0000635 3300048924 Bacteria 65524
795 Ga0496121_0001858 3300048924 Bacteria 33891
796 Ga0496121_0003396 3300048924 Bacteria 22781
797 Ga0496121_0003670 3300048924 Bacteria 21579
798 Ga0496121_0010257 3300048924 Bacteria 10600
799 Ga0496121_0048038 3300048924 Bacteria 3635
800 Ga0496121_0056216 3300048924 Bacteria 3270
801 Ga0496121_0116557 3300048924 Bacteria 2026
802 Ga0496121_0168806 3300048924 Bacteria 1592
803 Ga0496121_0198519 3300048924 Bacteria 1432
804 Ga0496122_0000050 3300048925 Bacteria 267874
805 Ga0496122_0000072 3300048925 Bacteria 222436
806 Ga0496122_0000696 3300048925 Bacteria 66890
807 Ga0496122_0000776 3300048925 Bacteria 61446
808 Ga0496122_0001980 3300048925 Bacteria 30575
809 Ga0496122_0009517 3300048925 Bacteria 10220
810 Ga0496122_0010072 3300048925 Bacteria 9816
811 Ga0496122_0016896 3300048925 Bacteria 6861
812 Ga0496122_0019851 3300048925 Bacteria 6115
813 Ga0496122_0034800 3300048925 Bacteria 4112
814 Ga0496122_0045223 3300048925 Bacteria 3424
815 Ga0496122_0046784 3300048925 Bacteria 3346
816 Ga0496122_0067529 3300048925 Bacteria 2574
817 Ga0496122_0095365 3300048925 Bacteria 2010
818 Ga0496123_0000035 3300048926 Bacteria 267288
819 Ga0496123_0000052 3300048926 Bacteria 236409
820 Ga0496123_0000439 3300048926 Bacteria 74838
821 Ga0496123_0001276 3300048926 Bacteria 35982
822 Ga0496123_0002483 3300048926 Bacteria 22768
823 Ga0496123_0005000 3300048926 Bacteria 13572
824 Ga0496123_0007711 3300048926 Bacteria 10049
825 Ga0496123_0013331 3300048926 Bacteria 6914
826 Ga0496123_0013680 3300048926 Bacteria 6788
827 Ga0496123_0028324 3300048926 Bacteria 4150
828 Ga0496123_0029082 3300048926 Bacteria 4078
829 Ga0496123_0032177 3300048926 Bacteria 3803
830 Ga0496123_0039578 3300048926 Bacteria 3296
831 Ga0496123_0054797 3300048926 Bacteria 2621
832 Ga0496123_0178112 3300048926 Bacteria 1113
833 Ga0496124_0001568 3300048927 Bacteria 33060
834 Ga0496124_0002465 3300048927 Bacteria 24191
835 Ga0496124_0018652 3300048927 Bacteria 6490
836 Ga0496124_0020951 3300048927 Bacteria 6030
837 Ga0496124_0027520 3300048927 Bacteria 5102
838 Ga0496124_0046464 3300048927 Bacteria 3717
839 Ga0496124_0060506 3300048927 Bacteria 3177
840 Ga0496124_0062581 3300048927 Bacteria 3113
841 Ga0496124_0064137 3300048927 Bacteria 3067
842 Ga0496124_0078989 3300048927 Bacteria 2710
843 Ga0496124_0091036 3300048927 Bacteria 2486
844 Ga0496124_0120197 3300048927 Bacteria 2100
845 Ga0496124_0144396 3300048927 Bacteria 1874
846 Ga0496124_0150045 3300048927 Bacteria 1830
847 Ga0496125_0000083 3300048928 Bacteria 227168
848 Ga0496125_0000284 3300048928 Bacteria 100114
849 Ga0496125_0000380 3300048928 Bacteria 82955
850 Ga0496125_0001952 3300048928 Bacteria 28153
851 Ga0496125_0002616 3300048928 Bacteria 23085
852 Ga0496125_0011227 3300048928 Bacteria 8977
853 Ga0496125_0013205 3300048928 Bacteria 8136
854 Ga0496125_0013807 3300048928 Bacteria 7912
855 Ga0496125_0047750 3300048928 Bacteria 3575
856 Ga0496126_0000059 3300048929 Bacteria 267449
857 Ga0496126_0023387 3300048929 Bacteria 5989
858 Ga0496126_0025397 3300048929 Bacteria 5700
859 Ga0496126_0044235 3300048929 Bacteria 4102
860 Ga0496126_0045862 3300048929 Bacteria 4014
861 Ga0496126_0086052 3300048929 Bacteria 2770
862 Ga0496126_0176205 3300048929 Bacteria 1819
863 Ga0496126_0205637 3300048929 Bacteria 1660
864 Ga0466983_0073864 3300048986 Bacteria 2858
865 Ga0495678_000883 3300049459 Bacteria 26673
866 Ga0495678_001048 3300049459 Bacteria 23397
867 Ga0495678_003236 3300049459 Bacteria 10212
868 Ga0495678_014652 3300049459 Bacteria 3640
869 Ga0495682_0000054 3300049460 Bacteria 104787
870 Ga0495682_0001160 3300049460 Bacteria 15137
871 Ga0495682_0005108 3300049460 Bacteria 5499
872 Ga0501032_0094992 3300049569 Bacteria 1976
873 Ga0501032_0211529 3300049569 Bacteria 1264
874 Ga0501032_0291198 3300049569 Bacteria 1056
875 Ga0501033_0086527 3300049570 Bacteria 2294
876 Ga0501034_0000012 3300049571 Bacteria 310504
877 Ga0501034_0012453 3300049571 Bacteria 8783
878 Ga0501034_0084905 3300049571 Bacteria 3167
879 Ga0501036_0013996 3300049572 Bacteria 6667
880 Ga0501036_0051379 3300049572 Bacteria 3490
881 Ga0501037_0029131 3300049573 Bacteria 4079
882 Ga0501037_0235276 3300049573 Bacteria 1285
883 Ga0501038_0001324 3300049574 Bacteria 22533
884 Ga0501038_0257156 3300049574 Bacteria 1381
885 Ga0501038_0303248 3300049574 Bacteria 1253
886 Ga0501039_0009870 3300049575 Bacteria 7281
887 Ga0501039_0014805 3300049575 Bacteria 5966
888 Ga0501039_0163374 3300049575 Bacteria 1751
889 Ga0501040_0040498 3300049576 Bacteria 3171
890 Ga0501041_0002166 3300049577 Bacteria 11078
891 Ga0501043_0017229 3300049579 Bacteria 5667
892 Ga0501043_0034195 3300049579 Bacteria 3998
893 Ga0501043_0132853 3300049579 Bacteria 1950
894 Ga0501046_0012126 3300049580 Bacteria 7348
895 Ga0501046_0086408 3300049580 Bacteria 2418
896 Ga0501047_0075233 3300049581 Bacteria 3250
897 Ga0501047_0191915 3300049581 Bacteria 1906
898 Ga0501047_0264272 3300049581 Bacteria 1568
899 Ga0501048_0152311 3300049582 Bacteria 1636
900 Ga0501048_0277564 3300049582 Bacteria 1191
901 Ga0501067_0007384 3300049583 Bacteria 6105
902 Ga0501067_0028994 3300049583 Bacteria 3068
903 Ga0501068_0030388 3300049584 Bacteria 3204
904 Ga0501069_0002823 3300049585 Bacteria 8891
905 Ga0501070_0015461 3300049586 Bacteria 6421
906 Ga0501070_0132980 3300049586 Bacteria 2054
907 Ga0501071_0060221 3300049587 Bacteria 2748
908 Ga0501072_0023777 3300049588 Bacteria 4760
909 Ga0501073_0010995 3300049589 Bacteria 6619
910 Ga0501074_0172302 3300049590 Bacteria 1544
911 Ga0501079_0073381 3300049741 Bacteria 2645
912 Ga0501080_0008605 3300049742 Bacteria 9260
913 Ga0501080_0538798 3300049742 Bacteria 1040
914 Ga0501083_0012781 3300049744 Bacteria 5872
915 Ga0501083_0034999 3300049744 Bacteria 3432
916 Ga0501083_0042724 3300049744 Bacteria 3072
917 Ga0501035_0005026 3300049822 Bacteria 12528
918 Ga0501044_0000197 3300049823 Bacteria 76234
919 Ga0501044_0017480 3300049823 Bacteria 7697
920 Ga0501044_0022584 3300049823 Bacteria 6704
921 Ga0501044_0055613 3300049823 Bacteria 4064
922 Ga0501044_0113390 3300049823 Bacteria 2718
923 Ga0501044_0500462 3300049823 Bacteria 1116
924 Ga0501226_000008 3300049853 Bacteria 199119
925 nmdc:mga03683_90121_c1 3300050489 Bacteria 1336
926 nmdc:mga03n38_12450_c1 3300050490 Bacteria 3202
927 nmdc:mga03n38_15347_c1 3300050490 Bacteria 2956
928 nmdc:mga00v17_104_c1 3300050491 Bacteria 50343
929 nmdc:mga00v17_23406_c1 3300050491 Bacteria 3572
930 nmdc:mga00v17_32_c1 3300050491 Bacteria 87395
931 nmdc:mga0yw44_276136_c1 3300050492 Bacteria 1122
932 nmdc:mga0yw44_5023_c1 3300050492 Bacteria 6180
933 nmdc:mga0yw44_60177_c1 3300050492 Bacteria 2326
934 nmdc:mga0yw44_6122_c1 3300050492 Bacteria 5777
935 nmdc:mga0yw44_757_c1 3300050492 Bacteria 11977
936 nmdc:mga06z11_130684_c1 3300050494 Bacteria 1410
937 nmdc:mga06z11_16947_c1 3300050494 Bacteria 3295
938 nmdc:mga06z11_27539_c1 3300050494 Bacteria 2717
939 nmdc:mga06z11_34263_c1 3300050494 Bacteria 2491
940 nmdc:mga06z11_71342_c1 3300050494 Bacteria 1839
941 nmdc:mga04h51_16149_c1 3300050495 Bacteria 2164
942 nmdc:mga07m45_77920_c1 3300050496 Bacteria 1891
943 nmdc:mga05p37_59611_c1 3300050507 Bacteria 4700
944 nmdc:mga0sz30_2467_c2 3300050516 Bacteria 3429
945 nmdc:mga0sz30_30_c1 3300050516 Bacteria 55841
946 nmdc:mga0sz30_5822_c1 3300050516 Bacteria 4543
947 Ga0500651_0039591 3300053093 Bacteria 2968
948 Ga0500641_0021103 3300053096 Bacteria 2478
949 Ga0500555_001367 3300053103 Bacteria 7607
950 Ga0500572_000268 3300053111 Bacteria 18816
951 Ga0500618_002627 3300053125 Bacteria 6620
952 Ga0500618_018846 3300053125 Bacteria 1703
953 Ga0500658_0092640 3300053134 Bacteria 1309
954 Ga0500659_0011667 3300053135 Bacteria 4795
955 Ga0500561_0000140 3300053137 Bacteria 14036
956 Ga0500568_0000163 3300053139 Bacteria 57189
957 Ga0500568_0002348 3300053139 Bacteria 11214
958 Ga0500573_0101848 3300053140 Bacteria 1615
959 Ga0500588_0026597 3300053146 Bacteria 1620
960 Ga0500604_0000934 3300053151 Bacteria 8079
961 Ga0500616_0000941 3300053153 Bacteria 31719
962 Ga0500624_000341 3300053157 Bacteria 15529
963 Ga0500627_0021948 3300053158 Bacteria 2583
964 Ga0500634_0000091 3300053161 Bacteria 34955
965 Ga0500634_0002225 3300053161 Bacteria 8080
966 Ga0500636_0002587 3300053177 Bacteria 10041
967 Ga0500609_006418 3300053731 Bacteria 1601
968 Ga0501084_0016873 3300054114 Bacteria 6068
969 Ga0501084_0144285 3300054114 Bacteria 2005
970 Ga0466962_0001725 3300061719 Bacteria 10271

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0291198 Ga0501032_0291198_17_835 266
2 3300041512 Ga0451853_3401237 Ga0451853_3401237_774_1706 286
3 3300048914 Ga0496111_0001272 Ga0496111_0001272_5181_6149 287
4 3300048927 Ga0496124_0062581 Ga0496124_0062581_1308_2276 287
5 3300003320 rootH2_10055630 rootH2_100556302 298
6 3300003856 Ga0058692_1000668 Ga0058692_100066813 298
7 3300005548 Ga0070665_100009039 Ga0070665_1000090395 298
8 3300006177 Ga0075362_10007557 Ga0075362_100075572 298
9 3300006186 Ga0075369_10005032 Ga0075369_100050322 298
10 3300006195 Ga0075366_10071103 Ga0075366_100711032 298
11 3300006948 Ga0099826_10008333 Ga0099826_100083336 298
12 3300009148 Ga0105243_10010726 Ga0105243_100107267 298
13 3300013100 Ga0157373_10001827 Ga0157373_1000182710 298
14 3300013102 Ga0157371_10000005 Ga0157371_10000005169 298
15 3300013104 Ga0157370_10000146 Ga0157370_1000014669 298
16 3300025294 Ga0209025_1000131 Ga0209025_1000131134 298
17 3300027312 Ga0209371_1000012 Ga0209371_1000012465 298
18 3300027312 Ga0209371_1016228 Ga0209371_10162281 298
19 3300027666 Ga0209282_1000071 Ga0209282_10000714 298
20 3300028379 Ga0268266_10014202 Ga0268266_100142023 298
21 3300030500 Ga0268256_1000013 Ga0268256_1000013466 298
22 3300030744 Ga0316181_1080007 Ga0316181_10800073 298
23 3300046460 Ga0495638_0000092 Ga0495638_0000092_112389_113366 298
24 3300046507 Ga0495606_0015041 Ga0495606_0015041_3416_4312 298
25 3300047320 Ga0495672_0003731 Ga0495672_0003731_10596_11573 298
26 3300048920 Ga0496117_0000083 Ga0496117_0000083_103785_104750 298
27 3300048921 Ga0496118_0003000 Ga0496118_0003000_7277_8242 298
28 3300048921 Ga0496118_0034322 Ga0496118_0034322_1592_2557 298
29 3300048923 Ga0496120_0000030 Ga0496120_0000030_122109_123074 298
30 3300048923 Ga0496120_0011253 Ga0496120_0011253_4677_5642 298
31 3300048925 Ga0496122_0000050 Ga0496122_0000050_261117_262082 298
32 3300048925 Ga0496122_0009517 Ga0496122_0009517_7054_7950 298
33 3300048926 Ga0496123_0000052 Ga0496123_0000052_102532_103497 298
34 3300048927 Ga0496124_0064137 Ga0496124_0064137_558_1523 298
35 3300050490 nmdc:mga03n38_12450_c1 nmdc:mga03n38_12450_c1_1409_2374 298
36 3300050491 nmdc:mga00v17_32_c1 nmdc:mga00v17_32_c1_29427_30392 298
37 3300050492 nmdc:mga0yw44_757_c1 nmdc:mga0yw44_757_c1_661_1626 298
38 3300050494 nmdc:mga06z11_71342_c1 nmdc:mga06z11_71342_c1_232_1197 298
39 3300050495 nmdc:mga04h51_16149_c1 nmdc:mga04h51_16149_c1_714_1679 298
40 3300050496 nmdc:mga07m45_77920_c1 nmdc:mga07m45_77920_c1_882_1847 298
41 3300050516 nmdc:mga0sz30_30_c1 nmdc:mga0sz30_30_c1_25115_26080 298
42 3300050516 nmdc:mga0sz30_5822_c1 nmdc:mga0sz30_5822_c1_481_1446 298
43 3300053096 Ga0500641_0021103 Ga0500641_0021103_596_1492 298
44 3300053134 Ga0500658_0092640 Ga0500658_0092640_312_1208 298
45 3300053137 Ga0500561_0000140 Ga0500561_0000140_10511_11476 298
46 3300053139 Ga0500568_0000163 Ga0500568_0000163_23697_24674 298
47 3300053146 Ga0500588_0026597 Ga0500588_0026597_346_1242 298
48 3300053151 Ga0500604_0000934 Ga0500604_0000934_1963_2859 298
49 3300053153 Ga0500616_0000941 Ga0500616_0000941_29458_30435 298
50 3300053158 Ga0500627_0021948 Ga0500627_0021948_1589_2566 298
51 3300039447 Ga0436361_0778808 Ga0436361_0778808_2450_3391 299
52 3300046507 Ga0495606_0044293 Ga0495606_0044293_1360_2259 299
53 3300046463 Ga0495653_0000077 Ga0495653_0000077_77261_78202 300
54 3300046507 Ga0495606_0000507 Ga0495606_0000507_11904_12845 300
55 3300048922 Ga0496119_0053675 Ga0496119_0053675_1547_2449 300
56 3300049459 Ga0495678_014652 Ga0495678_014652_2528_3430 300
57 3300006051 Ga0075364_10000309 Ga0075364_100003094 301
