F494559
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1524 | 926 | 970 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300025294|Ga0209025_1016489|Ga0209025_10164892 |
| Length | 365 |
| Sequence | MTSSALCFPGLRGRQGCCSDWPDLQIHETLRRMSRRSGPNQPPDHSSFLETKEILMASDVFTGTIPALMTPCRADRSPDFDALVRKGKELIAAGMSAVVYCGSMGDWPLLTDEERQEGVARLAAAGVPVIVGTGAQNTQRAAAFARHASEVGAKGLMVIPRVLSRGPSASAQQAHFMAILEAANGLPAVIYNSPYYGFETRAELFFQLRDKFPNLIGFKEFGGAASLTYAAENITGQSDDITLMVGVDTQVFHGFVNCGASGAITGIGNVLPEPVLKLVSLCEQAAKGDVTARQKALELDNALAVLSSFDEGPDLVLFYKYLMVLEGNPEYELHFNASDALSRGQMHYAKTQLELFKTWYAAWSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 6 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 7 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 8 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 9 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 10 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 11 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 12 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 13 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 14 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 15 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 16 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 17 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 18 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 19 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 20 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 21 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 22 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 23 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 24 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 25 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 26 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 27 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 28 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 29 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 30 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 31 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 32 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 33 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 34 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 35 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 36 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 37 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 38 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 39 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 40 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 41 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 42 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 43 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 44 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 45 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 46 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 47 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 48 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 49 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 50 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 51 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 52 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 53 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 54 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 55 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 56 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 57 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 58 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 59 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 60 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 61 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 62 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 63 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 64 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 65 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 66 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 67 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 68 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 69 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 70 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 71 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 72 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 73 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 74 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 75 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 76 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 77 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 78 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 79 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 80 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 81 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 82 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 83 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 84 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 85 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 86 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 87 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 88 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 89 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 90 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 91 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 92 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 93 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 94 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 95 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 96 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 97 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 98 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 99 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 100 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 101 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 102 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 103 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 104 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 105 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 106 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 107 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 108 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 109 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 110 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 111 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 112 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 113 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 114 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 115 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 116 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 117 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 118 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 119 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 120 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 121 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 122 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 123 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 124 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 125 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 126 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 127 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 128 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 129 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 130 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 131 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 132 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 133 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 134 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 135 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 136 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 137 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 138 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 139 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 140 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 141 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 142 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 143 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 144 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 145 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 146 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 147 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 148 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 149 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 150 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 151 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 152 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 153 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 154 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 155 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 156 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 157 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 158 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 159 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 160 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 161 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 162 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 163 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 164 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 165 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 166 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 167 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 168 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 169 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 170 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 171 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 172 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 173 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 174 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 175 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 176 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 177 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 178 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 179 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 180 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 181 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 182 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 183 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 184 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 185 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 186 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 187 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 188 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 189 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 190 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 191 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 192 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 193 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 194 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 195 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 196 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 197 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 198 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 199 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 200 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 201 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 202 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 203 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 204 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 205 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 206 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 207 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 208 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 209 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 210 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 211 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 212 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 213 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 214 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 215 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 216 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 217 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 218 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 219 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 220 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 221 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 222 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 223 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 224 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 225 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 226 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 227 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 228 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 229 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 230 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 231 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 232 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 233 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 234 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 235 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 236 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 237 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 238 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 239 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 240 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 241 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 242 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 243 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 244 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 245 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 246 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 247 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 248 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 249 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 250 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 251 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 252 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 253 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 254 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 255 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 256 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 257 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 258 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 259 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 260 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 261 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 262 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 263 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 264 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 265 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 266 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 267 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 268 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 269 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 270 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 271 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 272 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 273 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 274 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 275 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 276 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 277 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 278 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 279 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 280 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 281 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 282 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 283 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 284 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 285 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 286 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 287 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 288 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 289 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 290 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 291 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 292 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 293 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 294 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 295 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 296 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 297 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 298 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 299 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 300 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 301 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 302 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 303 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 304 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 305 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 306 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 307 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 308 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 309 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 310 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 311 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 312 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 313 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 314 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 315 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 316 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 317 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 318 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 319 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 320 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 321 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 322 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 323 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 324 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 325 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 326 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 327 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 328 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 329 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 330 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 331 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 332 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 333 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 334 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 335 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 336 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 337 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 338 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 339 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 340 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 341 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 342 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 343 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 344 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 345 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 346 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 347 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 348 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 349 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 350 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 351 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 352 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 353 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 354 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 355 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 356 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 357 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 358 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 359 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 360 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 361 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 362 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 363 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 364 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 365 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 366 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 367 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 368 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 369 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 370 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 371 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 372 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 373 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 374 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 375 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 376 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 377 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 378 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 379 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 380 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 381 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 382 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 383 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 384 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 385 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 386 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 387 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 388 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 389 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 390 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 391 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 392 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 393 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 394 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 395 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 396 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 397 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 398 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 399 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 400 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 401 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 402 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 403 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 404 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 405 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 406 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 407 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 408 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 409 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 410 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 411 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 412 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 413 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 414 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 415 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 416 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 417 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 418 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 419 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 420 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 421 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 422 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 423 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 424 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 425 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 426 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 427 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 428 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 429 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 430 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 431 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 432 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 433 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 434 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 435 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 436 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 437 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 438 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 439 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 440 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 441 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 442 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 443 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 444 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 445 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 446 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 447 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 448 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 449 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 450 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 451 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 452 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 453 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 454 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 455 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 456 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 457 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 458 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 459 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 460 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 461 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 462 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 463 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 464 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 465 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 466 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 467 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 468 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 469 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 470 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 471 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 472 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 473 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 474 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 475 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 476 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 477 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 478 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 479 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 480 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 481 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 482 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 483 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 484 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 485 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 486 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 487 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 488 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 489 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 490 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 491 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 492 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 493 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 494 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 495 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 496 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 497 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 498 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 499 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 500 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 501 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 502 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 503 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 504 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 505 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 506 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 507 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 508 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 509 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 510 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 511 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 512 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 513 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 514 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 515 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 516 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 517 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 518 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 519 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 520 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 521 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 522 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 523 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 524 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 525 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 526 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 527 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 528 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 529 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 530 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 531 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 532 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 533 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 534 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 535 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 536 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 537 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 538 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 539 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 540 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 541 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 542 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 543 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 544 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 545 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 546 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 547 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 548 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 549 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 550 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 551 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 552 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 553 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 554 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 555 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 556 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 557 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 558 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 559 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 560 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 561 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 562 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 563 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 564 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 565 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 566 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 567 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 568 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 569 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 570 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 571 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 572 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 573 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 574 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 575 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 576 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 577 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 578 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 579 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 580 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 581 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 582 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 583 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 584 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 585 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 586 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 587 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 588 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 589 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 590 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 591 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 592 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 593 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 594 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 595 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 596 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 597 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 598 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 599 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 600 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 601 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 602 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 603 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 604 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 605 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 606 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 607 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 608 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 609 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 610 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 611 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 612 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 613 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 614 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 615 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 616 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 617 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 618 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 619 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 620 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 621 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 622 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 623 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 624 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 625 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 626 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 627 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 628 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 629 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 630 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 631 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 632 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 633 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 634 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 635 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 636 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 655 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 656 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 657 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 658 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 659 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 660 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 661 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 662 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 663 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 665 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 666 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 667 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 668 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 669 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 670 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 671 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 672 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 673 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 674 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 675 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 676 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 677 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 678 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 679 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 680 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 681 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 682 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 683 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 684 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 685 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 686 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 687 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 688 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 689 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 690 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 691 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 692 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 693 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 694 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 695 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 696 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 697 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 698 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 699 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 700 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 701 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 702 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 703 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 704 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 705 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 706 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 707 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 708 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 709 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 710 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 711 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 712 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 713 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 714 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 715 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 716 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 717 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 718 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 719 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 720 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 721 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 722 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 723 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 724 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 725 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 726 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 727 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 728 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 729 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 730 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 731 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 808 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 809 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 810 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 811 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 812 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 813 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 814 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 815 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 816 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 817 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 818 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 819 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 820 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 821 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 822 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 823 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 824 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 825 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 826 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 827 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 828 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 829 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 830 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 831 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 832 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 833 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 834 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 835 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 836 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 837 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 838 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 839 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 840 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 841 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 842 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 843 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 844 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 845 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 846 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 847 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 848 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 849 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 850 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 851 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 852 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 853 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 854 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 855 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 856 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 857 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 858 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 859 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 860 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 861 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 862 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 863 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 864 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 865 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 866 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 867 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 868 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 869 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 870 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 871 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 872 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 873 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 874 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 875 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 876 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 877 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 878 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 879 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 880 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 881 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 882 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 883 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 884 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 885 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 886 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 887 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 888 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 889 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 890 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 891 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 892 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 893 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 894 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 895 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 896 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 897 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 898 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 899 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 900 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 901 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 902 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 903 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 904 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 905 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 906 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 907 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 908 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 909 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 910 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 911 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 912 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 913 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 914 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 915 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 916 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 917 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 918 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 919 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 920 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 921 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 922 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 923 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 924 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 925 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 926 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.71 |
| Metatranscriptomes | 0 |
| Isolates | 36.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.33 |
| Bulb | 0 |
| Endosphere | 12.2 |
| Nodule | 22.31 |
| Rhizoplane | 2.17 |
| Rhizosphere | 45.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2672424 | 2162886007 | Bacteria | 1070 |
| 2 | SwRhRL2b_contig_2703748 | 2162886007 | Bacteria | 1791 |
| 3 | SwRhRL2b_contig_2894984 | 2162886007 | Bacteria | 1205 |
| 4 | SwRhRL2b_contig_507962 | 2162886007 | Bacteria | 6187 |
| 5 | JGI24740J21852_10000099 | 3300001979 | Bacteria | 30439 |
| 6 | JGI24740J21852_10032415 | 3300001979 | Bacteria | 1671 |
| 7 | JGI24739J22299_10007607 | 3300001989 | Bacteria | 4058 |
| 8 | JGI24739J22299_10029968 | 3300001989 | Bacteria | 1888 |
| 9 | JGI24735J21928_10018021 | 3300002067 | Bacteria | 2180 |
| 10 | JGI25155J39150_1000027 | 3300002704 | Bacteria | 123955 |
| 11 | JGI25156J39149_1000008 | 3300002705 | Bacteria | 229035 |
| 12 | JGI25156J39149_1001201 | 3300002705 | Bacteria | 11486 |
| 13 | JGI25156J39149_1001580 | 3300002705 | Bacteria | 9377 |
| 14 | JGI25162J39368_1000074 | 3300002737 | Bacteria | 121066 |
| 15 | JGI25154J39366_1000050 | 3300002738 | Bacteria | 124480 |
| 16 | JGI25157J39369_1000028 | 3300002741 | Bacteria | 147384 |
| 17 | JGI25157J39369_1000767 | 3300002741 | Bacteria | 16640 |
| 18 | JGI25159J45721_1004247 | 3300002987 | Bacteria | 4820 |
| 19 | JGI25151J46595_10000036 | 3300003187 | Bacteria | 188770 |
| 20 | JGI25165J46597_1000020 | 3300003214 | Bacteria | 370477 |
| 21 | JGI25165J46597_1000201 | 3300003214 | Bacteria | 87622 |
| 22 | JGI25165J46597_1001615 | 3300003214 | Bacteria | 10764 |
| 23 | JGI25153J46596_10000024 | 3300003215 | Bacteria | 238285 |
| 24 | rootH1_10002623 | 3300003316 | Bacteria | 12699 |
| 25 | rootH1_10002623 | 3300003323 | Bacteria | 7256 |
| 26 | rootH2_10051550 | 3300003320 | Bacteria | 13941 |
| 27 | rootH2_10055630 | 3300003320 | Bacteria | 2716 |
| 28 | rootH1_10046512 | 3300003323 | Bacteria | 2288 |
| 29 | Ga0055538_1000062 | 3300003751 | Bacteria | 105260 |
| 30 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 31 | Ga0055539_1000093 | 3300003752 | Bacteria | 105260 |
| 32 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 33 | Ga0055533_1000070 | 3300003756 | Bacteria | 153414 |
| 34 | Ga0055533_1000105 | 3300003756 | Bacteria | 105260 |
| 35 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 36 | Ga0055532_1000011 | 3300003758 | Bacteria | 385294 |
| 37 | Ga0055532_1000230 | 3300003758 | Bacteria | 41833 |
| 38 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 39 | Ga0055525_1000137 | 3300003759 | Bacteria | 105260 |
| 40 | Ga0055527_1000009 | 3300003760 | Bacteria | 385294 |
| 41 | Ga0055527_1000042 | 3300003760 | Bacteria | 115844 |
| 42 | Ga0055535_1000008 | 3300003761 | Bacteria | 385294 |
| 43 | Ga0055535_1000066 | 3300003761 | Bacteria | 115844 |
| 44 | Ga0055542_1000014 | 3300003762 | Bacteria | 385294 |
| 45 | Ga0055542_1001483 | 3300003762 | Bacteria | 11519 |
| 46 | Ga0055529_1000010 | 3300003763 | Bacteria | 385294 |
| 47 | Ga0055529_1001530 | 3300003763 | Bacteria | 6659 |
| 48 | Ga0055529_1005106 | 3300003763 | Bacteria | 1935 |
| 49 | Ga0055526_1000209 | 3300003771 | Bacteria | 50344 |
| 50 | Ga0055526_1023065 | 3300003771 | Bacteria | 2089 |
| 51 | Ga0055524_1000018 | 3300003775 | Bacteria | 234806 |
| 52 | Ga0055524_1000748 | 3300003775 | Bacteria | 22121 |
| 53 | Ga0055524_1014052 | 3300003775 | Bacteria | 2988 |
| 54 | Ga0055536_1000013 | 3300003781 | Bacteria | 240693 |
| 55 | Ga0055536_1000035 | 3300003781 | Bacteria | 145848 |
| 56 | Ga0055528_1000299 | 3300003790 | Bacteria | 42145 |
| 57 | Ga0055530_10000212 | 3300003791 | Bacteria | 52572 |
| 58 | Ga0055530_10000534 | 3300003791 | Bacteria | 32971 |
| 59 | Ga0055540_1000008 | 3300003792 | Bacteria | 309635 |
| 60 | Ga0055540_1000042 | 3300003792 | Bacteria | 156410 |
| 61 | Ga0055531_10000002 | 3300003794 | Bacteria | 421971 |
| 62 | Ga0055531_10000150 | 3300003794 | Bacteria | 80520 |
| 63 | Ga0055531_10003120 | 3300003794 | Bacteria | 10695 |
| 64 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 65 | Ga0055541_1000063 | 3300003841 | Bacteria | 105260 |
| 66 | Ga0058692_1000668 | 3300003856 | Bacteria | 14146 |
| 67 | Ga0065165_1000362 | 3300005262 | Bacteria | 74503 |
| 68 | Ga0065714_10064524 | 3300005288 | Bacteria | 41924 |
| 69 | Ga0065704_10002196 | 3300005289 | Bacteria | 7375 |
| 70 | Ga0065704_10071779 | 3300005289 | Bacteria | 9959 |
| 71 | Ga0070658_10085570 | 3300005327 | Bacteria | 2593 |