58 3300044694 Ga0466963_0105508 Ga0466963_0105508_32_955 301
59 3300044765 Ga0466970_0000013 Ga0466970_0000013_41317_42240 301
60 3300044842 Ga0466957_0006587 Ga0466957_0006587_4403_5326 301
61 3300046524 Ga0495648_0002623 Ga0495648_0002623_2434_3378 301
62 3300047317 Ga0495604_0270827 Ga0495604_0270827_218_1123 301
63 3300047323 Ga0495683_0004036 Ga0495683_0004036_2987_3931 301
64 3300049579 Ga0501043_0017229 Ga0501043_0017229_1285_2208 301
65 3300049581 Ga0501047_0264272 Ga0501047_0264272_76_999 301
66 3300049586 Ga0501070_0132980 Ga0501070_0132980_1036_1959 301
67 3300049823 Ga0501044_0055613 Ga0501044_0055613_1209_2132 301
68 3300050491 nmdc:mga00v17_104_c1 nmdc:mga00v17_104_c1_14167_15132 301
69 3300017792 Ga0163161_10092731 Ga0163161_100927311 302
70 3300038735 Ga0400485_09726 Ga0400485_09726_4195_5121 302
71 3300053093 Ga0500651_0039591 Ga0500651_0039591_1740_2666 302
72 3300053103 Ga0500555_001367 Ga0500555_001367_1643_2569 302
73 3300025298 Ga0209050_1011286 Ga0209050_10112862 303
74 3300048928 Ga0496125_0013807 Ga0496125_0013807_2397_3362 303
75 3300025914 Ga0207671_10152347 Ga0207671_101523472 304
76 3300046471 Ga0495650_0003877 Ga0495650_0003877_8933_9877 304
77 3300046530 Ga0495654_0000030 Ga0495654_0000030_201873_202865 304
78 3300046694 Ga0495649_0014530 Ga0495649_0014530_1892_2839 304
79 3300003215 JGI25153J46596_10000024 JGI25153J46596_10000024143 305
80 3300003775 Ga0055524_1000748 Ga0055524_100074810 305
81 3300025291 Ga0209675_1007013 Ga0209675_10070134 305
82 3300025297 Ga0209758_1000033 Ga0209758_10000338 305
83 3300025299 Ga0209256_1000030 Ga0209256_1000030300 305
84 3300046522 Ga0495643_0084194 Ga0495643_0084194_568_1485 305
85 3300048917 Ga0496114_0012065 Ga0496114_0012065_4619_5563 305
86 3300003771 Ga0055526_1023065 Ga0055526_10230652 306
87 3300003775 Ga0055524_1014052 Ga0055524_10140523 306
88 3300003790 Ga0055528_1000299 Ga0055528_100029918 306
89 3300025273 Ga0209673_1000054 Ga0209673_1000054153 306
90 3300025295 Ga0209564_1009879 Ga0209564_10098794 306
91 3300025299 Ga0209256_1004982 Ga0209256_10049828 306
92 3300049459 Ga0495678_001048 Ga0495678_001048_26_946 306
93 iso_pu_bacteria 2891048133 2891048944 306
94 iso_pu_bacteria 2995392953 2995396729 306
95 3300013105 Ga0157369_10003028 Ga0157369_100030283 307
96 3300014497 Ga0182008_10000704 Ga0182008_100007047 307
97 3300046507 Ga0495606_0000724 Ga0495606_0000724_49737_50684 307
98 iso_pu_bacteria 2599185156 2599331658 307
99 iso_pu_bacteria 2643221568 2643854193 307
100 iso_pu_bacteria 2643221733 2644731750 307
101 iso_pu_bacteria 2808606373 2808906037 307
102 iso_pu_bacteria 2842922631 2842924061 307
103 iso_pu_bacteria 2919166419 2919168580 307
104 iso_pu_bacteria 2978969890 2978971267 307
105 iso_pu_bacteria 2984587000 2984588412 307
106 3300006051 Ga0075364_10030304 Ga0075364_100303042 308
107 3300037312 Ga0395899_0008648 Ga0395899_0008648_534_1496 308
108 3300037418 Ga0395900_0000021 Ga0395900_0000021_237119_238081 308
109 3300037466 Ga0395898_0001431 Ga0395898_0001431_28525_29487 308
110 3300037471 Ga0395905_0024723 Ga0395905_0024723_168_1130 308
111 3300038443 Ga0395901_0001615 Ga0395901_0001615_19788_20750 308
112 3300048924 Ga0496121_0000635 Ga0496121_0000635_2628_3569 308
113 iso_pu_bacteria 2599185288 2599880442 308
114 iso_pu_bacteria 2599185303 2599946828 308
115 iso_pu_bacteria 2738541294 2738806664 308
116 iso_pu_bacteria 2738541309 2738894024 308
117 iso_pu_bacteria 2808606385 2808979221 308
118 iso_pu_bacteria 2808606388 2808994896 308
119 iso_pu_bacteria 2852612431 2852614334 308
120 iso_pu_bacteria 2852667396 2852667928 308
121 iso_pu_bacteria 2919704043 2919705129 308
122 3300035398 Ga0316574_0058587 Ga0316574_0058587_1230_2174 309
123 iso_pu_bacteria 2510917030 2511199619 309
124 iso_pu_bacteria 2513237090 2513611438 309
125 iso_pu_bacteria 2519103095 2519463269 309
126 iso_pu_bacteria 2582581283 2585168586 309
127 iso_pu_bacteria 2582581298 2585226857 309
128 iso_pu_bacteria 2582581304 2585255634 309
129 iso_pu_bacteria 2582581306 2585268701 309
130 iso_pu_bacteria 2582581311 2585295133 309
131 iso_pu_bacteria 2582581865 2585389345 309
132 iso_pu_bacteria 2585427529 2585550272 309
133 iso_pu_bacteria 2585427594 2585842691 309
134 iso_pu_bacteria 2599185301 2599936897 309
135 iso_pu_bacteria 2643221607 2644047213 309
136 iso_pu_bacteria 2643221636 2644199584 309
137 iso_pu_bacteria 2643221686 2644480002 309
138 iso_pu_bacteria 2643221689 2644498291 309
139 iso_pu_bacteria 2643221734 2644734365 309
140 iso_pu_bacteria 2693429783 2694632775 309
141 iso_pu_bacteria 2693429784 2694639496 309
142 iso_pu_bacteria 2808606386 2808984960 309
143 iso_pu_bacteria 2816332253 2817263357 309
144 iso_pu_bacteria 2816332256 2817276738 309
145 iso_pu_bacteria 2816332286 2817452810 309
146 iso_pu_bacteria 2821131069 2821135767 309
147 iso_pu_bacteria 2837651117 2837652201 309
148 iso_pu_bacteria 2847670302 2847675464 309
149 iso_pu_bacteria 2856314179 2856319352 309
150 iso_pu_bacteria 2856364286 2856369299 309
151 iso_pu_bacteria 2857349434 2857351297 309
152 iso_pu_bacteria 2869285874 2869286628 309
153 iso_pu_bacteria 2871429161 2871434782 309
154 iso_pu_bacteria 2874146452 2874149985 309
155 iso_pu_bacteria 2874155637 2874158243 309
156 iso_pu_bacteria 2876369609 2876374449 309
157 iso_pu_bacteria 2876392853 2876397881 309
158 iso_pu_bacteria 2876413966 2876416447 309
159 iso_pu_bacteria 2878035449 2878040585 309
160 iso_pu_bacteria 2878745973 2878751915 309
161 iso_pu_bacteria 2881147464 2881149787 309
162 iso_pu_bacteria 2881161766 2881166642 309
163 iso_pu_bacteria 2885305155 2885308136 309
164 iso_pu_bacteria 2885334103 2885339956 309
165 iso_pu_bacteria 2888350351 2888355612 309
166 iso_pu_bacteria 2889010040 2889010541 309
167 iso_pu_bacteria 2889016732 2889017751 309
168 iso_pu_bacteria 2903492973 2903504860 309
169 iso_pu_bacteria 2904659560 2904664532 309
170 iso_pu_bacteria 2906308376 2906314312 309
171 iso_pu_bacteria 2906321335 2906327478 309
172 iso_pu_bacteria 2906414383 2906420072 309
173 iso_pu_bacteria 2919100787 2919102219 309
174 iso_pu_bacteria 2922130491 2922138541 309
175 iso_pu_bacteria 2922185730 2922191047 309
176 iso_pu_bacteria 2928157003 2928163623 309
177 iso_pu_bacteria 2928163908 2928166448 309
178 iso_pu_bacteria 2937813078 2937815579 309
179 iso_pu_bacteria 2938014810 2938014921 309
180 iso_pu_bacteria 2958100919 2958100920 309
181 iso_pu_bacteria 2958130278 2958131031 309
182 iso_pu_bacteria 2958172287 2958174166 309
183 iso_pu_bacteria 2958179912 2958184952 309
184 iso_pu_bacteria 2961077736 2961083119 309
185 iso_pu_bacteria 2961114664 2961119531 309
186 iso_pu_bacteria 2965119406 2965124154 309
187 iso_pu_bacteria 2968110612 2968115786 309
188 iso_pu_bacteria 2968117919 2968119806 309
189 iso_pu_bacteria 2977843712 2977845815 309
190 iso_pu_bacteria 2977942078 2977942608 309
191 iso_pu_bacteria 2977971508 2977975019 309
192 iso_pu_bacteria 2979710463 2979711172 309
193 iso_pu_bacteria 2981990288 2981997214 309
194 iso_pu_bacteria 2987636660 2987638481 309
195 iso_pu_bacteria 2987652177 2987656963 309
196 iso_pu_bacteria 3004203850 3004205276 309
197 iso_pu_bacteria 3005445848 3005451992 309
198 iso_pu_bacteria 641736154 642415289 309
199 iso_pu_bacteria 8004387939 8004393802 309
200 iso_pu_bacteria 8004640170 8004643803 309
201 iso_pu_bacteria 8004714634 8004720570 309
202 iso_pu_bacteria 8020807995 8020814096 309
203 iso_pu_bacteria 8039098773 8039099878 309
204 iso_pu_bacteria 8040167225 8040172047 309
205 iso_pu_bacteria 8040173305 8040178582 309
206 3300025294 Ga0209025_1016489 Ga0209025_10164892 310
207 3300028794 Ga0307515_10000112 Ga0307515_10000112192 310
208 3300049569 Ga0501032_0211529 Ga0501032_0211529_276_1208 310
209 3300049573 Ga0501037_0235276 Ga0501037_0235276_14_946 310
210 3300049574 Ga0501038_0257156 Ga0501038_0257156_402_1334 310
211 3300049581 Ga0501047_0191915 Ga0501047_0191915_908_1840 310
212 3300049582 Ga0501048_0277564 Ga0501048_0277564_215_1147 310
213 3300049742 Ga0501080_0538798 Ga0501080_0538798_39_971 310
214 3300049744 Ga0501083_0042724 Ga0501083_0042724_72_1004 310
215 3300049823 Ga0501044_0500462 Ga0501044_0500462_129_1061 310
216 iso_pu_bacteria 2508501050 2508725736 310
217 iso_pu_bacteria 2509276019 2509378384 310
218 iso_pu_bacteria 2510065057 2510303115 310
219 iso_pu_bacteria 2510461069 2510839512 310
220 iso_pu_bacteria 2511231052 2511497113 310
221 iso_pu_bacteria 2512875016 2512929004 310
222 iso_pu_bacteria 2512875026 2512968857 310
223 iso_pu_bacteria 2513237086 2513582716 310
224 iso_pu_bacteria 2513237089 2513606466 310
225 iso_pu_bacteria 2513237091 2513614770 310
226 iso_pu_bacteria 2513237140 2513882286 310
227 iso_pu_bacteria 2513237143 2513901777 310
228 iso_pu_bacteria 2513237156 2513986731 310
229 iso_pu_bacteria 2513237160 2514006092 310
230 iso_pu_bacteria 2515154107 2515611707 310
231 iso_pu_bacteria 2516653046 2516895657 310
232 iso_pu_bacteria 2517487022 2517566391 310
233 iso_pu_bacteria 2524023207 2524449365 310
234 iso_pu_bacteria 2534681786 2535486225 310
235 iso_pu_bacteria 2537561587 2537874977 310
236 iso_pu_bacteria 2551306084 2551678872 310
237 iso_pu_bacteria 2551306084 2551682110 310
238 iso_pu_bacteria 2551306085 2551683424 310
239 iso_pu_bacteria 2551306086 2551692948 310
240 iso_pu_bacteria 2551306087 2551702878 310
241 iso_pu_bacteria 2551306089 2551712424 310
242 iso_pu_bacteria 2551306090 2551718857 310
243 iso_pu_bacteria 2551306091 2551724311 310
244 iso_pu_bacteria 2551306092 2551734576 310
245 iso_pu_bacteria 2551306093 2551743879 310
246 iso_pu_bacteria 2554235003 2554244351 310
247 iso_pu_bacteria 2558860100 2558861766 310
248 iso_pu_bacteria 2558860242 2559297845 310
249 iso_pu_bacteria 2558860983 2561468469 310
250 iso_pu_bacteria 2585427608 2585899689 310
251 iso_pu_bacteria 2588253730 2588514550 310
252 iso_pu_bacteria 2599185210 2599603878 310
253 iso_pu_bacteria 2599185236 2599718245 310
254 iso_pu_bacteria 2600255279 2601612599 310
255 iso_pu_bacteria 2600255308 2601748318 310
256 iso_pu_bacteria 2615840698 2616552692 310
257 iso_pu_bacteria 2615840698 2616555246 310
258 iso_pu_bacteria 2643221582 2643917727 310
259 iso_pu_bacteria 2643221599 2644003055 310
260 iso_pu_bacteria 2643221693 2644522527 310
261 iso_pu_bacteria 2657244999 2657684236 310
262 iso_pu_bacteria 2667528174 2671114326 310
263 iso_pu_bacteria 2687453341 2688392682 310
264 iso_pu_bacteria 2738541297 2738826897 310
265 iso_pu_bacteria 2738541357 2739150694 310
266 iso_pu_bacteria 2738543003 2739192613 310
267 iso_pu_bacteria 2738543024 2739308109 310
268 iso_pu_bacteria 2738543026 2739319090 310
269 iso_pu_bacteria 2738543029 2739337331 310
270 iso_pu_bacteria 2751185800 2753357905 310
271 iso_pu_bacteria 2751185821 2753459199 310
272 iso_pu_bacteria 2751185846 2753566864 310
273 iso_pu_bacteria 2757320392 2757572630 310
274 iso_pu_bacteria 2758568016 2758640514 310
275 iso_pu_bacteria 2775507049 2776910630 310
276 iso_pu_bacteria 2791355082 2792580975 310
277 iso_pu_bacteria 2802428858 2802719703 310
278 iso_pu_bacteria 2802428859 2802728323 310
279 iso_pu_bacteria 2802428860 2802733533 310
280 iso_pu_bacteria 2802428861 2802738763 310
281 iso_pu_bacteria 2802428862 2802745637 310
282 iso_pu_bacteria 2802428863 2802751402 310
283 iso_pu_bacteria 2802429268 2804754198 310
284 iso_pu_bacteria 2808606387 2808989646 310
285 iso_pu_bacteria 2818991439 2819561927 310
286 iso_pu_bacteria 2818991448 2819613596 310
287 iso_pu_bacteria 2818991461 2819682965 310
288 iso_pu_bacteria 2818991467 2819720203 310
289 iso_pu_bacteria 2821123053 2821123534 310
290 iso_pu_bacteria 2838029111 2838030567 310
291 iso_pu_bacteria 2838675328 2838679215 310
292 iso_pu_bacteria 2838714209 2838719061 310
293 iso_pu_bacteria 2838719591 2838724060 310
294 iso_pu_bacteria 2838724970 2838728893 310
295 iso_pu_bacteria 2841846520 2841850184 310
296 iso_pu_bacteria 2841859092 2841861037 310
297 iso_pu_bacteria 2842124991 2842128656 310
298 iso_pu_bacteria 2842130223 2842134117 310
299 iso_pu_bacteria 2842152218 2842156113 310