| 72 | Ga0070670_100000277 | 3300005331 | Bacteria | 45000 |
| 73 | Ga0070670_100000837 | 3300005331 | Bacteria | 24028 |
| 74 | Ga0070668_100013859 | 3300005347 | Bacteria | 6027 |
| 75 | Ga0070669_100001853 | 3300005353 | Bacteria | 15219 |
| 76 | Ga0070671_100355327 | 3300005355 | Bacteria | 1251 |
| 77 | Ga0070659_100000038 | 3300005366 | Bacteria | 110675 |
| 78 | Ga0070663_100000558 | 3300005455 | Bacteria | 19863 |
| 79 | Ga0070662_100005634 | 3300005457 | Bacteria | 8008 |
| 80 | Ga0070681_10009242 | 3300005458 | Bacteria | 9688 |
| 81 | Ga0068853_100009469 | 3300005539 | Bacteria | 7848 |
| 82 | Ga0070665_100009039 | 3300005548 | Bacteria | 10094 |
| 83 | Ga0068855_100075336 | 3300005563 | Bacteria | 3918 |
| 84 | Ga0068855_100126350 | 3300005563 | Bacteria | 2923 |
| 85 | Ga0068855_100199532 | 3300005563 | Bacteria | 2253 |
| 86 | Ga0068855_100339440 | 3300005563 | Bacteria | 1657 |
| 87 | Ga0070664_100000861 | 3300005564 | Bacteria | 23450 |
| 88 | Ga0070664_100094179 | 3300005564 | Bacteria | 2597 |
| 89 | Ga0070664_100131815 | 3300005564 | Bacteria | 2196 |
| 90 | Ga0068857_100239574 | 3300005577 | Bacteria | 1660 |
| 91 | Ga0068856_100005571 | 3300005614 | Bacteria | 12401 |
| 92 | Ga0068852_100015462 | 3300005616 | Bacteria | 5921 |
| 93 | Ga0068851_10012475 | 3300005834 | Bacteria | 4008 |
| 94 | Ga0081539_10132905 | 3300005985 | Bacteria | 1220 |
| 95 | Ga0075365_10008792 | 3300006038 | Bacteria | 5762 |
| 96 | Ga0075365_10071991 | 3300006038 | Bacteria | 2328 |
| 97 | Ga0075365_10212790 | 3300006038 | Bacteria | 1355 |
| 98 | Ga0075363_100031537 | 3300006048 | Bacteria | 2749 |
| 99 | Ga0075364_10000309 | 3300006051 | Bacteria | 23917 |
| 100 | Ga0075364_10009737 | 3300006051 | Bacteria | 5776 |
| 101 | Ga0075364_10030304 | 3300006051 | Bacteria | 3472 |
| 102 | Ga0075364_10101485 | 3300006051 | Bacteria | 1915 |
| 103 | Ga0075432_10014173 | 3300006058 | Bacteria | 2714 |
| 104 | Ga0075362_10007557 | 3300006177 | Bacteria | 4123 |
| 105 | Ga0075362_10007635 | 3300006177 | Bacteria | 4108 |
| 106 | Ga0075362_10021049 | 3300006177 | Bacteria | 2732 |
| 107 | Ga0075367_10004732 | 3300006178 | Bacteria | 6694 |
| 108 | Ga0075367_10043833 | 3300006178 | Bacteria | 2620 |
| 109 | Ga0075367_10064999 | 3300006178 | Bacteria | 2183 |
| 110 | Ga0075367_10074090 | 3300006178 | Bacteria | 2053 |
| 111 | Ga0075367_10091479 | 3300006178 | Bacteria | 1851 |
| 112 | Ga0075369_10005032 | 3300006186 | Bacteria | 4924 |
| 113 | Ga0075369_10015202 | 3300006186 | Bacteria | 3086 |
| 114 | Ga0075366_10071103 | 3300006195 | Bacteria | 2073 |
| 115 | Ga0075370_10037803 | 3300006353 | Bacteria | 2715 |
| 116 | Ga0099823_1000102 | 3300006944 | Bacteria | 41832 |
| 117 | Ga0079104_1002790 | 3300006946 | Bacteria | 8806 |
| 118 | Ga0099826_10008333 | 3300006948 | Bacteria | 7704 |
| 119 | Ga0105251_10000476 | 3300009011 | Bacteria | 37938 |
| 120 | Ga0105251_10000877 | 3300009011 | Bacteria | 26945 |
| 121 | Ga0105251_10001557 | 3300009011 | Bacteria | 19655 |
| 122 | Ga0105251_10001803 | 3300009011 | Bacteria | 17776 |
| 123 | Ga0105251_10013303 | 3300009011 | Bacteria | 4608 |
| 124 | Ga0105244_10003371 | 3300009036 | Bacteria | 11440 |
| 125 | Ga0105244_10003390 | 3300009036 | Bacteria | 11393 |
| 126 | Ga0105244_10004115 | 3300009036 | Bacteria | 10152 |
| 127 | Ga0105244_10006154 | 3300009036 | Bacteria | 7834 |
| 128 | Ga0105244_10007082 | 3300009036 | Bacteria | 7170 |
| 129 | Ga0105244_10009624 | 3300009036 | Bacteria | 5922 |
| 130 | Ga0105244_10010494 | 3300009036 | Bacteria | 5616 |
| 131 | Ga0105244_10016205 | 3300009036 | Bacteria | 4252 |
| 132 | Ga0105244_10033265 | 3300009036 | Bacteria | 2719 |
| 133 | Ga0105244_10047099 | 3300009036 | Bacteria | 2213 |
| 134 | Ga0105250_10000041 | 3300009092 | Bacteria | 133571 |
| 135 | Ga0105250_10000058 | 3300009092 | Bacteria | 111233 |
| 136 | Ga0105250_10000155 | 3300009092 | Bacteria | 59663 |
| 137 | Ga0105250_10003365 | 3300009092 | Bacteria | 7596 |
| 138 | Ga0105250_10054190 | 3300009092 | Bacteria | 1608 |
| 139 | Ga0105240_10069968 | 3300009093 | Bacteria | 4342 |
| 140 | Ga0105240_10177754 | 3300009093 | Bacteria | 2515 |
| 141 | Ga0105240_10207805 | 3300009093 | Bacteria | 2290 |
| 142 | Ga0105240_10472910 | 3300009093 | Bacteria | 1398 |
| 143 | Ga0105243_10000736 | 3300009148 | Bacteria | 31344 |
| 144 | Ga0105243_10010726 | 3300009148 | Bacteria | 6942 |
| 145 | Ga0105242_10016807 | 3300009176 | Bacteria | 5694 |
| 146 | Ga0105237_10004461 | 3300009545 | Bacteria | 16177 |
| 147 | Ga0105238_10013098 | 3300009551 | Bacteria | 8367 |
| 148 | Ga0105238_10024559 | 3300009551 | Bacteria | 6143 |
| 149 | Ga0105238_10064040 | 3300009551 | Bacteria | 3677 |
| 150 | Ga0105238_10412598 | 3300009551 | Bacteria | 1344 |
| 151 | Ga0105239_10025754 | 3300010375 | Bacteria | 6478 |
| 152 | Ga0105239_10063548 | 3300010375 | Bacteria | 4053 |
| 153 | Ga0105239_10124942 | 3300010375 | Bacteria | 2859 |
| 154 | Ga0105239_10196744 | 3300010375 | Bacteria | 2257 |
| 155 | Ga0105239_10316980 | 3300010375 | Bacteria | 1758 |
| 156 | Ga0105246_10000357 | 3300011119 | Bacteria | 24630 |
| 157 | Ga0105246_10000699 | 3300011119 | Bacteria | 18935 |
| 158 | Ga0157345_1000001 | 3300012498 | Bacteria | 152919 |
| 159 | Ga0157373_10000039 | 3300013100 | Bacteria | 117160 |
| 160 | Ga0157373_10000193 | 3300013100 | Bacteria | 50206 |
| 161 | Ga0157373_10000225 | 3300013100 | Bacteria | 46142 |
| 162 | Ga0157373_10001827 | 3300013100 | Bacteria | 16204 |
| 163 | Ga0157373_10047616 | 3300013100 | Bacteria | 3057 |
| 164 | Ga0157373_10093927 | 3300013100 | Bacteria | 2112 |
| 165 | Ga0157371_10000005 | 3300013102 | Bacteria | 416456 |
| 166 | Ga0157371_10000262 | 3300013102 | Bacteria | 72390 |
| 167 | Ga0157371_10014295 | 3300013102 | Bacteria | 5995 |
| 168 | Ga0157371_10140454 | 3300013102 | Bacteria | 1720 |
| 169 | Ga0157370_10000146 | 3300013104 | Bacteria | 86599 |
| 170 | Ga0157370_10019164 | 3300013104 | Bacteria | 6875 |
| 171 | Ga0157370_10070977 | 3300013104 | Bacteria | 3287 |
| 172 | Ga0157370_10071884 | 3300013104 | Bacteria | 3264 |
| 173 | Ga0157370_10084869 | 3300013104 | Bacteria | 2975 |
| 174 | Ga0157370_10282385 | 3300013104 | Bacteria | 1534 |
| 175 | Ga0157369_10000236 | 3300013105 | Bacteria | 76415 |
| 176 | Ga0157369_10001402 | 3300013105 | Bacteria | 29596 |
| 177 | Ga0157369_10003028 | 3300013105 | Bacteria | 20066 |
| 178 | Ga0157369_10005269 | 3300013105 | Bacteria | 15076 |
| 179 | Ga0157369_10016893 | 3300013105 | Bacteria | 8201 |
| 180 | Ga0157369_10079725 | 3300013105 | Bacteria | 3506 |
| 181 | Ga0157369_10530863 | 3300013105 | Bacteria | 1217 |
| 182 | Ga0157374_10284715 | 3300013296 | Bacteria | 1632 |
| 183 | Ga0157374_10287320 | 3300013296 | Bacteria | 1625 |
| 184 | Ga0163162_10000392 | 3300013306 | Bacteria | 40123 |
| 185 | Ga0157375_10000139 | 3300013308 | Bacteria | 72260 |
| 186 | Ga0157375_10002380 | 3300013308 | Bacteria | 16274 |
| 187 | Ga0157375_10087900 | 3300013308 | Bacteria | 3161 |
| 188 | Ga0157380_10003627 | 3300014326 | Bacteria | 10611 |
| 189 | Ga0182008_10000202 | 3300014497 | Bacteria | 46777 |
| 190 | Ga0182008_10000704 | 3300014497 | Bacteria | 23899 |
| 191 | Ga0182008_10002912 | 3300014497 | Bacteria | 10586 |
| 192 | Ga0182008_10016440 | 3300014497 | Bacteria | 3844 |
| 193 | Ga0182008_10052400 | 3300014497 | Bacteria | 2023 |
| 194 | Ga0182006_1000107 | 3300015261 | Bacteria | 89971 |
| 195 | Ga0182006_1000257 | 3300015261 | Bacteria | 48864 |
| 196 | Ga0182006_1000654 | 3300015261 | Bacteria | 24643 |
| 197 | Ga0182007_10000237 | 3300015262 | Bacteria | 37215 |
| 198 | Ga0182007_10051204 | 3300015262 | Bacteria | 1363 |
| 199 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 200 | Ga0182005_1007215 | 3300015265 | Bacteria | 3346 |
| 201 | Ga0163161_10000066 | 3300017792 | Bacteria | 107442 |
| 202 | Ga0163161_10092213 | 3300017792 | Bacteria | 2243 |
| 203 | Ga0163161_10092731 | 3300017792 | Bacteria | 2237 |
| 204 | Ga0214544_1000130 | 3300021320 | Bacteria | 108844 |
| 205 | Ga0214542_1000014 | 3300021321 | Bacteria | 233825 |
| 206 | Ga0214542_1008629 | 3300021321 | Bacteria | 16592 |
| 207 | Ga0214543_1000018 | 3300021327 | Bacteria | 272335 |
| 208 | Ga0214543_1000146 | 3300021327 | Bacteria | 98609 |
| 209 | Ga0213872_10013982 | 3300021361 | Bacteria | 3752 |
| 210 | Ga0213876_10062142 | 3300021384 | Bacteria | 1971 |
| 211 | Ga0228711_1000005 | 3300022739 | Bacteria | 215594 |
| 212 | Ga0228710_1000141 | 3300022740 | Bacteria | 66299 |
| 213 | Ga0209435_100020 | 3300025206 | Bacteria | 229105 |
| 214 | Ga0209435_102302 | 3300025206 | Bacteria | 2249 |
| 215 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 216 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 217 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 218 | Ga0209566_100119 | 3300025225 | Bacteria | 105312 |
| 219 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 220 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 221 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 222 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 223 | Ga0209672_100090 | 3300025228 | Bacteria | 119861 |
| 224 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 225 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 226 | Ga0209147_100132 | 3300025229 | Bacteria | 119628 |
| 227 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 228 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 229 | Ga0209563_100549 | 3300025230 | Bacteria | 12534 |
| 230 | Ga0209563_101714 | 3300025230 | Bacteria | 5547 |
| 231 | Ga0209437_100067 | 3300025233 | Bacteria | 317685 |
| 232 | Ga0209437_100104 | 3300025233 | Bacteria | 220736 |
| 233 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 234 | Ga0209258_100211 | 3300025242 | Bacteria | 116100 |
| 235 | Ga0209258_100520 | 3300025242 | Bacteria | 37049 |
| 236 | Ga0207425_1000170 | 3300025245 | Bacteria | 53604 |
| 237 | Ga0209646_1000070 | 3300025246 | Bacteria | 229105 |
| 238 | Ga0209646_1000110 | 3300025246 | Bacteria | 156257 |
| 239 | Ga0209646_1005987 | 3300025246 | Bacteria | 2072 |
| 240 | Ga0209646_1007551 | 3300025246 | Bacteria | 1771 |
| 241 | Ga0209026_1000057 | 3300025250 | Bacteria | 229105 |
| 242 | Ga0209026_1000116 | 3300025250 | Bacteria | 133228 |
| 243 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 244 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 245 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 246 | Ga0209148_1000443 | 3300025254 | Bacteria | 45551 |
| 247 | Ga0209148_1001181 | 3300025254 | Bacteria | 15037 |
| 248 | Ga0209148_1012580 | 3300025254 | Bacteria | 1542 |
| 249 | Ga0209759_1000006 | 3300025256 | Bacteria | 492407 |
| 250 | Ga0209759_1000047 | 3300025256 | Bacteria | 229105 |
| 251 | Ga0209759_1000153 | 3300025256 | Bacteria | 119494 |
| 252 | Ga0209759_1001415 | 3300025256 | Bacteria | 13665 |
| 253 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 254 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 255 | Ga0209233_1000088 | 3300025261 | Bacteria | 317980 |
| 256 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 257 | Ga0209455_1000448 | 3300025272 | Bacteria | 31707 |
| 258 | Ga0209455_1000723 | 3300025272 | Bacteria | 19152 |
| 259 | Ga0209455_1001297 | 3300025272 | Bacteria | 11652 |
| 260 | Ga0209455_1003801 | 3300025272 | Bacteria | 5184 |
| 261 | Ga0209673_1000054 | 3300025273 | Bacteria | 279116 |
| 262 | Ga0209673_1019757 | 3300025273 | Bacteria | 2409 |
| 263 | Ga0209130_1000226 | 3300025284 | Bacteria | 73970 |
| 264 | Ga0209675_1002312 | 3300025291 | Bacteria | 9863 |
| 265 | Ga0209675_1002774 | 3300025291 | Bacteria | 8745 |
| 266 | Ga0209675_1007013 | 3300025291 | Bacteria | 4399 |
| 267 | Ga0209675_1016744 | 3300025291 | Bacteria | 2121 |
| 268 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 269 | Ga0209676_1000020 | 3300025292 | Bacteria | 617256 |
| 270 | Ga0209676_1019241 | 3300025292 | Bacteria | 2354 |
| 271 | Ga0209676_1026670 | 3300025292 | Bacteria | 1831 |
| 272 | Ga0209025_1000017 | 3300025294 | Bacteria | 768983 |
| 273 | Ga0209025_1000131 | 3300025294 | Bacteria | 198190 |
| 274 | Ga0209025_1000696 | 3300025294 | Bacteria | 57362 |
| 275 | Ga0209025_1003982 | 3300025294 | Bacteria | 13262 |
| 276 | Ga0209025_1004669 | 3300025294 | Bacteria | 11711 |
| 277 | Ga0209025_1016489 | 3300025294 | Bacteria | 4352 |
| 278 | Ga0209025_1038943 | 3300025294 | Bacteria | 2082 |
| 279 | Ga0209025_1044062 | 3300025294 | Bacteria | 1871 |
| 280 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 281 | Ga0209564_1000059 | 3300025295 | Bacteria | 328782 |
| 282 | Ga0209564_1009879 | 3300025295 | Bacteria | 4471 |
| 283 | Ga0209758_1000033 | 3300025297 | Bacteria | 469998 |
| 284 | Ga0209758_1000394 | 3300025297 | Bacteria | 75557 |
| 285 | Ga0209758_1017152 | 3300025297 | Bacteria | 3627 |
| 286 | Ga0209758_1029691 | 3300025297 | Bacteria | 2279 |
| 287 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 288 | Ga0209050_1001073 | 3300025298 | Bacteria | 33533 |
| 289 | Ga0209050_1003209 | 3300025298 | Bacteria | 12372 |
| 290 | Ga0209050_1007519 | 3300025298 | Bacteria | 6081 |
| 291 | Ga0209050_1011286 | 3300025298 | Bacteria | 4264 |
| 292 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 293 | Ga0209256_1000032 | 3300025299 | Bacteria | 395041 |
| 294 | Ga0209256_1004982 | 3300025299 | Bacteria | 7953 |
| 295 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 296 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 297 | Ga0209051_1009286 | 3300025303 | Bacteria | 5082 |
| 298 | Ga0209051_1012669 | 3300025303 | Bacteria | 4064 |
| 299 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 300 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 301 | Ga0209257_1000063 | 3300025304 | Bacteria | 359089 |
| 302 | Ga0209257_1000239 | 3300025304 | Bacteria | 128383 |
| 303 | Ga0209257_1009223 | 3300025304 | Bacteria | 5348 |
| 304 | Ga0207656_10016481 | 3300025321 | Bacteria | 2878 |
| 305 | Ga0207696_1000010 | 3300025711 | Bacteria | 534681 |
| 306 | Ga0207696_1000011 | 3300025711 | Bacteria | 530614 |
| 307 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 308 | Ga0207696_1000223 | 3300025711 | Bacteria | 82090 |
| 309 | Ga0207696_1000844 | 3300025711 | Bacteria | 19465 |
| 310 | Ga0207696_1002071 | 3300025711 | Bacteria | 10124 |
| 311 | Ga0207696_1017973 | 3300025711 | Bacteria | 2332 |
| 312 | Ga0207655_1000074 | 3300025728 | Bacteria | 232056 |
| 313 | Ga0207655_1000076 | 3300025728 | Bacteria | 226359 |
| 314 | Ga0207655_1000151 | 3300025728 | Bacteria | 127538 |
| 315 | Ga0207655_1002486 | 3300025728 | Bacteria | 14921 |
| 316 | Ga0207655_1003611 | 3300025728 | Bacteria | 11438 |
| 317 | Ga0207655_1006716 | 3300025728 | Bacteria | 7577 |
| 318 | Ga0207655_1007210 | 3300025728 | Bacteria | 7252 |
| 319 | Ga0207655_1009340 | 3300025728 | Bacteria | 6099 |
| 320 | Ga0207655_1009732 | 3300025728 | Bacteria | 5929 |
| 321 | Ga0207655_1010724 | 3300025728 | Bacteria | 5533 |
| 322 | Ga0207655_1015029 | 3300025728 | Bacteria | 4334 |
| 323 | Ga0207655_1018673 | 3300025728 | Bacteria | 3664 |
| 324 | Ga0207655_1048845 | 3300025728 | Bacteria | 1733 |
| 325 | Ga0207713_1000061 | 3300025735 | Bacteria | 209289 |
| 326 | Ga0207713_1000131 | 3300025735 | Bacteria | 114570 |
| 327 | Ga0207713_1000143 | 3300025735 | Bacteria | 107175 |
| 328 | Ga0207713_1000981 | 3300025735 | Bacteria | 25131 |
| 329 | Ga0207713_1001052 | 3300025735 | Bacteria | 23917 |
| 330 | Ga0207713_1002396 | 3300025735 | Bacteria | 13703 |
| 331 | Ga0207713_1004346 | 3300025735 | Bacteria | 9222 |
| 332 | Ga0207713_1004456 | 3300025735 | Bacteria | 9072 |
| 333 | Ga0207713_1004727 | 3300025735 | Bacteria | 8759 |
| 334 | Ga0207713_1010956 | 3300025735 | Bacteria | 4975 |
| 335 | Ga0207713_1018782 | 3300025735 | Bacteria | 3409 |
| 336 | Ga0207713_1024822 | 3300025735 | Bacteria | 2783 |
| 337 | Ga0207647_10005805 | 3300025904 | Bacteria | 9001 |
| 338 | Ga0207647_10006270 | 3300025904 | Bacteria | 8658 |
| 339 | Ga0207705_10014795 | 3300025909 | Bacteria | 5610 |
| 340 | Ga0207707_10131006 | 3300025912 | Bacteria | 2193 |
| 341 | Ga0207695_10131818 | 3300025913 | Bacteria | 2456 |
| 342 | Ga0207695_10189141 | 3300025913 | Bacteria | 1976 |
| 343 | Ga0207695_10241014 | 3300025913 | Bacteria | 1710 |
| 344 | Ga0207671_10009655 | 3300025914 | Bacteria | 8042 |
| 345 | Ga0207671_10067655 | 3300025914 | Bacteria | 2660 |
| 346 | Ga0207671_10117547 | 3300025914 | Bacteria | 2030 |
| 347 | Ga0207671_10152347 | 3300025914 | Bacteria | 1787 |
| 348 | Ga0207657_10000063 | 3300025919 | Bacteria | 100065 |
| 349 | Ga0207657_10111346 | 3300025919 | Bacteria | 2260 |
| 350 | Ga0207649_10000954 | 3300025920 | Bacteria | 17951 |
| 351 | Ga0207652_10270711 | 3300025921 | Bacteria | 1532 |
| 352 | Ga0207681_10000430 | 3300025923 | Bacteria | 29298 |
| 353 | Ga0207681_10009773 | 3300025923 | Bacteria | 5868 |
| 354 | Ga0207650_10000342 | 3300025925 | Bacteria | 45115 |
| 355 | Ga0207650_10001314 | 3300025925 | Bacteria | 17994 |
| 356 | Ga0207650_10001731 | 3300025925 | Bacteria | 15512 |
| 357 | Ga0207644_10382862 | 3300025931 | Bacteria | 1147 |
| 358 | Ga0207690_10000025 | 3300025932 | Bacteria | 179019 |
| 359 | Ga0207706_10035244 | 3300025933 | Bacteria | 4450 |
| 360 | Ga0207686_10020157 | 3300025934 | Bacteria | 3805 |
| 361 | Ga0207709_10000565 | 3300025935 | Bacteria | 31347 |
| 362 | Ga0207709_10006707 | 3300025935 | Bacteria | 6452 |
| 363 | Ga0207709_10007302 | 3300025935 | Bacteria | 6161 |
| 364 | Ga0207709_10143029 | 3300025935 | Bacteria | 1647 |
| 365 | Ga0207679_10000097 | 3300025945 | Bacteria | 75900 |
| 366 | Ga0207679_10204851 | 3300025945 | Bacteria | 1650 |
| 367 | Ga0207667_10015164 | 3300025949 | Bacteria | 8763 |
| 368 | Ga0207667_10550072 | 3300025949 | Bacteria | 1167 |
| 369 | Ga0207668_10042064 | 3300025972 | Bacteria | 3092 |
| 370 | Ga0207668_10438330 | 3300025972 | Bacteria | 1112 |
| 371 | Ga0207640_10079434 | 3300025981 | Bacteria | 2236 |
| 372 | Ga0207639_10185651 | 3300026041 | Bacteria | 1772 |
| 373 | Ga0207678_10001764 | 3300026067 | Bacteria | 19809 |
| 374 | Ga0207678_10446914 | 3300026067 | Bacteria | 1123 |
| 375 | Ga0209281_1000111 | 3300027111 | Bacteria | 215615 |
| 376 | Ga0209281_1000185 | 3300027111 | Bacteria | 144489 |
| 377 | Ga0209281_1003108 | 3300027111 | Bacteria | 5783 |
| 378 | Ga0209281_1010652 | 3300027111 | Bacteria | 2094 |
| 379 | Ga0209389_1000209 | 3300027296 | Bacteria | 41871 |
| 380 | Ga0209371_1000012 | 3300027312 | Bacteria | 748304 |
| 381 | Ga0209371_1005132 | 3300027312 | Bacteria | 5354 |
| 382 | Ga0209371_1016228 | 3300027312 | Bacteria | 1971 |
| 383 | Ga0209371_1018713 | 3300027312 | Bacteria | 1750 |
| 384 | Ga0209282_1000012 | 3300027666 | Bacteria | 215614 |
| 385 | Ga0209282_1000071 | 3300027666 | Bacteria | 81290 |
| 386 | Ga0207428_10011547 | 3300027907 | Bacteria | 7801 |
| 387 | Ga0268266_10014202 | 3300028379 | Bacteria | 6851 |
| 388 | Ga0307517_10184945 | 3300028786 | Bacteria | 1336 |
| 389 | Ga0307515_10000112 | 3300028794 | Bacteria | 195015 |
| 390 | Ga0268256_1000013 | 3300030500 | Bacteria | 752103 |
| 391 | Ga0268256_1003987 | 3300030500 | Bacteria | 6360 |
| 392 | Ga0268256_1020963 | 3300030500 | Bacteria | 1750 |
| 393 | Ga0316179_1023760 | 3300030734 | Bacteria | 2382 |
| 394 | Ga0316178_1120627 | 3300030735 | Bacteria | 7866 |
| 395 | Ga0316181_1080007 | 3300030744 | Bacteria | 4217 |
| 396 | Ga0265327_10082800 | 3300031251 | Bacteria | 1580 |
| 397 | Ga0307509_10292339 | 3300031507 | Bacteria | 1383 |
| 398 | Ga0307408_100000964 | 3300031548 | Bacteria | 22306 |
| 399 | Ga0307408_100053314 | 3300031548 | Bacteria | 2919 |
| 400 | Ga0307408_100200897 | 3300031548 | Bacteria | 1613 |
| 401 | Ga0307508_10085555 | 3300031616 | Bacteria | 2736 |
| 402 | Ga0316576_10015489 | 3300031727 | Bacteria | 5119 |
| 403 | Ga0316576_10368959 | 3300031727 | Bacteria | 1067 |
| 404 | Ga0307405_10000024 | 3300031731 | Bacteria | 127508 |
| 405 | Ga0307405_10007115 | 3300031731 | Bacteria | 5565 |
| 406 | Ga0307410_10052825 | 3300031852 | Bacteria | 2747 |
| 407 | Ga0307407_10320645 | 3300031903 | Bacteria | 1087 |
| 408 | Ga0307412_10003494 | 3300031911 | Bacteria | 8734 |
| 409 | Ga0307412_10050430 | 3300031911 | Bacteria | 2746 |
| 410 | Ga0307412_10086938 | 3300031911 | Bacteria | 2177 |
| 411 | Ga0307412_10177169 | 3300031911 | Bacteria | 1600 |
| 412 | Ga0307412_10244725 | 3300031911 | Bacteria | 1389 |
| 413 | Ga0315914_1000007 | 3300031967 | Bacteria | 215597 |
| 414 | Ga0307409_100147664 | 3300031995 | Bacteria | 2036 |
| 415 | Ga0307409_100600789 | 3300031995 | Bacteria | 1087 |
| 416 | Ga0307414_10317469 | 3300032004 | Bacteria | 1325 |
| 417 | Ga0307411_10005341 | 3300032005 | Bacteria | 6294 |
| 418 | Ga0307415_100023316 | 3300032126 | Bacteria | 3839 |
| 419 | Ga0307415_100100310 | 3300032126 | Bacteria | 2121 |
| 420 | Ga0307510_10001036 | 3300033180 | Bacteria | 29463 |
| 421 | Ga0315913_1000003 | 3300033430 | Bacteria | 215608 |
| 422 | Ga0315915_1000011 | 3300033464 | Bacteria | 215597 |
| 423 | Ga0373955_0079621 | 3300035172 | Bacteria | 1849 |
| 424 | Ga0316574_0058587 | 3300035398 | Bacteria | 2413 |
| 425 | Ga0373935_0244893 | 3300035692 | Bacteria | 1253 |
| 426 | Ga0373925_0406645 | 3300037068 | Bacteria | 1111 |
| 427 | Ga0395899_0008648 | 3300037312 | Bacteria | 7833 |
| 428 | Ga0395899_0041664 | 3300037312 | Bacteria | 3431 |
| 429 | Ga0395900_0000021 | 3300037418 | Bacteria | 351144 |
| 430 | Ga0395900_0004025 | 3300037418 | Bacteria | 15686 |
| 431 | Ga0395898_0001431 | 3300037466 | Bacteria | 33828 |
| 432 | Ga0395898_0027682 | 3300037466 | Bacteria | 5685 |
| 433 | Ga0395905_0001781 | 3300037471 | Bacteria | 24995 |
| 434 | Ga0395905_0002538 | 3300037471 | Bacteria | 20138 |
| 435 | Ga0395905_0017230 | 3300037471 | Bacteria | 6860 |
| 436 | Ga0395905_0024723 | 3300037471 | Bacteria | 5668 |
| 437 | Ga0395901_0000004 | 3300038443 | Bacteria | 657361 |
| 438 | Ga0395901_0001615 | 3300038443 | Bacteria | 23341 |
| 439 | Ga0395901_0010310 | 3300038443 | Bacteria | 9466 |
| 440 | Ga0395901_0016229 | 3300038443 | Bacteria | 7586 |
| 441 | Ga0400485_09726 | 3300038735 | Bacteria | 6524 |
| 442 | Ga0436365_0648684 | 3300039437 | Bacteria | 13254 |
| 443 | Ga0436361_0148410 | 3300039447 | Bacteria | 11149 |
| 444 | Ga0436361_0778808 | 3300039447 | Bacteria | 5113 |
| 445 | Ga0436361_1083939 | 3300039447 | Bacteria | 4429 |
| 446 | Ga0436362_0072394 | 3300039453 | Bacteria | 1087 |
| 447 | Ga0439438_000367 | 3300041405 | Bacteria | 20233 |
| 448 | Ga0439438_001742 | 3300041405 | Bacteria | 9564 |
| 449 | Ga0439438_005658 | 3300041405 | Bacteria | 4554 |
| 450 | Ga0439447_000821 | 3300041407 | Bacteria | 11386 |
| 451 | Ga0439466_0004223 | 3300041411 | Bacteria | 5546 |
| 452 | Ga0439466_0011487 | 3300041411 | Bacteria | 3277 |
| 453 | Ga0439466_0038793 | 3300041411 | Bacteria | 1599 |
| 454 | Ga0451789_0984162 | 3300041443 | Bacteria | 1060 |
| 455 | Ga0451853_3401237 | 3300041512 | Bacteria | 1995 |
| 456 | Ga0439432_000016 | 3300042006 | Bacteria | 63199 |
| 457 | Ga0439432_002483 | 3300042006 | Bacteria | 6948 |
| 458 | Ga0439432_011051 | 3300042006 | Bacteria | 3112 |
| 459 | Ga0439449_0019179 | 3300042007 | Bacteria | 2564 |
| 460 | Ga0439452_000046 | 3300042010 | Bacteria | 130842 |
| 461 | Ga0439452_000081 | 3300042010 | Bacteria | 82231 |
| 462 | Ga0439452_009073 | 3300042010 | Bacteria | 2955 |
| 463 | Ga0450911_000010 | 3300042115 | Bacteria | 149605 |
| 464 | Ga0450911_000054 | 3300042115 | Bacteria | 47325 |
| 465 | Ga0450911_001511 | 3300042115 | Bacteria | 5293 |
| 466 | Ga0450904_000392 | 3300042139 | Bacteria | 9054 |
| 467 | Ga0450906_000089 | 3300042145 | Bacteria | 15146 |
| 468 | Ga0450910_003545 | 3300042147 | Bacteria | 2073 |
| 469 | Ga0439459_0001682 | 3300042438 | Bacteria | 3293 |
| 470 | Ga0466969_0000044 | 3300044656 | Bacteria | 68499 |
| 471 | Ga0466972_0046804 | 3300044658 | Bacteria | 2093 |
| 472 | Ga0466972_0125339 | 3300044658 | Bacteria | 1210 |
| 473 | Ga0466973_0046713 | 3300044659 | Bacteria | 4033 |
| 474 | Ga0466965_0000720 | 3300044683 | Bacteria | 12310 |
| 475 | Ga0466966_0031238 | 3300044684 | Bacteria | 3454 |
| 476 | Ga0466961_0000032 | 3300044693 | Bacteria | 85497 |
| 477 | Ga0466961_0000318 | 3300044693 | Bacteria | 31807 |
| 478 | Ga0466963_0105508 | 3300044694 | Bacteria | 1931 |
| 479 | Ga0466971_0009600 | 3300044719 | Bacteria | 4222 |
| 480 | Ga0466968_0016062 | 3300044735 | Bacteria | 2976 |
| 481 | Ga0466970_0000013 | 3300044765 | Bacteria | 83194 |
| 482 | Ga0466957_0000261 | 3300044842 | Bacteria | 25375 |
| 483 | Ga0466957_0002377 | 3300044842 | Bacteria | 10103 |
| 484 | Ga0466957_0006587 | 3300044842 | Bacteria | 6566 |
| 485 | Ga0466960_0100614 | 3300044901 | Bacteria | 1488 |
| 486 | Ga0466959_0177961 | 3300045049 | Bacteria | 1489 |
| 487 | Ga0451576_0016127 | 3300045051 | Bacteria | 8255 |
| 488 | Ga0451576_0020127 | 3300045051 | Bacteria | 7271 |
| 489 | Ga0466958_0009268 | 3300045836 | Bacteria | 5480 |
| 490 | Ga0495617_000032 | 3300046452 | Bacteria | 148986 |
| 491 | Ga0495617_000379 | 3300046452 | Bacteria | 24623 |
| 492 | Ga0495627_000101 | 3300046453 | Bacteria | 105414 |
| 493 | Ga0495627_000542 | 3300046453 | Bacteria | 31159 |
| 494 | Ga0495627_003724 | 3300046453 | Bacteria | 6594 |
| 495 | Ga0495592_0016134 | 3300046454 | Bacteria | 5666 |
| 496 | Ga0495592_0022194 | 3300046454 | Bacteria | 4828 |
| 497 | Ga0495591_000032 | 3300046458 | Bacteria | 176337 |
| 498 | Ga0495591_000082 | 3300046458 | Bacteria | 107579 |
| 499 | Ga0495591_000276 | 3300046458 | Bacteria | 47822 |
| 500 | Ga0495591_000801 | 3300046458 | Bacteria | 22293 |
| 501 | Ga0495591_007727 | 3300046458 | Bacteria | 4511 |
| 502 | Ga0495591_017828 | 3300046458 | Bacteria | 2425 |
| 503 | Ga0495629_0058774 | 3300046459 | Bacteria | 2688 |
| 504 | Ga0495638_0000092 | 3300046460 | Bacteria | 145060 |
| 505 | Ga0495638_0001204 | 3300046460 | Bacteria | 24721 |
| 506 | Ga0495638_0009547 | 3300046460 | Bacteria | 6799 |
| 507 | Ga0495638_0010113 | 3300046460 | Bacteria | 6572 |
| 508 | Ga0495638_0016398 | 3300046460 | Bacteria | 4963 |
| 509 | Ga0495638_0019474 | 3300046460 | Bacteria | 4490 |
| 510 | Ga0495638_0095099 | 3300046460 | Bacteria | 1790 |
| 511 | Ga0495653_0000077 | 3300046463 | Bacteria | 82295 |
| 512 | Ga0495653_0004452 | 3300046463 | Bacteria | 11315 |
| 513 | Ga0495653_0006325 | 3300046463 | Bacteria | 9718 |
| 514 | Ga0495653_0013191 | 3300046463 | Bacteria | 6737 |
| 515 | Ga0495650_0000100 | 3300046471 | Bacteria | 213752 |
| 516 | Ga0495650_0000251 | 3300046471 | Bacteria | 105577 |
| 517 | Ga0495650_0001410 | 3300046471 | Bacteria | 23440 |
| 518 | Ga0495650_0003877 | 3300046471 | Bacteria | 10589 |
| 519 | Ga0495650_0005160 | 3300046471 | Bacteria | 8609 |
| 520 | Ga0495650_0025246 | 3300046471 | Bacteria | 2789 |
| 521 | Ga0495650_0032572 | 3300046471 | Bacteria | 2329 |
| 522 | Ga0495582_0051801 | 3300046473 | Bacteria | 2263 |
| 523 | Ga0495605_0000097 | 3300046474 | Bacteria | 109966 |
| 524 | Ga0495605_0000670 | 3300046474 | Bacteria | 25905 |
| 525 | Ga0495605_0002687 | 3300046474 | Bacteria | 10893 |
| 526 | Ga0495664_0005352 | 3300046477 | Bacteria | 7044 |
| 527 | Ga0495584_0000739 | 3300046491 | Bacteria | 21572 |
| 528 | Ga0495584_0003170 | 3300046491 | Bacteria | 9137 |
| 529 | Ga0495585_0000120 | 3300046492 | Bacteria | 85123 |
| 530 | Ga0495585_0000630 | 3300046492 | Bacteria | 32592 |
| 531 | Ga0495585_0001431 | 3300046492 | Bacteria | 18733 |
| 532 | Ga0495585_0068095 | 3300046492 | Bacteria | 1945 |
| 533 | Ga0495607_0000259 | 3300046501 | Bacteria | 56558 |
| 534 | Ga0495607_0000517 | 3300046501 | Bacteria | 38004 |
| 535 | Ga0495607_0002064 | 3300046501 | Bacteria | 16791 |
| 536 | Ga0495607_0004919 | 3300046501 | Bacteria | 9715 |
| 537 | Ga0495607_0039900 | 3300046501 | Bacteria | 2800 |
| 538 | Ga0495583_0000131 | 3300046506 | Bacteria | 125393 |
| 539 | Ga0495583_0000923 | 3300046506 | Bacteria | 34538 |
| 540 | Ga0495583_0053888 | 3300046506 | Bacteria | 1823 |
| 541 | Ga0495606_0000339 | 3300046507 | Bacteria | 80460 |
| 542 | Ga0495606_0000507 | 3300046507 | Bacteria | 63148 |
| 543 | Ga0495606_0000656 | 3300046507 | Bacteria | 54383 |
| 544 | Ga0495606_0000724 | 3300046507 | Bacteria | 51037 |
| 545 | Ga0495606_0000770 | 3300046507 | Bacteria | 49201 |
| 546 | Ga0495606_0001326 | 3300046507 | Bacteria | 33799 |
| 547 | Ga0495606_0002444 | 3300046507 | Bacteria | 21594 |
| 548 | Ga0495606_0007864 | 3300046507 | Bacteria | 9411 |
| 549 | Ga0495606_0012937 | 3300046507 | Bacteria | 6641 |
| 550 | Ga0495606_0015041 | 3300046507 | Bacteria | 5993 |
| 551 | Ga0495606_0028028 | 3300046507 | Bacteria | 3980 |
| 552 | Ga0495606_0044293 | 3300046507 | Bacteria | 2960 |
| 553 | Ga0495608_0025978 | 3300046511 | Bacteria | 3996 |
| 554 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 555 | Ga0495610_0000250 | 3300046512 | Bacteria | 56512 |
| 556 | Ga0495610_0000264 | 3300046512 | Bacteria | 54880 |
| 557 | Ga0495610_0000359 | 3300046512 | Bacteria | 47594 |
| 558 | Ga0495610_0001418 | 3300046512 | Bacteria | 21195 |
| 559 | Ga0495610_0002374 | 3300046512 | Bacteria | 15892 |
| 560 | Ga0495610_0011355 | 3300046512 | Bacteria | 5453 |
| 561 | Ga0495610_0018718 | 3300046512 | Bacteria | 3898 |
| 562 | Ga0495610_0021874 | 3300046512 | Bacteria | 3509 |
| 563 | Ga0495610_0056236 | 3300046512 | Bacteria | 1892 |
| 564 | Ga0495616_0000041 | 3300046513 | Bacteria | 122413 |
| 565 | Ga0495616_0000203 | 3300046513 | Bacteria | 49328 |
| 566 | Ga0495616_0000454 | 3300046513 | Bacteria | 31292 |
| 567 | Ga0495616_0000615 | 3300046513 | Bacteria | 26805 |
| 568 | Ga0495618_0005072 | 3300046514 | Bacteria | 8045 |
| 569 | Ga0495620_0000002 | 3300046515 | Bacteria | 373737 |
| 570 | Ga0495620_0000021 | 3300046515 | Bacteria | 139145 |
| 571 | Ga0495620_0000646 | 3300046515 | Bacteria | 21714 |
| 572 | Ga0495620_0007292 | 3300046515 | Bacteria | 6021 |
| 573 | Ga0495620_0067005 | 3300046515 | Bacteria | 1478 |
| 574 | Ga0495628_0089220 | 3300046516 | Bacteria | 2388 |
| 575 | Ga0495628_0111238 | 3300046516 | Bacteria | 2106 |
| 576 | Ga0495630_0009126 | 3300046517 | Bacteria | 7132 |
| 577 | Ga0495631_0000419 | 3300046518 | Bacteria | 29233 |
| 578 | Ga0495632_0000078 | 3300046519 | Bacteria | 100643 |
| 579 | Ga0495632_0000097 | 3300046519 | Bacteria | 88746 |
| 580 | Ga0495632_0002448 | 3300046519 | Bacteria | 14118 |
| 581 | Ga0495632_0010930 | 3300046519 | Bacteria | 5328 |
| 582 | Ga0495632_0043881 | 3300046519 | Bacteria | 2233 |
| 583 | Ga0495637_0000621 | 3300046520 | Bacteria | 25075 |
| 584 | Ga0495637_0000888 | 3300046520 | Bacteria | 19276 |
| 585 | Ga0495637_0012376 | 3300046520 | Bacteria | 4082 |
| 586 | Ga0495637_0035989 | 3300046520 | Bacteria | 2159 |
| 587 | Ga0495643_0000583 | 3300046522 | Bacteria | 44498 |
| 588 | Ga0495643_0000660 | 3300046522 | Bacteria | 40679 |
| 589 | Ga0495643_0004116 | 3300046522 | Bacteria | 10343 |
| 590 | Ga0495643_0084194 | 3300046522 | Bacteria | 1650 |
| 591 | Ga0495648_0000408 | 3300046524 | Bacteria | 47397 |
| 592 | Ga0495648_0002220 | 3300046524 | Bacteria | 18185 |
| 593 | Ga0495648_0002382 | 3300046524 | Bacteria | 17457 |
| 594 | Ga0495648_0002623 | 3300046524 | Bacteria | 16383 |
| 595 | Ga0495648_0004429 | 3300046524 | Bacteria | 11998 |
| 596 | Ga0495648_0017564 | 3300046524 | Bacteria | 5109 |
| 597 | Ga0495648_0021429 | 3300046524 | Bacteria | 4474 |
| 598 | Ga0495648_0025679 | 3300046524 | Bacteria | 3983 |
| 599 | Ga0495648_0026292 | 3300046524 | Bacteria | 3920 |
| 600 | Ga0495666_0002377 | 3300046526 | Bacteria | 9378 |
| 601 | Ga0495666_0004817 | 3300046526 | Bacteria | 6825 |
| 602 | Ga0495652_0068039 | 3300046529 | Bacteria | 2984 |
| 603 | Ga0495654_0000030 | 3300046530 | Bacteria | 216715 |
| 604 | Ga0495654_0000050 | 3300046530 | Bacteria | 146814 |
| 605 | Ga0495654_0000059 | 3300046530 | Bacteria | 137056 |
| 606 | Ga0495654_0001095 | 3300046530 | Bacteria | 19641 |
| 607 | Ga0495654_0013011 | 3300046530 | Bacteria | 4458 |
| 608 | Ga0495654_0014574 | 3300046530 | Bacteria | 4182 |
| 609 | Ga0495654_0018496 | 3300046530 | Bacteria | 3650 |
| 610 | Ga0495654_0060775 | 3300046530 | Bacteria | 1815 |
| 611 | Ga0495654_0069058 | 3300046530 | Bacteria | 1678 |
| 612 | Ga0495665_0004564 | 3300046531 | Bacteria | 7475 |
| 613 | Ga0495640_0006408 | 3300046533 | Bacteria | 9306 |
| 614 | Ga0495586_0020486 | 3300046535 | Bacteria | 3521 |
| 615 | Ga0495587_0004755 | 3300046536 | Bacteria | 8913 |
| 616 | Ga0495609_0000504 | 3300046538 | Bacteria | 31406 |
| 617 | Ga0495609_0000648 | 3300046538 | Bacteria | 27101 |
| 618 | Ga0495609_0008920 | 3300046538 | Bacteria | 4878 |
| 619 | Ga0495597_0000117 | 3300046542 | Bacteria | 71911 |
| 620 | Ga0495597_0000153 | 3300046542 | Bacteria | 61233 |
| 621 | Ga0495645_0018745 | 3300046543 | Bacteria | 4976 |
| 622 | Ga0495622_0000017 | 3300046557 | Bacteria | 176313 |
| 623 | Ga0495622_0000420 | 3300046557 | Bacteria | 28044 |
| 624 | Ga0495622_0005699 | 3300046557 | Bacteria | 5777 |
| 625 | Ga0495622_0009536 | 3300046557 | Bacteria | 4492 |
| 626 | Ga0495633_0000556 | 3300046558 | Bacteria | 36606 |
| 627 | Ga0495633_0013478 | 3300046558 | Bacteria | 4307 |
| 628 | Ga0495668_0000446 | 3300046616 | Bacteria | 52728 |
| 629 | Ga0495668_0000766 | 3300046616 | Bacteria | 37601 |
| 630 | Ga0495668_0006587 | 3300046616 | Bacteria | 7578 |
| 631 | Ga0495634_0000551 | 3300046642 | Bacteria | 36662 |
| 632 | Ga0495634_0008216 | 3300046642 | Bacteria | 7782 |
| 633 | Ga0495634_0016182 | 3300046642 | Bacteria | 5338 |
| 634 | Ga0495611_0000024 | 3300046648 | Bacteria | 118898 |
| 635 | Ga0495611_0033788 | 3300046648 | Bacteria | 2258 |
| 636 | Ga0495625_0000103 | 3300046660 | Bacteria | 136109 |
| 637 | Ga0495625_0000303 | 3300046660 | Bacteria | 75996 |
| 638 | Ga0495625_0000861 | 3300046660 | Bacteria | 41279 |
| 639 | Ga0495625_0022301 | 3300046660 | Bacteria | 4857 |
| 640 | Ga0495625_0059278 | 3300046660 | Bacteria | 2716 |
| 641 | Ga0495625_0081866 | 3300046660 | Bacteria | 2246 |
| 642 | Ga0495635_0000203 | 3300046663 | Bacteria | 37524 |
| 643 | Ga0495635_0045810 | 3300046663 | Bacteria | 3017 |
| 644 | Ga0495661_0000085 | 3300046665 | Bacteria | 114501 |
| 645 | Ga0495661_0013740 | 3300046665 | Bacteria | 5434 |
| 646 | Ga0495588_0003777 | 3300046674 | Bacteria | 6632 |
| 647 | Ga0495588_0063831 | 3300046674 | Bacteria | 1910 |
| 648 | Ga0495657_0034251 | 3300046675 | Bacteria | 3528 |
| 649 | Ga0495599_0173791 | 3300046678 | Bacteria | 1329 |
| 650 | Ga0495623_0000841 | 3300046679 | Bacteria | 20754 |
| 651 | Ga0495623_0005535 | 3300046679 | Bacteria | 8251 |
| 652 | Ga0495646_0001184 | 3300046680 | Bacteria | 15267 |
| 653 | Ga0495646_0003629 | 3300046680 | Bacteria | 9628 |
| 654 | Ga0495646_0024322 | 3300046680 | Bacteria | 3814 |
| 655 | Ga0495613_0004522 | 3300046689 | Bacteria | 10425 |
| 656 | Ga0495624_0001661 | 3300046690 | Bacteria | 17058 |
| 657 | Ga0495624_0027202 | 3300046690 | Bacteria | 3746 |
| 658 | Ga0495670_0000020 | 3300046691 | Bacteria | 110171 |
| 659 | Ga0495671_0000026 | 3300046692 | Bacteria | 237110 |
| 660 | Ga0495671_0000950 | 3300046692 | Bacteria | 20380 |
| 661 | Ga0495671_0001525 | 3300046692 | Bacteria | 15437 |
| 662 | Ga0495671_0017425 | 3300046692 | Bacteria | 3824 |
| 663 | Ga0495649_0001301 | 3300046694 | Bacteria | 19082 |
| 664 | Ga0495649_0001326 | 3300046694 | Bacteria | 18813 |
| 665 | Ga0495649_0012802 | 3300046694 | Bacteria | 4863 |
| 666 | Ga0495649_0014530 | 3300046694 | Bacteria | 4509 |
| 667 | Ga0495649_0015060 | 3300046694 | Bacteria | 4410 |
| 668 | Ga0495649_0101647 | 3300046694 | Bacteria | 1527 |
| 669 | Ga0495589_0000011 | 3300046794 | Bacteria | 250370 |
| 670 | Ga0495589_0000740 | 3300046794 | Bacteria | 21033 |
| 671 | Ga0495589_0005399 | 3300046794 | Bacteria | 6742 |
| 672 | Ga0495600_0001400 | 3300046809 | Bacteria | 13306 |
| 673 | Ga0495660_0000136 | 3300046810 | Bacteria | 79750 |
| 674 | Ga0495660_0001104 | 3300046810 | Bacteria | 19276 |
| 675 | Ga0495660_0003859 | 3300046810 | Bacteria | 9164 |
| 676 | Ga0495660_0005434 | 3300046810 | Bacteria | 7629 |
| 677 | Ga0495660_0016925 | 3300046810 | Bacteria | 4198 |
| 678 | Ga0495660_0087732 | 3300046810 | Bacteria | 1622 |
| 679 | Ga0495660_0097434 | 3300046810 | Bacteria | 1518 |
| 680 | Ga0495581_0001521 | 3300047315 | Bacteria | 12918 |
| 681 | Ga0495604_0002202 | 3300047317 | Bacteria | 15620 |
| 682 | Ga0495604_0012528 | 3300047317 | Bacteria | 6745 |
| 683 | Ga0495604_0029355 | 3300047317 | Bacteria | 4374 |
| 684 | Ga0495604_0097674 | 3300047317 | Bacteria | 2165 |
| 685 | Ga0495604_0270827 | 3300047317 | Bacteria | 1150 |
| 686 | Ga0495674_0003267 | 3300047319 | Bacteria | 15751 |
| 687 | Ga0495674_0025702 | 3300047319 | Bacteria | 5393 |
| 688 | Ga0495674_0118307 | 3300047319 | Bacteria | 2240 |
| 689 | Ga0495672_0003731 | 3300047320 | Bacteria | 12850 |
| 690 | Ga0495672_0003855 | 3300047320 | Bacteria | 12611 |
| 691 | Ga0495672_0005016 | 3300047320 | Bacteria | 10591 |
| 692 | Ga0495672_0005116 | 3300047320 | Bacteria | 10465 |
| 693 | Ga0495676_0001880 | 3300047321 | Bacteria | 18431 |
| 694 | Ga0495676_0004531 | 3300047321 | Bacteria | 12713 |
| 695 | Ga0495680_0012135 | 3300047322 | Bacteria | 7603 |
| 696 | Ga0495680_0022052 | 3300047322 | Bacteria | 5318 |
| 697 | Ga0495683_0000139 | 3300047323 | Bacteria | 71403 |
| 698 | Ga0495683_0004036 | 3300047323 | Bacteria | 8430 |
| 699 | Ga0495675_0004609 | 3300047444 | Bacteria | 8367 |
| 700 | Ga0495675_0005302 | 3300047444 | Bacteria | 7852 |
| 701 | Ga0495675_0044517 | 3300047444 | Bacteria | 2827 |
| 702 | Ga0495679_000233 | 3300047446 | Bacteria | 46629 |
| 703 | Ga0495679_000440 | 3300047446 | Bacteria | 30708 |
| 704 | Ga0495679_000569 | 3300047446 | Bacteria | 25611 |
| 705 | Ga0495679_000780 | 3300047446 | Bacteria | 20160 |
| 706 | Ga0495679_026414 | 3300047446 | Bacteria | 1928 |
| 707 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 708 | Ga0495673_0000069 | 3300047469 | Bacteria | 218170 |
| 709 | Ga0495673_0001184 | 3300047469 | Bacteria | 21958 |
| 710 | Ga0495673_0001421 | 3300047469 | Bacteria | 19171 |
| 711 | Ga0495673_0003804 | 3300047469 | Bacteria | 9754 |
| 712 | Ga0495673_0047182 | 3300047469 | Bacteria | 1905 |
| 713 | Ga0495673_0084971 | 3300047469 | Bacteria | 1303 |
| 714 | Ga0495681_0000109 | 3300047470 | Bacteria | 71558 |
| 715 | Ga0495681_0000370 | 3300047470 | Bacteria | 35144 |
| 716 | Ga0495681_0001460 | 3300047470 | Bacteria | 17676 |
| 717 | Ga0495681_0002166 | 3300047470 | Bacteria | 14237 |
| 718 | Ga0495681_0038749 | 3300047470 | Bacteria | 2333 |
| 719 | Ga0495684_0011799 | 3300047471 | Bacteria | 6742 |
| 720 | Ga0495686_0000266 | 3300047472 | Bacteria | 93781 |
| 721 | Ga0495686_0000653 | 3300047472 | Bacteria | 47362 |
| 722 | Ga0495686_0003817 | 3300047472 | Bacteria | 12778 |
| 723 | Ga0495686_0011858 | 3300047472 | Bacteria | 6129 |
| 724 | Ga0495686_0048052 | 3300047472 | Bacteria | 2692 |
| 725 | Ga0495686_0111908 | 3300047472 | Bacteria | 1636 |
| 726 | Ga0495593_0004240 | 3300047673 | Bacteria | 8527 |
| 727 | Ga0495593_0015742 | 3300047673 | Bacteria | 4275 |
| 728 | Ga0495593_0097103 | 3300047673 | Bacteria | 1513 |
| 729 | Ga0495602_0001929 | 3300048088 | Bacteria | 20798 |
| 730 | Ga0495602_0014867 | 3300048088 | Bacteria | 7879 |
| 731 | Ga0495602_0016763 | 3300048088 | Bacteria | 7357 |
| 732 | Ga0495602_0155740 | 3300048088 | Bacteria | 1789 |
| 733 | Ga0495614_0000262 | 3300048089 | Bacteria | 20541 |
| 734 | Ga0495626_0000074 | 3300048091 | Bacteria | 132552 |
| 735 | Ga0495626_0000326 | 3300048091 | Bacteria | 50232 |
| 736 | Ga0495626_0000394 | 3300048091 | Bacteria | 45106 |
| 737 | Ga0495626_0059754 | 3300048091 | Bacteria | 1738 |
| 738 | Ga0496100_0033040 | 3300048903 | Bacteria | 3234 |
| 739 | Ga0496102_0000659 | 3300048905 | Bacteria | 34506 |
| 740 | Ga0496102_0214164 | 3300048905 | Bacteria | 1816 |
| 741 | Ga0496103_0000839 | 3300048906 | Bacteria | 22466 |
| 742 | Ga0496103_0001333 | 3300048906 | Bacteria | 16717 |
| 743 | Ga0496104_0087727 | 3300048907 | Bacteria | 2971 |
| 744 | Ga0496110_0119215 | 3300048913 | Bacteria | 2377 |
| 745 | Ga0496111_0001272 | 3300048914 | Bacteria | 14126 |
| 746 | Ga0496114_0012065 | 3300048917 | Bacteria | 6914 |
| 747 | Ga0496114_0145344 | 3300048917 | Bacteria | 2055 |
| 748 | Ga0496114_0364924 | 3300048917 | Bacteria | 1278 |
| 749 | Ga0496115_0118077 | 3300048918 | Bacteria | 2182 |
| 750 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 751 | Ga0496116_0000654 | 3300048919 | Bacteria | 45317 |
| 752 | Ga0496116_0000857 | 3300048919 | Bacteria | 38047 |
| 753 | Ga0496116_0001333 | 3300048919 | Bacteria | 28080 |
| 754 | Ga0496116_0033797 | 3300048919 | Bacteria | 3622 |
| 755 | Ga0496116_0046769 | 3300048919 | Bacteria | 2918 |
| 756 | Ga0496117_0000083 | 3300048920 | Bacteria | 218945 |
| 757 | Ga0496117_0001203 | 3300048920 | Bacteria | 38893 |
| 758 | Ga0496117_0001218 | 3300048920 | Bacteria | 38567 |
| 759 | Ga0496117_0001929 | 3300048920 | Bacteria | 27669 |
| 760 | Ga0496117_0004699 | 3300048920 | Bacteria | 14839 |
| 761 | Ga0496117_0005079 | 3300048920 | Bacteria | 14084 |
| 762 | Ga0496117_0007592 | 3300048920 | Bacteria | 10541 |
| 763 | Ga0496117_0012990 | 3300048920 | Bacteria | 7295 |
| 764 | Ga0496117_0015538 | 3300048920 | Bacteria | 6480 |
| 765 | Ga0496117_0026279 | 3300048920 | Bacteria | 4558 |
| 766 | Ga0496117_0031918 | 3300048920 | Bacteria | 4013 |
| 767 | Ga0496117_0042094 | 3300048920 | Bacteria | 3337 |
| 768 | Ga0496117_0048849 | 3300048920 | Bacteria | 3016 |
| 769 | Ga0496117_0054958 | 3300048920 | Bacteria | 2786 |
| 770 | Ga0496117_0099895 | 3300048920 | Bacteria | 1839 |
| 771 | Ga0496117_0136717 | 3300048920 | Bacteria | 1475 |
| 772 | Ga0496118_0002447 | 3300048921 | Bacteria | 24994 |
| 773 | Ga0496118_0003000 | 3300048921 | Bacteria | 21801 |
| 774 | Ga0496118_0005809 | 3300048921 | Bacteria | 13832 |
| 775 | Ga0496118_0007347 | 3300048921 | Bacteria | 11715 |
| 776 | Ga0496118_0023509 | 3300048921 | Bacteria | 5350 |
| 777 | Ga0496118_0023969 | 3300048921 | Bacteria | 5282 |
| 778 | Ga0496118_0029726 | 3300048921 | Bacteria | 4576 |
| 779 | Ga0496118_0034322 | 3300048921 | Bacteria | 4142 |
| 780 | Ga0496118_0046977 | 3300048921 | Bacteria | 3352 |
| 781 | Ga0496118_0085659 | 3300048921 | Bacteria | 2193 |
| 782 | Ga0496119_0008762 | 3300048922 | Bacteria | 8818 |
| 783 | Ga0496119_0043800 | 3300048922 | Bacteria | 2824 |
| 784 | Ga0496119_0046501 | 3300048922 | Bacteria | 2709 |
| 785 | Ga0496119_0053675 | 3300048922 | Bacteria | 2460 |
| 786 | Ga0496120_0000030 | 3300048923 | Bacteria | 226066 |
| 787 | Ga0496120_0001071 | 3300048923 | Bacteria | 36173 |
| 788 | Ga0496120_0001883 | 3300048923 | Bacteria | 23304 |
| 789 | Ga0496120_0003959 | 3300048923 | Bacteria | 12877 |
| 790 | Ga0496120_0006699 | 3300048923 | Bacteria | 8771 |
| 791 | Ga0496120_0011253 | 3300048923 | Bacteria | 6168 |
| 792 | Ga0496120_0047971 | 3300048923 | Bacteria | 2460 |
| 793 | Ga0496121_0000216 | 3300048924 | Bacteria | 127028 |
| 794 | Ga0496121_0000635 | 3300048924 | Bacteria | 65524 |
| 795 | Ga0496121_0001858 | 3300048924 | Bacteria | 33891 |
| 796 | Ga0496121_0003396 | 3300048924 | Bacteria | 22781 |
| 797 | Ga0496121_0003670 | 3300048924 | Bacteria | 21579 |
| 798 | Ga0496121_0010257 | 3300048924 | Bacteria | 10600 |
| 799 | Ga0496121_0048038 | 3300048924 | Bacteria | 3635 |
| 800 | Ga0496121_0056216 | 3300048924 | Bacteria | 3270 |
| 801 | Ga0496121_0116557 | 3300048924 | Bacteria | 2026 |
| 802 | Ga0496121_0168806 | 3300048924 | Bacteria | 1592 |
| 803 | Ga0496121_0198519 | 3300048924 | Bacteria | 1432 |
| 804 | Ga0496122_0000050 | 3300048925 | Bacteria | 267874 |
| 805 | Ga0496122_0000072 | 3300048925 | Bacteria | 222436 |
| 806 | Ga0496122_0000696 | 3300048925 | Bacteria | 66890 |
| 807 | Ga0496122_0000776 | 3300048925 | Bacteria | 61446 |
| 808 | Ga0496122_0001980 | 3300048925 | Bacteria | 30575 |
| 809 | Ga0496122_0009517 | 3300048925 | Bacteria | 10220 |
| 810 | Ga0496122_0010072 | 3300048925 | Bacteria | 9816 |
| 811 | Ga0496122_0016896 | 3300048925 | Bacteria | 6861 |
| 812 | Ga0496122_0019851 | 3300048925 | Bacteria | 6115 |
| 813 | Ga0496122_0034800 | 3300048925 | Bacteria | 4112 |
| 814 | Ga0496122_0045223 | 3300048925 | Bacteria | 3424 |
| 815 | Ga0496122_0046784 | 3300048925 | Bacteria | 3346 |
| 816 | Ga0496122_0067529 | 3300048925 | Bacteria | 2574 |
| 817 | Ga0496122_0095365 | 3300048925 | Bacteria | 2010 |
| 818 | Ga0496123_0000035 | 3300048926 | Bacteria | 267288 |
| 819 | Ga0496123_0000052 | 3300048926 | Bacteria | 236409 |
| 820 | Ga0496123_0000439 | 3300048926 | Bacteria | 74838 |
| 821 | Ga0496123_0001276 | 3300048926 | Bacteria | 35982 |
| 822 | Ga0496123_0002483 | 3300048926 | Bacteria | 22768 |
| 823 | Ga0496123_0005000 | 3300048926 | Bacteria | 13572 |
| 824 | Ga0496123_0007711 | 3300048926 | Bacteria | 10049 |
| 825 | Ga0496123_0013331 | 3300048926 | Bacteria | 6914 |
| 826 | Ga0496123_0013680 | 3300048926 | Bacteria | 6788 |
| 827 | Ga0496123_0028324 | 3300048926 | Bacteria | 4150 |
| 828 | Ga0496123_0029082 | 3300048926 | Bacteria | 4078 |
| 829 | Ga0496123_0032177 | 3300048926 | Bacteria | 3803 |
| 830 | Ga0496123_0039578 | 3300048926 | Bacteria | 3296 |
| 831 | Ga0496123_0054797 | 3300048926 | Bacteria | 2621 |
| 832 | Ga0496123_0178112 | 3300048926 | Bacteria | 1113 |
| 833 | Ga0496124_0001568 | 3300048927 | Bacteria | 33060 |
| 834 | Ga0496124_0002465 | 3300048927 | Bacteria | 24191 |
| 835 | Ga0496124_0018652 | 3300048927 | Bacteria | 6490 |
| 836 | Ga0496124_0020951 | 3300048927 | Bacteria | 6030 |
| 837 | Ga0496124_0027520 | 3300048927 | Bacteria | 5102 |
| 838 | Ga0496124_0046464 | 3300048927 | Bacteria | 3717 |
| 839 | Ga0496124_0060506 | 3300048927 | Bacteria | 3177 |
| 840 | Ga0496124_0062581 | 3300048927 | Bacteria | 3113 |
| 841 | Ga0496124_0064137 | 3300048927 | Bacteria | 3067 |
| 842 | Ga0496124_0078989 | 3300048927 | Bacteria | 2710 |
| 843 | Ga0496124_0091036 | 3300048927 | Bacteria | 2486 |
| 844 | Ga0496124_0120197 | 3300048927 | Bacteria | 2100 |
| 845 | Ga0496124_0144396 | 3300048927 | Bacteria | 1874 |
| 846 | Ga0496124_0150045 | 3300048927 | Bacteria | 1830 |
| 847 | Ga0496125_0000083 | 3300048928 | Bacteria | 227168 |
| 848 | Ga0496125_0000284 | 3300048928 | Bacteria | 100114 |
| 849 | Ga0496125_0000380 | 3300048928 | Bacteria | 82955 |
| 850 | Ga0496125_0001952 | 3300048928 | Bacteria | 28153 |
| 851 | Ga0496125_0002616 | 3300048928 | Bacteria | 23085 |
| 852 | Ga0496125_0011227 | 3300048928 | Bacteria | 8977 |
| 853 | Ga0496125_0013205 | 3300048928 | Bacteria | 8136 |
| 854 | Ga0496125_0013807 | 3300048928 | Bacteria | 7912 |
| 855 | Ga0496125_0047750 | 3300048928 | Bacteria | 3575 |
| 856 | Ga0496126_0000059 | 3300048929 | Bacteria | 267449 |
| 857 | Ga0496126_0023387 | 3300048929 | Bacteria | 5989 |
| 858 | Ga0496126_0025397 | 3300048929 | Bacteria | 5700 |
| 859 | Ga0496126_0044235 | 3300048929 | Bacteria | 4102 |
| 860 | Ga0496126_0045862 | 3300048929 | Bacteria | 4014 |
| 861 | Ga0496126_0086052 | 3300048929 | Bacteria | 2770 |
| 862 | Ga0496126_0176205 | 3300048929 | Bacteria | 1819 |
| 863 | Ga0496126_0205637 | 3300048929 | Bacteria | 1660 |
| 864 | Ga0466983_0073864 | 3300048986 | Bacteria | 2858 |
| 865 | Ga0495678_000883 | 3300049459 | Bacteria | 26673 |
| 866 | Ga0495678_001048 | 3300049459 | Bacteria | 23397 |
| 867 | Ga0495678_003236 | 3300049459 | Bacteria | 10212 |
| 868 | Ga0495678_014652 | 3300049459 | Bacteria | 3640 |
| 869 | Ga0495682_0000054 | 3300049460 | Bacteria | 104787 |
| 870 | Ga0495682_0001160 | 3300049460 | Bacteria | 15137 |
| 871 | Ga0495682_0005108 | 3300049460 | Bacteria | 5499 |
| 872 | Ga0501032_0094992 | 3300049569 | Bacteria | 1976 |
| 873 | Ga0501032_0211529 | 3300049569 | Bacteria | 1264 |
| 874 | Ga0501032_0291198 | 3300049569 | Bacteria | 1056 |
| 875 | Ga0501033_0086527 | 3300049570 | Bacteria | 2294 |
| 876 | Ga0501034_0000012 | 3300049571 | Bacteria | 310504 |
| 877 | Ga0501034_0012453 | 3300049571 | Bacteria | 8783 |
| 878 | Ga0501034_0084905 | 3300049571 | Bacteria | 3167 |
| 879 | Ga0501036_0013996 | 3300049572 | Bacteria | 6667 |
| 880 | Ga0501036_0051379 | 3300049572 | Bacteria | 3490 |
| 881 | Ga0501037_0029131 | 3300049573 | Bacteria | 4079 |
| 882 | Ga0501037_0235276 | 3300049573 | Bacteria | 1285 |
| 883 | Ga0501038_0001324 | 3300049574 | Bacteria | 22533 |
| 884 | Ga0501038_0257156 | 3300049574 | Bacteria | 1381 |
| 885 | Ga0501038_0303248 | 3300049574 | Bacteria | 1253 |
| 886 | Ga0501039_0009870 | 3300049575 | Bacteria | 7281 |
| 887 | Ga0501039_0014805 | 3300049575 | Bacteria | 5966 |
| 888 | Ga0501039_0163374 | 3300049575 | Bacteria | 1751 |
| 889 | Ga0501040_0040498 | 3300049576 | Bacteria | 3171 |
| 890 | Ga0501041_0002166 | 3300049577 | Bacteria | 11078 |
| 891 | Ga0501043_0017229 | 3300049579 | Bacteria | 5667 |
| 892 | Ga0501043_0034195 | 3300049579 | Bacteria | 3998 |
| 893 | Ga0501043_0132853 | 3300049579 | Bacteria | 1950 |
| 894 | Ga0501046_0012126 | 3300049580 | Bacteria | 7348 |
| 895 | Ga0501046_0086408 | 3300049580 | Bacteria | 2418 |
| 896 | Ga0501047_0075233 | 3300049581 | Bacteria | 3250 |
| 897 | Ga0501047_0191915 | 3300049581 | Bacteria | 1906 |
| 898 | Ga0501047_0264272 | 3300049581 | Bacteria | 1568 |
| 899 | Ga0501048_0152311 | 3300049582 | Bacteria | 1636 |
| 900 | Ga0501048_0277564 | 3300049582 | Bacteria | 1191 |
| 901 | Ga0501067_0007384 | 3300049583 | Bacteria | 6105 |
| 902 | Ga0501067_0028994 | 3300049583 | Bacteria | 3068 |
| 903 | Ga0501068_0030388 | 3300049584 | Bacteria | 3204 |
| 904 | Ga0501069_0002823 | 3300049585 | Bacteria | 8891 |
| 905 | Ga0501070_0015461 | 3300049586 | Bacteria | 6421 |
| 906 | Ga0501070_0132980 | 3300049586 | Bacteria | 2054 |
| 907 | Ga0501071_0060221 | 3300049587 | Bacteria | 2748 |
| 908 | Ga0501072_0023777 | 3300049588 | Bacteria | 4760 |
| 909 | Ga0501073_0010995 | 3300049589 | Bacteria | 6619 |
| 910 | Ga0501074_0172302 | 3300049590 | Bacteria | 1544 |
| 911 | Ga0501079_0073381 | 3300049741 | Bacteria | 2645 |
| 912 | Ga0501080_0008605 | 3300049742 | Bacteria | 9260 |
| 913 | Ga0501080_0538798 | 3300049742 | Bacteria | 1040 |
| 914 | Ga0501083_0012781 | 3300049744 | Bacteria | 5872 |
| 915 | Ga0501083_0034999 | 3300049744 | Bacteria | 3432 |
| 916 | Ga0501083_0042724 | 3300049744 | Bacteria | 3072 |
| 917 | Ga0501035_0005026 | 3300049822 | Bacteria | 12528 |
| 918 | Ga0501044_0000197 | 3300049823 | Bacteria | 76234 |
| 919 | Ga0501044_0017480 | 3300049823 | Bacteria | 7697 |
| 920 | Ga0501044_0022584 | 3300049823 | Bacteria | 6704 |
| 921 | Ga0501044_0055613 | 3300049823 | Bacteria | 4064 |
| 922 | Ga0501044_0113390 | 3300049823 | Bacteria | 2718 |
| 923 | Ga0501044_0500462 | 3300049823 | Bacteria | 1116 |
| 924 | Ga0501226_000008 | 3300049853 | Bacteria | 199119 |
| 925 | nmdc:mga03683_90121_c1 | 3300050489 | Bacteria | 1336 |
| 926 | nmdc:mga03n38_12450_c1 | 3300050490 | Bacteria | 3202 |
| 927 | nmdc:mga03n38_15347_c1 | 3300050490 | Bacteria | 2956 |
| 928 | nmdc:mga00v17_104_c1 | 3300050491 | Bacteria | 50343 |
| 929 | nmdc:mga00v17_23406_c1 | 3300050491 | Bacteria | 3572 |
| 930 | nmdc:mga00v17_32_c1 | 3300050491 | Bacteria | 87395 |
| 931 | nmdc:mga0yw44_276136_c1 | 3300050492 | Bacteria | 1122 |
| 932 | nmdc:mga0yw44_5023_c1 | 3300050492 | Bacteria | 6180 |
| 933 | nmdc:mga0yw44_60177_c1 | 3300050492 | Bacteria | 2326 |
| 934 | nmdc:mga0yw44_6122_c1 | 3300050492 | Bacteria | 5777 |
| 935 | nmdc:mga0yw44_757_c1 | 3300050492 | Bacteria | 11977 |
| 936 | nmdc:mga06z11_130684_c1 | 3300050494 | Bacteria | 1410 |
| 937 | nmdc:mga06z11_16947_c1 | 3300050494 | Bacteria | 3295 |
| 938 | nmdc:mga06z11_27539_c1 | 3300050494 | Bacteria | 2717 |
| 939 | nmdc:mga06z11_34263_c1 | 3300050494 | Bacteria | 2491 |
| 940 | nmdc:mga06z11_71342_c1 | 3300050494 | Bacteria | 1839 |
| 941 | nmdc:mga04h51_16149_c1 | 3300050495 | Bacteria | 2164 |
| 942 | nmdc:mga07m45_77920_c1 | 3300050496 | Bacteria | 1891 |
| 943 | nmdc:mga05p37_59611_c1 | 3300050507 | Bacteria | 4700 |
| 944 | nmdc:mga0sz30_2467_c2 | 3300050516 | Bacteria | 3429 |
| 945 | nmdc:mga0sz30_30_c1 | 3300050516 | Bacteria | 55841 |
| 946 | nmdc:mga0sz30_5822_c1 | 3300050516 | Bacteria | 4543 |
| 947 | Ga0500651_0039591 | 3300053093 | Bacteria | 2968 |
| 948 | Ga0500641_0021103 | 3300053096 | Bacteria | 2478 |
| 949 | Ga0500555_001367 | 3300053103 | Bacteria | 7607 |
| 950 | Ga0500572_000268 | 3300053111 | Bacteria | 18816 |
| 951 | Ga0500618_002627 | 3300053125 | Bacteria | 6620 |
| 952 | Ga0500618_018846 | 3300053125 | Bacteria | 1703 |
| 953 | Ga0500658_0092640 | 3300053134 | Bacteria | 1309 |
| 954 | Ga0500659_0011667 | 3300053135 | Bacteria | 4795 |
| 955 | Ga0500561_0000140 | 3300053137 | Bacteria | 14036 |
| 956 | Ga0500568_0000163 | 3300053139 | Bacteria | 57189 |
| 957 | Ga0500568_0002348 | 3300053139 | Bacteria | 11214 |
| 958 | Ga0500573_0101848 | 3300053140 | Bacteria | 1615 |
| 959 | Ga0500588_0026597 | 3300053146 | Bacteria | 1620 |