300 iso_pu_bacteria 2842170452 2842175307 310
301 iso_pu_bacteria 2842175837 2842179793 310
302 iso_pu_bacteria 2842187318 2842191806 310
303 iso_pu_bacteria 2842211629 2842216123 310
304 iso_pu_bacteria 2842224351 2842228825 310
305 iso_pu_bacteria 2842475841 2842477152 310
306 iso_pu_bacteria 2842502639 2842503949 310
307 iso_pu_bacteria 2842515876 2842518696 310
308 iso_pu_bacteria 2850079185 2850084186 310
309 iso_pu_bacteria 2852387548 2852392997 310
310 iso_pu_bacteria 2854911287 2854914829 310
311 iso_pu_bacteria 2855825444 2855829527 310
312 iso_pu_bacteria 2855839649 2855844626 310
313 iso_pu_bacteria 2856349417 2856353455 310
314 iso_pu_bacteria 2857531043 2857531097 310
315 iso_pu_bacteria 2857564685 2857568111 310
316 iso_pu_bacteria 2858800743 2858805913 310
317 iso_pu_bacteria 2871495908 2871496383 310
318 iso_pu_bacteria 2876363079 2876369470 310
319 iso_pu_bacteria 2878760144 2878760611 310
320 iso_pu_bacteria 2878767105 2878767764 310
321 iso_pu_bacteria 2881155292 2881160582 310
322 iso_pu_bacteria 2881853255 2881857178 310
323 iso_pu_bacteria 2885342637 2885344738 310
324 iso_pu_bacteria 2885350715 2885357763 310
325 iso_pu_bacteria 2899792073 2899793344 310
326 iso_pu_bacteria 2899845264 2899849841 310
327 iso_pu_bacteria 2903448605 2903453056 310
328 iso_pu_bacteria 2903521522 2903523946 310
329 iso_pu_bacteria 2903528002 2903531567 310
330 iso_pu_bacteria 2903540706 2903541177 310
331 iso_pu_bacteria 2903748898 2903755432 310
332 iso_pu_bacteria 2904424332 2904425332 310
333 iso_pu_bacteria 2904483920 2904486432 310
334 iso_pu_bacteria 2909042592 2909045346 310
335 iso_pu_bacteria 2913295892 2913296027 310
336 iso_pu_bacteria 2915650412 2915651023 310
337 iso_pu_bacteria 2915980308 2915982113 310
338 iso_pu_bacteria 2915986958 2915988354 310
339 iso_pu_bacteria 2915993759 2916000501 310
340 iso_pu_bacteria 2916000859 2916003417 310
341 iso_pu_bacteria 2916007675 2916007758 310
342 iso_pu_bacteria 2916014648 2916015992 310
343 iso_pu_bacteria 2916021584 2916021836 310
344 iso_pu_bacteria 2916028427 2916030966 310
345 iso_pu_bacteria 2916035215 2916037357 310
346 iso_pu_bacteria 2916041962 2916042187 310
347 iso_pu_bacteria 2916048683 2916048959 310
348 iso_pu_bacteria 2916055098 2916057239 310
349 iso_pu_bacteria 2916061851 2916066902 310
350 iso_pu_bacteria 2916068649 2916072157 310
351 iso_pu_bacteria 2916076590 2916079085 310
352 iso_pu_bacteria 2917699015 2917700668 310
353 iso_pu_bacteria 2919114240 2919117788 310
354 iso_pu_bacteria 2919408235 2919412346 310
355 iso_pu_bacteria 2919476304 2919477080 310
356 iso_pu_bacteria 2919527303 2919527777 310
357 iso_pu_bacteria 2921201388 2921202937 310
358 iso_pu_bacteria 2921208531 2921213828 310
359 iso_pu_bacteria 2921237296 2921242142 310
360 iso_pu_bacteria 2921244191 2921246319 310
361 iso_pu_bacteria 2921250672 2921256727 310
362 iso_pu_bacteria 2921257292 2921259285 310
363 iso_pu_bacteria 2921263974 2921269784 310
364 iso_pu_bacteria 2921282425 2921286693 310
365 iso_pu_bacteria 2921289301 2921292377 310
366 iso_pu_bacteria 2921296804 2921297769 310
367 iso_pu_bacteria 2924144063 2924147974 310
368 iso_pu_bacteria 2924150972 2924152859 310
369 iso_pu_bacteria 2924158325 2924161876 310
370 iso_pu_bacteria 2924165586 2924165712 310
371 iso_pu_bacteria 2924172951 2924175693 310
372 iso_pu_bacteria 2924179722 2924184267 310
373 iso_pu_bacteria 2924186466 2924186670 310
374 iso_pu_bacteria 2924193448 2924197918 310
375 iso_pu_bacteria 2924200457 2924200705 310
376 iso_pu_bacteria 2924207177 2924207328 310
377 iso_pu_bacteria 2924214083 2924214148 310
378 iso_pu_bacteria 2924221636 2924222477 310
379 iso_pu_bacteria 2924228884 2924229045 310
380 iso_pu_bacteria 2926754445 2926757602 310
381 iso_pu_bacteria 2926760298 2926764789 310
382 iso_pu_bacteria 2933006813 2933010193 310
383 iso_pu_bacteria 2933011516 2933014322 310
384 iso_pu_bacteria 2933594066 2933597088 310
385 iso_pu_bacteria 2936996657 2936997140 310
386 iso_pu_bacteria 2937002841 2937003169 310
387 iso_pu_bacteria 2937009748 2937010017 310
388 iso_pu_bacteria 2937016420 2937020455 310
389 iso_pu_bacteria 2937023124 2937025337 310
390 iso_pu_bacteria 2937029754 2937033728 310
391 iso_pu_bacteria 2937036028 2937040271 310
392 iso_pu_bacteria 2937042894 2937044096 310
393 iso_pu_bacteria 2937049772 2937054405 310
394 iso_pu_bacteria 2937056579 2937060366 310
395 iso_pu_bacteria 2937063883 2937064095 310
396 iso_pu_bacteria 2937071275 2937071830 310
397 iso_pu_bacteria 2937078374 2937084604 310
398 iso_pu_bacteria 2937084907 2937091570 310
399 iso_pu_bacteria 2937091812 2937095807 310
400 iso_pu_bacteria 2937098957 2937100949 310
401 iso_pu_bacteria 2937106411 2937109864 310
402 iso_pu_bacteria 2937113482 2937115599 310
403 iso_pu_bacteria 2937119839 2937119921 310
404 iso_pu_bacteria 2937126314 2937132479 310
405 iso_pu_bacteria 2937848649 2937853940 310
406 iso_pu_bacteria 2937994558 2937995033 310
407 iso_pu_bacteria 2952252522 2952255074 310
408 iso_pu_bacteria 2957375807 2957381148 310
409 iso_pu_bacteria 2957382221 2957382444 310
410 iso_pu_bacteria 2957388812 2957391658 310
411 iso_pu_bacteria 2957395598 2957400116 310
412 iso_pu_bacteria 2957402308 2957404110 310
413 iso_pu_bacteria 2957408893 2957411496 310
414 iso_pu_bacteria 2957415311 2957416387 310
415 iso_pu_bacteria 2957422303 2957429569 310
416 iso_pu_bacteria 2957430029 2957432783 310
417 iso_pu_bacteria 2957437181 2957441827 310
418 iso_pu_bacteria 2957443900 2957445836 310
419 iso_pu_bacteria 2957450854 2957450939 310
420 iso_pu_bacteria 2957457609 2957460240 310
421 iso_pu_bacteria 2957464669 2957465381 310
422 iso_pu_bacteria 2957478035 2957478817 310
423 iso_pu_bacteria 2957484790 2957485335 310
424 iso_pu_bacteria 2957491536 2957493358 310
425 iso_pu_bacteria 2957498199 2957498551 310
426 iso_pu_bacteria 2957505466 2957506490 310
427 iso_pu_bacteria 2958165035 2958165702 310
428 iso_pu_bacteria 2960584000 2960590307 310
429 iso_pu_bacteria 2960591022 2960597016 310
430 iso_pu_bacteria 2960597568 2960600111 310
431 iso_pu_bacteria 2960603979 2960603989 310
432 iso_pu_bacteria 2960610863 2960611118 310
433 iso_pu_bacteria 2960617483 2960622477 310
434 iso_pu_bacteria 2960624210 2960625188 310
435 iso_pu_bacteria 2960631154 2960631483 310
436 iso_pu_bacteria 2960637947 2960644292 310
437 iso_pu_bacteria 2960645483 2960647307 310
438 iso_pu_bacteria 2960652885 2960657791 310
439 iso_pu_bacteria 2960660292 2960663864 310
440 iso_pu_bacteria 2960667422 2960667676 310
441 iso_pu_bacteria 2960674078 2960679216 310
442 iso_pu_bacteria 2960680706 2960682220 310
443 iso_pu_bacteria 2960687367 2960691873 310
444 iso_pu_bacteria 2960693952 2960697978 310
445 iso_pu_bacteria 2961127735 2961132598 310
446 iso_pu_bacteria 2961163497 2961164161 310
447 iso_pu_bacteria 2963644680 2963650230 310
448 iso_pu_bacteria 2964607997 2964615032 310
449 iso_pu_bacteria 2964615318 2964620209 310
450 iso_pu_bacteria 2964621998 2964626719 310
451 iso_pu_bacteria 2964628898 2964629128 310
452 iso_pu_bacteria 2964636051 2964636239 310
453 iso_pu_bacteria 2964643177 2964643259 310
454 iso_pu_bacteria 2964649959 2964652519 310
455 iso_pu_bacteria 2964656573 2964662093 310
456 iso_pu_bacteria 2964663802 2964663885 310
457 iso_pu_bacteria 2964670856 2964677745 310
458 iso_pu_bacteria 2964678106 2964678208 310
459 iso_pu_bacteria 2964685014 2964685211 310
460 iso_pu_bacteria 2964691889 2964694186 310
461 iso_pu_bacteria 2964698721 2964699029 310
462 iso_pu_bacteria 2964705432 2964710838 310
463 iso_pu_bacteria 2964712639 2964716641 310
464 iso_pu_bacteria 2964719344 2964720743 310
465 iso_pu_bacteria 2965018300 2965018773 310
466 iso_pu_bacteria 2967664464 2967664861 310
467 iso_pu_bacteria 2967671571 2967671654 310
468 iso_pu_bacteria 2967678726 2967685571 310
469 iso_pu_bacteria 2967686174 2967689526 310
470 iso_pu_bacteria 2967693043 2967695637 310
471 iso_pu_bacteria 2967699805 2967699920 310
472 iso_pu_bacteria 2967706974 2967708138 310
473 iso_pu_bacteria 2967714385 2967717475 310
474 iso_pu_bacteria 2967721400 2967721526 310
475 iso_pu_bacteria 2967728569 2967730297 310
476 iso_pu_bacteria 2967735183 2967737290 310
477 iso_pu_bacteria 2967742019 2967748782 310
478 iso_pu_bacteria 2967748971 2967749055 310
479 iso_pu_bacteria 2967755722 2967755805 310
480 iso_pu_bacteria 2967762386 2967764654 310
481 iso_pu_bacteria 2967769361 2967769569 310
482 iso_pu_bacteria 2967775926 2967781727 310
483 iso_pu_bacteria 2968083720 2968086422 310
484 iso_pu_bacteria 2968171901 2968172564 310
485 iso_pu_bacteria 2970019648 2970025930 310
486 iso_pu_bacteria 2970026789 2970028956 310
487 iso_pu_bacteria 2970033650 2970033733 310
488 iso_pu_bacteria 2970040964 2970043403 310
489 iso_pu_bacteria 2970047711 2970050131 310
490 iso_pu_bacteria 2970054988 2970057712 310
491 iso_pu_bacteria 2970061556 2970063481 310
492 iso_pu_bacteria 2970068827 2970068909 310
493 iso_pu_bacteria 2970076120 2970078133 310
494 iso_pu_bacteria 2970082768 2970084342 310
495 iso_pu_bacteria 2970088815 2970092022 310
496 iso_pu_bacteria 2970095765 2970095849 310
497 iso_pu_bacteria 2970102677 2970102760 310
498 iso_pu_bacteria 2970109326 2970111222 310
499 iso_pu_bacteria 2970116247 2970117643 310
500 iso_pu_bacteria 2970122695 2970125690 310
501 iso_pu_bacteria 2970129317 2970132136 310
502 iso_pu_bacteria 2970136068 2970136175 310
503 iso_pu_bacteria 2970143518 2970149445 310
504 iso_pu_bacteria 2970149975 2970152010 310
505 iso_pu_bacteria 2970156795 2970162460 310
506 iso_pu_bacteria 2970164137 2970168971 310
507 iso_pu_bacteria 2970170962 2970171045 310
508 iso_pu_bacteria 2970177841 2970180141 310
509 iso_pu_bacteria 2970184632 2970189543 310
510 iso_pu_bacteria 2970191845 2970191976 310
511 iso_pu_bacteria 2970554993 2970555464 310
512 iso_pu_bacteria 2977516862 2977518401 310
513 iso_pu_bacteria 2977523885 2977526412 310
514 iso_pu_bacteria 2977530762 2977534605 310
515 iso_pu_bacteria 2977537788 2977539714 310
516 iso_pu_bacteria 2977544691 2977548914 310
517 iso_pu_bacteria 2977551784 2977556034 310
518 iso_pu_bacteria 2977558990 2977560560 310
519 iso_pu_bacteria 2977565890 2977566202 310
520 iso_pu_bacteria 2977572785 2977575382 310
521 iso_pu_bacteria 2977579622 2977582412 310
522 iso_pu_bacteria 2977922695 2977928579 310
523 iso_pu_bacteria 2977986579 2977991167 310
524 iso_pu_bacteria 2979089926 2979090095 310
525 iso_pu_bacteria 2979095461 2979095631 310
526 iso_pu_bacteria 2979100975 2979101141 310
527 iso_pu_bacteria 2984509177 2984510909 310
528 iso_pu_bacteria 2984518228 2984518389 310
529 iso_pu_bacteria 2984537506 2984539259 310
530 iso_pu_bacteria 2984601300 2984605965 310
531 iso_pu_bacteria 2987659509 2987660169 310
532 iso_pu_bacteria 2996887358 2996889780 310
533 iso_pu_bacteria 3004188549 3004189217 310
534 iso_pu_bacteria 3004211236 3004213406 310
535 iso_pu_bacteria 3004218560 3004221307 310
536 iso_pu_bacteria 3004334049 3004338426 310
537 iso_pu_bacteria 3005409236 3005416135 310
538 iso_pu_bacteria 3005416602 3005420961 310
539 iso_pu_bacteria 3005452660 3005455193 310
540 iso_pu_bacteria 637000159 637078718 310
541 iso_pu_bacteria 648276728 648735637 310
542 iso_pu_bacteria 650716007 650842431 310
543 iso_pu_bacteria 8003570095 8003573445 310
544 iso_pu_bacteria 8003992118 8003997151 310
545 iso_pu_bacteria 8003999396 8004004862 310
546 iso_pu_bacteria 8005258706 8005261626 310
547 iso_pu_bacteria 8005314921 8005319304 310
548 iso_pu_bacteria 8005321885 8005324307 310
549 iso_pu_bacteria 8005484373 8005489357 310
550 iso_pu_bacteria 8005645114 8005650256 310
551 iso_pu_bacteria 8005658619 8005662218 310
552 iso_pu_bacteria 8005682033 8005683872 310
553 iso_pu_bacteria 8018150411 8018154728 310
554 iso_pu_bacteria 8046767195 8046771987 310
555 iso_pu_bacteria 8049293176 8049297226 310
556 3300005985 Ga0081539_10132905 Ga0081539_101329052 311
557 3300031251 Ga0265327_10082800 Ga0265327_100828001 311
558 3300042115 Ga0450911_000054 Ga0450911_000054_6197_7132 311
559 3300042139 Ga0450904_000392 Ga0450904_000392_6214_7149 311
560 3300042438 Ga0439459_0001682 Ga0439459_0001682_152_1087 311