| 960 | Ga0500604_0000934 | 3300053151 | Bacteria | 8079 |
| 961 | Ga0500616_0000941 | 3300053153 | Bacteria | 31719 |
| 962 | Ga0500624_000341 | 3300053157 | Bacteria | 15529 |
| 963 | Ga0500627_0021948 | 3300053158 | Bacteria | 2583 |
| 964 | Ga0500634_0000091 | 3300053161 | Bacteria | 34955 |
| 965 | Ga0500634_0002225 | 3300053161 | Bacteria | 8080 |
| 966 | Ga0500636_0002587 | 3300053177 | Bacteria | 10041 |
| 967 | Ga0500609_006418 | 3300053731 | Bacteria | 1601 |
| 968 | Ga0501084_0016873 | 3300054114 | Bacteria | 6068 |
| 969 | Ga0501084_0144285 | 3300054114 | Bacteria | 2005 |
| 970 | Ga0466962_0001725 | 3300061719 | Bacteria | 10271 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0291198 | Ga0501032_0291198_17_835 | 266 |
| 2 | 3300041512 | Ga0451853_3401237 | Ga0451853_3401237_774_1706 | 286 |
| 3 | 3300048914 | Ga0496111_0001272 | Ga0496111_0001272_5181_6149 | 287 |
| 4 | 3300048927 | Ga0496124_0062581 | Ga0496124_0062581_1308_2276 | 287 |
| 5 | 3300003320 | rootH2_10055630 | rootH2_100556302 | 298 |
| 6 | 3300003856 | Ga0058692_1000668 | Ga0058692_100066813 | 298 |
| 7 | 3300005548 | Ga0070665_100009039 | Ga0070665_1000090395 | 298 |
| 8 | 3300006177 | Ga0075362_10007557 | Ga0075362_100075572 | 298 |
| 9 | 3300006186 | Ga0075369_10005032 | Ga0075369_100050322 | 298 |
| 10 | 3300006195 | Ga0075366_10071103 | Ga0075366_100711032 | 298 |
| 11 | 3300006948 | Ga0099826_10008333 | Ga0099826_100083336 | 298 |
| 12 | 3300009148 | Ga0105243_10010726 | Ga0105243_100107267 | 298 |
| 13 | 3300013100 | Ga0157373_10001827 | Ga0157373_1000182710 | 298 |
| 14 | 3300013102 | Ga0157371_10000005 | Ga0157371_10000005169 | 298 |
| 15 | 3300013104 | Ga0157370_10000146 | Ga0157370_1000014669 | 298 |
| 16 | 3300025294 | Ga0209025_1000131 | Ga0209025_1000131134 | 298 |
| 17 | 3300027312 | Ga0209371_1000012 | Ga0209371_1000012465 | 298 |
| 18 | 3300027312 | Ga0209371_1016228 | Ga0209371_10162281 | 298 |
| 19 | 3300027666 | Ga0209282_1000071 | Ga0209282_10000714 | 298 |
| 20 | 3300028379 | Ga0268266_10014202 | Ga0268266_100142023 | 298 |
| 21 | 3300030500 | Ga0268256_1000013 | Ga0268256_1000013466 | 298 |
| 22 | 3300030744 | Ga0316181_1080007 | Ga0316181_10800073 | 298 |
| 23 | 3300046460 | Ga0495638_0000092 | Ga0495638_0000092_112389_113366 | 298 |
| 24 | 3300046507 | Ga0495606_0015041 | Ga0495606_0015041_3416_4312 | 298 |
| 25 | 3300047320 | Ga0495672_0003731 | Ga0495672_0003731_10596_11573 | 298 |
| 26 | 3300048920 | Ga0496117_0000083 | Ga0496117_0000083_103785_104750 | 298 |
| 27 | 3300048921 | Ga0496118_0003000 | Ga0496118_0003000_7277_8242 | 298 |
| 28 | 3300048921 | Ga0496118_0034322 | Ga0496118_0034322_1592_2557 | 298 |
| 29 | 3300048923 | Ga0496120_0000030 | Ga0496120_0000030_122109_123074 | 298 |
| 30 | 3300048923 | Ga0496120_0011253 | Ga0496120_0011253_4677_5642 | 298 |
| 31 | 3300048925 | Ga0496122_0000050 | Ga0496122_0000050_261117_262082 | 298 |
| 32 | 3300048925 | Ga0496122_0009517 | Ga0496122_0009517_7054_7950 | 298 |
| 33 | 3300048926 | Ga0496123_0000052 | Ga0496123_0000052_102532_103497 | 298 |
| 34 | 3300048927 | Ga0496124_0064137 | Ga0496124_0064137_558_1523 | 298 |
| 35 | 3300050490 | nmdc:mga03n38_12450_c1 | nmdc:mga03n38_12450_c1_1409_2374 | 298 |
| 36 | 3300050491 | nmdc:mga00v17_32_c1 | nmdc:mga00v17_32_c1_29427_30392 | 298 |
| 37 | 3300050492 | nmdc:mga0yw44_757_c1 | nmdc:mga0yw44_757_c1_661_1626 | 298 |
| 38 | 3300050494 | nmdc:mga06z11_71342_c1 | nmdc:mga06z11_71342_c1_232_1197 | 298 |
| 39 | 3300050495 | nmdc:mga04h51_16149_c1 | nmdc:mga04h51_16149_c1_714_1679 | 298 |
| 40 | 3300050496 | nmdc:mga07m45_77920_c1 | nmdc:mga07m45_77920_c1_882_1847 | 298 |
| 41 | 3300050516 | nmdc:mga0sz30_30_c1 | nmdc:mga0sz30_30_c1_25115_26080 | 298 |
| 42 | 3300050516 | nmdc:mga0sz30_5822_c1 | nmdc:mga0sz30_5822_c1_481_1446 | 298 |
| 43 | 3300053096 | Ga0500641_0021103 | Ga0500641_0021103_596_1492 | 298 |
| 44 | 3300053134 | Ga0500658_0092640 | Ga0500658_0092640_312_1208 | 298 |
| 45 | 3300053137 | Ga0500561_0000140 | Ga0500561_0000140_10511_11476 | 298 |
| 46 | 3300053139 | Ga0500568_0000163 | Ga0500568_0000163_23697_24674 | 298 |
| 47 | 3300053146 | Ga0500588_0026597 | Ga0500588_0026597_346_1242 | 298 |
| 48 | 3300053151 | Ga0500604_0000934 | Ga0500604_0000934_1963_2859 | 298 |
| 49 | 3300053153 | Ga0500616_0000941 | Ga0500616_0000941_29458_30435 | 298 |
| 50 | 3300053158 | Ga0500627_0021948 | Ga0500627_0021948_1589_2566 | 298 |
| 51 | 3300039447 | Ga0436361_0778808 | Ga0436361_0778808_2450_3391 | 299 |
| 52 | 3300046507 | Ga0495606_0044293 | Ga0495606_0044293_1360_2259 | 299 |
| 53 | 3300046463 | Ga0495653_0000077 | Ga0495653_0000077_77261_78202 | 300 |
| 54 | 3300046507 | Ga0495606_0000507 | Ga0495606_0000507_11904_12845 | 300 |
| 55 | 3300048922 | Ga0496119_0053675 | Ga0496119_0053675_1547_2449 | 300 |
| 56 | 3300049459 | Ga0495678_014652 | Ga0495678_014652_2528_3430 | 300 |
| 57 | 3300006051 | Ga0075364_10000309 | Ga0075364_100003094 | 301 |
| 58 | 3300044694 | Ga0466963_0105508 | Ga0466963_0105508_32_955 | 301 |
| 59 | 3300044765 | Ga0466970_0000013 | Ga0466970_0000013_41317_42240 | 301 |
| 60 | 3300044842 | Ga0466957_0006587 | Ga0466957_0006587_4403_5326 | 301 |
| 61 | 3300046524 | Ga0495648_0002623 | Ga0495648_0002623_2434_3378 | 301 |
| 62 | 3300047317 | Ga0495604_0270827 | Ga0495604_0270827_218_1123 | 301 |
| 63 | 3300047323 | Ga0495683_0004036 | Ga0495683_0004036_2987_3931 | 301 |
| 64 | 3300049579 | Ga0501043_0017229 | Ga0501043_0017229_1285_2208 | 301 |
| 65 | 3300049581 | Ga0501047_0264272 | Ga0501047_0264272_76_999 | 301 |
| 66 | 3300049586 | Ga0501070_0132980 | Ga0501070_0132980_1036_1959 | 301 |
| 67 | 3300049823 | Ga0501044_0055613 | Ga0501044_0055613_1209_2132 | 301 |
| 68 | 3300050491 | nmdc:mga00v17_104_c1 | nmdc:mga00v17_104_c1_14167_15132 | 301 |
| 69 | 3300017792 | Ga0163161_10092731 | Ga0163161_100927311 | 302 |
| 70 | 3300038735 | Ga0400485_09726 | Ga0400485_09726_4195_5121 | 302 |
| 71 | 3300053093 | Ga0500651_0039591 | Ga0500651_0039591_1740_2666 | 302 |
| 72 | 3300053103 | Ga0500555_001367 | Ga0500555_001367_1643_2569 | 302 |
| 73 | 3300025298 | Ga0209050_1011286 | Ga0209050_10112862 | 303 |
| 74 | 3300048928 | Ga0496125_0013807 | Ga0496125_0013807_2397_3362 | 303 |
| 75 | 3300025914 | Ga0207671_10152347 | Ga0207671_101523472 | 304 |
| 76 | 3300046471 | Ga0495650_0003877 | Ga0495650_0003877_8933_9877 | 304 |
| 77 | 3300046530 | Ga0495654_0000030 | Ga0495654_0000030_201873_202865 | 304 |
| 78 | 3300046694 | Ga0495649_0014530 | Ga0495649_0014530_1892_2839 | 304 |
| 79 | 3300003215 | JGI25153J46596_10000024 | JGI25153J46596_10000024143 | 305 |
| 80 | 3300003775 | Ga0055524_1000748 | Ga0055524_100074810 | 305 |
| 81 | 3300025291 | Ga0209675_1007013 | Ga0209675_10070134 | 305 |
| 82 | 3300025297 | Ga0209758_1000033 | Ga0209758_10000338 | 305 |
| 83 | 3300025299 | Ga0209256_1000030 | Ga0209256_1000030300 | 305 |
| 84 | 3300046522 | Ga0495643_0084194 | Ga0495643_0084194_568_1485 | 305 |
| 85 | 3300048917 | Ga0496114_0012065 | Ga0496114_0012065_4619_5563 | 305 |
| 86 | 3300003771 | Ga0055526_1023065 | Ga0055526_10230652 | 306 |
| 87 | 3300003775 | Ga0055524_1014052 | Ga0055524_10140523 | 306 |
| 88 | 3300003790 | Ga0055528_1000299 | Ga0055528_100029918 | 306 |
| 89 | 3300025273 | Ga0209673_1000054 | Ga0209673_1000054153 | 306 |
| 90 | 3300025295 | Ga0209564_1009879 | Ga0209564_10098794 | 306 |
| 91 | 3300025299 | Ga0209256_1004982 | Ga0209256_10049828 | 306 |
| 92 | 3300049459 | Ga0495678_001048 | Ga0495678_001048_26_946 | 306 |
| 93 | iso_pu_bacteria | 2891048133 | 2891048944 | 306 |
| 94 | iso_pu_bacteria | 2995392953 | 2995396729 | 306 |
| 95 | 3300013105 | Ga0157369_10003028 | Ga0157369_100030283 | 307 |
| 96 | 3300014497 | Ga0182008_10000704 | Ga0182008_100007047 | 307 |
| 97 | 3300046507 | Ga0495606_0000724 | Ga0495606_0000724_49737_50684 | 307 |
| 98 | iso_pu_bacteria | 2599185156 | 2599331658 | 307 |
| 99 | iso_pu_bacteria | 2643221568 | 2643854193 | 307 |
| 100 | iso_pu_bacteria | 2643221733 | 2644731750 | 307 |
| 101 | iso_pu_bacteria | 2808606373 | 2808906037 | 307 |
| 102 | iso_pu_bacteria | 2842922631 | 2842924061 | 307 |
| 103 | iso_pu_bacteria | 2919166419 | 2919168580 | 307 |
| 104 | iso_pu_bacteria | 2978969890 | 2978971267 | 307 |
| 105 | iso_pu_bacteria | 2984587000 | 2984588412 | 307 |
| 106 | 3300006051 | Ga0075364_10030304 | Ga0075364_100303042 | 308 |
| 107 | 3300037312 | Ga0395899_0008648 | Ga0395899_0008648_534_1496 | 308 |
| 108 | 3300037418 | Ga0395900_0000021 | Ga0395900_0000021_237119_238081 | 308 |
| 109 | 3300037466 | Ga0395898_0001431 | Ga0395898_0001431_28525_29487 | 308 |
| 110 | 3300037471 | Ga0395905_0024723 | Ga0395905_0024723_168_1130 | 308 |
| 111 | 3300038443 | Ga0395901_0001615 | Ga0395901_0001615_19788_20750 | 308 |
| 112 | 3300048924 | Ga0496121_0000635 | Ga0496121_0000635_2628_3569 | 308 |
| 113 | iso_pu_bacteria | 2599185288 | 2599880442 | 308 |
| 114 | iso_pu_bacteria | 2599185303 | 2599946828 | 308 |
| 115 | iso_pu_bacteria | 2738541294 | 2738806664 | 308 |
| 116 | iso_pu_bacteria | 2738541309 | 2738894024 | 308 |
| 117 | iso_pu_bacteria | 2808606385 | 2808979221 | 308 |
| 118 | iso_pu_bacteria | 2808606388 | 2808994896 | 308 |
| 119 | iso_pu_bacteria | 2852612431 | 2852614334 | 308 |
| 120 | iso_pu_bacteria | 2852667396 | 2852667928 | 308 |
| 121 | iso_pu_bacteria | 2919704043 | 2919705129 | 308 |
| 122 | 3300035398 | Ga0316574_0058587 | Ga0316574_0058587_1230_2174 | 309 |
| 123 | iso_pu_bacteria | 2510917030 | 2511199619 | 309 |
| 124 | iso_pu_bacteria | 2513237090 | 2513611438 | 309 |
| 125 | iso_pu_bacteria | 2519103095 | 2519463269 | 309 |
| 126 | iso_pu_bacteria | 2582581283 | 2585168586 | 309 |
| 127 | iso_pu_bacteria | 2582581298 | 2585226857 | 309 |
| 128 | iso_pu_bacteria | 2582581304 | 2585255634 | 309 |
| 129 | iso_pu_bacteria | 2582581306 | 2585268701 | 309 |
| 130 | iso_pu_bacteria | 2582581311 | 2585295133 | 309 |
| 131 | iso_pu_bacteria | 2582581865 | 2585389345 | 309 |
| 132 | iso_pu_bacteria | 2585427529 | 2585550272 | 309 |
| 133 | iso_pu_bacteria | 2585427594 | 2585842691 | 309 |
| 134 | iso_pu_bacteria | 2599185301 | 2599936897 | 309 |
| 135 | iso_pu_bacteria | 2643221607 | 2644047213 | 309 |
| 136 | iso_pu_bacteria | 2643221636 | 2644199584 | 309 |
| 137 | iso_pu_bacteria | 2643221686 | 2644480002 | 309 |
| 138 | iso_pu_bacteria | 2643221689 | 2644498291 | 309 |
| 139 | iso_pu_bacteria | 2643221734 | 2644734365 | 309 |
| 140 | iso_pu_bacteria | 2693429783 | 2694632775 | 309 |
| 141 | iso_pu_bacteria | 2693429784 | 2694639496 | 309 |
| 142 | iso_pu_bacteria | 2808606386 | 2808984960 | 309 |
| 143 | iso_pu_bacteria | 2816332253 | 2817263357 | 309 |
| 144 | iso_pu_bacteria | 2816332256 | 2817276738 | 309 |
| 145 | iso_pu_bacteria | 2816332286 | 2817452810 | 309 |
| 146 | iso_pu_bacteria | 2821131069 | 2821135767 | 309 |
| 147 | iso_pu_bacteria | 2837651117 | 2837652201 | 309 |
| 148 | iso_pu_bacteria | 2847670302 | 2847675464 | 309 |
| 149 | iso_pu_bacteria | 2856314179 | 2856319352 | 309 |
| 150 | iso_pu_bacteria | 2856364286 | 2856369299 | 309 |
| 151 | iso_pu_bacteria | 2857349434 | 2857351297 | 309 |
| 152 | iso_pu_bacteria | 2869285874 | 2869286628 | 309 |
| 153 | iso_pu_bacteria | 2871429161 | 2871434782 | 309 |
| 154 | iso_pu_bacteria | 2874146452 | 2874149985 | 309 |
| 155 | iso_pu_bacteria | 2874155637 | 2874158243 | 309 |
| 156 | iso_pu_bacteria | 2876369609 | 2876374449 | 309 |
| 157 | iso_pu_bacteria | 2876392853 | 2876397881 | 309 |
| 158 | iso_pu_bacteria | 2876413966 | 2876416447 | 309 |
| 159 | iso_pu_bacteria | 2878035449 | 2878040585 | 309 |
| 160 | iso_pu_bacteria | 2878745973 | 2878751915 | 309 |
| 161 | iso_pu_bacteria | 2881147464 | 2881149787 | 309 |
| 162 | iso_pu_bacteria | 2881161766 | 2881166642 | 309 |
| 163 | iso_pu_bacteria | 2885305155 | 2885308136 | 309 |
| 164 | iso_pu_bacteria | 2885334103 | 2885339956 | 309 |
| 165 | iso_pu_bacteria | 2888350351 | 2888355612 | 309 |
| 166 | iso_pu_bacteria | 2889010040 | 2889010541 | 309 |
| 167 | iso_pu_bacteria | 2889016732 | 2889017751 | 309 |
| 168 | iso_pu_bacteria | 2903492973 | 2903504860 | 309 |
| 169 | iso_pu_bacteria | 2904659560 | 2904664532 | 309 |
| 170 | iso_pu_bacteria | 2906308376 | 2906314312 | 309 |
| 171 | iso_pu_bacteria | 2906321335 | 2906327478 | 309 |
| 172 | iso_pu_bacteria | 2906414383 | 2906420072 | 309 |
| 173 | iso_pu_bacteria | 2919100787 | 2919102219 | 309 |
| 174 | iso_pu_bacteria | 2922130491 | 2922138541 | 309 |
| 175 | iso_pu_bacteria | 2922185730 | 2922191047 | 309 |
| 176 | iso_pu_bacteria | 2928157003 | 2928163623 | 309 |
| 177 | iso_pu_bacteria | 2928163908 | 2928166448 | 309 |
| 178 | iso_pu_bacteria | 2937813078 | 2937815579 | 309 |
| 179 | iso_pu_bacteria | 2938014810 | 2938014921 | 309 |
| 180 | iso_pu_bacteria | 2958100919 | 2958100920 | 309 |
| 181 | iso_pu_bacteria | 2958130278 | 2958131031 | 309 |
| 182 | iso_pu_bacteria | 2958172287 | 2958174166 | 309 |
| 183 | iso_pu_bacteria | 2958179912 | 2958184952 | 309 |
| 184 | iso_pu_bacteria | 2961077736 | 2961083119 | 309 |
| 185 | iso_pu_bacteria | 2961114664 | 2961119531 | 309 |
| 186 | iso_pu_bacteria | 2965119406 | 2965124154 | 309 |
| 187 | iso_pu_bacteria | 2968110612 | 2968115786 | 309 |
| 188 | iso_pu_bacteria | 2968117919 | 2968119806 | 309 |
| 189 | iso_pu_bacteria | 2977843712 | 2977845815 | 309 |
| 190 | iso_pu_bacteria | 2977942078 | 2977942608 | 309 |
| 191 | iso_pu_bacteria | 2977971508 | 2977975019 | 309 |
| 192 | iso_pu_bacteria | 2979710463 | 2979711172 | 309 |
| 193 | iso_pu_bacteria | 2981990288 | 2981997214 | 309 |
| 194 | iso_pu_bacteria | 2987636660 | 2987638481 | 309 |
| 195 | iso_pu_bacteria | 2987652177 | 2987656963 | 309 |
| 196 | iso_pu_bacteria | 3004203850 | 3004205276 | 309 |
| 197 | iso_pu_bacteria | 3005445848 | 3005451992 | 309 |
| 198 | iso_pu_bacteria | 641736154 | 642415289 | 309 |
| 199 | iso_pu_bacteria | 8004387939 | 8004393802 | 309 |
| 200 | iso_pu_bacteria | 8004640170 | 8004643803 | 309 |
| 201 | iso_pu_bacteria | 8004714634 | 8004720570 | 309 |
| 202 | iso_pu_bacteria | 8020807995 | 8020814096 | 309 |
| 203 | iso_pu_bacteria | 8039098773 | 8039099878 | 309 |
| 204 | iso_pu_bacteria | 8040167225 | 8040172047 | 309 |
| 205 | iso_pu_bacteria | 8040173305 | 8040178582 | 309 |
| 206 | 3300025294 | Ga0209025_1016489 | Ga0209025_10164892 | 310 |
| 207 | 3300028794 | Ga0307515_10000112 | Ga0307515_10000112192 | 310 |
| 208 | 3300049569 | Ga0501032_0211529 | Ga0501032_0211529_276_1208 | 310 |
| 209 | 3300049573 | Ga0501037_0235276 | Ga0501037_0235276_14_946 | 310 |
| 210 | 3300049574 | Ga0501038_0257156 | Ga0501038_0257156_402_1334 | 310 |
| 211 | 3300049581 | Ga0501047_0191915 | Ga0501047_0191915_908_1840 | 310 |
| 212 | 3300049582 | Ga0501048_0277564 | Ga0501048_0277564_215_1147 | 310 |
| 213 | 3300049742 | Ga0501080_0538798 | Ga0501080_0538798_39_971 | 310 |
| 214 | 3300049744 | Ga0501083_0042724 | Ga0501083_0042724_72_1004 | 310 |
| 215 | 3300049823 | Ga0501044_0500462 | Ga0501044_0500462_129_1061 | 310 |
| 216 | iso_pu_bacteria | 2508501050 | 2508725736 | 310 |
| 217 | iso_pu_bacteria | 2509276019 | 2509378384 | 310 |
| 218 | iso_pu_bacteria | 2510065057 | 2510303115 | 310 |
| 219 | iso_pu_bacteria | 2510461069 | 2510839512 | 310 |
| 220 | iso_pu_bacteria | 2511231052 | 2511497113 | 310 |
| 221 | iso_pu_bacteria | 2512875016 | 2512929004 | 310 |
| 222 | iso_pu_bacteria | 2512875026 | 2512968857 | 310 |
| 223 | iso_pu_bacteria | 2513237086 | 2513582716 | 310 |
| 224 | iso_pu_bacteria | 2513237089 | 2513606466 | 310 |
| 225 | iso_pu_bacteria | 2513237091 | 2513614770 | 310 |
| 226 | iso_pu_bacteria | 2513237140 | 2513882286 | 310 |
| 227 | iso_pu_bacteria | 2513237143 | 2513901777 | 310 |
| 228 | iso_pu_bacteria | 2513237156 | 2513986731 | 310 |
| 229 | iso_pu_bacteria | 2513237160 | 2514006092 | 310 |
| 230 | iso_pu_bacteria | 2515154107 | 2515611707 | 310 |
| 231 | iso_pu_bacteria | 2516653046 | 2516895657 | 310 |
| 232 | iso_pu_bacteria | 2517487022 | 2517566391 | 310 |
| 233 | iso_pu_bacteria | 2524023207 | 2524449365 | 310 |
| 234 | iso_pu_bacteria | 2534681786 | 2535486225 | 310 |
| 235 | iso_pu_bacteria | 2537561587 | 2537874977 | 310 |
| 236 | iso_pu_bacteria | 2551306084 | 2551678872 | 310 |
| 237 | iso_pu_bacteria | 2551306084 | 2551682110 | 310 |
| 238 | iso_pu_bacteria | 2551306085 | 2551683424 | 310 |
| 239 | iso_pu_bacteria | 2551306086 | 2551692948 | 310 |
| 240 | iso_pu_bacteria | 2551306087 | 2551702878 | 310 |
| 241 | iso_pu_bacteria | 2551306089 | 2551712424 | 310 |
| 242 | iso_pu_bacteria | 2551306090 | 2551718857 | 310 |
| 243 | iso_pu_bacteria | 2551306091 | 2551724311 | 310 |
| 244 | iso_pu_bacteria | 2551306092 | 2551734576 | 310 |
| 245 | iso_pu_bacteria | 2551306093 | 2551743879 | 310 |
| 246 | iso_pu_bacteria | 2554235003 | 2554244351 | 310 |
| 247 | iso_pu_bacteria | 2558860100 | 2558861766 | 310 |
| 248 | iso_pu_bacteria | 2558860242 | 2559297845 | 310 |
| 249 | iso_pu_bacteria | 2558860983 | 2561468469 | 310 |
| 250 | iso_pu_bacteria | 2585427608 | 2585899689 | 310 |
| 251 | iso_pu_bacteria | 2588253730 | 2588514550 | 310 |
| 252 | iso_pu_bacteria | 2599185210 | 2599603878 | 310 |
| 253 | iso_pu_bacteria | 2599185236 | 2599718245 | 310 |
| 254 | iso_pu_bacteria | 2600255279 | 2601612599 | 310 |
| 255 | iso_pu_bacteria | 2600255308 | 2601748318 | 310 |
| 256 | iso_pu_bacteria | 2615840698 | 2616552692 | 310 |
| 257 | iso_pu_bacteria | 2615840698 | 2616555246 | 310 |
| 258 | iso_pu_bacteria | 2643221582 | 2643917727 | 310 |
| 259 | iso_pu_bacteria | 2643221599 | 2644003055 | 310 |
| 260 | iso_pu_bacteria | 2643221693 | 2644522527 | 310 |
| 261 | iso_pu_bacteria | 2657244999 | 2657684236 | 310 |
| 262 | iso_pu_bacteria | 2667528174 | 2671114326 | 310 |
| 263 | iso_pu_bacteria | 2687453341 | 2688392682 | 310 |
| 264 | iso_pu_bacteria | 2738541297 | 2738826897 | 310 |
| 265 | iso_pu_bacteria | 2738541357 | 2739150694 | 310 |
| 266 | iso_pu_bacteria | 2738543003 | 2739192613 | 310 |
| 267 | iso_pu_bacteria | 2738543024 | 2739308109 | 310 |
| 268 | iso_pu_bacteria | 2738543026 | 2739319090 | 310 |
| 269 | iso_pu_bacteria | 2738543029 | 2739337331 | 310 |
| 270 | iso_pu_bacteria | 2751185800 | 2753357905 | 310 |
| 271 | iso_pu_bacteria | 2751185821 | 2753459199 | 310 |
| 272 | iso_pu_bacteria | 2751185846 | 2753566864 | 310 |
| 273 | iso_pu_bacteria | 2757320392 | 2757572630 | 310 |
| 274 | iso_pu_bacteria | 2758568016 | 2758640514 | 310 |
| 275 | iso_pu_bacteria | 2775507049 | 2776910630 | 310 |
| 276 | iso_pu_bacteria | 2791355082 | 2792580975 | 310 |
| 277 | iso_pu_bacteria | 2802428858 | 2802719703 | 310 |
| 278 | iso_pu_bacteria | 2802428859 | 2802728323 | 310 |
| 279 | iso_pu_bacteria | 2802428860 | 2802733533 | 310 |
| 280 | iso_pu_bacteria | 2802428861 | 2802738763 | 310 |
| 281 | iso_pu_bacteria | 2802428862 | 2802745637 | 310 |
| 282 | iso_pu_bacteria | 2802428863 | 2802751402 | 310 |
| 283 | iso_pu_bacteria | 2802429268 | 2804754198 | 310 |
| 284 | iso_pu_bacteria | 2808606387 | 2808989646 | 310 |
| 285 | iso_pu_bacteria | 2818991439 | 2819561927 | 310 |
| 286 | iso_pu_bacteria | 2818991448 | 2819613596 | 310 |
| 287 | iso_pu_bacteria | 2818991461 | 2819682965 | 310 |
| 288 | iso_pu_bacteria | 2818991467 | 2819720203 | 310 |
| 289 | iso_pu_bacteria | 2821123053 | 2821123534 | 310 |
| 290 | iso_pu_bacteria | 2838029111 | 2838030567 | 310 |
| 291 | iso_pu_bacteria | 2838675328 | 2838679215 | 310 |
| 292 | iso_pu_bacteria | 2838714209 | 2838719061 | 310 |
| 293 | iso_pu_bacteria | 2838719591 | 2838724060 | 310 |
| 294 | iso_pu_bacteria | 2838724970 | 2838728893 | 310 |
| 295 | iso_pu_bacteria | 2841846520 | 2841850184 | 310 |
| 296 | iso_pu_bacteria | 2841859092 | 2841861037 | 310 |
| 297 | iso_pu_bacteria | 2842124991 | 2842128656 | 310 |
| 298 | iso_pu_bacteria | 2842130223 | 2842134117 | 310 |
| 299 | iso_pu_bacteria | 2842152218 | 2842156113 | 310 |
| 300 | iso_pu_bacteria | 2842170452 | 2842175307 | 310 |
| 301 | iso_pu_bacteria | 2842175837 | 2842179793 | 310 |
| 302 | iso_pu_bacteria | 2842187318 | 2842191806 | 310 |
| 303 | iso_pu_bacteria | 2842211629 | 2842216123 | 310 |
| 304 | iso_pu_bacteria | 2842224351 | 2842228825 | 310 |
| 305 | iso_pu_bacteria | 2842475841 | 2842477152 | 310 |
| 306 | iso_pu_bacteria | 2842502639 | 2842503949 | 310 |
| 307 | iso_pu_bacteria | 2842515876 | 2842518696 | 310 |
| 308 | iso_pu_bacteria | 2850079185 | 2850084186 | 310 |
| 309 | iso_pu_bacteria | 2852387548 | 2852392997 | 310 |
| 310 | iso_pu_bacteria | 2854911287 | 2854914829 | 310 |
| 311 | iso_pu_bacteria | 2855825444 | 2855829527 | 310 |
| 312 | iso_pu_bacteria | 2855839649 | 2855844626 | 310 |
| 313 | iso_pu_bacteria | 2856349417 | 2856353455 | 310 |
| 314 | iso_pu_bacteria | 2857531043 | 2857531097 | 310 |
| 315 | iso_pu_bacteria | 2857564685 | 2857568111 | 310 |
| 316 | iso_pu_bacteria | 2858800743 | 2858805913 | 310 |
| 317 | iso_pu_bacteria | 2871495908 | 2871496383 | 310 |
| 318 | iso_pu_bacteria | 2876363079 | 2876369470 | 310 |
| 319 | iso_pu_bacteria | 2878760144 | 2878760611 | 310 |
| 320 | iso_pu_bacteria | 2878767105 | 2878767764 | 310 |
| 321 | iso_pu_bacteria | 2881155292 | 2881160582 | 310 |
| 322 | iso_pu_bacteria | 2881853255 | 2881857178 | 310 |
| 323 | iso_pu_bacteria | 2885342637 | 2885344738 | 310 |
| 324 | iso_pu_bacteria | 2885350715 | 2885357763 | 310 |
| 325 | iso_pu_bacteria | 2899792073 | 2899793344 | 310 |
| 326 | iso_pu_bacteria | 2899845264 | 2899849841 | 310 |
| 327 | iso_pu_bacteria | 2903448605 | 2903453056 | 310 |
| 328 | iso_pu_bacteria | 2903521522 | 2903523946 | 310 |
| 329 | iso_pu_bacteria | 2903528002 | 2903531567 | 310 |
| 330 | iso_pu_bacteria | 2903540706 | 2903541177 | 310 |
| 331 | iso_pu_bacteria | 2903748898 | 2903755432 | 310 |
| 332 | iso_pu_bacteria | 2904424332 | 2904425332 | 310 |
| 333 | iso_pu_bacteria | 2904483920 | 2904486432 | 310 |
| 334 | iso_pu_bacteria | 2909042592 | 2909045346 | 310 |
| 335 | iso_pu_bacteria | 2913295892 | 2913296027 | 310 |
| 336 | iso_pu_bacteria | 2915650412 | 2915651023 | 310 |
| 337 | iso_pu_bacteria | 2915980308 | 2915982113 | 310 |
| 338 | iso_pu_bacteria | 2915986958 | 2915988354 | 310 |
| 339 | iso_pu_bacteria | 2915993759 | 2916000501 | 310 |
| 340 | iso_pu_bacteria | 2916000859 | 2916003417 | 310 |
| 341 | iso_pu_bacteria | 2916007675 | 2916007758 | 310 |
| 342 | iso_pu_bacteria | 2916014648 | 2916015992 | 310 |
| 343 | iso_pu_bacteria | 2916021584 | 2916021836 | 310 |
| 344 | iso_pu_bacteria | 2916028427 | 2916030966 | 310 |
| 345 | iso_pu_bacteria | 2916035215 | 2916037357 | 310 |
| 346 | iso_pu_bacteria | 2916041962 | 2916042187 | 310 |
| 347 | iso_pu_bacteria | 2916048683 | 2916048959 | 310 |
| 348 | iso_pu_bacteria | 2916055098 | 2916057239 | 310 |
| 349 | iso_pu_bacteria | 2916061851 | 2916066902 | 310 |
| 350 | iso_pu_bacteria | 2916068649 | 2916072157 | 310 |
| 351 | iso_pu_bacteria | 2916076590 | 2916079085 | 310 |
| 352 | iso_pu_bacteria | 2917699015 | 2917700668 | 310 |
| 353 | iso_pu_bacteria | 2919114240 | 2919117788 | 310 |
| 354 | iso_pu_bacteria | 2919408235 | 2919412346 | 310 |
| 355 | iso_pu_bacteria | 2919476304 | 2919477080 | 310 |
| 356 | iso_pu_bacteria | 2919527303 | 2919527777 | 310 |
| 357 | iso_pu_bacteria | 2921201388 | 2921202937 | 310 |
| 358 | iso_pu_bacteria | 2921208531 | 2921213828 | 310 |
| 359 | iso_pu_bacteria | 2921237296 | 2921242142 | 310 |
| 360 | iso_pu_bacteria | 2921244191 | 2921246319 | 310 |
| 361 | iso_pu_bacteria | 2921250672 | 2921256727 | 310 |
| 362 | iso_pu_bacteria | 2921257292 | 2921259285 | 310 |
| 363 | iso_pu_bacteria | 2921263974 | 2921269784 | 310 |
| 364 | iso_pu_bacteria | 2921282425 | 2921286693 | 310 |
| 365 | iso_pu_bacteria | 2921289301 | 2921292377 | 310 |
| 366 | iso_pu_bacteria | 2921296804 | 2921297769 | 310 |
| 367 | iso_pu_bacteria | 2924144063 | 2924147974 | 310 |
| 368 | iso_pu_bacteria | 2924150972 | 2924152859 | 310 |
| 369 | iso_pu_bacteria | 2924158325 | 2924161876 | 310 |
| 370 | iso_pu_bacteria | 2924165586 | 2924165712 | 310 |
| 371 | iso_pu_bacteria | 2924172951 | 2924175693 | 310 |
| 372 | iso_pu_bacteria | 2924179722 | 2924184267 | 310 |
| 373 | iso_pu_bacteria | 2924186466 | 2924186670 | 310 |
| 374 | iso_pu_bacteria | 2924193448 | 2924197918 | 310 |
| 375 | iso_pu_bacteria | 2924200457 | 2924200705 | 310 |
| 376 | iso_pu_bacteria | 2924207177 | 2924207328 | 310 |
| 377 | iso_pu_bacteria | 2924214083 | 2924214148 | 310 |
| 378 | iso_pu_bacteria | 2924221636 | 2924222477 | 310 |
| 379 | iso_pu_bacteria | 2924228884 | 2924229045 | 310 |
| 380 | iso_pu_bacteria | 2926754445 | 2926757602 | 310 |
| 381 | iso_pu_bacteria | 2926760298 | 2926764789 | 310 |
| 382 | iso_pu_bacteria | 2933006813 | 2933010193 | 310 |
| 383 | iso_pu_bacteria | 2933011516 | 2933014322 | 310 |
| 384 | iso_pu_bacteria | 2933594066 | 2933597088 | 310 |
| 385 | iso_pu_bacteria | 2936996657 | 2936997140 | 310 |
| 386 | iso_pu_bacteria | 2937002841 | 2937003169 | 310 |
| 387 | iso_pu_bacteria | 2937009748 | 2937010017 | 310 |
| 388 | iso_pu_bacteria | 2937016420 | 2937020455 | 310 |
| 389 | iso_pu_bacteria | 2937023124 | 2937025337 | 310 |
| 390 | iso_pu_bacteria | 2937029754 | 2937033728 | 310 |
| 391 | iso_pu_bacteria | 2937036028 | 2937040271 | 310 |
| 392 | iso_pu_bacteria | 2937042894 | 2937044096 | 310 |
| 393 | iso_pu_bacteria | 2937049772 | 2937054405 | 310 |
| 394 | iso_pu_bacteria | 2937056579 | 2937060366 | 310 |
| 395 | iso_pu_bacteria | 2937063883 | 2937064095 | 310 |
| 396 | iso_pu_bacteria | 2937071275 | 2937071830 | 310 |
| 397 | iso_pu_bacteria | 2937078374 | 2937084604 | 310 |
| 398 | iso_pu_bacteria | 2937084907 | 2937091570 | 310 |
| 399 | iso_pu_bacteria | 2937091812 | 2937095807 | 310 |
| 400 | iso_pu_bacteria | 2937098957 | 2937100949 | 310 |
| 401 | iso_pu_bacteria | 2937106411 | 2937109864 | 310 |
| 402 | iso_pu_bacteria | 2937113482 | 2937115599 | 310 |
| 403 | iso_pu_bacteria | 2937119839 | 2937119921 | 310 |
| 404 | iso_pu_bacteria | 2937126314 | 2937132479 | 310 |
| 405 | iso_pu_bacteria | 2937848649 | 2937853940 | 310 |
| 406 | iso_pu_bacteria | 2937994558 | 2937995033 | 310 |
| 407 | iso_pu_bacteria | 2952252522 | 2952255074 | 310 |
| 408 | iso_pu_bacteria | 2957375807 | 2957381148 | 310 |
| 409 | iso_pu_bacteria | 2957382221 | 2957382444 | 310 |
| 410 | iso_pu_bacteria | 2957388812 | 2957391658 | 310 |
| 411 | iso_pu_bacteria | 2957395598 | 2957400116 | 310 |
| 412 | iso_pu_bacteria | 2957402308 | 2957404110 | 310 |
| 413 | iso_pu_bacteria | 2957408893 | 2957411496 | 310 |
| 414 | iso_pu_bacteria | 2957415311 | 2957416387 | 310 |
| 415 | iso_pu_bacteria | 2957422303 | 2957429569 | 310 |
| 416 | iso_pu_bacteria | 2957430029 | 2957432783 | 310 |
| 417 | iso_pu_bacteria | 2957437181 | 2957441827 | 310 |
| 418 | iso_pu_bacteria | 2957443900 | 2957445836 | 310 |
| 419 | iso_pu_bacteria | 2957450854 | 2957450939 | 310 |
| 420 | iso_pu_bacteria | 2957457609 | 2957460240 | 310 |
| 421 | iso_pu_bacteria | 2957464669 | 2957465381 | 310 |
| 422 | iso_pu_bacteria | 2957478035 | 2957478817 | 310 |
| 423 | iso_pu_bacteria | 2957484790 | 2957485335 | 310 |
| 424 | iso_pu_bacteria | 2957491536 | 2957493358 | 310 |
| 425 | iso_pu_bacteria | 2957498199 | 2957498551 | 310 |
| 426 | iso_pu_bacteria | 2957505466 | 2957506490 | 310 |
| 427 | iso_pu_bacteria | 2958165035 | 2958165702 | 310 |
| 428 | iso_pu_bacteria | 2960584000 | 2960590307 | 310 |
| 429 | iso_pu_bacteria | 2960591022 | 2960597016 | 310 |
| 430 | iso_pu_bacteria | 2960597568 | 2960600111 | 310 |
| 431 | iso_pu_bacteria | 2960603979 | 2960603989 | 310 |
| 432 | iso_pu_bacteria | 2960610863 | 2960611118 | 310 |
| 433 | iso_pu_bacteria | 2960617483 | 2960622477 | 310 |
| 434 | iso_pu_bacteria | 2960624210 | 2960625188 | 310 |
| 435 | iso_pu_bacteria | 2960631154 | 2960631483 | 310 |
| 436 | iso_pu_bacteria | 2960637947 | 2960644292 | 310 |
| 437 | iso_pu_bacteria | 2960645483 | 2960647307 | 310 |
| 438 | iso_pu_bacteria | 2960652885 | 2960657791 | 310 |
| 439 | iso_pu_bacteria | 2960660292 | 2960663864 | 310 |
| 440 | iso_pu_bacteria | 2960667422 | 2960667676 | 310 |
| 441 | iso_pu_bacteria | 2960674078 | 2960679216 | 310 |
| 442 | iso_pu_bacteria | 2960680706 | 2960682220 | 310 |
| 443 | iso_pu_bacteria | 2960687367 | 2960691873 | 310 |
| 444 | iso_pu_bacteria | 2960693952 | 2960697978 | 310 |
| 445 | iso_pu_bacteria | 2961127735 | 2961132598 | 310 |
| 446 | iso_pu_bacteria | 2961163497 | 2961164161 | 310 |
| 447 | iso_pu_bacteria | 2963644680 | 2963650230 | 310 |
| 448 | iso_pu_bacteria | 2964607997 | 2964615032 | 310 |
| 449 | iso_pu_bacteria | 2964615318 | 2964620209 | 310 |
| 450 | iso_pu_bacteria | 2964621998 | 2964626719 | 310 |
| 451 | iso_pu_bacteria | 2964628898 | 2964629128 | 310 |
| 452 | iso_pu_bacteria | 2964636051 | 2964636239 | 310 |
| 453 | iso_pu_bacteria | 2964643177 | 2964643259 | 310 |
| 454 | iso_pu_bacteria | 2964649959 | 2964652519 | 310 |
| 455 | iso_pu_bacteria | 2964656573 | 2964662093 | 310 |
| 456 | iso_pu_bacteria | 2964663802 | 2964663885 | 310 |
| 457 | iso_pu_bacteria | 2964670856 | 2964677745 | 310 |
| 458 | iso_pu_bacteria | 2964678106 | 2964678208 | 310 |
| 459 | iso_pu_bacteria | 2964685014 | 2964685211 | 310 |
| 460 | iso_pu_bacteria | 2964691889 | 2964694186 | 310 |
| 461 | iso_pu_bacteria | 2964698721 | 2964699029 | 310 |
| 462 | iso_pu_bacteria | 2964705432 | 2964710838 | 310 |
| 463 | iso_pu_bacteria | 2964712639 | 2964716641 | 310 |
| 464 | iso_pu_bacteria | 2964719344 | 2964720743 | 310 |
| 465 | iso_pu_bacteria | 2965018300 | 2965018773 | 310 |
| 466 | iso_pu_bacteria | 2967664464 | 2967664861 | 310 |
| 467 | iso_pu_bacteria | 2967671571 | 2967671654 | 310 |
| 468 | iso_pu_bacteria | 2967678726 | 2967685571 | 310 |
| 469 | iso_pu_bacteria | 2967686174 | 2967689526 | 310 |
| 470 | iso_pu_bacteria | 2967693043 | 2967695637 | 310 |
| 471 | iso_pu_bacteria | 2967699805 | 2967699920 | 310 |
| 472 | iso_pu_bacteria | 2967706974 | 2967708138 | 310 |
| 473 | iso_pu_bacteria | 2967714385 | 2967717475 | 310 |
| 474 | iso_pu_bacteria | 2967721400 | 2967721526 | 310 |
| 475 | iso_pu_bacteria | 2967728569 | 2967730297 | 310 |
| 476 | iso_pu_bacteria | 2967735183 | 2967737290 | 310 |
| 477 | iso_pu_bacteria | 2967742019 | 2967748782 | 310 |
| 478 | iso_pu_bacteria | 2967748971 | 2967749055 | 310 |
| 479 | iso_pu_bacteria | 2967755722 | 2967755805 | 310 |
| 480 | iso_pu_bacteria | 2967762386 | 2967764654 | 310 |
| 481 | iso_pu_bacteria | 2967769361 | 2967769569 | 310 |
| 482 | iso_pu_bacteria | 2967775926 | 2967781727 | 310 |
| 483 | iso_pu_bacteria | 2968083720 | 2968086422 | 310 |
| 484 | iso_pu_bacteria | 2968171901 | 2968172564 | 310 |
| 485 | iso_pu_bacteria | 2970019648 | 2970025930 | 310 |
| 486 | iso_pu_bacteria | 2970026789 | 2970028956 | 310 |
| 487 | iso_pu_bacteria | 2970033650 | 2970033733 | 310 |
| 488 | iso_pu_bacteria | 2970040964 | 2970043403 | 310 |
| 489 | iso_pu_bacteria | 2970047711 | 2970050131 | 310 |
| 490 | iso_pu_bacteria | 2970054988 | 2970057712 | 310 |
| 491 | iso_pu_bacteria | 2970061556 | 2970063481 | 310 |
| 492 | iso_pu_bacteria | 2970068827 | 2970068909 | 310 |
| 493 | iso_pu_bacteria | 2970076120 | 2970078133 | 310 |
| 494 | iso_pu_bacteria | 2970082768 | 2970084342 | 310 |
| 495 | iso_pu_bacteria | 2970088815 | 2970092022 | 310 |
| 496 | iso_pu_bacteria | 2970095765 | 2970095849 | 310 |
| 497 | iso_pu_bacteria | 2970102677 | 2970102760 | 310 |
| 498 | iso_pu_bacteria | 2970109326 | 2970111222 | 310 |
| 499 | iso_pu_bacteria | 2970116247 | 2970117643 | 310 |
| 500 | iso_pu_bacteria | 2970122695 | 2970125690 | 310 |
| 501 | iso_pu_bacteria | 2970129317 | 2970132136 | 310 |
| 502 | iso_pu_bacteria | 2970136068 | 2970136175 | 310 |
| 503 | iso_pu_bacteria | 2970143518 | 2970149445 | 310 |
| 504 | iso_pu_bacteria | 2970149975 | 2970152010 | 310 |
| 505 | iso_pu_bacteria | 2970156795 | 2970162460 | 310 |
| 506 | iso_pu_bacteria | 2970164137 | 2970168971 | 310 |
| 507 | iso_pu_bacteria | 2970170962 | 2970171045 | 310 |
| 508 | iso_pu_bacteria | 2970177841 | 2970180141 | 310 |
| 509 | iso_pu_bacteria | 2970184632 | 2970189543 | 310 |
| 510 | iso_pu_bacteria | 2970191845 | 2970191976 | 310 |
| 511 | iso_pu_bacteria | 2970554993 | 2970555464 | 310 |
| 512 | iso_pu_bacteria | 2977516862 | 2977518401 | 310 |
| 513 | iso_pu_bacteria | 2977523885 | 2977526412 | 310 |
| 514 | iso_pu_bacteria | 2977530762 | 2977534605 | 310 |
| 515 | iso_pu_bacteria | 2977537788 | 2977539714 | 310 |
| 516 | iso_pu_bacteria | 2977544691 | 2977548914 | 310 |
| 517 | iso_pu_bacteria | 2977551784 | 2977556034 | 310 |
| 518 | iso_pu_bacteria | 2977558990 | 2977560560 | 310 |
| 519 | iso_pu_bacteria | 2977565890 | 2977566202 | 310 |
| 520 | iso_pu_bacteria | 2977572785 | 2977575382 | 310 |
| 521 | iso_pu_bacteria | 2977579622 | 2977582412 | 310 |
| 522 | iso_pu_bacteria | 2977922695 | 2977928579 | 310 |
| 523 | iso_pu_bacteria | 2977986579 | 2977991167 | 310 |
| 524 | iso_pu_bacteria | 2979089926 | 2979090095 | 310 |
| 525 | iso_pu_bacteria | 2979095461 | 2979095631 | 310 |
| 526 | iso_pu_bacteria | 2979100975 | 2979101141 | 310 |
| 527 | iso_pu_bacteria | 2984509177 | 2984510909 | 310 |
| 528 | iso_pu_bacteria | 2984518228 | 2984518389 | 310 |
| 529 | iso_pu_bacteria | 2984537506 | 2984539259 | 310 |
| 530 | iso_pu_bacteria | 2984601300 | 2984605965 | 310 |
| 531 | iso_pu_bacteria | 2987659509 | 2987660169 | 310 |
| 532 | iso_pu_bacteria | 2996887358 | 2996889780 | 310 |
| 533 | iso_pu_bacteria | 3004188549 | 3004189217 | 310 |
| 534 | iso_pu_bacteria | 3004211236 | 3004213406 | 310 |
| 535 | iso_pu_bacteria | 3004218560 | 3004221307 | 310 |
| 536 | iso_pu_bacteria | 3004334049 | 3004338426 | 310 |
| 537 | iso_pu_bacteria | 3005409236 | 3005416135 | 310 |
| 538 | iso_pu_bacteria | 3005416602 | 3005420961 | 310 |
| 539 | iso_pu_bacteria | 3005452660 | 3005455193 | 310 |
| 540 | iso_pu_bacteria | 637000159 | 637078718 | 310 |
| 541 | iso_pu_bacteria | 648276728 | 648735637 | 310 |
| 542 | iso_pu_bacteria | 650716007 | 650842431 | 310 |
| 543 | iso_pu_bacteria | 8003570095 | 8003573445 | 310 |
| 544 | iso_pu_bacteria | 8003992118 | 8003997151 | 310 |
| 545 | iso_pu_bacteria | 8003999396 | 8004004862 | 310 |
| 546 | iso_pu_bacteria | 8005258706 | 8005261626 | 310 |
| 547 | iso_pu_bacteria | 8005314921 | 8005319304 | 310 |
| 548 | iso_pu_bacteria | 8005321885 | 8005324307 | 310 |
| 549 | iso_pu_bacteria | 8005484373 | 8005489357 | 310 |
| 550 | iso_pu_bacteria | 8005645114 | 8005650256 | 310 |
| 551 | iso_pu_bacteria | 8005658619 | 8005662218 | 310 |
| 552 | iso_pu_bacteria | 8005682033 | 8005683872 | 310 |
| 553 | iso_pu_bacteria | 8018150411 | 8018154728 | 310 |
| 554 | iso_pu_bacteria | 8046767195 | 8046771987 | 310 |
| 555 | iso_pu_bacteria | 8049293176 | 8049297226 | 310 |
| 556 | 3300005985 | Ga0081539_10132905 | Ga0081539_101329052 | 311 |
| 557 | 3300031251 | Ga0265327_10082800 | Ga0265327_100828001 | 311 |
| 558 | 3300042115 | Ga0450911_000054 | Ga0450911_000054_6197_7132 | 311 |
| 559 | 3300042139 | Ga0450904_000392 | Ga0450904_000392_6214_7149 | 311 |
| 560 | 3300042438 | Ga0439459_0001682 | Ga0439459_0001682_152_1087 | 311 |
| 561 | 3300045051 | Ga0451576_0016127 | Ga0451576_0016127_4389_5324 | 311 |
| 562 | 3300045051 | Ga0451576_0020127 | Ga0451576_0020127_4879_5814 | 311 |
| 563 | 3300047472 | Ga0495686_0111908 | Ga0495686_0111908_101_1051 | 311 |
| 564 | 3300048919 | Ga0496116_0000026 | Ga0496116_0000026_398132_399067 | 311 |
| 565 | 3300048920 | Ga0496117_0031918 | Ga0496117_0031918_100_1035 | 311 |
| 566 | 3300048926 | Ga0496123_0039578 | Ga0496123_0039578_279_1214 | 311 |
| 567 | 3300048929 | Ga0496126_0000059 | Ga0496126_0000059_97829_98764 | 311 |
| 568 | 3300049853 | Ga0501226_000008 | Ga0501226_000008_162730_163665 | 311 |
| 569 | 3300053125 | Ga0500618_002627 | Ga0500618_002627_4205_5140 | 311 |
| 570 | 3300053177 | Ga0500636_0002587 | Ga0500636_0002587_7327_8262 | 311 |
| 571 | iso_pu_bacteria | 2511231010 | 2511291944 | 311 |
| 572 | iso_pu_bacteria | 2511231011 | 2511298493 | 311 |
| 573 | iso_pu_bacteria | 2511231012 | 2511304769 | 311 |
| 574 | iso_pu_bacteria | 2511231014 | 2511315884 | 311 |
| 575 | iso_pu_bacteria | 2511231017 | 2511334534 | 311 |
| 576 | iso_pu_bacteria | 2511231020 | 2511352211 | 311 |
| 577 | iso_pu_bacteria | 2511231023 | 2511372578 | 311 |
| 578 | iso_pu_bacteria | 2511231024 | 2511377910 | 311 |
| 579 | iso_pu_bacteria | 2511231031 | 2511414508 | 311 |
| 580 | iso_pu_bacteria | 2554235231 | 2555248824 | 311 |
| 581 | iso_pu_bacteria | 2597489888 | 2597864151 | 311 |
| 582 | iso_pu_bacteria | 2597489889 | 2597869707 | 311 |
| 583 | iso_pu_bacteria | 2599185167 | 2599398458 | 311 |
| 584 | iso_pu_bacteria | 2599185179 | 2599450460 | 311 |
| 585 | iso_pu_bacteria | 2599185189 | 2599507260 | 311 |
| 586 | iso_pu_bacteria | 2599185190 | 2599512944 | 311 |
| 587 | iso_pu_bacteria | 2599185191 | 2599521688 | 311 |
| 588 | iso_pu_bacteria | 2599185290 | 2599891621 | 311 |
| 589 | iso_pu_bacteria | 2600255296 | 2601691992 | 311 |
| 590 | iso_pu_bacteria | 2600255318 | 2601799314 | 311 |
| 591 | iso_pu_bacteria | 2603880185 | 2606078455 | 311 |
| 592 | iso_pu_bacteria | 2603880199 | 2606130563 | 311 |
| 593 | iso_pu_bacteria | 2619619299 | 2621299997 | 311 |
| 594 | iso_pu_bacteria | 2623620443 | 2624480301 | 311 |
| 595 | iso_pu_bacteria | 2643221565 | 2643845784 | 311 |
| 596 | iso_pu_bacteria | 2643221571 | 2643873940 | 311 |
| 597 | iso_pu_bacteria | 2643221713 | 2644620324 | 311 |
| 598 | iso_pu_bacteria | 2643221736 | 2644744499 | 311 |
| 599 | iso_pu_bacteria | 2675903420 | 2677896260 | 311 |
| 600 | iso_pu_bacteria | 2713897148 | 2715753486 | 311 |
| 601 | iso_pu_bacteria | 2713897149 | 2715758628 | 311 |
| 602 | iso_pu_bacteria | 2718217725 | 2718634491 | 311 |
| 603 | iso_pu_bacteria | 2721755607 | 2723248855 | 311 |
| 604 | iso_pu_bacteria | 2738541265 | 2738669996 | 311 |
| 605 | iso_pu_bacteria | 2738541282 | 2738748389 | 311 |
| 606 | iso_pu_bacteria | 2738541303 | 2738857431 | 311 |
| 607 | iso_pu_bacteria | 2738543025 | 2739313219 | 311 |
| 608 | iso_pu_bacteria | 2765235841 | 2765582532 | 311 |
| 609 | iso_pu_bacteria | 2773857673 | 2774138115 | 311 |
| 610 | iso_pu_bacteria | 2784132063 | 2784264820 | 311 |
| 611 | iso_pu_bacteria | 2806310737 | 2807409693 | 311 |
| 612 | iso_pu_bacteria | 2806310745 | 2807457994 | 311 |
| 613 | iso_pu_bacteria | 2808606377 | 2808929020 | 311 |
| 614 | iso_pu_bacteria | 2808606381 | 2808951141 | 311 |
| 615 | iso_pu_bacteria | 2816332298 | 2817491291 | 311 |
| 616 | iso_pu_bacteria | 2818991456 | 2819654778 | 311 |
| 617 | iso_pu_bacteria | 2834028612 | 2834034126 | 311 |
| 618 | iso_pu_bacteria | 2841760612 | 2841763290 | 311 |
| 619 | iso_pu_bacteria | 2842826826 | 2842827052 | 311 |
| 620 | iso_pu_bacteria | 2842832357 | 2842835289 | 311 |
| 621 | iso_pu_bacteria | 2842837860 | 2842839153 | 311 |
| 622 | iso_pu_bacteria | 2842843487 | 2842844108 | 311 |
| 623 | iso_pu_bacteria | 2844104063 | 2844108840 | 311 |
| 624 | iso_pu_bacteria | 2846037992 | 2846038708 | 311 |
| 625 | iso_pu_bacteria | 2851182111 | 2851182536 | 311 |
| 626 | iso_pu_bacteria | 2851246043 | 2851250947 | 311 |
| 627 | iso_pu_bacteria | 2852657418 | 2852662288 | 311 |
| 628 | iso_pu_bacteria | 2860339153 | 2860342687 | 311 |
| 629 | iso_pu_bacteria | 2860867994 | 2860870716 | 311 |
| 630 | iso_pu_bacteria | 2878029506 | 2878032202 | 311 |
| 631 | iso_pu_bacteria | 2880230671 | 2880233146 | 311 |
| 632 | iso_pu_bacteria | 2894817345 | 2894822021 | 311 |
| 633 | iso_pu_bacteria | 2904518522 | 2904521965 | 311 |
| 634 | iso_pu_bacteria | 2904550169 | 2904550624 | 311 |
| 635 | iso_pu_bacteria | 2908446538 | 2908449525 | 311 |
| 636 | iso_pu_bacteria | 2919063839 | 2919068691 | 311 |
| 637 | iso_pu_bacteria | 2919385768 | 2919391036 | 311 |
| 638 | iso_pu_bacteria | 2919487758 | 2919492205 | 311 |
| 639 | iso_pu_bacteria | 2929189879 | 2929192706 | 311 |
| 640 | iso_pu_bacteria | 2931390751 | 2931393810 | 311 |
| 641 | iso_pu_bacteria | 2931396565 | 2931401781 | 311 |
| 642 | iso_pu_bacteria | 2939636861 | 2939641396 | 311 |
| 643 | iso_pu_bacteria | 2945928738 | 2945933350 | 311 |
| 644 | iso_pu_bacteria | 2945961074 | 2945962499 | 311 |
| 645 | iso_pu_bacteria | 2946006987 | 2946009642 | 311 |
| 646 | iso_pu_bacteria | 2946027586 | 2946030813 | 311 |
| 647 | iso_pu_bacteria | 2947233263 | 2947237950 | 311 |
| 648 | iso_pu_bacteria | 2969304461 | 2969307106 | 311 |
| 649 | iso_pu_bacteria | 2974289157 | 2974291535 | 311 |
| 650 | iso_pu_bacteria | 2998139840 | 2998142243 | 311 |
| 651 | iso_pu_bacteria | 3007252601 | 3007254864 | 311 |
| 652 | iso_pu_bacteria | 3007315729 | 3007316314 | 311 |
| 653 | iso_pu_bacteria | 3007614139 | 3007619242 | 311 |
| 654 | iso_pu_bacteria | 3007718800 | 3007723565 | 311 |
| 655 | iso_pu_bacteria | 3007803356 | 3007804819 | 311 |
| 656 | iso_pu_bacteria | 3007855910 | 3007856444 | 311 |
| 657 | iso_pu_bacteria | 3007861166 | 3007862466 | 311 |
| 658 | iso_pu_bacteria | 8029995093 | 8029998467 | 311 |
| 659 | iso_pu_bacteria | 8052494512 | 8052498679 | 311 |
| 660 | iso_pu_bacteria | 8054285046 | 8054291407 | 311 |
| 661 | iso_pu_bacteria | 8054347763 | 8054352394 | 311 |
| 662 | iso_pu_bacteria | 8054563764 | 8054566866 | 311 |
| 663 | iso_pu_bacteria | 8054929484 | 8054933950 | 311 |
| 664 | iso_pu_bacteria | 8055817908 | 8055821232 | 311 |
| 665 | iso_pu_bacteria | 8056115690 | 8056119995 | 311 |
| 666 | iso_pu_bacteria | 8056120720 | 8056122076 | 311 |
| 667 | iso_pu_bacteria | 8056131705 | 8056134892 | 311 |
| 668 | iso_pu_bacteria | 8056137416 | 8056141644 | 311 |
| 669 | iso_pu_bacteria | 8056148874 | 8056150788 | 311 |
| 670 | iso_pu_bacteria | 8056161164 | 8056165932 | 311 |
| 671 | iso_pu_bacteria | 8056166840 | 8056168829 | 311 |
| 672 | iso_pu_bacteria | 8056172158 | 8056173928 | 311 |
| 673 | iso_pu_bacteria | 8056177738 | 8056182441 | 311 |
| 674 | iso_pu_bacteria | 8056569372 | 8056574130 | 311 |
| 675 | iso_pu_bacteria | 8057529695 | 8057534786 | 311 |
| 676 | 3300009011 | Ga0105251_10001803 | Ga0105251_100018032 | 312 |
| 677 | 3300009092 | Ga0105250_10000058 | Ga0105250_1000005851 | 312 |
| 678 | 3300009093 | Ga0105240_10177754 | Ga0105240_101777542 | 312 |
| 679 | 3300025254 | Ga0209148_1012580 | Ga0209148_10125802 | 312 |
| 680 | 3300025272 | Ga0209455_1003801 | Ga0209455_10038013 | 312 |
| 681 | 3300025291 | Ga0209675_1016744 | Ga0209675_10167442 | 312 |
| 682 | 3300025711 | Ga0207696_1000017 | Ga0207696_1000017387 | 312 |
| 683 | 3300025735 | Ga0207713_1000981 | Ga0207713_100098117 | 312 |
| 684 | 3300025913 | Ga0207695_10131818 | Ga0207695_101318182 | 312 |
| 685 | 3300031616 | Ga0307508_10085555 | Ga0307508_100855552 | 312 |
| 686 | 3300031731 | Ga0307405_10000024 | Ga0307405_1000002432 | 312 |
| 687 | 3300035172 | Ga0373955_0079621 | Ga0373955_0079621_886_1827 | 312 |
| 688 | 3300039447 | Ga0436361_1083939 | Ga0436361_1083939_2815_3753 | 312 |
| 689 | 3300048920 | Ga0496117_0015538 | Ga0496117_0015538_3252_4190 | 312 |
| 690 | 3300048921 | Ga0496118_0029726 | Ga0496118_0029726_1360_2298 | 312 |
| 691 | 3300048926 | Ga0496123_0178112 | Ga0496123_0178112_162_1100 | 312 |
| 692 | 3300048927 | Ga0496124_0020951 | Ga0496124_0020951_2607_3545 | 312 |
| 693 | 3300048929 | Ga0496126_0023387 | Ga0496126_0023387_3982_4920 | 312 |
| 694 | 3300050507 | nmdc:mga05p37_59611_c1 | nmdc:mga05p37_59611_c1_1707_2645 | 312 |
| 695 | iso_pu_bacteria | 2684623219 | 2687236671 | 312 |
| 696 | 3300001989 | JGI24739J22299_10007607 | JGI24739J22299_100076073 | 313 |
| 697 | 3300001989 | JGI24739J22299_10029968 | JGI24739J22299_100299681 | 313 |
| 698 | 3300002067 | JGI24735J21928_10018021 | JGI24735J21928_100180212 | 313 |
| 699 | 3300003187 | JGI25151J46595_10000036 | JGI25151J46595_10000036170 | 313 |
| 700 | 3300003214 | JGI25165J46597_1000020 | JGI25165J46597_1000020294 | 313 |
| 701 | 3300003751 | Ga0055538_1000062 | Ga0055538_100006237 | 313 |
| 702 | 3300003752 | Ga0055539_1000093 | Ga0055539_100009337 | 313 |
| 703 | 3300003756 | Ga0055533_1000105 | Ga0055533_100010537 | 313 |
| 704 | 3300003758 | Ga0055532_1000230 | Ga0055532_100023014 | 313 |
| 705 | 3300003759 | Ga0055525_1000137 | Ga0055525_100013737 | 313 |
| 706 | 3300003760 | Ga0055527_1000042 | Ga0055527_100004214 | 313 |
| 707 | 3300003761 | Ga0055535_1000066 | Ga0055535_100006614 | 313 |
| 708 | 3300003763 | Ga0055529_1001530 | Ga0055529_10015305 | 313 |
| 709 | 3300003763 | Ga0055529_1005106 | Ga0055529_10051061 | 313 |
| 710 | 3300003775 | Ga0055524_1000018 | Ga0055524_100001858 | 313 |
| 711 | 3300003841 | Ga0055541_1000063 | Ga0055541_100006337 | 313 |
| 712 | 3300005327 | Ga0070658_10085570 | Ga0070658_100855702 | 313 |
| 713 | 3300005331 | Ga0070670_100000277 | Ga0070670_10000027724 | 313 |
| 714 | 3300005366 | Ga0070659_100000038 | Ga0070659_10000003824 | 313 |
| 715 | 3300005455 | Ga0070663_100000558 | Ga0070663_1000005584 | 313 |
| 716 | 3300005458 | Ga0070681_10009242 | Ga0070681_1000924211 | 313 |
| 717 | 3300005539 | Ga0068853_100009469 | Ga0068853_1000094696 | 313 |
| 718 | 3300005563 | Ga0068855_100075336 | Ga0068855_1000753362 | 313 |
| 719 | 3300005563 | Ga0068855_100199532 | Ga0068855_1001995322 | 313 |
| 720 | 3300005563 | Ga0068855_100339440 | Ga0068855_1003394402 | 313 |
| 721 | 3300005564 | Ga0070664_100094179 | Ga0070664_1000941792 | 313 |
| 722 | 3300005577 | Ga0068857_100239574 | Ga0068857_1002395742 | 313 |
| 723 | 3300005616 | Ga0068852_100015462 | Ga0068852_1000154622 | 313 |
| 724 | 3300006038 | Ga0075365_10008792 | Ga0075365_100087923 | 313 |
| 725 | 3300006038 | Ga0075365_10071991 | Ga0075365_100719913 | 313 |
| 726 | 3300006051 | Ga0075364_10009737 | Ga0075364_100097373 | 313 |
| 727 | 3300006177 | Ga0075362_10007635 | Ga0075362_100076353 | 313 |
| 728 | 3300006178 | Ga0075367_10043833 | Ga0075367_100438332 | 313 |
| 729 | 3300006178 | Ga0075367_10074090 | Ga0075367_100740902 | 313 |
| 730 | 3300006178 | Ga0075367_10091479 | Ga0075367_100914792 | 313 |
| 731 | 3300006353 | Ga0075370_10037803 | Ga0075370_100378032 | 313 |
| 732 | 3300009093 | Ga0105240_10069968 | Ga0105240_100699683 | 313 |
| 733 | 3300009093 | Ga0105240_10472910 | Ga0105240_104729102 | 313 |
| 734 | 3300009551 | Ga0105238_10013098 | Ga0105238_100130984 | 313 |
| 735 | 3300009551 | Ga0105238_10024559 | Ga0105238_100245594 | 313 |
| 736 | 3300009551 | Ga0105238_10064040 | Ga0105238_100640401 | 313 |
| 737 | 3300010375 | Ga0105239_10025754 | Ga0105239_100257544 | 313 |
| 738 | 3300010375 | Ga0105239_10063548 | Ga0105239_100635484 | 313 |
| 739 | 3300010375 | Ga0105239_10124942 | Ga0105239_101249423 | 313 |
| 740 | 3300013104 | Ga0157370_10071884 | Ga0157370_100718844 | 313 |
| 741 | 3300013104 | Ga0157370_10084869 | Ga0157370_100848691 | 313 |
| 742 | 3300013296 | Ga0157374_10284715 | Ga0157374_102847152 | 313 |
| 743 | 3300014326 | Ga0157380_10003627 | Ga0157380_100036275 | 313 |
| 744 | 3300015265 | Ga0182005_1007215 | Ga0182005_10072152 | 313 |
| 745 | 3300021361 | Ga0213872_10013982 | Ga0213872_100139823 | 313 |
| 746 | 3300021384 | Ga0213876_10062142 | Ga0213876_100621422 | 313 |
| 747 | 3300025224 | Ga0209784_100021 | Ga0209784_100021327 | 313 |
| 748 | 3300025225 | Ga0209566_100119 | Ga0209566_10011955 | 313 |
| 749 | 3300025226 | Ga0209674_100036 | Ga0209674_100036327 | 313 |
| 750 | 3300025228 | Ga0209672_100090 | Ga0209672_10009098 | 313 |
| 751 | 3300025229 | Ga0209147_100132 | Ga0209147_10013297 | 313 |
| 752 | 3300025230 | Ga0209563_100040 | Ga0209563_100040327 | 313 |
| 753 | 3300025242 | Ga0209258_100211 | Ga0209258_10021198 | 313 |
| 754 | 3300025253 | Ga0209677_100023 | Ga0209677_100023327 | 313 |
| 755 | 3300025254 | Ga0209148_1000443 | Ga0209148_100044314 | 313 |
| 756 | 3300025256 | Ga0209759_1001415 | Ga0209759_10014151 | 313 |
| 757 | 3300025261 | Ga0209233_1000047 | Ga0209233_100004741 | 313 |
| 758 | 3300025272 | Ga0209455_1000448 | Ga0209455_100044823 | 313 |
| 759 | 3300025272 | Ga0209455_1000723 | Ga0209455_100072316 | 313 |
| 760 | 3300025273 | Ga0209673_1019757 | Ga0209673_10197572 | 313 |
| 761 | 3300025291 | Ga0209675_1002312 | Ga0209675_10023125 | 313 |
| 762 | 3300025292 | Ga0209676_1019241 | Ga0209676_10192412 | 313 |
| 763 | 3300025294 | Ga0209025_1000017 | Ga0209025_1000017346 | 313 |
| 764 | 3300025295 | Ga0209564_1000059 | Ga0209564_1000059126 | 313 |
| 765 | 3300025297 | Ga0209758_1029691 | Ga0209758_10296913 | 313 |
| 766 | 3300025299 | Ga0209256_1000032 | Ga0209256_100003261 | 313 |
| 767 | 3300025304 | Ga0209257_1000239 | Ga0209257_100023930 | 313 |
| 768 | 3300025904 | Ga0207647_10005805 | Ga0207647_100058054 | 313 |
| 769 | 3300025909 | Ga0207705_10014795 | Ga0207705_100147954 | 313 |
| 770 | 3300025912 | Ga0207707_10131006 | Ga0207707_101310061 | 313 |
| 771 | 3300025913 | Ga0207695_10241014 | Ga0207695_102410141 | 313 |
| 772 | 3300025914 | Ga0207671_10067655 | Ga0207671_100676553 | 313 |
| 773 | 3300025914 | Ga0207671_10117547 | Ga0207671_101175471 | 313 |
| 774 | 3300025919 | Ga0207657_10000063 | Ga0207657_1000006327 | 313 |
| 775 | 3300025921 | Ga0207652_10270711 | Ga0207652_102707112 | 313 |
| 776 | 3300025925 | Ga0207650_10000342 | Ga0207650_1000034221 | 313 |
| 777 | 3300025932 | Ga0207690_10000025 | Ga0207690_10000025142 | 313 |
| 778 | 3300025945 | Ga0207679_10204851 | Ga0207679_102048511 | 313 |
| 779 | 3300025949 | Ga0207667_10015164 | Ga0207667_100151642 | 313 |
| 780 | 3300025949 | Ga0207667_10550072 | Ga0207667_105500721 | 313 |
| 781 | 3300026067 | Ga0207678_10001764 | Ga0207678_100017644 | 313 |
| 782 | 3300031727 | Ga0316576_10015489 | Ga0316576_100154892 | 313 |
| 783 | 3300031727 | Ga0316576_10368959 | Ga0316576_103689592 | 313 |
| 784 | 3300031731 | Ga0307405_10007115 | Ga0307405_100071155 | 313 |
| 785 | 3300031911 | Ga0307412_10177169 | Ga0307412_101771692 | 313 |
| 786 | 3300035692 | Ga0373935_0244893 | Ga0373935_0244893_65_1006 | 313 |
| 787 | 3300037068 | Ga0373925_0406645 | Ga0373925_0406645_30_971 | 313 |
| 788 | 3300037418 | Ga0395900_0004025 | Ga0395900_0004025_11228_12187 | 313 |
| 789 | 3300037471 | Ga0395905_0002538 | Ga0395905_0002538_11126_12085 | 313 |
| 790 | 3300038443 | Ga0395901_0010310 | Ga0395901_0010310_2758_3837 | 313 |
| 791 | 3300039437 | Ga0436365_0648684 | Ga0436365_0648684_11146_12087 | 313 |
| 792 | 3300039447 | Ga0436361_0148410 | Ga0436361_0148410_6186_7127 | 313 |
| 793 | 3300039453 | Ga0436362_0072394 | Ga0436362_0072394_88_1029 | 313 |
| 794 | 3300044658 | Ga0466972_0125339 | Ga0466972_0125339_179_1195 | 313 |
| 795 | 3300044684 | Ga0466966_0031238 | Ga0466966_0031238_1780_2721 | 313 |
| 796 | 3300044735 | Ga0466968_0016062 | Ga0466968_0016062_38_985 | 313 |
| 797 | 3300044842 | Ga0466957_0000261 | Ga0466957_0000261_9207_10148 | 313 |
| 798 | 3300045049 | Ga0466959_0177961 | Ga0466959_0177961_478_1419 | 313 |
| 799 | 3300046512 | Ga0495610_0000250 | Ga0495610_0000250_5847_6788 | 313 |
| 800 | 3300046519 | Ga0495632_0000078 | Ga0495632_0000078_93279_94244 | 313 |
| 801 | 3300047469 | Ga0495673_0047182 | Ga0495673_0047182_420_1361 | 313 |
| 802 | 3300047472 | Ga0495686_0011858 | Ga0495686_0011858_1998_2939 | 313 |
| 803 | 3300048903 | Ga0496100_0033040 | Ga0496100_0033040_1352_2293 | 313 |
| 804 | 3300048907 | Ga0496104_0087727 | Ga0496104_0087727_890_1831 | 313 |
| 805 | 3300048917 | Ga0496114_0364924 | Ga0496114_0364924_121_1080 | 313 |
| 806 | 3300048918 | Ga0496115_0118077 | Ga0496115_0118077_1111_2070 | 313 |
| 807 | 3300048919 | Ga0496116_0000857 | Ga0496116_0000857_19922_20941 | 313 |
| 808 | 3300048920 | Ga0496117_0001218 | Ga0496117_0001218_12041_13060 | 313 |
| 809 | 3300048920 | Ga0496117_0042094 | Ga0496117_0042094_1754_2695 | 313 |
| 810 | 3300048921 | Ga0496118_0002447 | Ga0496118_0002447_12279_13298 | 313 |
| 811 | 3300048923 | Ga0496120_0001071 | Ga0496120_0001071_27718_28797 | 313 |
| 812 | 3300048923 | Ga0496120_0047971 | Ga0496120_0047971_783_1724 | 313 |
| 813 | 3300048924 | Ga0496121_0000216 | Ga0496121_0000216_56317_57276 | 313 |
| 814 | 3300048924 | Ga0496121_0048038 | Ga0496121_0048038_1784_2725 | 313 |
| 815 | 3300048924 | Ga0496121_0168806 | Ga0496121_0168806_542_1561 | 313 |
| 816 | 3300048925 | Ga0496122_0010072 | Ga0496122_0010072_3577_4596 | 313 |
| 817 | 3300048925 | Ga0496122_0019851 | Ga0496122_0019851_3941_4882 | 313 |
| 818 | 3300048925 | Ga0496122_0067529 | Ga0496122_0067529_704_1645 | 313 |
| 819 | 3300048926 | Ga0496123_0007711 | Ga0496123_0007711_4866_5807 | 313 |
| 820 | 3300048926 | Ga0496123_0013331 | Ga0496123_0013331_2814_3833 | 313 |
| 821 | 3300048926 | Ga0496123_0054797 | Ga0496123_0054797_411_1352 | 313 |
| 822 | 3300048927 | Ga0496124_0002465 | Ga0496124_0002465_4069_5088 | 313 |
| 823 | 3300048927 | Ga0496124_0144396 | Ga0496124_0144396_227_1168 | 313 |
| 824 | 3300048927 | Ga0496124_0150045 | Ga0496124_0150045_789_1730 | 313 |
| 825 | 3300048928 | Ga0496125_0013205 | Ga0496125_0013205_3087_4028 | 313 |
| 826 | 3300048929 | Ga0496126_0176205 | Ga0496126_0176205_59_1000 | 313 |
| 827 | 3300048986 | Ga0466983_0073864 | Ga0466983_0073864_383_1324 | 313 |
| 828 | 3300049569 | Ga0501032_0094992 | Ga0501032_0094992_501_1532 | 313 |