561 3300045051 Ga0451576_0016127 Ga0451576_0016127_4389_5324 311
562 3300045051 Ga0451576_0020127 Ga0451576_0020127_4879_5814 311
563 3300047472 Ga0495686_0111908 Ga0495686_0111908_101_1051 311
564 3300048919 Ga0496116_0000026 Ga0496116_0000026_398132_399067 311
565 3300048920 Ga0496117_0031918 Ga0496117_0031918_100_1035 311
566 3300048926 Ga0496123_0039578 Ga0496123_0039578_279_1214 311
567 3300048929 Ga0496126_0000059 Ga0496126_0000059_97829_98764 311
568 3300049853 Ga0501226_000008 Ga0501226_000008_162730_163665 311
569 3300053125 Ga0500618_002627 Ga0500618_002627_4205_5140 311
570 3300053177 Ga0500636_0002587 Ga0500636_0002587_7327_8262 311
571 iso_pu_bacteria 2511231010 2511291944 311
572 iso_pu_bacteria 2511231011 2511298493 311
573 iso_pu_bacteria 2511231012 2511304769 311
574 iso_pu_bacteria 2511231014 2511315884 311
575 iso_pu_bacteria 2511231017 2511334534 311
576 iso_pu_bacteria 2511231020 2511352211 311
577 iso_pu_bacteria 2511231023 2511372578 311
578 iso_pu_bacteria 2511231024 2511377910 311
579 iso_pu_bacteria 2511231031 2511414508 311
580 iso_pu_bacteria 2554235231 2555248824 311
581 iso_pu_bacteria 2597489888 2597864151 311
582 iso_pu_bacteria 2597489889 2597869707 311
583 iso_pu_bacteria 2599185167 2599398458 311
584 iso_pu_bacteria 2599185179 2599450460 311
585 iso_pu_bacteria 2599185189 2599507260 311
586 iso_pu_bacteria 2599185190 2599512944 311
587 iso_pu_bacteria 2599185191 2599521688 311
588 iso_pu_bacteria 2599185290 2599891621 311
589 iso_pu_bacteria 2600255296 2601691992 311
590 iso_pu_bacteria 2600255318 2601799314 311
591 iso_pu_bacteria 2603880185 2606078455 311
592 iso_pu_bacteria 2603880199 2606130563 311
593 iso_pu_bacteria 2619619299 2621299997 311
594 iso_pu_bacteria 2623620443 2624480301 311
595 iso_pu_bacteria 2643221565 2643845784 311
596 iso_pu_bacteria 2643221571 2643873940 311
597 iso_pu_bacteria 2643221713 2644620324 311
598 iso_pu_bacteria 2643221736 2644744499 311
599 iso_pu_bacteria 2675903420 2677896260 311
600 iso_pu_bacteria 2713897148 2715753486 311
601 iso_pu_bacteria 2713897149 2715758628 311
602 iso_pu_bacteria 2718217725 2718634491 311
603 iso_pu_bacteria 2721755607 2723248855 311
604 iso_pu_bacteria 2738541265 2738669996 311
605 iso_pu_bacteria 2738541282 2738748389 311
606 iso_pu_bacteria 2738541303 2738857431 311
607 iso_pu_bacteria 2738543025 2739313219 311
608 iso_pu_bacteria 2765235841 2765582532 311
609 iso_pu_bacteria 2773857673 2774138115 311
610 iso_pu_bacteria 2784132063 2784264820 311
611 iso_pu_bacteria 2806310737 2807409693 311
612 iso_pu_bacteria 2806310745 2807457994 311
613 iso_pu_bacteria 2808606377 2808929020 311
614 iso_pu_bacteria 2808606381 2808951141 311
615 iso_pu_bacteria 2816332298 2817491291 311
616 iso_pu_bacteria 2818991456 2819654778 311
617 iso_pu_bacteria 2834028612 2834034126 311
618 iso_pu_bacteria 2841760612 2841763290 311
619 iso_pu_bacteria 2842826826 2842827052 311
620 iso_pu_bacteria 2842832357 2842835289 311
621 iso_pu_bacteria 2842837860 2842839153 311
622 iso_pu_bacteria 2842843487 2842844108 311
623 iso_pu_bacteria 2844104063 2844108840 311
624 iso_pu_bacteria 2846037992 2846038708 311
625 iso_pu_bacteria 2851182111 2851182536 311
626 iso_pu_bacteria 2851246043 2851250947 311
627 iso_pu_bacteria 2852657418 2852662288 311
628 iso_pu_bacteria 2860339153 2860342687 311
629 iso_pu_bacteria 2860867994 2860870716 311
630 iso_pu_bacteria 2878029506 2878032202 311
631 iso_pu_bacteria 2880230671 2880233146 311
632 iso_pu_bacteria 2894817345 2894822021 311
633 iso_pu_bacteria 2904518522 2904521965 311
634 iso_pu_bacteria 2904550169 2904550624 311
635 iso_pu_bacteria 2908446538 2908449525 311
636 iso_pu_bacteria 2919063839 2919068691 311
637 iso_pu_bacteria 2919385768 2919391036 311
638 iso_pu_bacteria 2919487758 2919492205 311
639 iso_pu_bacteria 2929189879 2929192706 311
640 iso_pu_bacteria 2931390751 2931393810 311
641 iso_pu_bacteria 2931396565 2931401781 311
642 iso_pu_bacteria 2939636861 2939641396 311
643 iso_pu_bacteria 2945928738 2945933350 311
644 iso_pu_bacteria 2945961074 2945962499 311
645 iso_pu_bacteria 2946006987 2946009642 311
646 iso_pu_bacteria 2946027586 2946030813 311
647 iso_pu_bacteria 2947233263 2947237950 311
648 iso_pu_bacteria 2969304461 2969307106 311
649 iso_pu_bacteria 2974289157 2974291535 311
650 iso_pu_bacteria 2998139840 2998142243 311
651 iso_pu_bacteria 3007252601 3007254864 311
652 iso_pu_bacteria 3007315729 3007316314 311
653 iso_pu_bacteria 3007614139 3007619242 311
654 iso_pu_bacteria 3007718800 3007723565 311
655 iso_pu_bacteria 3007803356 3007804819 311
656 iso_pu_bacteria 3007855910 3007856444 311
657 iso_pu_bacteria 3007861166 3007862466 311
658 iso_pu_bacteria 8029995093 8029998467 311
659 iso_pu_bacteria 8052494512 8052498679 311
660 iso_pu_bacteria 8054285046 8054291407 311
661 iso_pu_bacteria 8054347763 8054352394 311
662 iso_pu_bacteria 8054563764 8054566866 311
663 iso_pu_bacteria 8054929484 8054933950 311
664 iso_pu_bacteria 8055817908 8055821232 311
665 iso_pu_bacteria 8056115690 8056119995 311
666 iso_pu_bacteria 8056120720 8056122076 311
667 iso_pu_bacteria 8056131705 8056134892 311
668 iso_pu_bacteria 8056137416 8056141644 311
669 iso_pu_bacteria 8056148874 8056150788 311
670 iso_pu_bacteria 8056161164 8056165932 311
671 iso_pu_bacteria 8056166840 8056168829 311
672 iso_pu_bacteria 8056172158 8056173928 311
673 iso_pu_bacteria 8056177738 8056182441 311
674 iso_pu_bacteria 8056569372 8056574130 311
675 iso_pu_bacteria 8057529695 8057534786 311
676 3300009011 Ga0105251_10001803 Ga0105251_100018032 312
677 3300009092 Ga0105250_10000058 Ga0105250_1000005851 312
678 3300009093 Ga0105240_10177754 Ga0105240_101777542 312
679 3300025254 Ga0209148_1012580 Ga0209148_10125802 312
680 3300025272 Ga0209455_1003801 Ga0209455_10038013 312
681 3300025291 Ga0209675_1016744 Ga0209675_10167442 312
682 3300025711 Ga0207696_1000017 Ga0207696_1000017387 312
683 3300025735 Ga0207713_1000981 Ga0207713_100098117 312
684 3300025913 Ga0207695_10131818 Ga0207695_101318182 312
685 3300031616 Ga0307508_10085555 Ga0307508_100855552 312
686 3300031731 Ga0307405_10000024 Ga0307405_1000002432 312
687 3300035172 Ga0373955_0079621 Ga0373955_0079621_886_1827 312
688 3300039447 Ga0436361_1083939 Ga0436361_1083939_2815_3753 312
689 3300048920 Ga0496117_0015538 Ga0496117_0015538_3252_4190 312
690 3300048921 Ga0496118_0029726 Ga0496118_0029726_1360_2298 312
691 3300048926 Ga0496123_0178112 Ga0496123_0178112_162_1100 312
692 3300048927 Ga0496124_0020951 Ga0496124_0020951_2607_3545 312
693 3300048929 Ga0496126_0023387 Ga0496126_0023387_3982_4920 312
694 3300050507 nmdc:mga05p37_59611_c1 nmdc:mga05p37_59611_c1_1707_2645 312
695 iso_pu_bacteria 2684623219 2687236671 312
696 3300001989 JGI24739J22299_10007607 JGI24739J22299_100076073 313
697 3300001989 JGI24739J22299_10029968 JGI24739J22299_100299681 313
698 3300002067 JGI24735J21928_10018021 JGI24735J21928_100180212 313
699 3300003187 JGI25151J46595_10000036 JGI25151J46595_10000036170 313
700 3300003214 JGI25165J46597_1000020 JGI25165J46597_1000020294 313
701 3300003751 Ga0055538_1000062 Ga0055538_100006237 313
702 3300003752 Ga0055539_1000093 Ga0055539_100009337 313
703 3300003756 Ga0055533_1000105 Ga0055533_100010537 313
704 3300003758 Ga0055532_1000230 Ga0055532_100023014 313
705 3300003759 Ga0055525_1000137 Ga0055525_100013737 313
706 3300003760 Ga0055527_1000042 Ga0055527_100004214 313
707 3300003761 Ga0055535_1000066 Ga0055535_100006614 313
708 3300003763 Ga0055529_1001530 Ga0055529_10015305 313
709 3300003763 Ga0055529_1005106 Ga0055529_10051061 313
710 3300003775 Ga0055524_1000018 Ga0055524_100001858 313
711 3300003841 Ga0055541_1000063 Ga0055541_100006337 313
712 3300005327 Ga0070658_10085570 Ga0070658_100855702 313
713 3300005331 Ga0070670_100000277 Ga0070670_10000027724 313
714 3300005366 Ga0070659_100000038 Ga0070659_10000003824 313
715 3300005455 Ga0070663_100000558 Ga0070663_1000005584 313
716 3300005458 Ga0070681_10009242 Ga0070681_1000924211 313
717 3300005539 Ga0068853_100009469 Ga0068853_1000094696 313
718 3300005563 Ga0068855_100075336 Ga0068855_1000753362 313
719 3300005563 Ga0068855_100199532 Ga0068855_1001995322 313
720 3300005563 Ga0068855_100339440 Ga0068855_1003394402 313
721 3300005564 Ga0070664_100094179 Ga0070664_1000941792 313
722 3300005577 Ga0068857_100239574 Ga0068857_1002395742 313
723 3300005616 Ga0068852_100015462 Ga0068852_1000154622 313
724 3300006038 Ga0075365_10008792 Ga0075365_100087923 313
725 3300006038 Ga0075365_10071991 Ga0075365_100719913 313
726 3300006051 Ga0075364_10009737 Ga0075364_100097373 313
727 3300006177 Ga0075362_10007635 Ga0075362_100076353 313
728 3300006178 Ga0075367_10043833 Ga0075367_100438332 313
729 3300006178 Ga0075367_10074090 Ga0075367_100740902 313
730 3300006178 Ga0075367_10091479 Ga0075367_100914792 313
731 3300006353 Ga0075370_10037803 Ga0075370_100378032 313
732 3300009093 Ga0105240_10069968 Ga0105240_100699683 313
733 3300009093 Ga0105240_10472910 Ga0105240_104729102 313
734 3300009551 Ga0105238_10013098 Ga0105238_100130984 313
735 3300009551 Ga0105238_10024559 Ga0105238_100245594 313
736 3300009551 Ga0105238_10064040 Ga0105238_100640401 313
737 3300010375 Ga0105239_10025754 Ga0105239_100257544 313
738 3300010375 Ga0105239_10063548 Ga0105239_100635484 313
739 3300010375 Ga0105239_10124942 Ga0105239_101249423 313
740 3300013104 Ga0157370_10071884 Ga0157370_100718844 313
741 3300013104 Ga0157370_10084869 Ga0157370_100848691 313
742 3300013296 Ga0157374_10284715 Ga0157374_102847152 313
743 3300014326 Ga0157380_10003627 Ga0157380_100036275 313
744 3300015265 Ga0182005_1007215 Ga0182005_10072152 313
745 3300021361 Ga0213872_10013982 Ga0213872_100139823 313
746 3300021384 Ga0213876_10062142 Ga0213876_100621422 313
747 3300025224 Ga0209784_100021 Ga0209784_100021327 313
748 3300025225 Ga0209566_100119 Ga0209566_10011955 313
749 3300025226 Ga0209674_100036 Ga0209674_100036327 313
750 3300025228 Ga0209672_100090 Ga0209672_10009098 313
751 3300025229 Ga0209147_100132 Ga0209147_10013297 313
752 3300025230 Ga0209563_100040 Ga0209563_100040327 313
753 3300025242 Ga0209258_100211 Ga0209258_10021198 313
754 3300025253 Ga0209677_100023 Ga0209677_100023327 313
755 3300025254 Ga0209148_1000443 Ga0209148_100044314 313
756 3300025256 Ga0209759_1001415 Ga0209759_10014151 313
757 3300025261 Ga0209233_1000047 Ga0209233_100004741 313
758 3300025272 Ga0209455_1000448 Ga0209455_100044823 313
759 3300025272 Ga0209455_1000723 Ga0209455_100072316 313
760 3300025273 Ga0209673_1019757 Ga0209673_10197572 313
761 3300025291 Ga0209675_1002312 Ga0209675_10023125 313
762 3300025292 Ga0209676_1019241 Ga0209676_10192412 313
763 3300025294 Ga0209025_1000017 Ga0209025_1000017346 313
764 3300025295 Ga0209564_1000059 Ga0209564_1000059126 313
765 3300025297 Ga0209758_1029691 Ga0209758_10296913 313
766 3300025299 Ga0209256_1000032 Ga0209256_100003261 313
767 3300025304 Ga0209257_1000239 Ga0209257_100023930 313
768 3300025904 Ga0207647_10005805 Ga0207647_100058054 313
769 3300025909 Ga0207705_10014795 Ga0207705_100147954 313
770 3300025912 Ga0207707_10131006 Ga0207707_101310061 313
771 3300025913 Ga0207695_10241014 Ga0207695_102410141 313
772 3300025914 Ga0207671_10067655 Ga0207671_100676553 313
773 3300025914 Ga0207671_10117547 Ga0207671_101175471 313
774 3300025919 Ga0207657_10000063 Ga0207657_1000006327 313
775 3300025921 Ga0207652_10270711 Ga0207652_102707112 313
776 3300025925 Ga0207650_10000342 Ga0207650_1000034221 313
777 3300025932 Ga0207690_10000025 Ga0207690_10000025142 313
778 3300025945 Ga0207679_10204851 Ga0207679_102048511 313
779 3300025949 Ga0207667_10015164 Ga0207667_100151642 313
780 3300025949 Ga0207667_10550072 Ga0207667_105500721 313
781 3300026067 Ga0207678_10001764 Ga0207678_100017644 313
782 3300031727 Ga0316576_10015489 Ga0316576_100154892 313
783 3300031727 Ga0316576_10368959 Ga0316576_103689592 313
784 3300031731 Ga0307405_10007115 Ga0307405_100071155 313
785 3300031911 Ga0307412_10177169 Ga0307412_101771692 313
786 3300035692 Ga0373935_0244893 Ga0373935_0244893_65_1006 313
787 3300037068 Ga0373925_0406645 Ga0373925_0406645_30_971 313