| 829 | 3300049570 | Ga0501033_0086527 | Ga0501033_0086527_1035_2066 | 313 |
| 830 | 3300049571 | Ga0501034_0084905 | Ga0501034_0084905_1035_2066 | 313 |
| 831 | 3300049572 | Ga0501036_0013996 | Ga0501036_0013996_1219_2250 | 313 |
| 832 | 3300049573 | Ga0501037_0029131 | Ga0501037_0029131_2440_3471 | 313 |
| 833 | 3300049574 | Ga0501038_0001324 | Ga0501038_0001324_5530_6561 | 313 |
| 834 | 3300049575 | Ga0501039_0009870 | Ga0501039_0009870_210_1241 | 313 |
| 835 | 3300049579 | Ga0501043_0132853 | Ga0501043_0132853_229_1260 | 313 |
| 836 | 3300049580 | Ga0501046_0012126 | Ga0501046_0012126_94_1125 | 313 |
| 837 | 3300049582 | Ga0501048_0152311 | Ga0501048_0152311_191_1222 | 313 |
| 838 | 3300049583 | Ga0501067_0007384 | Ga0501067_0007384_4526_5557 | 313 |
| 839 | 3300049584 | Ga0501068_0030388 | Ga0501068_0030388_2093_3124 | 313 |
| 840 | 3300049585 | Ga0501069_0002823 | Ga0501069_0002823_1939_2970 | 313 |
| 841 | 3300049586 | Ga0501070_0015461 | Ga0501070_0015461_5139_6170 | 313 |
| 842 | 3300049589 | Ga0501073_0010995 | Ga0501073_0010995_568_1599 | 313 |
| 843 | 3300049590 | Ga0501074_0172302 | Ga0501074_0172302_208_1239 | 313 |
| 844 | 3300049741 | Ga0501079_0073381 | Ga0501079_0073381_19_1050 | 313 |
| 845 | 3300049742 | Ga0501080_0008605 | Ga0501080_0008605_1894_2925 | 313 |
| 846 | 3300049744 | Ga0501083_0012781 | Ga0501083_0012781_4638_5702 | 313 |
| 847 | 3300049744 | Ga0501083_0034999 | Ga0501083_0034999_681_1712 | 313 |
| 848 | 3300049822 | Ga0501035_0005026 | Ga0501035_0005026_6232_7263 | 313 |
| 849 | 3300049823 | Ga0501044_0000197 | Ga0501044_0000197_74830_75771 | 313 |
| 850 | 3300049823 | Ga0501044_0017480 | Ga0501044_0017480_2598_3629 | 313 |
| 851 | 3300050490 | nmdc:mga03n38_15347_c1 | nmdc:mga03n38_15347_c1_876_1826 | 313 |
| 852 | 3300050492 | nmdc:mga0yw44_6122_c1 | nmdc:mga0yw44_6122_c1_2118_3059 | 313 |
| 853 | 3300050494 | nmdc:mga06z11_16947_c1 | nmdc:mga06z11_16947_c1_1480_2430 | 313 |
| 854 | 3300050494 | nmdc:mga06z11_27539_c1 | nmdc:mga06z11_27539_c1_295_1236 | 313 |
| 855 | 3300053125 | Ga0500618_018846 | Ga0500618_018846_135_1076 | 313 |
| 856 | 3300054114 | Ga0501084_0144285 | Ga0501084_0144285_389_1420 | 313 |
| 857 | iso_pu_bacteria | 2595698237 | 2596375078 | 313 |
| 858 | iso_pu_bacteria | 2902330777 | 2902335428 | 313 |
| 859 | iso_pu_bacteria | 2902405164 | 2902409518 | 313 |
| 860 | iso_pu_bacteria | 2928125067 | 2928126426 | 313 |
| 861 | 2162886007 | SwRhRL2b_contig_2703748 | SwRhRL2b_0919.00000720 | 314 |
| 862 | 2162886007 | SwRhRL2b_contig_507962 | SwRhRL2b_0297.00003340 | 314 |
| 863 | 3300001979 | JGI24740J21852_10000099 | JGI24740J21852_1000009926 | 314 |
| 864 | 3300001979 | JGI24740J21852_10032415 | JGI24740J21852_100324152 | 314 |
| 865 | 3300002704 | JGI25155J39150_1000027 | JGI25155J39150_100002775 | 314 |
| 866 | 3300002705 | JGI25156J39149_1000008 | JGI25156J39149_100000850 | 314 |
| 867 | 3300002705 | JGI25156J39149_1001201 | JGI25156J39149_100120111 | 314 |
| 868 | 3300002705 | JGI25156J39149_1001580 | JGI25156J39149_10015809 | 314 |
| 869 | 3300002737 | JGI25162J39368_1000074 | JGI25162J39368_100007437 | 314 |
| 870 | 3300002738 | JGI25154J39366_1000050 | JGI25154J39366_100005075 | 314 |
| 871 | 3300002741 | JGI25157J39369_1000028 | JGI25157J39369_100002850 | 314 |
| 872 | 3300002741 | JGI25157J39369_1000767 | JGI25157J39369_10007675 | 314 |
| 873 | 3300003214 | JGI25165J46597_1000201 | JGI25165J46597_100020178 | 314 |
| 874 | 3300003214 | JGI25165J46597_1001615 | JGI25165J46597_10016154 | 314 |
| 875 | 3300003316 | rootH1_10002623 | rootH1_100026236 | 314 |
| 876 | 3300003320 | rootH2_10051550 | rootH2_100515507 | 314 |
| 877 | 3300003323 | rootH1_10046512 | rootH1_100465122 | 314 |
| 878 | 3300003756 | Ga0055533_1000070 | Ga0055533_1000070147 | 314 |
| 879 | 3300003758 | Ga0055532_1000011 | Ga0055532_1000011228 | 314 |
| 880 | 3300003760 | Ga0055527_1000009 | Ga0055527_1000009227 | 314 |
| 881 | 3300003761 | Ga0055535_1000008 | Ga0055535_1000008141 | 314 |
| 882 | 3300003762 | Ga0055542_1000014 | Ga0055542_1000014141 | 314 |
| 883 | 3300003762 | Ga0055542_1001483 | Ga0055542_10014835 | 314 |
| 884 | 3300003763 | Ga0055529_1000010 | Ga0055529_1000010141 | 314 |
| 885 | 3300003771 | Ga0055526_1000209 | Ga0055526_100020924 | 314 |
| 886 | 3300003791 | Ga0055530_10000534 | Ga0055530_1000053426 | 314 |
| 887 | 3300003792 | Ga0055540_1000042 | Ga0055540_1000042136 | 314 |
| 888 | 3300003794 | Ga0055531_10000002 | Ga0055531_10000002247 | 314 |
| 889 | 3300003794 | Ga0055531_10003120 | Ga0055531_100031206 | 314 |
| 890 | 3300005289 | Ga0065704_10002196 | Ga0065704_100021962 | 314 |
| 891 | 3300005289 | Ga0065704_10071779 | Ga0065704_100717795 | 314 |
| 892 | 3300005347 | Ga0070668_100013859 | Ga0070668_1000138593 | 314 |
| 893 | 3300005355 | Ga0070671_100355327 | Ga0070671_1003553272 | 314 |
| 894 | 3300005563 | Ga0068855_100126350 | Ga0068855_1001263502 | 314 |
| 895 | 3300005614 | Ga0068856_100005571 | Ga0068856_1000055717 | 314 |
| 896 | 3300006038 | Ga0075365_10212790 | Ga0075365_102127901 | 314 |
| 897 | 3300006048 | Ga0075363_100031537 | Ga0075363_1000315372 | 314 |
| 898 | 3300006177 | Ga0075362_10021049 | Ga0075362_100210492 | 314 |
| 899 | 3300006178 | Ga0075367_10004732 | Ga0075367_100047323 | 314 |
| 900 | 3300006178 | Ga0075367_10064999 | Ga0075367_100649992 | 314 |
| 901 | 3300006186 | Ga0075369_10015202 | Ga0075369_100152022 | 314 |
| 902 | 3300009036 | Ga0105244_10003371 | Ga0105244_100033715 | 314 |
| 903 | 3300009036 | Ga0105244_10004115 | Ga0105244_100041154 | 314 |
| 904 | 3300009093 | Ga0105240_10207805 | Ga0105240_102078053 | 314 |
| 905 | 3300009551 | Ga0105238_10412598 | Ga0105238_104125981 | 314 |
| 906 | 3300010375 | Ga0105239_10196744 | Ga0105239_101967442 | 314 |
| 907 | 3300010375 | Ga0105239_10316980 | Ga0105239_103169802 | 314 |
| 908 | 3300013105 | Ga0157369_10530863 | Ga0157369_105308631 | 314 |
| 909 | 3300013296 | Ga0157374_10287320 | Ga0157374_102873203 | 314 |
| 910 | 3300014497 | Ga0182008_10016440 | Ga0182008_100164402 | 314 |
| 911 | 3300015261 | Ga0182006_1000257 | Ga0182006_100025716 | 314 |
| 912 | 3300015262 | Ga0182007_10051204 | Ga0182007_100512042 | 314 |
| 913 | 3300015265 | Ga0182005_1000016 | Ga0182005_1000016169 | 314 |
| 914 | 3300021320 | Ga0214544_1000130 | Ga0214544_100013027 | 314 |
| 915 | 3300021321 | Ga0214542_1000014 | Ga0214542_100001438 | 314 |
| 916 | 3300021321 | Ga0214542_1008629 | Ga0214542_10086295 | 314 |
| 917 | 3300021327 | Ga0214543_1000018 | Ga0214543_100001879 | 314 |
| 918 | 3300021327 | Ga0214543_1000146 | Ga0214543_100014638 | 314 |
| 919 | 3300022739 | Ga0228711_1000005 | Ga0228711_1000005158 | 314 |
| 920 | 3300022740 | Ga0228710_1000141 | Ga0228710_100014118 | 314 |
| 921 | 3300025206 | Ga0209435_100020 | Ga0209435_10002049 | 314 |
| 922 | 3300025226 | Ga0209674_100011 | Ga0209674_100011687 | 314 |
| 923 | 3300025228 | Ga0209672_100002 | Ga0209672_100002680 | 314 |
| 924 | 3300025229 | Ga0209147_100003 | Ga0209147_100003680 | 314 |
| 925 | 3300025230 | Ga0209563_101714 | Ga0209563_1017143 | 314 |
| 926 | 3300025233 | Ga0209437_100067 | Ga0209437_10006781 | 314 |
| 927 | 3300025233 | Ga0209437_100104 | Ga0209437_100104134 | 314 |
| 928 | 3300025242 | Ga0209258_100005 | Ga0209258_100005322 | 314 |
| 929 | 3300025245 | Ga0207425_1000170 | Ga0207425_10001705 | 314 |
| 930 | 3300025246 | Ga0209646_1000070 | Ga0209646_100007049 | 314 |
| 931 | 3300025246 | Ga0209646_1005987 | Ga0209646_10059873 | 314 |
| 932 | 3300025246 | Ga0209646_1007551 | Ga0209646_10075512 | 314 |
| 933 | 3300025250 | Ga0209026_1000057 | Ga0209026_1000057173 | 314 |
| 934 | 3300025250 | Ga0209026_1000116 | Ga0209026_100011622 | 314 |
| 935 | 3300025254 | Ga0209148_1000006 | Ga0209148_1000006680 | 314 |
| 936 | 3300025254 | Ga0209148_1001181 | Ga0209148_10011815 | 314 |
| 937 | 3300025256 | Ga0209759_1000006 | Ga0209759_1000006318 | 314 |
| 938 | 3300025256 | Ga0209759_1000047 | Ga0209759_1000047173 | 314 |
| 939 | 3300025256 | Ga0209759_1000153 | Ga0209759_1000153101 | 314 |
| 940 | 3300025261 | Ga0209233_1000018 | Ga0209233_1000018668 | 314 |
| 941 | 3300025261 | Ga0209233_1000088 | Ga0209233_100008881 | 314 |
| 942 | 3300025272 | Ga0209455_1000003 | Ga0209455_1000003680 | 314 |
| 943 | 3300025272 | Ga0209455_1001297 | Ga0209455_10012975 | 314 |
| 944 | 3300025294 | Ga0209025_1003982 | Ga0209025_100398213 | 314 |
| 945 | 3300025294 | Ga0209025_1004669 | Ga0209025_10046698 | 314 |
| 946 | 3300025294 | Ga0209025_1044062 | Ga0209025_10440622 | 314 |
| 947 | 3300025295 | Ga0209564_1000027 | Ga0209564_1000027193 | 314 |
| 948 | 3300025297 | Ga0209758_1000394 | Ga0209758_100039420 | 314 |
| 949 | 3300025297 | Ga0209758_1017152 | Ga0209758_10171522 | 314 |
| 950 | 3300025298 | Ga0209050_1003209 | Ga0209050_100320910 | 314 |
| 951 | 3300025298 | Ga0209050_1007519 | Ga0209050_10075193 | 314 |
| 952 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004728 | 314 |
| 953 | 3300025303 | Ga0209051_1009286 | Ga0209051_10092865 | 314 |
| 954 | 3300025304 | Ga0209257_1000049 | Ga0209257_1000049282 | 314 |
| 955 | 3300025304 | Ga0209257_1000063 | Ga0209257_1000063214 | 314 |
| 956 | 3300025304 | Ga0209257_1009223 | Ga0209257_10092232 | 314 |
| 957 | 3300025711 | Ga0207696_1000010 | Ga0207696_1000010270 | 314 |
| 958 | 3300025711 | Ga0207696_1017973 | Ga0207696_10179733 | 314 |
| 959 | 3300025728 | Ga0207655_1002486 | Ga0207655_100248612 | 314 |
| 960 | 3300025728 | Ga0207655_1007210 | Ga0207655_10072102 | 314 |
| 961 | 3300025728 | Ga0207655_1048845 | Ga0207655_10488452 | 314 |
| 962 | 3300025735 | Ga0207713_1004456 | Ga0207713_100445612 | 314 |
| 963 | 3300025735 | Ga0207713_1018782 | Ga0207713_10187825 | 314 |
| 964 | 3300025904 | Ga0207647_10006270 | Ga0207647_100062708 | 314 |
| 965 | 3300025913 | Ga0207695_10189141 | Ga0207695_101891412 | 314 |
| 966 | 3300025919 | Ga0207657_10111346 | Ga0207657_101113462 | 314 |
| 967 | 3300025931 | Ga0207644_10382862 | Ga0207644_103828621 | 314 |
| 968 | 3300025935 | Ga0207709_10143029 | Ga0207709_101430292 | 314 |
| 969 | 3300025972 | Ga0207668_10042064 | Ga0207668_100420642 | 314 |
| 970 | 3300025972 | Ga0207668_10438330 | Ga0207668_104383301 | 314 |
| 971 | 3300026041 | Ga0207639_10185651 | Ga0207639_101856512 | 314 |
| 972 | 3300026067 | Ga0207678_10446914 | Ga0207678_104469141 | 314 |
| 973 | 3300027111 | Ga0209281_1000111 | Ga0209281_1000111158 | 314 |
| 974 | 3300027111 | Ga0209281_1000185 | Ga0209281_100018568 | 314 |
| 975 | 3300027111 | Ga0209281_1010652 | Ga0209281_10106522 | 314 |
| 976 | 3300027312 | Ga0209371_1005132 | Ga0209371_10051323 | 314 |
| 977 | 3300027666 | Ga0209282_1000012 | Ga0209282_1000012158 | 314 |
| 978 | 3300030500 | Ga0268256_1003987 | Ga0268256_10039875 | 314 |
| 979 | 3300031548 | Ga0307408_100000964 | Ga0307408_10000096411 | 314 |
| 980 | 3300031548 | Ga0307408_100200897 | Ga0307408_1002008972 | 314 |
| 981 | 3300031852 | Ga0307410_10052825 | Ga0307410_100528251 | 314 |
| 982 | 3300031903 | Ga0307407_10320645 | Ga0307407_103206451 | 314 |
| 983 | 3300031911 | Ga0307412_10086938 | Ga0307412_100869382 | 314 |
| 984 | 3300031967 | Ga0315914_1000007 | Ga0315914_100000756 | 314 |
| 985 | 3300031995 | Ga0307409_100147664 | Ga0307409_1001476642 | 314 |
| 986 | 3300032004 | Ga0307414_10317469 | Ga0307414_103174691 | 314 |
| 987 | 3300032126 | Ga0307415_100023316 | Ga0307415_1000233162 | 314 |
| 988 | 3300032126 | Ga0307415_100100310 | Ga0307415_1001003101 | 314 |
| 989 | 3300033430 | Ga0315913_1000003 | Ga0315913_1000003158 | 314 |
| 990 | 3300033464 | Ga0315915_1000011 | Ga0315915_100001156 | 314 |
| 991 | 3300037312 | Ga0395899_0041664 | Ga0395899_0041664_874_1821 | 314 |
| 992 | 3300037466 | Ga0395898_0027682 | Ga0395898_0027682_3936_4883 | 314 |
| 993 | 3300037471 | Ga0395905_0001781 | Ga0395905_0001781_15720_16694 | 314 |
| 994 | 3300037471 | Ga0395905_0017230 | Ga0395905_0017230_373_1320 | 314 |
| 995 | 3300038443 | Ga0395901_0000004 | Ga0395901_0000004_426190_427137 | 314 |
| 996 | 3300038443 | Ga0395901_0016229 | Ga0395901_0016229_5175_6122 | 314 |
| 997 | 3300041443 | Ga0451789_0984162 | Ga0451789_0984162_14_976 | 314 |
| 998 | 3300042007 | Ga0439449_0019179 | Ga0439449_0019179_1546_2508 | 314 |
| 999 | 3300044656 | Ga0466969_0000044 | Ga0466969_0000044_32859_33803 | 314 |
| 1000 | 3300044658 | Ga0466972_0046804 | Ga0466972_0046804_283_1227 | 314 |
| 1001 | 3300044659 | Ga0466973_0046713 | Ga0466973_0046713_1194_2138 | 314 |
| 1002 | 3300044683 | Ga0466965_0000720 | Ga0466965_0000720_1095_2039 | 314 |
| 1003 | 3300044693 | Ga0466961_0000032 | Ga0466961_0000032_82217_83161 | 314 |
| 1004 | 3300044719 | Ga0466971_0009600 | Ga0466971_0009600_72_1016 | 314 |
| 1005 | 3300044842 | Ga0466957_0002377 | Ga0466957_0002377_5228_6172 | 314 |
| 1006 | 3300044901 | Ga0466960_0100614 | Ga0466960_0100614_215_1177 | 314 |
| 1007 | 3300046452 | Ga0495617_000032 | Ga0495617_000032_14069_15013 | 314 |
| 1008 | 3300046454 | Ga0495592_0022194 | Ga0495592_0022194_422_1366 | 314 |
| 1009 | 3300046459 | Ga0495629_0058774 | Ga0495629_0058774_925_1869 | 314 |
| 1010 | 3300046460 | Ga0495638_0095099 | Ga0495638_0095099_467_1411 | 314 |
| 1011 | 3300046463 | Ga0495653_0004452 | Ga0495653_0004452_9428_10372 | 314 |
| 1012 | 3300046471 | Ga0495650_0000100 | Ga0495650_0000100_205695_206639 | 314 |
| 1013 | 3300046471 | Ga0495650_0000251 | Ga0495650_0000251_28477_29421 | 314 |
| 1014 | 3300046471 | Ga0495650_0005160 | Ga0495650_0005160_2139_3083 | 314 |
| 1015 | 3300046473 | Ga0495582_0051801 | Ga0495582_0051801_89_1033 | 314 |
| 1016 | 3300046474 | Ga0495605_0000097 | Ga0495605_0000097_95738_96682 | 314 |
| 1017 | 3300046477 | Ga0495664_0005352 | Ga0495664_0005352_1775_2719 | 314 |
| 1018 | 3300046492 | Ga0495585_0000630 | Ga0495585_0000630_30275_31219 | 314 |
| 1019 | 3300046501 | Ga0495607_0039900 | Ga0495607_0039900_168_1112 | 314 |
| 1020 | 3300046506 | Ga0495583_0053888 | Ga0495583_0053888_111_1073 | 314 |
| 1021 | 3300046507 | Ga0495606_0000770 | Ga0495606_0000770_32591_33535 | 314 |
| 1022 | 3300046507 | Ga0495606_0012937 | Ga0495606_0012937_4642_5604 | 314 |
| 1023 | 3300046511 | Ga0495608_0025978 | Ga0495608_0025978_2912_3856 | 314 |
| 1024 | 3300046512 | Ga0495610_0000017 | Ga0495610_0000017_212385_213329 | 314 |
| 1025 | 3300046512 | Ga0495610_0001418 | Ga0495610_0001418_15640_16584 | 314 |
| 1026 | 3300046512 | Ga0495610_0021874 | Ga0495610_0021874_1925_2887 | 314 |
| 1027 | 3300046514 | Ga0495618_0005072 | Ga0495618_0005072_6120_7064 | 314 |
| 1028 | 3300046515 | Ga0495620_0000002 | Ga0495620_0000002_82574_83524 | 314 |
| 1029 | 3300046515 | Ga0495620_0067005 | Ga0495620_0067005_11_973 | 314 |
| 1030 | 3300046516 | Ga0495628_0089220 | Ga0495628_0089220_977_1921 | 314 |
| 1031 | 3300046516 | Ga0495628_0111238 | Ga0495628_0111238_337_1281 | 314 |
| 1032 | 3300046517 | Ga0495630_0009126 | Ga0495630_0009126_4870_5814 | 314 |
| 1033 | 3300046519 | Ga0495632_0002448 | Ga0495632_0002448_7520_8470 | 314 |
| 1034 | 3300046522 | Ga0495643_0004116 | Ga0495643_0004116_8125_9075 | 314 |
| 1035 | 3300046524 | Ga0495648_0004429 | Ga0495648_0004429_6412_7362 | 314 |
| 1036 | 3300046524 | Ga0495648_0025679 | Ga0495648_0025679_1377_2321 | 314 |
| 1037 | 3300046526 | Ga0495666_0002377 | Ga0495666_0002377_6419_7363 | 314 |
| 1038 | 3300046529 | Ga0495652_0068039 | Ga0495652_0068039_1572_2516 | 314 |
| 1039 | 3300046530 | Ga0495654_0001095 | Ga0495654_0001095_1889_2833 | 314 |
| 1040 | 3300046530 | Ga0495654_0069058 | Ga0495654_0069058_140_1102 | 314 |
| 1041 | 3300046531 | Ga0495665_0004564 | Ga0495665_0004564_5683_6627 | 314 |
| 1042 | 3300046533 | Ga0495640_0006408 | Ga0495640_0006408_2013_2957 | 314 |
| 1043 | 3300046535 | Ga0495586_0020486 | Ga0495586_0020486_627_1571 | 314 |
| 1044 | 3300046538 | Ga0495609_0008920 | Ga0495609_0008920_2201_3163 | 314 |
| 1045 | 3300046542 | Ga0495597_0000153 | Ga0495597_0000153_31101_32045 | 314 |
| 1046 | 3300046557 | Ga0495622_0000017 | Ga0495622_0000017_49126_50070 | 314 |
| 1047 | 3300046557 | Ga0495622_0009536 | Ga0495622_0009536_1536_2498 | 314 |
| 1048 | 3300046558 | Ga0495633_0013478 | Ga0495633_0013478_253_1197 | 314 |
| 1049 | 3300046616 | Ga0495668_0000446 | Ga0495668_0000446_43761_44705 | 314 |
| 1050 | 3300046616 | Ga0495668_0000766 | Ga0495668_0000766_6797_7741 | 314 |
| 1051 | 3300046642 | Ga0495634_0016182 | Ga0495634_0016182_98_1042 | 314 |
| 1052 | 3300046660 | Ga0495625_0000303 | Ga0495625_0000303_62195_63139 | 314 |
| 1053 | 3300046660 | Ga0495625_0059278 | Ga0495625_0059278_597_1559 | 314 |
| 1054 | 3300046660 | Ga0495625_0081866 | Ga0495625_0081866_846_1790 | 314 |
| 1055 | 3300046663 | Ga0495635_0045810 | Ga0495635_0045810_1199_2143 | 314 |
| 1056 | 3300046665 | Ga0495661_0013740 | Ga0495661_0013740_1246_2190 | 314 |
| 1057 | 3300046674 | Ga0495588_0003777 | Ga0495588_0003777_3946_4908 | 314 |
| 1058 | 3300046675 | Ga0495657_0034251 | Ga0495657_0034251_61_1005 | 314 |
| 1059 | 3300046679 | Ga0495623_0000841 | Ga0495623_0000841_5466_6410 | 314 |
| 1060 | 3300046679 | Ga0495623_0005535 | Ga0495623_0005535_5564_6508 | 314 |
| 1061 | 3300046680 | Ga0495646_0003629 | Ga0495646_0003629_7751_8695 | 314 |
| 1062 | 3300046690 | Ga0495624_0027202 | Ga0495624_0027202_2090_3034 | 314 |
| 1063 | 3300046692 | Ga0495671_0000026 | Ga0495671_0000026_31933_32877 | 314 |
| 1064 | 3300046810 | Ga0495660_0005434 | Ga0495660_0005434_206_1150 | 314 |
| 1065 | 3300046810 | Ga0495660_0087732 | Ga0495660_0087732_527_1489 | 314 |
| 1066 | 3300047315 | Ga0495581_0001521 | Ga0495581_0001521_7276_8220 | 314 |
| 1067 | 3300047317 | Ga0495604_0002202 | Ga0495604_0002202_8968_9912 | 314 |
| 1068 | 3300047317 | Ga0495604_0012528 | Ga0495604_0012528_360_1304 | 314 |
| 1069 | 3300047319 | Ga0495674_0025702 | Ga0495674_0025702_351_1295 | 314 |
| 1070 | 3300047319 | Ga0495674_0118307 | Ga0495674_0118307_352_1296 | 314 |
| 1071 | 3300047321 | Ga0495676_0004531 | Ga0495676_0004531_9629_10573 | 314 |
| 1072 | 3300047322 | Ga0495680_0012135 | Ga0495680_0012135_5581_6525 | 314 |
| 1073 | 3300047444 | Ga0495675_0004609 | Ga0495675_0004609_301_1245 | 314 |
| 1074 | 3300047444 | Ga0495675_0005302 | Ga0495675_0005302_68_1012 | 314 |
| 1075 | 3300047446 | Ga0495679_026414 | Ga0495679_026414_754_1698 | 314 |
| 1076 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_245931_246875 | 314 |
| 1077 | 3300047469 | Ga0495673_0000069 | Ga0495673_0000069_13581_14525 | 314 |
| 1078 | 3300047472 | Ga0495686_0003817 | Ga0495686_0003817_1679_2623 | 314 |
| 1079 | 3300047673 | Ga0495593_0015742 | Ga0495593_0015742_2820_3764 | 314 |
| 1080 | 3300048088 | Ga0495602_0014867 | Ga0495602_0014867_820_1764 | 314 |
| 1081 | 3300048088 | Ga0495602_0016763 | Ga0495602_0016763_4873_5817 | 314 |
| 1082 | 3300048088 | Ga0495602_0155740 | Ga0495602_0155740_522_1466 | 314 |
| 1083 | 3300048089 | Ga0495614_0000262 | Ga0495614_0000262_6410_7354 | 314 |
| 1084 | 3300048905 | Ga0496102_0214164 | Ga0496102_0214164_311_1273 | 314 |
| 1085 | 3300048906 | Ga0496103_0001333 | Ga0496103_0001333_1782_2726 | 314 |
| 1086 | 3300048913 | Ga0496110_0119215 | Ga0496110_0119215_113_1075 | 314 |
| 1087 | 3300048917 | Ga0496114_0145344 | Ga0496114_0145344_621_1565 | 314 |
| 1088 | 3300048919 | Ga0496116_0046769 | Ga0496116_0046769_1251_2195 | 314 |
| 1089 | 3300048920 | Ga0496117_0004699 | Ga0496117_0004699_4644_5588 | 314 |
| 1090 | 3300048920 | Ga0496117_0005079 | Ga0496117_0005079_7863_8813 | 314 |
| 1091 | 3300048920 | Ga0496117_0007592 | Ga0496117_0007592_5348_6298 | 314 |
| 1092 | 3300048920 | Ga0496117_0136717 | Ga0496117_0136717_131_1093 | 314 |
| 1093 | 3300048921 | Ga0496118_0005809 | Ga0496118_0005809_4985_5935 | 314 |
| 1094 | 3300048921 | Ga0496118_0007347 | Ga0496118_0007347_7682_8626 | 314 |
| 1095 | 3300048922 | Ga0496119_0043800 | Ga0496119_0043800_31_993 | 314 |
| 1096 | 3300048924 | Ga0496121_0003670 | Ga0496121_0003670_6331_7275 | 314 |
| 1097 | 3300048924 | Ga0496121_0056216 | Ga0496121_0056216_1297_2259 | 314 |
| 1098 | 3300048924 | Ga0496121_0198519 | Ga0496121_0198519_372_1322 | 314 |
| 1099 | 3300048925 | Ga0496122_0000072 | Ga0496122_0000072_31723_32685 | 314 |
| 1100 | 3300048925 | Ga0496122_0016896 | Ga0496122_0016896_1885_2847 | 314 |
| 1101 | 3300048925 | Ga0496122_0034800 | Ga0496122_0034800_1287_2231 | 314 |
| 1102 | 3300048925 | Ga0496122_0045223 | Ga0496122_0045223_215_1228 | 314 |
| 1103 | 3300048925 | Ga0496122_0046784 | Ga0496122_0046784_1578_2540 | 314 |
| 1104 | 3300048925 | Ga0496122_0095365 | Ga0496122_0095365_244_1206 | 314 |
| 1105 | 3300048926 | Ga0496123_0000035 | Ga0496123_0000035_76575_77585 | 314 |
| 1106 | 3300048926 | Ga0496123_0001276 | Ga0496123_0001276_28627_29571 | 314 |
| 1107 | 3300048926 | Ga0496123_0028324 | Ga0496123_0028324_2131_3144 | 314 |
| 1108 | 3300048926 | Ga0496123_0029082 | Ga0496123_0029082_1995_2957 | 314 |
| 1109 | 3300048926 | Ga0496123_0032177 | Ga0496123_0032177_32_994 | 314 |
| 1110 | 3300048927 | Ga0496124_0046464 | Ga0496124_0046464_1352_2314 | 314 |
| 1111 | 3300048927 | Ga0496124_0060506 | Ga0496124_0060506_337_1299 | 314 |
| 1112 | 3300048927 | Ga0496124_0120197 | Ga0496124_0120197_967_1917 | 314 |
| 1113 | 3300048928 | Ga0496125_0000083 | Ga0496125_0000083_56276_57238 | 314 |
| 1114 | 3300048928 | Ga0496125_0002616 | Ga0496125_0002616_16964_17914 | 314 |
| 1115 | 3300048929 | Ga0496126_0025397 | Ga0496126_0025397_1255_2205 | 314 |
| 1116 | 3300048929 | Ga0496126_0044235 | Ga0496126_0044235_2120_3064 | 314 |
| 1117 | 3300048929 | Ga0496126_0086052 | Ga0496126_0086052_1734_2696 | 314 |
| 1118 | 3300048929 | Ga0496126_0205637 | Ga0496126_0205637_341_1303 | 314 |
| 1119 | 3300049572 | Ga0501036_0051379 | Ga0501036_0051379_155_1144 | 314 |
| 1120 | 3300049574 | Ga0501038_0303248 | Ga0501038_0303248_87_1085 | 314 |
| 1121 | 3300049575 | Ga0501039_0014805 | Ga0501039_0014805_135_1124 | 314 |
| 1122 | 3300049575 | Ga0501039_0163374 | Ga0501039_0163374_533_1564 | 314 |
| 1123 | 3300049576 | Ga0501040_0040498 | Ga0501040_0040498_2100_3098 | 314 |
| 1124 | 3300049577 | Ga0501041_0002166 | Ga0501041_0002166_9501_10499 | 314 |
| 1125 | 3300049579 | Ga0501043_0034195 | Ga0501043_0034195_1293_2318 | 314 |
| 1126 | 3300049580 | Ga0501046_0086408 | Ga0501046_0086408_710_1741 | 314 |
| 1127 | 3300049583 | Ga0501067_0028994 | Ga0501067_0028994_28_990 | 314 |
| 1128 | 3300049587 | Ga0501071_0060221 | Ga0501071_0060221_1669_2658 | 314 |
| 1129 | 3300049588 | Ga0501072_0023777 | Ga0501072_0023777_1391_2380 | 314 |
| 1130 | 3300049823 | Ga0501044_0022584 | Ga0501044_0022584_1862_2824 | 314 |
| 1131 | 3300049823 | Ga0501044_0113390 | Ga0501044_0113390_422_1453 | 314 |
| 1132 | 3300050489 | nmdc:mga03683_90121_c1 | nmdc:mga03683_90121_c1_283_1227 | 314 |
| 1133 | 3300050491 | nmdc:mga00v17_23406_c1 | nmdc:mga00v17_23406_c1_375_1337 | 314 |
| 1134 | 3300050492 | nmdc:mga0yw44_5023_c1 | nmdc:mga0yw44_5023_c1_4444_5406 | 314 |
| 1135 | 3300050492 | nmdc:mga0yw44_60177_c1 | nmdc:mga0yw44_60177_c1_153_1115 | 314 |
| 1136 | 3300050494 | nmdc:mga06z11_130684_c1 | nmdc:mga06z11_130684_c1_431_1393 | 314 |
| 1137 | 3300050494 | nmdc:mga06z11_34263_c1 | nmdc:mga06z11_34263_c1_339_1301 | 314 |
| 1138 | 3300050516 | nmdc:mga0sz30_2467_c2 | nmdc:mga0sz30_2467_c2_677_1639 | 314 |
| 1139 | 3300053140 | Ga0500573_0101848 | Ga0500573_0101848_271_1233 | 314 |
| 1140 | 3300053157 | Ga0500624_000341 | Ga0500624_000341_12111_13076 | 314 |
| 1141 | 3300053161 | Ga0500634_0002225 | Ga0500634_0002225_3074_4039 | 314 |
| 1142 | 3300054114 | Ga0501084_0016873 | Ga0501084_0016873_4870_5901 | 314 |
| 1143 | 3300061719 | Ga0466962_0001725 | Ga0466962_0001725_6121_7065 | 314 |
| 1144 | iso_pu_bacteria | 2508501122 | 2509109995 | 314 |
| 1145 | 2162886007 | SwRhRL2b_contig_2672424 | SwRhRL2b_0506.00001210 | 315 |
| 1146 | 2162886007 | SwRhRL2b_contig_2894984 | SwRhRL2b_0584.00005460 | 315 |
| 1147 | 3300002987 | JGI25159J45721_1004247 | JGI25159J45721_10042475 | 315 |
| 1148 | 3300003752 | Ga0055539_1000011 | Ga0055539_1000011282 | 315 |
| 1149 | 3300003756 | Ga0055533_1000014 | Ga0055533_1000014282 | 315 |
| 1150 | 3300003758 | Ga0055532_1000009 | Ga0055532_1000009282 | 315 |
| 1151 | 3300003759 | Ga0055525_1000016 | Ga0055525_1000016282 | 315 |
| 1152 | 3300003781 | Ga0055536_1000013 | Ga0055536_100001339 | 315 |
| 1153 | 3300003781 | Ga0055536_1000035 | Ga0055536_1000035135 | 315 |
| 1154 | 3300003791 | Ga0055530_10000212 | Ga0055530_100002122 | 315 |
| 1155 | 3300003792 | Ga0055540_1000008 | Ga0055540_100000887 | 315 |
| 1156 | 3300003794 | Ga0055531_10000150 | Ga0055531_1000015046 | 315 |
| 1157 | 3300003841 | Ga0055541_1000008 | Ga0055541_1000008282 | 315 |
| 1158 | 3300005262 | Ga0065165_1000362 | Ga0065165_100036251 | 315 |
| 1159 | 3300005288 | Ga0065714_10064524 | Ga0065714_100645245 | 315 |
| 1160 | 3300005331 | Ga0070670_100000837 | Ga0070670_1000008375 | 315 |
| 1161 | 3300005353 | Ga0070669_100001853 | Ga0070669_10000185313 | 315 |
| 1162 | 3300005457 | Ga0070662_100005634 | Ga0070662_1000056345 | 315 |
| 1163 | 3300005564 | Ga0070664_100000861 | Ga0070664_10000086120 | 315 |
| 1164 | 3300005564 | Ga0070664_100131815 | Ga0070664_1001318152 | 315 |
| 1165 | 3300005834 | Ga0068851_10012475 | Ga0068851_100124753 | 315 |
| 1166 | 3300006051 | Ga0075364_10101485 | Ga0075364_101014851 | 315 |
| 1167 | 3300006058 | Ga0075432_10014173 | Ga0075432_100141732 | 315 |
| 1168 | 3300006944 | Ga0099823_1000102 | Ga0099823_100010227 | 315 |
| 1169 | 3300006946 | Ga0079104_1002790 | Ga0079104_10027909 | 315 |
| 1170 | 3300009011 | Ga0105251_10000476 | Ga0105251_100004763 | 315 |
| 1171 | 3300009011 | Ga0105251_10000877 | Ga0105251_1000087722 | 315 |
| 1172 | 3300009011 | Ga0105251_10001557 | Ga0105251_100015574 | 315 |
| 1173 | 3300009011 | Ga0105251_10013303 | Ga0105251_100133033 | 315 |
| 1174 | 3300009036 | Ga0105244_10003390 | Ga0105244_100033902 | 315 |
| 1175 | 3300009036 | Ga0105244_10006154 | Ga0105244_100061542 | 315 |
| 1176 | 3300009036 | Ga0105244_10007082 | Ga0105244_100070825 | 315 |
| 1177 | 3300009036 | Ga0105244_10009624 | Ga0105244_100096244 | 315 |
| 1178 | 3300009036 | Ga0105244_10010494 | Ga0105244_100104944 | 315 |
| 1179 | 3300009036 | Ga0105244_10016205 | Ga0105244_100162053 | 315 |
| 1180 | 3300009036 | Ga0105244_10033265 | Ga0105244_100332653 | 315 |
| 1181 | 3300009036 | Ga0105244_10047099 | Ga0105244_100470992 | 315 |
| 1182 | 3300009092 | Ga0105250_10000041 | Ga0105250_100000413 | 315 |
| 1183 | 3300009092 | Ga0105250_10000155 | Ga0105250_1000015517 | 315 |
| 1184 | 3300009092 | Ga0105250_10003365 | Ga0105250_100033655 | 315 |