788 3300037418 Ga0395900_0004025 Ga0395900_0004025_11228_12187 313
789 3300037471 Ga0395905_0002538 Ga0395905_0002538_11126_12085 313
790 3300038443 Ga0395901_0010310 Ga0395901_0010310_2758_3837 313
791 3300039437 Ga0436365_0648684 Ga0436365_0648684_11146_12087 313
792 3300039447 Ga0436361_0148410 Ga0436361_0148410_6186_7127 313
793 3300039453 Ga0436362_0072394 Ga0436362_0072394_88_1029 313
794 3300044658 Ga0466972_0125339 Ga0466972_0125339_179_1195 313
795 3300044684 Ga0466966_0031238 Ga0466966_0031238_1780_2721 313
796 3300044735 Ga0466968_0016062 Ga0466968_0016062_38_985 313
797 3300044842 Ga0466957_0000261 Ga0466957_0000261_9207_10148 313
798 3300045049 Ga0466959_0177961 Ga0466959_0177961_478_1419 313
799 3300046512 Ga0495610_0000250 Ga0495610_0000250_5847_6788 313
800 3300046519 Ga0495632_0000078 Ga0495632_0000078_93279_94244 313
801 3300047469 Ga0495673_0047182 Ga0495673_0047182_420_1361 313
802 3300047472 Ga0495686_0011858 Ga0495686_0011858_1998_2939 313
803 3300048903 Ga0496100_0033040 Ga0496100_0033040_1352_2293 313
804 3300048907 Ga0496104_0087727 Ga0496104_0087727_890_1831 313
805 3300048917 Ga0496114_0364924 Ga0496114_0364924_121_1080 313
806 3300048918 Ga0496115_0118077 Ga0496115_0118077_1111_2070 313
807 3300048919 Ga0496116_0000857 Ga0496116_0000857_19922_20941 313
808 3300048920 Ga0496117_0001218 Ga0496117_0001218_12041_13060 313
809 3300048920 Ga0496117_0042094 Ga0496117_0042094_1754_2695 313
810 3300048921 Ga0496118_0002447 Ga0496118_0002447_12279_13298 313
811 3300048923 Ga0496120_0001071 Ga0496120_0001071_27718_28797 313
812 3300048923 Ga0496120_0047971 Ga0496120_0047971_783_1724 313
813 3300048924 Ga0496121_0000216 Ga0496121_0000216_56317_57276 313
814 3300048924 Ga0496121_0048038 Ga0496121_0048038_1784_2725 313
815 3300048924 Ga0496121_0168806 Ga0496121_0168806_542_1561 313
816 3300048925 Ga0496122_0010072 Ga0496122_0010072_3577_4596 313
817 3300048925 Ga0496122_0019851 Ga0496122_0019851_3941_4882 313
818 3300048925 Ga0496122_0067529 Ga0496122_0067529_704_1645 313
819 3300048926 Ga0496123_0007711 Ga0496123_0007711_4866_5807 313
820 3300048926 Ga0496123_0013331 Ga0496123_0013331_2814_3833 313
821 3300048926 Ga0496123_0054797 Ga0496123_0054797_411_1352 313
822 3300048927 Ga0496124_0002465 Ga0496124_0002465_4069_5088 313
823 3300048927 Ga0496124_0144396 Ga0496124_0144396_227_1168 313
824 3300048927 Ga0496124_0150045 Ga0496124_0150045_789_1730 313
825 3300048928 Ga0496125_0013205 Ga0496125_0013205_3087_4028 313
826 3300048929 Ga0496126_0176205 Ga0496126_0176205_59_1000 313
827 3300048986 Ga0466983_0073864 Ga0466983_0073864_383_1324 313
828 3300049569 Ga0501032_0094992 Ga0501032_0094992_501_1532 313
829 3300049570 Ga0501033_0086527 Ga0501033_0086527_1035_2066 313
830 3300049571 Ga0501034_0084905 Ga0501034_0084905_1035_2066 313
831 3300049572 Ga0501036_0013996 Ga0501036_0013996_1219_2250 313
832 3300049573 Ga0501037_0029131 Ga0501037_0029131_2440_3471 313
833 3300049574 Ga0501038_0001324 Ga0501038_0001324_5530_6561 313
834 3300049575 Ga0501039_0009870 Ga0501039_0009870_210_1241 313
835 3300049579 Ga0501043_0132853 Ga0501043_0132853_229_1260 313
836 3300049580 Ga0501046_0012126 Ga0501046_0012126_94_1125 313
837 3300049582 Ga0501048_0152311 Ga0501048_0152311_191_1222 313
838 3300049583 Ga0501067_0007384 Ga0501067_0007384_4526_5557 313
839 3300049584 Ga0501068_0030388 Ga0501068_0030388_2093_3124 313
840 3300049585 Ga0501069_0002823 Ga0501069_0002823_1939_2970 313
841 3300049586 Ga0501070_0015461 Ga0501070_0015461_5139_6170 313
842 3300049589 Ga0501073_0010995 Ga0501073_0010995_568_1599 313
843 3300049590 Ga0501074_0172302 Ga0501074_0172302_208_1239 313
844 3300049741 Ga0501079_0073381 Ga0501079_0073381_19_1050 313
845 3300049742 Ga0501080_0008605 Ga0501080_0008605_1894_2925 313
846 3300049744 Ga0501083_0012781 Ga0501083_0012781_4638_5702 313
847 3300049744 Ga0501083_0034999 Ga0501083_0034999_681_1712 313
848 3300049822 Ga0501035_0005026 Ga0501035_0005026_6232_7263 313
849 3300049823 Ga0501044_0000197 Ga0501044_0000197_74830_75771 313
850 3300049823 Ga0501044_0017480 Ga0501044_0017480_2598_3629 313
851 3300050490 nmdc:mga03n38_15347_c1 nmdc:mga03n38_15347_c1_876_1826 313
852 3300050492 nmdc:mga0yw44_6122_c1 nmdc:mga0yw44_6122_c1_2118_3059 313
853 3300050494 nmdc:mga06z11_16947_c1 nmdc:mga06z11_16947_c1_1480_2430 313
854 3300050494 nmdc:mga06z11_27539_c1 nmdc:mga06z11_27539_c1_295_1236 313
855 3300053125 Ga0500618_018846 Ga0500618_018846_135_1076 313
856 3300054114 Ga0501084_0144285 Ga0501084_0144285_389_1420 313
857 iso_pu_bacteria 2595698237 2596375078 313
858 iso_pu_bacteria 2902330777 2902335428 313
859 iso_pu_bacteria 2902405164 2902409518 313
860 iso_pu_bacteria 2928125067 2928126426 313
861 2162886007 SwRhRL2b_contig_2703748 SwRhRL2b_0919.00000720 314
862 2162886007 SwRhRL2b_contig_507962 SwRhRL2b_0297.00003340 314
863 3300001979 JGI24740J21852_10000099 JGI24740J21852_1000009926 314
864 3300001979 JGI24740J21852_10032415 JGI24740J21852_100324152 314
865 3300002704 JGI25155J39150_1000027 JGI25155J39150_100002775 314
866 3300002705 JGI25156J39149_1000008 JGI25156J39149_100000850 314
867 3300002705 JGI25156J39149_1001201 JGI25156J39149_100120111 314
868 3300002705 JGI25156J39149_1001580 JGI25156J39149_10015809 314
869 3300002737 JGI25162J39368_1000074 JGI25162J39368_100007437 314
870 3300002738 JGI25154J39366_1000050 JGI25154J39366_100005075 314
871 3300002741 JGI25157J39369_1000028 JGI25157J39369_100002850 314
872 3300002741 JGI25157J39369_1000767 JGI25157J39369_10007675 314
873 3300003214 JGI25165J46597_1000201 JGI25165J46597_100020178 314
874 3300003214 JGI25165J46597_1001615 JGI25165J46597_10016154 314
875 3300003316 rootH1_10002623 rootH1_100026236 314
876 3300003320 rootH2_10051550 rootH2_100515507 314
877 3300003323 rootH1_10046512 rootH1_100465122 314
878 3300003756 Ga0055533_1000070 Ga0055533_1000070147 314
879 3300003758 Ga0055532_1000011 Ga0055532_1000011228 314
880 3300003760 Ga0055527_1000009 Ga0055527_1000009227 314
881 3300003761 Ga0055535_1000008 Ga0055535_1000008141 314
882 3300003762 Ga0055542_1000014 Ga0055542_1000014141 314
883 3300003762 Ga0055542_1001483 Ga0055542_10014835 314
884 3300003763 Ga0055529_1000010 Ga0055529_1000010141 314
885 3300003771 Ga0055526_1000209 Ga0055526_100020924 314
886 3300003791 Ga0055530_10000534 Ga0055530_1000053426 314
887 3300003792 Ga0055540_1000042 Ga0055540_1000042136 314
888 3300003794 Ga0055531_10000002 Ga0055531_10000002247 314
889 3300003794 Ga0055531_10003120 Ga0055531_100031206 314
890 3300005289 Ga0065704_10002196 Ga0065704_100021962 314
891 3300005289 Ga0065704_10071779 Ga0065704_100717795 314
892 3300005347 Ga0070668_100013859 Ga0070668_1000138593 314
893 3300005355 Ga0070671_100355327 Ga0070671_1003553272 314
894 3300005563 Ga0068855_100126350 Ga0068855_1001263502 314
895 3300005614 Ga0068856_100005571 Ga0068856_1000055717 314
896 3300006038 Ga0075365_10212790 Ga0075365_102127901 314
897 3300006048 Ga0075363_100031537 Ga0075363_1000315372 314
898 3300006177 Ga0075362_10021049 Ga0075362_100210492 314
899 3300006178 Ga0075367_10004732 Ga0075367_100047323 314
900 3300006178 Ga0075367_10064999 Ga0075367_100649992 314
901 3300006186 Ga0075369_10015202 Ga0075369_100152022 314
902 3300009036 Ga0105244_10003371 Ga0105244_100033715 314
903 3300009036 Ga0105244_10004115 Ga0105244_100041154 314
904 3300009093 Ga0105240_10207805 Ga0105240_102078053 314
905 3300009551 Ga0105238_10412598 Ga0105238_104125981 314
906 3300010375 Ga0105239_10196744 Ga0105239_101967442 314
907 3300010375 Ga0105239_10316980 Ga0105239_103169802 314
908 3300013105 Ga0157369_10530863 Ga0157369_105308631 314
909 3300013296 Ga0157374_10287320 Ga0157374_102873203 314
910 3300014497 Ga0182008_10016440 Ga0182008_100164402 314
911 3300015261 Ga0182006_1000257 Ga0182006_100025716 314
912 3300015262 Ga0182007_10051204 Ga0182007_100512042 314
913 3300015265 Ga0182005_1000016 Ga0182005_1000016169 314
914 3300021320 Ga0214544_1000130 Ga0214544_100013027 314
915 3300021321 Ga0214542_1000014 Ga0214542_100001438 314
916 3300021321 Ga0214542_1008629 Ga0214542_10086295 314
917 3300021327 Ga0214543_1000018 Ga0214543_100001879 314
918 3300021327 Ga0214543_1000146 Ga0214543_100014638 314
919 3300022739 Ga0228711_1000005 Ga0228711_1000005158 314
920 3300022740 Ga0228710_1000141 Ga0228710_100014118 314
921 3300025206 Ga0209435_100020 Ga0209435_10002049 314
922 3300025226 Ga0209674_100011 Ga0209674_100011687 314
923 3300025228 Ga0209672_100002 Ga0209672_100002680 314
924 3300025229 Ga0209147_100003 Ga0209147_100003680 314
925 3300025230 Ga0209563_101714 Ga0209563_1017143 314
926 3300025233 Ga0209437_100067 Ga0209437_10006781 314
927 3300025233 Ga0209437_100104 Ga0209437_100104134 314
928 3300025242 Ga0209258_100005 Ga0209258_100005322 314
929 3300025245 Ga0207425_1000170 Ga0207425_10001705 314
930 3300025246 Ga0209646_1000070 Ga0209646_100007049 314
931 3300025246 Ga0209646_1005987 Ga0209646_10059873 314
932 3300025246 Ga0209646_1007551 Ga0209646_10075512 314
933 3300025250 Ga0209026_1000057 Ga0209026_1000057173 314
934 3300025250 Ga0209026_1000116 Ga0209026_100011622 314
935 3300025254 Ga0209148_1000006 Ga0209148_1000006680 314
936 3300025254 Ga0209148_1001181 Ga0209148_10011815 314
937 3300025256 Ga0209759_1000006 Ga0209759_1000006318 314
938 3300025256 Ga0209759_1000047 Ga0209759_1000047173 314
939 3300025256 Ga0209759_1000153 Ga0209759_1000153101 314
940 3300025261 Ga0209233_1000018 Ga0209233_1000018668 314
941 3300025261 Ga0209233_1000088 Ga0209233_100008881 314
942 3300025272 Ga0209455_1000003 Ga0209455_1000003680 314
943 3300025272 Ga0209455_1001297 Ga0209455_10012975 314
944 3300025294 Ga0209025_1003982 Ga0209025_100398213 314
945 3300025294 Ga0209025_1004669 Ga0209025_10046698 314
946 3300025294 Ga0209025_1044062 Ga0209025_10440622 314
947 3300025295 Ga0209564_1000027 Ga0209564_1000027193 314
948 3300025297 Ga0209758_1000394 Ga0209758_100039420 314
949 3300025297 Ga0209758_1017152 Ga0209758_10171522 314
950 3300025298 Ga0209050_1003209 Ga0209050_100320910 314
951 3300025298 Ga0209050_1007519 Ga0209050_10075193 314
952 3300025303 Ga0209051_1000004 Ga0209051_1000004728 314
953 3300025303 Ga0209051_1009286 Ga0209051_10092865 314
954 3300025304 Ga0209257_1000049 Ga0209257_1000049282 314
955 3300025304 Ga0209257_1000063 Ga0209257_1000063214 314
956 3300025304 Ga0209257_1009223 Ga0209257_10092232 314
957 3300025711 Ga0207696_1000010 Ga0207696_1000010270 314
958 3300025711 Ga0207696_1017973 Ga0207696_10179733 314
959 3300025728 Ga0207655_1002486 Ga0207655_100248612 314
960 3300025728 Ga0207655_1007210 Ga0207655_10072102 314
961 3300025728 Ga0207655_1048845 Ga0207655_10488452 314
962 3300025735 Ga0207713_1004456 Ga0207713_100445612 314
963 3300025735 Ga0207713_1018782 Ga0207713_10187825 314
964 3300025904 Ga0207647_10006270 Ga0207647_100062708 314
965 3300025913 Ga0207695_10189141 Ga0207695_101891412 314
966 3300025919 Ga0207657_10111346 Ga0207657_101113462 314
967 3300025931 Ga0207644_10382862 Ga0207644_103828621 314
968 3300025935 Ga0207709_10143029 Ga0207709_101430292 314
969 3300025972 Ga0207668_10042064 Ga0207668_100420642 314
970 3300025972 Ga0207668_10438330 Ga0207668_104383301 314
971 3300026041 Ga0207639_10185651 Ga0207639_101856512 314
972 3300026067 Ga0207678_10446914 Ga0207678_104469141 314
973 3300027111 Ga0209281_1000111 Ga0209281_1000111158 314
974 3300027111 Ga0209281_1000185 Ga0209281_100018568 314
975 3300027111 Ga0209281_1010652 Ga0209281_10106522 314
976 3300027312 Ga0209371_1005132 Ga0209371_10051323 314
977 3300027666 Ga0209282_1000012 Ga0209282_1000012158 314
978 3300030500 Ga0268256_1003987 Ga0268256_10039875 314
979 3300031548 Ga0307408_100000964 Ga0307408_10000096411 314
980 3300031548 Ga0307408_100200897 Ga0307408_1002008972 314
981 3300031852 Ga0307410_10052825 Ga0307410_100528251 314
982 3300031903 Ga0307407_10320645 Ga0307407_103206451 314
983 3300031911 Ga0307412_10086938 Ga0307412_100869382 314
984 3300031967 Ga0315914_1000007 Ga0315914_100000756 314
985 3300031995 Ga0307409_100147664 Ga0307409_1001476642 314
986 3300032004 Ga0307414_10317469 Ga0307414_103174691 314
987 3300032126 Ga0307415_100023316 Ga0307415_1000233162 314
988 3300032126 Ga0307415_100100310 Ga0307415_1001003101 314
989 3300033430 Ga0315913_1000003 Ga0315913_1000003158 314
990 3300033464 Ga0315915_1000011 Ga0315915_100001156 314
991 3300037312 Ga0395899_0041664 Ga0395899_0041664_874_1821 314
992 3300037466 Ga0395898_0027682 Ga0395898_0027682_3936_4883 314
993 3300037471 Ga0395905_0001781 Ga0395905_0001781_15720_16694 314
994 3300037471 Ga0395905_0017230 Ga0395905_0017230_373_1320 314
995 3300038443 Ga0395901_0000004 Ga0395901_0000004_426190_427137 314
996 3300038443 Ga0395901_0016229 Ga0395901_0016229_5175_6122 314
997 3300041443 Ga0451789_0984162 Ga0451789_0984162_14_976 314
998 3300042007 Ga0439449_0019179 Ga0439449_0019179_1546_2508 314
999 3300044656 Ga0466969_0000044 Ga0466969_0000044_32859_33803 314
1000 3300044658 Ga0466972_0046804 Ga0466972_0046804_283_1227 314
1001 3300044659 Ga0466973_0046713 Ga0466973_0046713_1194_2138 314
1002 3300044683 Ga0466965_0000720 Ga0466965_0000720_1095_2039 314
1003 3300044693 Ga0466961_0000032 Ga0466961_0000032_82217_83161 314
1004 3300044719 Ga0466971_0009600 Ga0466971_0009600_72_1016 314
1005 3300044842 Ga0466957_0002377 Ga0466957_0002377_5228_6172 314
1006 3300044901 Ga0466960_0100614 Ga0466960_0100614_215_1177 314
1007 3300046452 Ga0495617_000032 Ga0495617_000032_14069_15013 314
1008 3300046454 Ga0495592_0022194 Ga0495592_0022194_422_1366 314
1009 3300046459 Ga0495629_0058774 Ga0495629_0058774_925_1869 314
1010 3300046460 Ga0495638_0095099 Ga0495638_0095099_467_1411 314
1011 3300046463 Ga0495653_0004452 Ga0495653_0004452_9428_10372 314
1012 3300046471 Ga0495650_0000100 Ga0495650_0000100_205695_206639 314
1013 3300046471 Ga0495650_0000251 Ga0495650_0000251_28477_29421 314
1014 3300046471 Ga0495650_0005160 Ga0495650_0005160_2139_3083 314
1015 3300046473 Ga0495582_0051801 Ga0495582_0051801_89_1033 314
1016 3300046474 Ga0495605_0000097 Ga0495605_0000097_95738_96682 314
1017 3300046477 Ga0495664_0005352 Ga0495664_0005352_1775_2719 314
1018 3300046492 Ga0495585_0000630 Ga0495585_0000630_30275_31219 314
1019 3300046501 Ga0495607_0039900 Ga0495607_0039900_168_1112 314
1020 3300046506 Ga0495583_0053888 Ga0495583_0053888_111_1073 314
1021 3300046507 Ga0495606_0000770 Ga0495606_0000770_32591_33535 314
1022 3300046507 Ga0495606_0012937 Ga0495606_0012937_4642_5604 314
1023 3300046511 Ga0495608_0025978 Ga0495608_0025978_2912_3856 314
1024 3300046512 Ga0495610_0000017 Ga0495610_0000017_212385_213329 314
1025 3300046512 Ga0495610_0001418 Ga0495610_0001418_15640_16584 314
1026 3300046512 Ga0495610_0021874 Ga0495610_0021874_1925_2887 314
1027 3300046514 Ga0495618_0005072 Ga0495618_0005072_6120_7064 314
1028 3300046515 Ga0495620_0000002 Ga0495620_0000002_82574_83524 314
1029 3300046515 Ga0495620_0067005 Ga0495620_0067005_11_973 314
1030 3300046516 Ga0495628_0089220 Ga0495628_0089220_977_1921 314
1031 3300046516 Ga0495628_0111238 Ga0495628_0111238_337_1281 314
1032 3300046517 Ga0495630_0009126 Ga0495630_0009126_4870_5814 314
1033 3300046519 Ga0495632_0002448 Ga0495632_0002448_7520_8470 314
1034 3300046522 Ga0495643_0004116 Ga0495643_0004116_8125_9075 314
1035 3300046524 Ga0495648_0004429 Ga0495648_0004429_6412_7362 314
1036 3300046524 Ga0495648_0025679 Ga0495648_0025679_1377_2321 314
1037 3300046526 Ga0495666_0002377 Ga0495666_0002377_6419_7363 314
1038 3300046529 Ga0495652_0068039 Ga0495652_0068039_1572_2516 314
1039 3300046530 Ga0495654_0001095 Ga0495654_0001095_1889_2833 314
1040 3300046530 Ga0495654_0069058 Ga0495654_0069058_140_1102 314
1041 3300046531 Ga0495665_0004564 Ga0495665_0004564_5683_6627 314
1042 3300046533 Ga0495640_0006408 Ga0495640_0006408_2013_2957 314
1043 3300046535 Ga0495586_0020486 Ga0495586_0020486_627_1571 314
1044 3300046538 Ga0495609_0008920 Ga0495609_0008920_2201_3163 314
1045 3300046542 Ga0495597_0000153 Ga0495597_0000153_31101_32045 314
1046 3300046557 Ga0495622_0000017 Ga0495622_0000017_49126_50070 314
1047 3300046557 Ga0495622_0009536 Ga0495622_0009536_1536_2498 314
1048 3300046558 Ga0495633_0013478 Ga0495633_0013478_253_1197 314
1049 3300046616 Ga0495668_0000446 Ga0495668_0000446_43761_44705 314
1050 3300046616 Ga0495668_0000766 Ga0495668_0000766_6797_7741 314
1051 3300046642 Ga0495634_0016182 Ga0495634_0016182_98_1042 314
1052 3300046660 Ga0495625_0000303 Ga0495625_0000303_62195_63139 314
1053 3300046660 Ga0495625_0059278 Ga0495625_0059278_597_1559 314
1054 3300046660 Ga0495625_0081866 Ga0495625_0081866_846_1790 314
1055 3300046663 Ga0495635_0045810 Ga0495635_0045810_1199_2143 314
1056 3300046665 Ga0495661_0013740 Ga0495661_0013740_1246_2190 314
1057 3300046674 Ga0495588_0003777 Ga0495588_0003777_3946_4908 314
1058 3300046675 Ga0495657_0034251 Ga0495657_0034251_61_1005 314
1059 3300046679 Ga0495623_0000841 Ga0495623_0000841_5466_6410 314
1060 3300046679 Ga0495623_0005535 Ga0495623_0005535_5564_6508 314
1061 3300046680 Ga0495646_0003629 Ga0495646_0003629_7751_8695 314
1062 3300046690 Ga0495624_0027202 Ga0495624_0027202_2090_3034 314
1063 3300046692 Ga0495671_0000026 Ga0495671_0000026_31933_32877 314
1064 3300046810 Ga0495660_0005434 Ga0495660_0005434_206_1150 314
1065 3300046810 Ga0495660_0087732 Ga0495660_0087732_527_1489 314
1066 3300047315 Ga0495581_0001521 Ga0495581_0001521_7276_8220 314
1067 3300047317 Ga0495604_0002202 Ga0495604_0002202_8968_9912 314
1068 3300047317 Ga0495604_0012528 Ga0495604_0012528_360_1304 314
1069 3300047319 Ga0495674_0025702 Ga0495674_0025702_351_1295 314
1070 3300047319 Ga0495674_0118307 Ga0495674_0118307_352_1296 314
1071 3300047321 Ga0495676_0004531 Ga0495676_0004531_9629_10573 314
1072 3300047322 Ga0495680_0012135 Ga0495680_0012135_5581_6525 314
1073 3300047444 Ga0495675_0004609 Ga0495675_0004609_301_1245 314
1074 3300047444 Ga0495675_0005302 Ga0495675_0005302_68_1012 314
1075 3300047446 Ga0495679_026414 Ga0495679_026414_754_1698 314
1076 3300047469 Ga0495673_0000008 Ga0495673_0000008_245931_246875 314
1077 3300047469 Ga0495673_0000069 Ga0495673_0000069_13581_14525 314
1078 3300047472 Ga0495686_0003817 Ga0495686_0003817_1679_2623 314
1079 3300047673 Ga0495593_0015742 Ga0495593_0015742_2820_3764 314
1080 3300048088 Ga0495602_0014867 Ga0495602_0014867_820_1764 314
1081 3300048088 Ga0495602_0016763 Ga0495602_0016763_4873_5817 314
1082 3300048088 Ga0495602_0155740 Ga0495602_0155740_522_1466 314
1083 3300048089 Ga0495614_0000262 Ga0495614_0000262_6410_7354 314
1084 3300048905 Ga0496102_0214164 Ga0496102_0214164_311_1273 314
1085 3300048906 Ga0496103_0001333 Ga0496103_0001333_1782_2726 314
1086 3300048913 Ga0496110_0119215 Ga0496110_0119215_113_1075 314
1087 3300048917 Ga0496114_0145344 Ga0496114_0145344_621_1565 314
1088 3300048919 Ga0496116_0046769 Ga0496116_0046769_1251_2195 314
1089 3300048920 Ga0496117_0004699 Ga0496117_0004699_4644_5588 314
1090 3300048920 Ga0496117_0005079 Ga0496117_0005079_7863_8813 314
1091 3300048920 Ga0496117_0007592 Ga0496117_0007592_5348_6298 314
1092 3300048920 Ga0496117_0136717 Ga0496117_0136717_131_1093 314
1093 3300048921 Ga0496118_0005809 Ga0496118_0005809_4985_5935 314
1094 3300048921 Ga0496118_0007347 Ga0496118_0007347_7682_8626 314
1095 3300048922 Ga0496119_0043800 Ga0496119_0043800_31_993 314
1096 3300048924 Ga0496121_0003670 Ga0496121_0003670_6331_7275 314
1097 3300048924 Ga0496121_0056216 Ga0496121_0056216_1297_2259 314
1098 3300048924 Ga0496121_0198519 Ga0496121_0198519_372_1322 314
1099 3300048925 Ga0496122_0000072 Ga0496122_0000072_31723_32685 314
1100 3300048925 Ga0496122_0016896 Ga0496122_0016896_1885_2847 314
1101 3300048925 Ga0496122_0034800 Ga0496122_0034800_1287_2231 314
1102 3300048925 Ga0496122_0045223 Ga0496122_0045223_215_1228 314
1103 3300048925 Ga0496122_0046784 Ga0496122_0046784_1578_2540 314
1104 3300048925 Ga0496122_0095365 Ga0496122_0095365_244_1206 314
1105 3300048926 Ga0496123_0000035 Ga0496123_0000035_76575_77585 314
1106 3300048926 Ga0496123_0001276 Ga0496123_0001276_28627_29571 314
1107 3300048926 Ga0496123_0028324 Ga0496123_0028324_2131_3144 314
1108 3300048926 Ga0496123_0029082 Ga0496123_0029082_1995_2957 314
1109 3300048926 Ga0496123_0032177 Ga0496123_0032177_32_994 314
1110 3300048927 Ga0496124_0046464 Ga0496124_0046464_1352_2314 314
1111 3300048927 Ga0496124_0060506 Ga0496124_0060506_337_1299 314
1112 3300048927 Ga0496124_0120197 Ga0496124_0120197_967_1917 314
1113 3300048928 Ga0496125_0000083 Ga0496125_0000083_56276_57238 314
1114 3300048928 Ga0496125_0002616 Ga0496125_0002616_16964_17914 314
1115 3300048929 Ga0496126_0025397 Ga0496126_0025397_1255_2205 314
1116 3300048929 Ga0496126_0044235 Ga0496126_0044235_2120_3064 314
1117 3300048929 Ga0496126_0086052 Ga0496126_0086052_1734_2696 314
1118 3300048929 Ga0496126_0205637 Ga0496126_0205637_341_1303 314
1119 3300049572 Ga0501036_0051379 Ga0501036_0051379_155_1144 314
1120 3300049574 Ga0501038_0303248 Ga0501038_0303248_87_1085 314
1121 3300049575 Ga0501039_0014805 Ga0501039_0014805_135_1124 314
1122 3300049575 Ga0501039_0163374 Ga0501039_0163374_533_1564 314
1123 3300049576 Ga0501040_0040498 Ga0501040_0040498_2100_3098 314
1124 3300049577 Ga0501041_0002166 Ga0501041_0002166_9501_10499 314
1125 3300049579 Ga0501043_0034195 Ga0501043_0034195_1293_2318 314
1126 3300049580 Ga0501046_0086408 Ga0501046_0086408_710_1741 314
1127 3300049583 Ga0501067_0028994 Ga0501067_0028994_28_990 314
1128 3300049587 Ga0501071_0060221 Ga0501071_0060221_1669_2658 314
1129 3300049588 Ga0501072_0023777 Ga0501072_0023777_1391_2380 314
1130 3300049823 Ga0501044_0022584 Ga0501044_0022584_1862_2824 314
1131 3300049823 Ga0501044_0113390 Ga0501044_0113390_422_1453 314
1132 3300050489 nmdc:mga03683_90121_c1 nmdc:mga03683_90121_c1_283_1227 314
1133 3300050491 nmdc:mga00v17_23406_c1 nmdc:mga00v17_23406_c1_375_1337 314
1134 3300050492 nmdc:mga0yw44_5023_c1 nmdc:mga0yw44_5023_c1_4444_5406 314
1135 3300050492 nmdc:mga0yw44_60177_c1 nmdc:mga0yw44_60177_c1_153_1115 314
1136 3300050494 nmdc:mga06z11_130684_c1 nmdc:mga06z11_130684_c1_431_1393 314
1137 3300050494 nmdc:mga06z11_34263_c1 nmdc:mga06z11_34263_c1_339_1301 314
1138 3300050516 nmdc:mga0sz30_2467_c2 nmdc:mga0sz30_2467_c2_677_1639 314
1139 3300053140 Ga0500573_0101848 Ga0500573_0101848_271_1233 314
1140 3300053157 Ga0500624_000341 Ga0500624_000341_12111_13076 314
1141 3300053161 Ga0500634_0002225 Ga0500634_0002225_3074_4039 314
1142 3300054114 Ga0501084_0016873 Ga0501084_0016873_4870_5901 314
1143 3300061719 Ga0466962_0001725 Ga0466962_0001725_6121_7065 314
1144 iso_pu_bacteria 2508501122 2509109995 314
1145 2162886007 SwRhRL2b_contig_2672424 SwRhRL2b_0506.00001210 315
1146 2162886007 SwRhRL2b_contig_2894984 SwRhRL2b_0584.00005460 315
1147 3300002987 JGI25159J45721_1004247 JGI25159J45721_10042475 315
1148 3300003752 Ga0055539_1000011 Ga0055539_1000011282 315
1149 3300003756 Ga0055533_1000014 Ga0055533_1000014282 315
1150 3300003758 Ga0055532_1000009 Ga0055532_1000009282 315
1151 3300003759 Ga0055525_1000016 Ga0055525_1000016282 315
1152 3300003781 Ga0055536_1000013 Ga0055536_100001339 315
1153 3300003781 Ga0055536_1000035 Ga0055536_1000035135 315
1154 3300003791 Ga0055530_10000212 Ga0055530_100002122 315
1155 3300003792 Ga0055540_1000008 Ga0055540_100000887 315
1156 3300003794 Ga0055531_10000150 Ga0055531_1000015046 315
1157 3300003841 Ga0055541_1000008 Ga0055541_1000008282 315
1158 3300005262 Ga0065165_1000362 Ga0065165_100036251 315
1159 3300005288 Ga0065714_10064524 Ga0065714_100645245 315
1160 3300005331 Ga0070670_100000837 Ga0070670_1000008375 315
1161 3300005353 Ga0070669_100001853 Ga0070669_10000185313 315
1162 3300005457 Ga0070662_100005634 Ga0070662_1000056345 315
1163 3300005564 Ga0070664_100000861 Ga0070664_10000086120 315
1164 3300005564 Ga0070664_100131815 Ga0070664_1001318152 315
1165 3300005834 Ga0068851_10012475 Ga0068851_100124753 315
1166 3300006051 Ga0075364_10101485 Ga0075364_101014851 315
1167 3300006058 Ga0075432_10014173 Ga0075432_100141732 315
1168 3300006944 Ga0099823_1000102 Ga0099823_100010227 315
1169 3300006946 Ga0079104_1002790 Ga0079104_10027909 315
1170 3300009011 Ga0105251_10000476 Ga0105251_100004763 315
1171 3300009011 Ga0105251_10000877 Ga0105251_1000087722 315
1172 3300009011 Ga0105251_10001557 Ga0105251_100015574 315
1173 3300009011 Ga0105251_10013303 Ga0105251_100133033 315
1174 3300009036 Ga0105244_10003390 Ga0105244_100033902 315
1175 3300009036 Ga0105244_10006154 Ga0105244_100061542 315
1176 3300009036 Ga0105244_10007082 Ga0105244_100070825 315
1177 3300009036 Ga0105244_10009624 Ga0105244_100096244 315
1178 3300009036 Ga0105244_10010494 Ga0105244_100104944 315
1179 3300009036 Ga0105244_10016205 Ga0105244_100162053 315
1180 3300009036 Ga0105244_10033265 Ga0105244_100332653 315
1181 3300009036 Ga0105244_10047099 Ga0105244_100470992 315
1182 3300009092 Ga0105250_10000041 Ga0105250_100000413 315
1183 3300009092 Ga0105250_10000155 Ga0105250_1000015517 315
1184 3300009092 Ga0105250_10003365 Ga0105250_100033655 315
1185 3300009092 Ga0105250_10054190 Ga0105250_100541901 315
1186 3300009148 Ga0105243_10000736 Ga0105243_1000073618 315
1187 3300009176 Ga0105242_10016807 Ga0105242_100168072 315
1188 3300009545 Ga0105237_10004461 Ga0105237_100044618 315
1189 3300011119 Ga0105246_10000357 Ga0105246_1000035721 315
1190 3300011119 Ga0105246_10000699 Ga0105246_100006993 315
1191 3300012498 Ga0157345_1000001 Ga0157345_1000001110 315
1192 3300013100 Ga0157373_10000039 Ga0157373_1000003932 315
1193 3300013100 Ga0157373_10000193 Ga0157373_1000019343 315
1194 3300013100 Ga0157373_10000225 Ga0157373_1000022546 315
1195 3300013100 Ga0157373_10047616 Ga0157373_100476162 315
1196 3300013100 Ga0157373_10093927 Ga0157373_100939272 315
1197 3300013102 Ga0157371_10000262 Ga0157371_1000026220 315
1198 3300013102 Ga0157371_10014295 Ga0157371_100142956 315
1199 3300013102 Ga0157371_10140454 Ga0157371_101404542 315
1200 3300013104 Ga0157370_10019164 Ga0157370_100191645 315
1201 3300013104 Ga0157370_10070977 Ga0157370_100709772 315
1202 3300013104 Ga0157370_10282385 Ga0157370_102823852 315
1203 3300013105 Ga0157369_10000236 Ga0157369_1000023615 315
1204 3300013105 Ga0157369_10001402 Ga0157369_100014028 315
1205 3300013105 Ga0157369_10005269 Ga0157369_1000526910 315
1206 3300013105 Ga0157369_10016893 Ga0157369_100168932 315
1207 3300013105 Ga0157369_10079725 Ga0157369_100797252 315
1208 3300013306 Ga0163162_10000392 Ga0163162_1000039218 315
1209 3300013308 Ga0157375_10000139 Ga0157375_1000013932 315
1210 3300013308 Ga0157375_10002380 Ga0157375_100023803 315
1211 3300013308 Ga0157375_10087900 Ga0157375_100879002 315
1212 3300014497 Ga0182008_10000202 Ga0182008_1000020240 315
1213 3300014497 Ga0182008_10002912 Ga0182008_100029126 315
1214 3300014497 Ga0182008_10052400 Ga0182008_100524002 315
1215 3300015261 Ga0182006_1000107 Ga0182006_100010751 315
1216 3300015261 Ga0182006_1000654 Ga0182006_100065418 315
1217 3300015262 Ga0182007_10000237 Ga0182007_1000023731 315
1218 3300017792 Ga0163161_10000066 Ga0163161_1000006688 315
1219 3300017792 Ga0163161_10092213 Ga0163161_100922132 315
1220 3300025206 Ga0209435_102302 Ga0209435_1023022 315
1221 3300025224 Ga0209784_100023 Ga0209784_100023276 315
1222 3300025225 Ga0209566_100019 Ga0209566_100019289 315
1223 3300025226 Ga0209674_100034 Ga0209674_100034289 315
1224 3300025229 Ga0209147_100027 Ga0209147_100027291 315
1225 3300025230 Ga0209563_100037 Ga0209563_100037289 315
1226 3300025230 Ga0209563_100549 Ga0209563_10054912 315
1227 3300025242 Ga0209258_100520 Ga0209258_1005203 315
1228 3300025246 Ga0209646_1000110 Ga0209646_1000110105 315
1229 3300025253 Ga0209677_100021 Ga0209677_100021289 315
1230 3300025284 Ga0209130_1000226 Ga0209130_100022620 315
1231 3300025291 Ga0209675_1002774 Ga0209675_10027742 315
1232 3300025292 Ga0209676_1000002 Ga0209676_10000021484 315
1233 3300025292 Ga0209676_1000020 Ga0209676_1000020409 315
1234 3300025292 Ga0209676_1026670 Ga0209676_10266702 315
1235 3300025294 Ga0209025_1000696 Ga0209025_100069639 315
1236 3300025294 Ga0209025_1038943 Ga0209025_10389431 315
1237 3300025298 Ga0209050_1000006 Ga0209050_100000687 315
1238 3300025298 Ga0209050_1001073 Ga0209050_10010737 315
1239 3300025303 Ga0209051_1000001 Ga0209051_10000011484 315
1240 3300025303 Ga0209051_1012669 Ga0209051_10126693 315
1241 3300025304 Ga0209257_1000029 Ga0209257_100002987 315
1242 3300025321 Ga0207656_10016481 Ga0207656_100164813 315
1243 3300025711 Ga0207696_1000010 Ga0207696_1000010104 315
1244 3300025711 Ga0207696_1000011 Ga0207696_100001138 315
1245 3300025711 Ga0207696_1000223 Ga0207696_100022346 315
1246 3300025711 Ga0207696_1000844 Ga0207696_10008442 315
1247 3300025711 Ga0207696_1002071 Ga0207696_10020719 315
1248 3300025728 Ga0207655_1000074 Ga0207655_1000074147 315
1249 3300025728 Ga0207655_1000076 Ga0207655_1000076219 315
1250 3300025728 Ga0207655_1000151 Ga0207655_100015186 315
1251 3300025728 Ga0207655_1003611 Ga0207655_10036112 315
1252 3300025728 Ga0207655_1006716 Ga0207655_10067162 315
1253 3300025728 Ga0207655_1009340 Ga0207655_10093404 315
1254 3300025728 Ga0207655_1009732 Ga0207655_10097325 315
1255 3300025728 Ga0207655_1010724 Ga0207655_10107243 315
1256 3300025728 Ga0207655_1015029 Ga0207655_10150293 315
1257 3300025728 Ga0207655_1018673 Ga0207655_10186732 315
1258 3300025735 Ga0207713_1000061 Ga0207713_100006169 315
1259 3300025735 Ga0207713_1000131 Ga0207713_100013129 315
1260 3300025735 Ga0207713_1000143 Ga0207713_100014363 315
1261 3300025735 Ga0207713_1001052 Ga0207713_100105217 315
1262 3300025735 Ga0207713_1002396 Ga0207713_10023968 315
1263 3300025735 Ga0207713_1004346 Ga0207713_10043467 315
1264 3300025735 Ga0207713_1004727 Ga0207713_10047276 315
1265 3300025735 Ga0207713_1010956 Ga0207713_10109562 315
1266 3300025735 Ga0207713_1024822 Ga0207713_10248221 315
1267 3300025914 Ga0207671_10009655 Ga0207671_100096553 315
1268 3300025920 Ga0207649_10000954 Ga0207649_1000095415 315
1269 3300025923 Ga0207681_10000430 Ga0207681_1000043028 315
1270 3300025923 Ga0207681_10009773 Ga0207681_100097733 315
1271 3300025925 Ga0207650_10001314 Ga0207650_100013146 315
1272 3300025925 Ga0207650_10001731 Ga0207650_100017316 315
1273 3300025933 Ga0207706_10035244 Ga0207706_100352442 315
1274 3300025934 Ga0207686_10020157 Ga0207686_100201573 315
1275 3300025935 Ga0207709_10000565 Ga0207709_1000056518 315
1276 3300025935 Ga0207709_10006707 Ga0207709_100067073 315
1277 3300025935 Ga0207709_10007302 Ga0207709_100073022 315
1278 3300025945 Ga0207679_10000097 Ga0207679_1000009763 315
1279 3300025981 Ga0207640_10079434 Ga0207640_100794342 315
1280 3300027111 Ga0209281_1003108 Ga0209281_10031082 315
1281 3300027296 Ga0209389_1000209 Ga0209389_100020916 315
1282 3300027312 Ga0209371_1018713 Ga0209371_10187132 315
1283 3300027907 Ga0207428_10011547 Ga0207428_100115475 315
1284 3300028786 Ga0307517_10184945 Ga0307517_101849452 315
1285 3300030500 Ga0268256_1020963 Ga0268256_10209632 315
1286 3300030734 Ga0316179_1023760 Ga0316179_10237602 315
1287 3300030735 Ga0316178_1120627 Ga0316178_11206278 315
1288 3300031507 Ga0307509_10292339 Ga0307509_102923392 315
1289 3300031548 Ga0307408_100053314 Ga0307408_1000533142 315
1290 3300031911 Ga0307412_10003494 Ga0307412_100034943 315
1291 3300031911 Ga0307412_10050430 Ga0307412_100504303 315
1292 3300031911 Ga0307412_10244725 Ga0307412_102447252 315
1293 3300031995 Ga0307409_100600789 Ga0307409_1006007891 315
1294 3300032005 Ga0307411_10005341 Ga0307411_100053413 315
1295 3300033180 Ga0307510_10001036 Ga0307510_1000103614 315
1296 3300041405 Ga0439438_000367 Ga0439438_000367_17765_18712 315
1297 3300041405 Ga0439438_001742 Ga0439438_001742_6498_7445 315
1298 3300041405 Ga0439438_005658 Ga0439438_005658_1579_2526 315
1299 3300041407 Ga0439447_000821 Ga0439447_000821_6469_7416 315
1300 3300041411 Ga0439466_0004223 Ga0439466_0004223_1193_2140 315
1301 3300041411 Ga0439466_0011487 Ga0439466_0011487_1510_2457 315
1302 3300041411 Ga0439466_0038793 Ga0439466_0038793_198_1157 315
1303 3300042006 Ga0439432_000016 Ga0439432_000016_31027_31974 315
1304 3300042006 Ga0439432_002483 Ga0439432_002483_5854_6801 315
1305 3300042006 Ga0439432_011051 Ga0439432_011051_1494_2441 315
1306 3300042010 Ga0439452_000046 Ga0439452_000046_100289_101236 315
1307 3300042010 Ga0439452_000081 Ga0439452_000081_54733_55680 315
1308 3300042010 Ga0439452_009073 Ga0439452_009073_1612_2559 315
1309 3300042115 Ga0450911_000010 Ga0450911_000010_135978_136925 315
1310 3300042115 Ga0450911_001511 Ga0450911_001511_1738_2685 315
1311 3300042145 Ga0450906_000089 Ga0450906_000089_1446_2393 315
1312 3300042147 Ga0450910_003545 Ga0450910_003545_505_1452 315
1313 3300044693 Ga0466961_0000318 Ga0466961_0000318_13431_14390 315
1314 3300045836 Ga0466958_0009268 Ga0466958_0009268_3674_4633 315
1315 3300046452 Ga0495617_000379 Ga0495617_000379_19785_20732 315
1316 3300046453 Ga0495627_000101 Ga0495627_000101_5202_6149 315
1317 3300046453 Ga0495627_000542 Ga0495627_000542_12701_13648 315
1318 3300046453 Ga0495627_003724 Ga0495627_003724_5201_6148 315
1319 3300046454 Ga0495592_0016134 Ga0495592_0016134_4318_5265 315
1320 3300046458 Ga0495591_000032 Ga0495591_000032_83537_84484 315
1321 3300046458 Ga0495591_000082 Ga0495591_000082_8356_9303 315
1322 3300046458 Ga0495591_000276 Ga0495591_000276_17740_18687 315
1323 3300046458 Ga0495591_000801 Ga0495591_000801_14127_15074 315
1324 3300046458 Ga0495591_007727 Ga0495591_007727_1983_2930 315
1325 3300046458 Ga0495591_017828 Ga0495591_017828_1460_2407 315
1326 3300046460 Ga0495638_0001204 Ga0495638_0001204_8926_9873 315
1327 3300046460 Ga0495638_0009547 Ga0495638_0009547_1716_2663 315
1328 3300046460 Ga0495638_0010113 Ga0495638_0010113_1794_2741 315
1329 3300046460 Ga0495638_0016398 Ga0495638_0016398_1459_2406 315
1330 3300046460 Ga0495638_0019474 Ga0495638_0019474_2239_3186 315
1331 3300046463 Ga0495653_0006325 Ga0495653_0006325_5173_6120 315
1332 3300046463 Ga0495653_0013191 Ga0495653_0013191_2809_3756 315
1333 3300046471 Ga0495650_0001410 Ga0495650_0001410_11396_12343 315
1334 3300046471 Ga0495650_0025246 Ga0495650_0025246_352_1299 315
1335 3300046471 Ga0495650_0032572 Ga0495650_0032572_43_990 315
1336 3300046474 Ga0495605_0000670 Ga0495605_0000670_2275_3222 315
1337 3300046474 Ga0495605_0002687 Ga0495605_0002687_338_1285 315
1338 3300046491 Ga0495584_0000739 Ga0495584_0000739_1572_2519 315
1339 3300046491 Ga0495584_0003170 Ga0495584_0003170_5088_6035 315
1340 3300046492 Ga0495585_0000120 Ga0495585_0000120_18864_19811 315
1341 3300046492 Ga0495585_0001431 Ga0495585_0001431_9125_10072 315
1342 3300046492 Ga0495585_0068095 Ga0495585_0068095_145_1092 315
1343 3300046501 Ga0495607_0000259 Ga0495607_0000259_20084_21031 315
1344 3300046501 Ga0495607_0000517 Ga0495607_0000517_27972_28919 315
1345 3300046501 Ga0495607_0002064 Ga0495607_0002064_10672_11619 315
1346 3300046501 Ga0495607_0004919 Ga0495607_0004919_129_1076 315
1347 3300046506 Ga0495583_0000131 Ga0495583_0000131_34631_35578 315
1348 3300046506 Ga0495583_0000923 Ga0495583_0000923_32053_33000 315
1349 3300046507 Ga0495606_0000339 Ga0495606_0000339_31645_32592 315
1350 3300046507 Ga0495606_0000656 Ga0495606_0000656_43722_44669 315
1351 3300046507 Ga0495606_0001326 Ga0495606_0001326_20199_21146 315
1352 3300046507 Ga0495606_0002444 Ga0495606_0002444_1441_2388 315
1353 3300046507 Ga0495606_0007864 Ga0495606_0007864_4353_5300 315
1354 3300046507 Ga0495606_0028028 Ga0495606_0028028_56_1003 315
1355 3300046512 Ga0495610_0000264 Ga0495610_0000264_38785_39732 315
1356 3300046512 Ga0495610_0000359 Ga0495610_0000359_5790_6737 315
1357 3300046512 Ga0495610_0002374 Ga0495610_0002374_9087_10034 315
1358 3300046512 Ga0495610_0011355 Ga0495610_0011355_1891_2838 315
1359 3300046512 Ga0495610_0018718 Ga0495610_0018718_402_1349 315
1360 3300046512 Ga0495610_0056236 Ga0495610_0056236_279_1226 315
1361 3300046513 Ga0495616_0000041 Ga0495616_0000041_112384_113331 315
1362 3300046513 Ga0495616_0000203 Ga0495616_0000203_12899_13867 315
1363 3300046513 Ga0495616_0000454 Ga0495616_0000454_1552_2499 315
1364 3300046513 Ga0495616_0000615 Ga0495616_0000615_17168_18115 315
1365 3300046515 Ga0495620_0000002 Ga0495620_0000002_289670_290617 315
1366 3300046515 Ga0495620_0000021 Ga0495620_0000021_20980_21927 315
1367 3300046515 Ga0495620_0000646 Ga0495620_0000646_4412_5359 315
1368 3300046515 Ga0495620_0007292 Ga0495620_0007292_4181_5128 315
1369 3300046518 Ga0495631_0000419 Ga0495631_0000419_18639_19586 315
1370 3300046519 Ga0495632_0000097 Ga0495632_0000097_80659_81606 315
1371 3300046519 Ga0495632_0010930 Ga0495632_0010930_2063_3010 315
1372 3300046519 Ga0495632_0043881 Ga0495632_0043881_920_1867 315
1373 3300046520 Ga0495637_0000621 Ga0495637_0000621_8640_9587 315
1374 3300046520 Ga0495637_0000888 Ga0495637_0000888_1830_2777 315
1375 3300046520 Ga0495637_0012376 Ga0495637_0012376_2769_3716 315
1376 3300046520 Ga0495637_0035989 Ga0495637_0035989_542_1489 315
1377 3300046522 Ga0495643_0000583 Ga0495643_0000583_5497_6444 315
1378 3300046522 Ga0495643_0000660 Ga0495643_0000660_27094_28041 315
1379 3300046524 Ga0495648_0000408 Ga0495648_0000408_28844_29791 315
1380 3300046524 Ga0495648_0002220 Ga0495648_0002220_17199_18146 315
1381 3300046524 Ga0495648_0002382 Ga0495648_0002382_8700_9647 315
1382 3300046524 Ga0495648_0017564 Ga0495648_0017564_4003_4950 315
1383 3300046524 Ga0495648_0021429 Ga0495648_0021429_3183_4130 315
1384 3300046524 Ga0495648_0026292 Ga0495648_0026292_2940_3887 315
1385 3300046526 Ga0495666_0004817 Ga0495666_0004817_4425_5372 315
1386 3300046530 Ga0495654_0000050 Ga0495654_0000050_113281_114228 315
1387 3300046530 Ga0495654_0000059 Ga0495654_0000059_46187_47134 315
1388 3300046530 Ga0495654_0013011 Ga0495654_0013011_3480_4427 315
1389 3300046530 Ga0495654_0014574 Ga0495654_0014574_3114_4061 315
1390 3300046530 Ga0495654_0018496 Ga0495654_0018496_1643_2590 315
1391 3300046530 Ga0495654_0060775 Ga0495654_0060775_843_1790 315
1392 3300046536 Ga0495587_0004755 Ga0495587_0004755_4508_5455 315
1393 3300046538 Ga0495609_0000504 Ga0495609_0000504_21809_22756 315
1394 3300046538 Ga0495609_0000648 Ga0495609_0000648_8546_9493 315
1395 3300046542 Ga0495597_0000117 Ga0495597_0000117_9106_10053 315
1396 3300046543 Ga0495645_0018745 Ga0495645_0018745_2512_3459 315
1397 3300046557 Ga0495622_0000420 Ga0495622_0000420_17618_18565 315
1398 3300046557 Ga0495622_0005699 Ga0495622_0005699_4413_5360 315
1399 3300046558 Ga0495633_0000556 Ga0495633_0000556_26580_27527 315
1400 3300046616 Ga0495668_0006587 Ga0495668_0006587_6585_7532 315
1401 3300046642 Ga0495634_0000551 Ga0495634_0000551_10998_11945 315
1402 3300046642 Ga0495634_0008216 Ga0495634_0008216_4950_5897 315
1403 3300046648 Ga0495611_0000024 Ga0495611_0000024_15019_15966 315
1404 3300046648 Ga0495611_0033788 Ga0495611_0033788_28_975 315
1405 3300046660 Ga0495625_0000103 Ga0495625_0000103_8396_9343 315
1406 3300046660 Ga0495625_0000861 Ga0495625_0000861_4635_5582 315
1407 3300046660 Ga0495625_0022301 Ga0495625_0022301_277_1224 315
1408 3300046663 Ga0495635_0000203 Ga0495635_0000203_23325_24272 315
1409 3300046665 Ga0495661_0000085 Ga0495661_0000085_12082_13029 315
1410 3300046674 Ga0495588_0063831 Ga0495588_0063831_316_1263 315
1411 3300046678 Ga0495599_0173791 Ga0495599_0173791_286_1233 315
1412 3300046680 Ga0495646_0001184 Ga0495646_0001184_12272_13219 315
1413 3300046680 Ga0495646_0024322 Ga0495646_0024322_56_1003 315
1414 3300046689 Ga0495613_0004522 Ga0495613_0004522_908_1855 315
1415 3300046690 Ga0495624_0001661 Ga0495624_0001661_5183_6130 315
1416 3300046691 Ga0495670_0000020 Ga0495670_0000020_99979_100926 315
1417 3300046692 Ga0495671_0000950 Ga0495671_0000950_118_1065 315
1418 3300046692 Ga0495671_0001525 Ga0495671_0001525_153_1100 315
1419 3300046692 Ga0495671_0017425 Ga0495671_0017425_778_1725 315
1420 3300046694 Ga0495649_0001301 Ga0495649_0001301_16866_17813 315
1421 3300046694 Ga0495649_0001326 Ga0495649_0001326_8766_9713 315
1422 3300046694 Ga0495649_0012802 Ga0495649_0012802_1934_2881 315
1423 3300046694 Ga0495649_0015060 Ga0495649_0015060_1530_2477 315
1424 3300046694 Ga0495649_0101647 Ga0495649_0101647_323_1270 315
1425 3300046794 Ga0495589_0000011 Ga0495589_0000011_19207_20154 315
1426 3300046794 Ga0495589_0000740 Ga0495589_0000740_1719_2666 315
1427 3300046794 Ga0495589_0005399 Ga0495589_0005399_5227_6174 315
1428 3300046809 Ga0495600_0001400 Ga0495600_0001400_7600_8547 315
1429 3300046810 Ga0495660_0000136 Ga0495660_0000136_28425_29372 315
1430 3300046810 Ga0495660_0001104 Ga0495660_0001104_730_1677 315
1431 3300046810 Ga0495660_0003859 Ga0495660_0003859_4728_5675 315
1432 3300046810 Ga0495660_0016925 Ga0495660_0016925_618_1565 315
1433 3300046810 Ga0495660_0097434 Ga0495660_0097434_432_1379 315
1434 3300047317 Ga0495604_0029355 Ga0495604_0029355_2929_3876 315
1435 3300047317 Ga0495604_0097674 Ga0495604_0097674_378_1325 315
1436 3300047319 Ga0495674_0003267 Ga0495674_0003267_10337_11284 315
1437 3300047320 Ga0495672_0003855 Ga0495672_0003855_1996_2943 315
1438 3300047320 Ga0495672_0005016 Ga0495672_0005016_3593_4540 315
1439 3300047320 Ga0495672_0005116 Ga0495672_0005116_8502_9449 315
1440 3300047321 Ga0495676_0001880 Ga0495676_0001880_4375_5322 315
1441 3300047322 Ga0495680_0022052 Ga0495680_0022052_3072_4019 315
1442 3300047323 Ga0495683_0000139 Ga0495683_0000139_55160_56107 315
1443 3300047444 Ga0495675_0044517 Ga0495675_0044517_224_1171 315
1444 3300047446 Ga0495679_000233 Ga0495679_000233_16679_17626 315
1445 3300047446 Ga0495679_000440 Ga0495679_000440_29600_30547 315
1446 3300047446 Ga0495679_000569 Ga0495679_000569_15797_16744 315
1447 3300047446 Ga0495679_000780 Ga0495679_000780_14208_15155 315
1448 3300047469 Ga0495673_0001184 Ga0495673_0001184_19408_20382 315
1449 3300047469 Ga0495673_0001421 Ga0495673_0001421_7888_8835 315
1450 3300047469 Ga0495673_0003804 Ga0495673_0003804_8357_9304 315
1451 3300047469 Ga0495673_0084971 Ga0495673_0084971_331_1278 315
1452 3300047470 Ga0495681_0000109 Ga0495681_0000109_35474_36421 315
1453 3300047470 Ga0495681_0000370 Ga0495681_0000370_1663_2610 315
1454 3300047470 Ga0495681_0001460 Ga0495681_0001460_7805_8752 315
1455 3300047470 Ga0495681_0002166 Ga0495681_0002166_8322_9269 315
1456 3300047470 Ga0495681_0038749 Ga0495681_0038749_1163_2110 315
1457 3300047471 Ga0495684_0011799 Ga0495684_0011799_4350_5297 315
1458 3300047472 Ga0495686_0000266 Ga0495686_0000266_2675_3622 315
1459 3300047472 Ga0495686_0000653 Ga0495686_0000653_10622_11569 315
1460 3300047472 Ga0495686_0048052 Ga0495686_0048052_1034_1981 315
1461 3300047673 Ga0495593_0004240 Ga0495593_0004240_3988_4935 315
1462 3300047673 Ga0495593_0097103 Ga0495593_0097103_531_1478 315
1463 3300048088 Ga0495602_0001929 Ga0495602_0001929_14826_15773 315
1464 3300048091 Ga0495626_0000074 Ga0495626_0000074_123209_124156 315
1465 3300048091 Ga0495626_0000326 Ga0495626_0000326_9516_10490 315
1466 3300048091 Ga0495626_0000394 Ga0495626_0000394_16858_17805 315
1467 3300048091 Ga0495626_0059754 Ga0495626_0059754_762_1709 315
1468 3300048905 Ga0496102_0000659 Ga0496102_0000659_10923_11870 315
1469 3300048906 Ga0496103_0000839 Ga0496103_0000839_7032_7979 315
1470 3300048919 Ga0496116_0000654 Ga0496116_0000654_25673_26620 315
1471 3300048919 Ga0496116_0001333 Ga0496116_0001333_17758_18705 315
1472 3300048919 Ga0496116_0033797 Ga0496116_0033797_1494_2441 315
1473 3300048920 Ga0496117_0001203 Ga0496117_0001203_24656_25603 315
1474 3300048920 Ga0496117_0001929 Ga0496117_0001929_23583_24530 315
1475 3300048920 Ga0496117_0012990 Ga0496117_0012990_1104_2051 315
1476 3300048920 Ga0496117_0026279 Ga0496117_0026279_523_1470 315
1477 3300048920 Ga0496117_0048849 Ga0496117_0048849_768_1715 315
1478 3300048920 Ga0496117_0054958 Ga0496117_0054958_1334_2281 315
1479 3300048920 Ga0496117_0099895 Ga0496117_0099895_784_1731 315
1480 3300048921 Ga0496118_0023509 Ga0496118_0023509_1686_2633 315
1481 3300048921 Ga0496118_0023969 Ga0496118_0023969_1741_2688 315
1482 3300048921 Ga0496118_0046977 Ga0496118_0046977_1302_2249 315
1483 3300048921 Ga0496118_0085659 Ga0496118_0085659_1100_2047 315
1484 3300048922 Ga0496119_0008762 Ga0496119_0008762_3100_4047 315
1485 3300048922 Ga0496119_0046501 Ga0496119_0046501_190_1137 315
1486 3300048923 Ga0496120_0001883 Ga0496120_0001883_9410_10357 315
1487 3300048923 Ga0496120_0003959 Ga0496120_0003959_4813_5760 315
1488 3300048923 Ga0496120_0006699 Ga0496120_0006699_709_1656 315
1489 3300048924 Ga0496121_0001858 Ga0496121_0001858_27682_28629 315
1490 3300048924 Ga0496121_0003396 Ga0496121_0003396_18727_19674 315
1491 3300048924 Ga0496121_0010257 Ga0496121_0010257_1804_2751 315
1492 3300048924 Ga0496121_0116557 Ga0496121_0116557_725_1672 315
1493 3300048925 Ga0496122_0000696 Ga0496122_0000696_10562_11509 315
1494 3300048925 Ga0496122_0000776 Ga0496122_0000776_57391_58338 315
1495 3300048925 Ga0496122_0001980 Ga0496122_0001980_13154_14101 315
1496 3300048926 Ga0496123_0000439 Ga0496123_0000439_15552_16499 315
1497 3300048926 Ga0496123_0002483 Ga0496123_0002483_18619_19566 315
1498 3300048926 Ga0496123_0005000 Ga0496123_0005000_2075_3022 315
1499 3300048926 Ga0496123_0013680 Ga0496123_0013680_1458_2405 315
1500 3300048927 Ga0496124_0001568 Ga0496124_0001568_24590_25537 315
1501 3300048927 Ga0496124_0018652 Ga0496124_0018652_5263_6210 315
1502 3300048927 Ga0496124_0027520 Ga0496124_0027520_1859_2806 315
1503 3300048927 Ga0496124_0078989 Ga0496124_0078989_204_1151 315
1504 3300048927 Ga0496124_0091036 Ga0496124_0091036_84_1031 315
1505 3300048928 Ga0496125_0000284 Ga0496125_0000284_43338_44285 315
1506 3300048928 Ga0496125_0000380 Ga0496125_0000380_3076_4023 315
1507 3300048928 Ga0496125_0001952 Ga0496125_0001952_9501_10448 315
1508 3300048928 Ga0496125_0011227 Ga0496125_0011227_7095_8042 315
1509 3300048928 Ga0496125_0047750 Ga0496125_0047750_200_1147 315
1510 3300048929 Ga0496126_0045862 Ga0496126_0045862_2155_3102 315
1511 3300049459 Ga0495678_000883 Ga0495678_000883_16109_17056 315
1512 3300049459 Ga0495678_003236 Ga0495678_003236_9224_10171 315
1513 3300049460 Ga0495682_0000054 Ga0495682_0000054_17348_18295 315
1514 3300049460 Ga0495682_0001160 Ga0495682_0001160_9188_10135 315
1515 3300049460 Ga0495682_0005108 Ga0495682_0005108_3175_4122 315
1516 3300049571 Ga0501034_0000012 Ga0501034_0000012_47328_48287 315
1517 3300049571 Ga0501034_0012453 Ga0501034_0012453_4785_5732 315
1518 3300049581 Ga0501047_0075233 Ga0501047_0075233_2044_3003 315
1519 3300050492 nmdc:mga0yw44_276136_c1 nmdc:mga0yw44_276136_c1_112_1065 315
1520 3300053111 Ga0500572_000268 Ga0500572_000268_17582_18529 315
1521 3300053135 Ga0500659_0011667 Ga0500659_0011667_3562_4509 315
1522 3300053139 Ga0500568_0002348 Ga0500568_0002348_8288_9253 315
1523 3300053161 Ga0500634_0000091 Ga0500634_0000091_5930_6877 315
1524 3300053731 Ga0500609_006418 Ga0500609_006418_143_1108 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

60

325

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hmc-assembly1.cif.gz_A the crystal structure of dihydrodipicolinate synthase dapa from agrobacterium tumefaciens 0.9868 1 309
5czj-assembly2.cif.gz_B crystal structure of hypd, a 1-pyrroline-4-hydroxy-2-carboxylate deaminase from sinorhizobium meliloti 0.9851 5 310
4mpq-assembly1.cif.gz_A crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis atcc 23457 0.9848 4 309
4o0k-assembly1.cif.gz_A crystal structure of 1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis with covalently bound substrate 0.9848 4 310
2hmc-assembly1.cif.gz_A the crystal structure of dihydrodipicolinate synthase dapa from agrobacterium tumefaciens 0.9681 1 309
ID Description Score Start End Superfamily
2hmcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9829 2 309 3.20.20.70
2hmcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9638 2 309 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8896 6 297 3.20.20.70
3s5oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.889 6 301 3.20.20.70
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8815 4 301 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4R3DXN8-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.9878 1 309 GO:0008840
AF-V7D853-F1-model_v4 Dihydrodipicolinate synthetase 0.987 76 315 GO:0008840
AF-A0A529HHF9-F1-model_v4 deleted 0.987 88 168
AF-A0A6I1IT49-F1-model_v4 deleted 0.9869 113 311
AF-A0A653HWC3-F1-model_v4 deleted 0.9866 1 314

Feature Viewer

pLDDT pTM Quality
93.31 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map