| 1185 | 3300009092 | Ga0105250_10054190 | Ga0105250_100541901 | 315 |
| 1186 | 3300009148 | Ga0105243_10000736 | Ga0105243_1000073618 | 315 |
| 1187 | 3300009176 | Ga0105242_10016807 | Ga0105242_100168072 | 315 |
| 1188 | 3300009545 | Ga0105237_10004461 | Ga0105237_100044618 | 315 |
| 1189 | 3300011119 | Ga0105246_10000357 | Ga0105246_1000035721 | 315 |
| 1190 | 3300011119 | Ga0105246_10000699 | Ga0105246_100006993 | 315 |
| 1191 | 3300012498 | Ga0157345_1000001 | Ga0157345_1000001110 | 315 |
| 1192 | 3300013100 | Ga0157373_10000039 | Ga0157373_1000003932 | 315 |
| 1193 | 3300013100 | Ga0157373_10000193 | Ga0157373_1000019343 | 315 |
| 1194 | 3300013100 | Ga0157373_10000225 | Ga0157373_1000022546 | 315 |
| 1195 | 3300013100 | Ga0157373_10047616 | Ga0157373_100476162 | 315 |
| 1196 | 3300013100 | Ga0157373_10093927 | Ga0157373_100939272 | 315 |
| 1197 | 3300013102 | Ga0157371_10000262 | Ga0157371_1000026220 | 315 |
| 1198 | 3300013102 | Ga0157371_10014295 | Ga0157371_100142956 | 315 |
| 1199 | 3300013102 | Ga0157371_10140454 | Ga0157371_101404542 | 315 |
| 1200 | 3300013104 | Ga0157370_10019164 | Ga0157370_100191645 | 315 |
| 1201 | 3300013104 | Ga0157370_10070977 | Ga0157370_100709772 | 315 |
| 1202 | 3300013104 | Ga0157370_10282385 | Ga0157370_102823852 | 315 |
| 1203 | 3300013105 | Ga0157369_10000236 | Ga0157369_1000023615 | 315 |
| 1204 | 3300013105 | Ga0157369_10001402 | Ga0157369_100014028 | 315 |
| 1205 | 3300013105 | Ga0157369_10005269 | Ga0157369_1000526910 | 315 |
| 1206 | 3300013105 | Ga0157369_10016893 | Ga0157369_100168932 | 315 |
| 1207 | 3300013105 | Ga0157369_10079725 | Ga0157369_100797252 | 315 |
| 1208 | 3300013306 | Ga0163162_10000392 | Ga0163162_1000039218 | 315 |
| 1209 | 3300013308 | Ga0157375_10000139 | Ga0157375_1000013932 | 315 |
| 1210 | 3300013308 | Ga0157375_10002380 | Ga0157375_100023803 | 315 |
| 1211 | 3300013308 | Ga0157375_10087900 | Ga0157375_100879002 | 315 |
| 1212 | 3300014497 | Ga0182008_10000202 | Ga0182008_1000020240 | 315 |
| 1213 | 3300014497 | Ga0182008_10002912 | Ga0182008_100029126 | 315 |
| 1214 | 3300014497 | Ga0182008_10052400 | Ga0182008_100524002 | 315 |
| 1215 | 3300015261 | Ga0182006_1000107 | Ga0182006_100010751 | 315 |
| 1216 | 3300015261 | Ga0182006_1000654 | Ga0182006_100065418 | 315 |
| 1217 | 3300015262 | Ga0182007_10000237 | Ga0182007_1000023731 | 315 |
| 1218 | 3300017792 | Ga0163161_10000066 | Ga0163161_1000006688 | 315 |
| 1219 | 3300017792 | Ga0163161_10092213 | Ga0163161_100922132 | 315 |
| 1220 | 3300025206 | Ga0209435_102302 | Ga0209435_1023022 | 315 |
| 1221 | 3300025224 | Ga0209784_100023 | Ga0209784_100023276 | 315 |
| 1222 | 3300025225 | Ga0209566_100019 | Ga0209566_100019289 | 315 |
| 1223 | 3300025226 | Ga0209674_100034 | Ga0209674_100034289 | 315 |
| 1224 | 3300025229 | Ga0209147_100027 | Ga0209147_100027291 | 315 |
| 1225 | 3300025230 | Ga0209563_100037 | Ga0209563_100037289 | 315 |
| 1226 | 3300025230 | Ga0209563_100549 | Ga0209563_10054912 | 315 |
| 1227 | 3300025242 | Ga0209258_100520 | Ga0209258_1005203 | 315 |
| 1228 | 3300025246 | Ga0209646_1000110 | Ga0209646_1000110105 | 315 |
| 1229 | 3300025253 | Ga0209677_100021 | Ga0209677_100021289 | 315 |
| 1230 | 3300025284 | Ga0209130_1000226 | Ga0209130_100022620 | 315 |
| 1231 | 3300025291 | Ga0209675_1002774 | Ga0209675_10027742 | 315 |
| 1232 | 3300025292 | Ga0209676_1000002 | Ga0209676_10000021484 | 315 |
| 1233 | 3300025292 | Ga0209676_1000020 | Ga0209676_1000020409 | 315 |
| 1234 | 3300025292 | Ga0209676_1026670 | Ga0209676_10266702 | 315 |
| 1235 | 3300025294 | Ga0209025_1000696 | Ga0209025_100069639 | 315 |
| 1236 | 3300025294 | Ga0209025_1038943 | Ga0209025_10389431 | 315 |
| 1237 | 3300025298 | Ga0209050_1000006 | Ga0209050_100000687 | 315 |
| 1238 | 3300025298 | Ga0209050_1001073 | Ga0209050_10010737 | 315 |
| 1239 | 3300025303 | Ga0209051_1000001 | Ga0209051_10000011484 | 315 |
| 1240 | 3300025303 | Ga0209051_1012669 | Ga0209051_10126693 | 315 |
| 1241 | 3300025304 | Ga0209257_1000029 | Ga0209257_100002987 | 315 |
| 1242 | 3300025321 | Ga0207656_10016481 | Ga0207656_100164813 | 315 |
| 1243 | 3300025711 | Ga0207696_1000010 | Ga0207696_1000010104 | 315 |
| 1244 | 3300025711 | Ga0207696_1000011 | Ga0207696_100001138 | 315 |
| 1245 | 3300025711 | Ga0207696_1000223 | Ga0207696_100022346 | 315 |
| 1246 | 3300025711 | Ga0207696_1000844 | Ga0207696_10008442 | 315 |
| 1247 | 3300025711 | Ga0207696_1002071 | Ga0207696_10020719 | 315 |
| 1248 | 3300025728 | Ga0207655_1000074 | Ga0207655_1000074147 | 315 |
| 1249 | 3300025728 | Ga0207655_1000076 | Ga0207655_1000076219 | 315 |
| 1250 | 3300025728 | Ga0207655_1000151 | Ga0207655_100015186 | 315 |
| 1251 | 3300025728 | Ga0207655_1003611 | Ga0207655_10036112 | 315 |
| 1252 | 3300025728 | Ga0207655_1006716 | Ga0207655_10067162 | 315 |
| 1253 | 3300025728 | Ga0207655_1009340 | Ga0207655_10093404 | 315 |
| 1254 | 3300025728 | Ga0207655_1009732 | Ga0207655_10097325 | 315 |
| 1255 | 3300025728 | Ga0207655_1010724 | Ga0207655_10107243 | 315 |
| 1256 | 3300025728 | Ga0207655_1015029 | Ga0207655_10150293 | 315 |
| 1257 | 3300025728 | Ga0207655_1018673 | Ga0207655_10186732 | 315 |
| 1258 | 3300025735 | Ga0207713_1000061 | Ga0207713_100006169 | 315 |
| 1259 | 3300025735 | Ga0207713_1000131 | Ga0207713_100013129 | 315 |
| 1260 | 3300025735 | Ga0207713_1000143 | Ga0207713_100014363 | 315 |
| 1261 | 3300025735 | Ga0207713_1001052 | Ga0207713_100105217 | 315 |
| 1262 | 3300025735 | Ga0207713_1002396 | Ga0207713_10023968 | 315 |
| 1263 | 3300025735 | Ga0207713_1004346 | Ga0207713_10043467 | 315 |
| 1264 | 3300025735 | Ga0207713_1004727 | Ga0207713_10047276 | 315 |
| 1265 | 3300025735 | Ga0207713_1010956 | Ga0207713_10109562 | 315 |
| 1266 | 3300025735 | Ga0207713_1024822 | Ga0207713_10248221 | 315 |
| 1267 | 3300025914 | Ga0207671_10009655 | Ga0207671_100096553 | 315 |
| 1268 | 3300025920 | Ga0207649_10000954 | Ga0207649_1000095415 | 315 |
| 1269 | 3300025923 | Ga0207681_10000430 | Ga0207681_1000043028 | 315 |
| 1270 | 3300025923 | Ga0207681_10009773 | Ga0207681_100097733 | 315 |
| 1271 | 3300025925 | Ga0207650_10001314 | Ga0207650_100013146 | 315 |
| 1272 | 3300025925 | Ga0207650_10001731 | Ga0207650_100017316 | 315 |
| 1273 | 3300025933 | Ga0207706_10035244 | Ga0207706_100352442 | 315 |
| 1274 | 3300025934 | Ga0207686_10020157 | Ga0207686_100201573 | 315 |
| 1275 | 3300025935 | Ga0207709_10000565 | Ga0207709_1000056518 | 315 |
| 1276 | 3300025935 | Ga0207709_10006707 | Ga0207709_100067073 | 315 |
| 1277 | 3300025935 | Ga0207709_10007302 | Ga0207709_100073022 | 315 |
| 1278 | 3300025945 | Ga0207679_10000097 | Ga0207679_1000009763 | 315 |
| 1279 | 3300025981 | Ga0207640_10079434 | Ga0207640_100794342 | 315 |
| 1280 | 3300027111 | Ga0209281_1003108 | Ga0209281_10031082 | 315 |
| 1281 | 3300027296 | Ga0209389_1000209 | Ga0209389_100020916 | 315 |
| 1282 | 3300027312 | Ga0209371_1018713 | Ga0209371_10187132 | 315 |
| 1283 | 3300027907 | Ga0207428_10011547 | Ga0207428_100115475 | 315 |
| 1284 | 3300028786 | Ga0307517_10184945 | Ga0307517_101849452 | 315 |
| 1285 | 3300030500 | Ga0268256_1020963 | Ga0268256_10209632 | 315 |
| 1286 | 3300030734 | Ga0316179_1023760 | Ga0316179_10237602 | 315 |
| 1287 | 3300030735 | Ga0316178_1120627 | Ga0316178_11206278 | 315 |
| 1288 | 3300031507 | Ga0307509_10292339 | Ga0307509_102923392 | 315 |
| 1289 | 3300031548 | Ga0307408_100053314 | Ga0307408_1000533142 | 315 |
| 1290 | 3300031911 | Ga0307412_10003494 | Ga0307412_100034943 | 315 |
| 1291 | 3300031911 | Ga0307412_10050430 | Ga0307412_100504303 | 315 |
| 1292 | 3300031911 | Ga0307412_10244725 | Ga0307412_102447252 | 315 |
| 1293 | 3300031995 | Ga0307409_100600789 | Ga0307409_1006007891 | 315 |
| 1294 | 3300032005 | Ga0307411_10005341 | Ga0307411_100053413 | 315 |
| 1295 | 3300033180 | Ga0307510_10001036 | Ga0307510_1000103614 | 315 |
| 1296 | 3300041405 | Ga0439438_000367 | Ga0439438_000367_17765_18712 | 315 |
| 1297 | 3300041405 | Ga0439438_001742 | Ga0439438_001742_6498_7445 | 315 |
| 1298 | 3300041405 | Ga0439438_005658 | Ga0439438_005658_1579_2526 | 315 |
| 1299 | 3300041407 | Ga0439447_000821 | Ga0439447_000821_6469_7416 | 315 |
| 1300 | 3300041411 | Ga0439466_0004223 | Ga0439466_0004223_1193_2140 | 315 |
| 1301 | 3300041411 | Ga0439466_0011487 | Ga0439466_0011487_1510_2457 | 315 |
| 1302 | 3300041411 | Ga0439466_0038793 | Ga0439466_0038793_198_1157 | 315 |
| 1303 | 3300042006 | Ga0439432_000016 | Ga0439432_000016_31027_31974 | 315 |
| 1304 | 3300042006 | Ga0439432_002483 | Ga0439432_002483_5854_6801 | 315 |
| 1305 | 3300042006 | Ga0439432_011051 | Ga0439432_011051_1494_2441 | 315 |
| 1306 | 3300042010 | Ga0439452_000046 | Ga0439452_000046_100289_101236 | 315 |
| 1307 | 3300042010 | Ga0439452_000081 | Ga0439452_000081_54733_55680 | 315 |
| 1308 | 3300042010 | Ga0439452_009073 | Ga0439452_009073_1612_2559 | 315 |
| 1309 | 3300042115 | Ga0450911_000010 | Ga0450911_000010_135978_136925 | 315 |
| 1310 | 3300042115 | Ga0450911_001511 | Ga0450911_001511_1738_2685 | 315 |
| 1311 | 3300042145 | Ga0450906_000089 | Ga0450906_000089_1446_2393 | 315 |
| 1312 | 3300042147 | Ga0450910_003545 | Ga0450910_003545_505_1452 | 315 |
| 1313 | 3300044693 | Ga0466961_0000318 | Ga0466961_0000318_13431_14390 | 315 |
| 1314 | 3300045836 | Ga0466958_0009268 | Ga0466958_0009268_3674_4633 | 315 |
| 1315 | 3300046452 | Ga0495617_000379 | Ga0495617_000379_19785_20732 | 315 |
| 1316 | 3300046453 | Ga0495627_000101 | Ga0495627_000101_5202_6149 | 315 |
| 1317 | 3300046453 | Ga0495627_000542 | Ga0495627_000542_12701_13648 | 315 |
| 1318 | 3300046453 | Ga0495627_003724 | Ga0495627_003724_5201_6148 | 315 |
| 1319 | 3300046454 | Ga0495592_0016134 | Ga0495592_0016134_4318_5265 | 315 |
| 1320 | 3300046458 | Ga0495591_000032 | Ga0495591_000032_83537_84484 | 315 |
| 1321 | 3300046458 | Ga0495591_000082 | Ga0495591_000082_8356_9303 | 315 |
| 1322 | 3300046458 | Ga0495591_000276 | Ga0495591_000276_17740_18687 | 315 |
| 1323 | 3300046458 | Ga0495591_000801 | Ga0495591_000801_14127_15074 | 315 |
| 1324 | 3300046458 | Ga0495591_007727 | Ga0495591_007727_1983_2930 | 315 |
| 1325 | 3300046458 | Ga0495591_017828 | Ga0495591_017828_1460_2407 | 315 |
| 1326 | 3300046460 | Ga0495638_0001204 | Ga0495638_0001204_8926_9873 | 315 |
| 1327 | 3300046460 | Ga0495638_0009547 | Ga0495638_0009547_1716_2663 | 315 |
| 1328 | 3300046460 | Ga0495638_0010113 | Ga0495638_0010113_1794_2741 | 315 |
| 1329 | 3300046460 | Ga0495638_0016398 | Ga0495638_0016398_1459_2406 | 315 |
| 1330 | 3300046460 | Ga0495638_0019474 | Ga0495638_0019474_2239_3186 | 315 |
| 1331 | 3300046463 | Ga0495653_0006325 | Ga0495653_0006325_5173_6120 | 315 |
| 1332 | 3300046463 | Ga0495653_0013191 | Ga0495653_0013191_2809_3756 | 315 |
| 1333 | 3300046471 | Ga0495650_0001410 | Ga0495650_0001410_11396_12343 | 315 |
| 1334 | 3300046471 | Ga0495650_0025246 | Ga0495650_0025246_352_1299 | 315 |
| 1335 | 3300046471 | Ga0495650_0032572 | Ga0495650_0032572_43_990 | 315 |
| 1336 | 3300046474 | Ga0495605_0000670 | Ga0495605_0000670_2275_3222 | 315 |
| 1337 | 3300046474 | Ga0495605_0002687 | Ga0495605_0002687_338_1285 | 315 |
| 1338 | 3300046491 | Ga0495584_0000739 | Ga0495584_0000739_1572_2519 | 315 |
| 1339 | 3300046491 | Ga0495584_0003170 | Ga0495584_0003170_5088_6035 | 315 |
| 1340 | 3300046492 | Ga0495585_0000120 | Ga0495585_0000120_18864_19811 | 315 |
| 1341 | 3300046492 | Ga0495585_0001431 | Ga0495585_0001431_9125_10072 | 315 |
| 1342 | 3300046492 | Ga0495585_0068095 | Ga0495585_0068095_145_1092 | 315 |
| 1343 | 3300046501 | Ga0495607_0000259 | Ga0495607_0000259_20084_21031 | 315 |
| 1344 | 3300046501 | Ga0495607_0000517 | Ga0495607_0000517_27972_28919 | 315 |
| 1345 | 3300046501 | Ga0495607_0002064 | Ga0495607_0002064_10672_11619 | 315 |
| 1346 | 3300046501 | Ga0495607_0004919 | Ga0495607_0004919_129_1076 | 315 |
| 1347 | 3300046506 | Ga0495583_0000131 | Ga0495583_0000131_34631_35578 | 315 |
| 1348 | 3300046506 | Ga0495583_0000923 | Ga0495583_0000923_32053_33000 | 315 |
| 1349 | 3300046507 | Ga0495606_0000339 | Ga0495606_0000339_31645_32592 | 315 |
| 1350 | 3300046507 | Ga0495606_0000656 | Ga0495606_0000656_43722_44669 | 315 |
| 1351 | 3300046507 | Ga0495606_0001326 | Ga0495606_0001326_20199_21146 | 315 |
| 1352 | 3300046507 | Ga0495606_0002444 | Ga0495606_0002444_1441_2388 | 315 |
| 1353 | 3300046507 | Ga0495606_0007864 | Ga0495606_0007864_4353_5300 | 315 |
| 1354 | 3300046507 | Ga0495606_0028028 | Ga0495606_0028028_56_1003 | 315 |
| 1355 | 3300046512 | Ga0495610_0000264 | Ga0495610_0000264_38785_39732 | 315 |
| 1356 | 3300046512 | Ga0495610_0000359 | Ga0495610_0000359_5790_6737 | 315 |
| 1357 | 3300046512 | Ga0495610_0002374 | Ga0495610_0002374_9087_10034 | 315 |
| 1358 | 3300046512 | Ga0495610_0011355 | Ga0495610_0011355_1891_2838 | 315 |
| 1359 | 3300046512 | Ga0495610_0018718 | Ga0495610_0018718_402_1349 | 315 |
| 1360 | 3300046512 | Ga0495610_0056236 | Ga0495610_0056236_279_1226 | 315 |
| 1361 | 3300046513 | Ga0495616_0000041 | Ga0495616_0000041_112384_113331 | 315 |
| 1362 | 3300046513 | Ga0495616_0000203 | Ga0495616_0000203_12899_13867 | 315 |
| 1363 | 3300046513 | Ga0495616_0000454 | Ga0495616_0000454_1552_2499 | 315 |
| 1364 | 3300046513 | Ga0495616_0000615 | Ga0495616_0000615_17168_18115 | 315 |
| 1365 | 3300046515 | Ga0495620_0000002 | Ga0495620_0000002_289670_290617 | 315 |
| 1366 | 3300046515 | Ga0495620_0000021 | Ga0495620_0000021_20980_21927 | 315 |
| 1367 | 3300046515 | Ga0495620_0000646 | Ga0495620_0000646_4412_5359 | 315 |
| 1368 | 3300046515 | Ga0495620_0007292 | Ga0495620_0007292_4181_5128 | 315 |
| 1369 | 3300046518 | Ga0495631_0000419 | Ga0495631_0000419_18639_19586 | 315 |
| 1370 | 3300046519 | Ga0495632_0000097 | Ga0495632_0000097_80659_81606 | 315 |
| 1371 | 3300046519 | Ga0495632_0010930 | Ga0495632_0010930_2063_3010 | 315 |
| 1372 | 3300046519 | Ga0495632_0043881 | Ga0495632_0043881_920_1867 | 315 |
| 1373 | 3300046520 | Ga0495637_0000621 | Ga0495637_0000621_8640_9587 | 315 |
| 1374 | 3300046520 | Ga0495637_0000888 | Ga0495637_0000888_1830_2777 | 315 |
| 1375 | 3300046520 | Ga0495637_0012376 | Ga0495637_0012376_2769_3716 | 315 |
| 1376 | 3300046520 | Ga0495637_0035989 | Ga0495637_0035989_542_1489 | 315 |
| 1377 | 3300046522 | Ga0495643_0000583 | Ga0495643_0000583_5497_6444 | 315 |
| 1378 | 3300046522 | Ga0495643_0000660 | Ga0495643_0000660_27094_28041 | 315 |
| 1379 | 3300046524 | Ga0495648_0000408 | Ga0495648_0000408_28844_29791 | 315 |
| 1380 | 3300046524 | Ga0495648_0002220 | Ga0495648_0002220_17199_18146 | 315 |
| 1381 | 3300046524 | Ga0495648_0002382 | Ga0495648_0002382_8700_9647 | 315 |
| 1382 | 3300046524 | Ga0495648_0017564 | Ga0495648_0017564_4003_4950 | 315 |
| 1383 | 3300046524 | Ga0495648_0021429 | Ga0495648_0021429_3183_4130 | 315 |
| 1384 | 3300046524 | Ga0495648_0026292 | Ga0495648_0026292_2940_3887 | 315 |
| 1385 | 3300046526 | Ga0495666_0004817 | Ga0495666_0004817_4425_5372 | 315 |
| 1386 | 3300046530 | Ga0495654_0000050 | Ga0495654_0000050_113281_114228 | 315 |
| 1387 | 3300046530 | Ga0495654_0000059 | Ga0495654_0000059_46187_47134 | 315 |
| 1388 | 3300046530 | Ga0495654_0013011 | Ga0495654_0013011_3480_4427 | 315 |
| 1389 | 3300046530 | Ga0495654_0014574 | Ga0495654_0014574_3114_4061 | 315 |
| 1390 | 3300046530 | Ga0495654_0018496 | Ga0495654_0018496_1643_2590 | 315 |
| 1391 | 3300046530 | Ga0495654_0060775 | Ga0495654_0060775_843_1790 | 315 |
| 1392 | 3300046536 | Ga0495587_0004755 | Ga0495587_0004755_4508_5455 | 315 |
| 1393 | 3300046538 | Ga0495609_0000504 | Ga0495609_0000504_21809_22756 | 315 |
| 1394 | 3300046538 | Ga0495609_0000648 | Ga0495609_0000648_8546_9493 | 315 |
| 1395 | 3300046542 | Ga0495597_0000117 | Ga0495597_0000117_9106_10053 | 315 |
| 1396 | 3300046543 | Ga0495645_0018745 | Ga0495645_0018745_2512_3459 | 315 |
| 1397 | 3300046557 | Ga0495622_0000420 | Ga0495622_0000420_17618_18565 | 315 |
| 1398 | 3300046557 | Ga0495622_0005699 | Ga0495622_0005699_4413_5360 | 315 |
| 1399 | 3300046558 | Ga0495633_0000556 | Ga0495633_0000556_26580_27527 | 315 |
| 1400 | 3300046616 | Ga0495668_0006587 | Ga0495668_0006587_6585_7532 | 315 |
| 1401 | 3300046642 | Ga0495634_0000551 | Ga0495634_0000551_10998_11945 | 315 |
| 1402 | 3300046642 | Ga0495634_0008216 | Ga0495634_0008216_4950_5897 | 315 |
| 1403 | 3300046648 | Ga0495611_0000024 | Ga0495611_0000024_15019_15966 | 315 |
| 1404 | 3300046648 | Ga0495611_0033788 | Ga0495611_0033788_28_975 | 315 |
| 1405 | 3300046660 | Ga0495625_0000103 | Ga0495625_0000103_8396_9343 | 315 |
| 1406 | 3300046660 | Ga0495625_0000861 | Ga0495625_0000861_4635_5582 | 315 |
| 1407 | 3300046660 | Ga0495625_0022301 | Ga0495625_0022301_277_1224 | 315 |
| 1408 | 3300046663 | Ga0495635_0000203 | Ga0495635_0000203_23325_24272 | 315 |
| 1409 | 3300046665 | Ga0495661_0000085 | Ga0495661_0000085_12082_13029 | 315 |
| 1410 | 3300046674 | Ga0495588_0063831 | Ga0495588_0063831_316_1263 | 315 |
| 1411 | 3300046678 | Ga0495599_0173791 | Ga0495599_0173791_286_1233 | 315 |
| 1412 | 3300046680 | Ga0495646_0001184 | Ga0495646_0001184_12272_13219 | 315 |
| 1413 | 3300046680 | Ga0495646_0024322 | Ga0495646_0024322_56_1003 | 315 |
| 1414 | 3300046689 | Ga0495613_0004522 | Ga0495613_0004522_908_1855 | 315 |
| 1415 | 3300046690 | Ga0495624_0001661 | Ga0495624_0001661_5183_6130 | 315 |
| 1416 | 3300046691 | Ga0495670_0000020 | Ga0495670_0000020_99979_100926 | 315 |
| 1417 | 3300046692 | Ga0495671_0000950 | Ga0495671_0000950_118_1065 | 315 |
| 1418 | 3300046692 | Ga0495671_0001525 | Ga0495671_0001525_153_1100 | 315 |
| 1419 | 3300046692 | Ga0495671_0017425 | Ga0495671_0017425_778_1725 | 315 |
| 1420 | 3300046694 | Ga0495649_0001301 | Ga0495649_0001301_16866_17813 | 315 |
| 1421 | 3300046694 | Ga0495649_0001326 | Ga0495649_0001326_8766_9713 | 315 |
| 1422 | 3300046694 | Ga0495649_0012802 | Ga0495649_0012802_1934_2881 | 315 |
| 1423 | 3300046694 | Ga0495649_0015060 | Ga0495649_0015060_1530_2477 | 315 |
| 1424 | 3300046694 | Ga0495649_0101647 | Ga0495649_0101647_323_1270 | 315 |
| 1425 | 3300046794 | Ga0495589_0000011 | Ga0495589_0000011_19207_20154 | 315 |
| 1426 | 3300046794 | Ga0495589_0000740 | Ga0495589_0000740_1719_2666 | 315 |
| 1427 | 3300046794 | Ga0495589_0005399 | Ga0495589_0005399_5227_6174 | 315 |
| 1428 | 3300046809 | Ga0495600_0001400 | Ga0495600_0001400_7600_8547 | 315 |
| 1429 | 3300046810 | Ga0495660_0000136 | Ga0495660_0000136_28425_29372 | 315 |
| 1430 | 3300046810 | Ga0495660_0001104 | Ga0495660_0001104_730_1677 | 315 |
| 1431 | 3300046810 | Ga0495660_0003859 | Ga0495660_0003859_4728_5675 | 315 |
| 1432 | 3300046810 | Ga0495660_0016925 | Ga0495660_0016925_618_1565 | 315 |
| 1433 | 3300046810 | Ga0495660_0097434 | Ga0495660_0097434_432_1379 | 315 |
| 1434 | 3300047317 | Ga0495604_0029355 | Ga0495604_0029355_2929_3876 | 315 |
| 1435 | 3300047317 | Ga0495604_0097674 | Ga0495604_0097674_378_1325 | 315 |
| 1436 | 3300047319 | Ga0495674_0003267 | Ga0495674_0003267_10337_11284 | 315 |
| 1437 | 3300047320 | Ga0495672_0003855 | Ga0495672_0003855_1996_2943 | 315 |
| 1438 | 3300047320 | Ga0495672_0005016 | Ga0495672_0005016_3593_4540 | 315 |
| 1439 | 3300047320 | Ga0495672_0005116 | Ga0495672_0005116_8502_9449 | 315 |
| 1440 | 3300047321 | Ga0495676_0001880 | Ga0495676_0001880_4375_5322 | 315 |
| 1441 | 3300047322 | Ga0495680_0022052 | Ga0495680_0022052_3072_4019 | 315 |
| 1442 | 3300047323 | Ga0495683_0000139 | Ga0495683_0000139_55160_56107 | 315 |
| 1443 | 3300047444 | Ga0495675_0044517 | Ga0495675_0044517_224_1171 | 315 |
| 1444 | 3300047446 | Ga0495679_000233 | Ga0495679_000233_16679_17626 | 315 |
| 1445 | 3300047446 | Ga0495679_000440 | Ga0495679_000440_29600_30547 | 315 |
| 1446 | 3300047446 | Ga0495679_000569 | Ga0495679_000569_15797_16744 | 315 |
| 1447 | 3300047446 | Ga0495679_000780 | Ga0495679_000780_14208_15155 | 315 |
| 1448 | 3300047469 | Ga0495673_0001184 | Ga0495673_0001184_19408_20382 | 315 |
| 1449 | 3300047469 | Ga0495673_0001421 | Ga0495673_0001421_7888_8835 | 315 |
| 1450 | 3300047469 | Ga0495673_0003804 | Ga0495673_0003804_8357_9304 | 315 |
| 1451 | 3300047469 | Ga0495673_0084971 | Ga0495673_0084971_331_1278 | 315 |
| 1452 | 3300047470 | Ga0495681_0000109 | Ga0495681_0000109_35474_36421 | 315 |
| 1453 | 3300047470 | Ga0495681_0000370 | Ga0495681_0000370_1663_2610 | 315 |
| 1454 | 3300047470 | Ga0495681_0001460 | Ga0495681_0001460_7805_8752 | 315 |
| 1455 | 3300047470 | Ga0495681_0002166 | Ga0495681_0002166_8322_9269 | 315 |
| 1456 | 3300047470 | Ga0495681_0038749 | Ga0495681_0038749_1163_2110 | 315 |
| 1457 | 3300047471 | Ga0495684_0011799 | Ga0495684_0011799_4350_5297 | 315 |
| 1458 | 3300047472 | Ga0495686_0000266 | Ga0495686_0000266_2675_3622 | 315 |
| 1459 | 3300047472 | Ga0495686_0000653 | Ga0495686_0000653_10622_11569 | 315 |
| 1460 | 3300047472 | Ga0495686_0048052 | Ga0495686_0048052_1034_1981 | 315 |
| 1461 | 3300047673 | Ga0495593_0004240 | Ga0495593_0004240_3988_4935 | 315 |
| 1462 | 3300047673 | Ga0495593_0097103 | Ga0495593_0097103_531_1478 | 315 |
| 1463 | 3300048088 | Ga0495602_0001929 | Ga0495602_0001929_14826_15773 | 315 |
| 1464 | 3300048091 | Ga0495626_0000074 | Ga0495626_0000074_123209_124156 | 315 |
| 1465 | 3300048091 | Ga0495626_0000326 | Ga0495626_0000326_9516_10490 | 315 |
| 1466 | 3300048091 | Ga0495626_0000394 | Ga0495626_0000394_16858_17805 | 315 |
| 1467 | 3300048091 | Ga0495626_0059754 | Ga0495626_0059754_762_1709 | 315 |
| 1468 | 3300048905 | Ga0496102_0000659 | Ga0496102_0000659_10923_11870 | 315 |
| 1469 | 3300048906 | Ga0496103_0000839 | Ga0496103_0000839_7032_7979 | 315 |
| 1470 | 3300048919 | Ga0496116_0000654 | Ga0496116_0000654_25673_26620 | 315 |
| 1471 | 3300048919 | Ga0496116_0001333 | Ga0496116_0001333_17758_18705 | 315 |
| 1472 | 3300048919 | Ga0496116_0033797 | Ga0496116_0033797_1494_2441 | 315 |
| 1473 | 3300048920 | Ga0496117_0001203 | Ga0496117_0001203_24656_25603 | 315 |
| 1474 | 3300048920 | Ga0496117_0001929 | Ga0496117_0001929_23583_24530 | 315 |
| 1475 | 3300048920 | Ga0496117_0012990 | Ga0496117_0012990_1104_2051 | 315 |
| 1476 | 3300048920 | Ga0496117_0026279 | Ga0496117_0026279_523_1470 | 315 |
| 1477 | 3300048920 | Ga0496117_0048849 | Ga0496117_0048849_768_1715 | 315 |
| 1478 | 3300048920 | Ga0496117_0054958 | Ga0496117_0054958_1334_2281 | 315 |
| 1479 | 3300048920 | Ga0496117_0099895 | Ga0496117_0099895_784_1731 | 315 |
| 1480 | 3300048921 | Ga0496118_0023509 | Ga0496118_0023509_1686_2633 | 315 |
| 1481 | 3300048921 | Ga0496118_0023969 | Ga0496118_0023969_1741_2688 | 315 |
| 1482 | 3300048921 | Ga0496118_0046977 | Ga0496118_0046977_1302_2249 | 315 |
| 1483 | 3300048921 | Ga0496118_0085659 | Ga0496118_0085659_1100_2047 | 315 |
| 1484 | 3300048922 | Ga0496119_0008762 | Ga0496119_0008762_3100_4047 | 315 |
| 1485 | 3300048922 | Ga0496119_0046501 | Ga0496119_0046501_190_1137 | 315 |
| 1486 | 3300048923 | Ga0496120_0001883 | Ga0496120_0001883_9410_10357 | 315 |
| 1487 | 3300048923 | Ga0496120_0003959 | Ga0496120_0003959_4813_5760 | 315 |
| 1488 | 3300048923 | Ga0496120_0006699 | Ga0496120_0006699_709_1656 | 315 |
| 1489 | 3300048924 | Ga0496121_0001858 | Ga0496121_0001858_27682_28629 | 315 |
| 1490 | 3300048924 | Ga0496121_0003396 | Ga0496121_0003396_18727_19674 | 315 |
| 1491 | 3300048924 | Ga0496121_0010257 | Ga0496121_0010257_1804_2751 | 315 |
| 1492 | 3300048924 | Ga0496121_0116557 | Ga0496121_0116557_725_1672 | 315 |
| 1493 | 3300048925 | Ga0496122_0000696 | Ga0496122_0000696_10562_11509 | 315 |
| 1494 | 3300048925 | Ga0496122_0000776 | Ga0496122_0000776_57391_58338 | 315 |
| 1495 | 3300048925 | Ga0496122_0001980 | Ga0496122_0001980_13154_14101 | 315 |
| 1496 | 3300048926 | Ga0496123_0000439 | Ga0496123_0000439_15552_16499 | 315 |
| 1497 | 3300048926 | Ga0496123_0002483 | Ga0496123_0002483_18619_19566 | 315 |
| 1498 | 3300048926 | Ga0496123_0005000 | Ga0496123_0005000_2075_3022 | 315 |
| 1499 | 3300048926 | Ga0496123_0013680 | Ga0496123_0013680_1458_2405 | 315 |
| 1500 | 3300048927 | Ga0496124_0001568 | Ga0496124_0001568_24590_25537 | 315 |
| 1501 | 3300048927 | Ga0496124_0018652 | Ga0496124_0018652_5263_6210 | 315 |
| 1502 | 3300048927 | Ga0496124_0027520 | Ga0496124_0027520_1859_2806 | 315 |
| 1503 | 3300048927 | Ga0496124_0078989 | Ga0496124_0078989_204_1151 | 315 |
| 1504 | 3300048927 | Ga0496124_0091036 | Ga0496124_0091036_84_1031 | 315 |
| 1505 | 3300048928 | Ga0496125_0000284 | Ga0496125_0000284_43338_44285 | 315 |
| 1506 | 3300048928 | Ga0496125_0000380 | Ga0496125_0000380_3076_4023 | 315 |
| 1507 | 3300048928 | Ga0496125_0001952 | Ga0496125_0001952_9501_10448 | 315 |
| 1508 | 3300048928 | Ga0496125_0011227 | Ga0496125_0011227_7095_8042 | 315 |
| 1509 | 3300048928 | Ga0496125_0047750 | Ga0496125_0047750_200_1147 | 315 |
| 1510 | 3300048929 | Ga0496126_0045862 | Ga0496126_0045862_2155_3102 | 315 |
| 1511 | 3300049459 | Ga0495678_000883 | Ga0495678_000883_16109_17056 | 315 |
| 1512 | 3300049459 | Ga0495678_003236 | Ga0495678_003236_9224_10171 | 315 |
| 1513 | 3300049460 | Ga0495682_0000054 | Ga0495682_0000054_17348_18295 | 315 |
| 1514 | 3300049460 | Ga0495682_0001160 | Ga0495682_0001160_9188_10135 | 315 |
| 1515 | 3300049460 | Ga0495682_0005108 | Ga0495682_0005108_3175_4122 | 315 |
| 1516 | 3300049571 | Ga0501034_0000012 | Ga0501034_0000012_47328_48287 | 315 |
| 1517 | 3300049571 | Ga0501034_0012453 | Ga0501034_0012453_4785_5732 | 315 |
| 1518 | 3300049581 | Ga0501047_0075233 | Ga0501047_0075233_2044_3003 | 315 |
| 1519 | 3300050492 | nmdc:mga0yw44_276136_c1 | nmdc:mga0yw44_276136_c1_112_1065 | 315 |
| 1520 | 3300053111 | Ga0500572_000268 | Ga0500572_000268_17582_18529 | 315 |
| 1521 | 3300053135 | Ga0500659_0011667 | Ga0500659_0011667_3562_4509 | 315 |
| 1522 | 3300053139 | Ga0500568_0002348 | Ga0500568_0002348_8288_9253 | 315 |
| 1523 | 3300053161 | Ga0500634_0000091 | Ga0500634_0000091_5930_6877 | 315 |
| 1524 | 3300053731 | Ga0500609_006418 | Ga0500609_006418_143_1108 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hmc-assembly1.cif.gz_A | the crystal structure of dihydrodipicolinate synthase dapa from agrobacterium tumefaciens | 0.9868 | 1 | 309 |
| 5czj-assembly2.cif.gz_B | crystal structure of hypd, a 1-pyrroline-4-hydroxy-2-carboxylate deaminase from sinorhizobium meliloti | 0.9851 | 5 | 310 |
| 4mpq-assembly1.cif.gz_A | crystal structure of1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis atcc 23457 | 0.9848 | 4 | 309 |
| 4o0k-assembly1.cif.gz_A | crystal structure of 1-pyrroline-4-hydroxy-2-carboxylate deaminase from brucella melitensis with covalently bound substrate | 0.9848 | 4 | 310 |
| 2hmc-assembly1.cif.gz_A | the crystal structure of dihydrodipicolinate synthase dapa from agrobacterium tumefaciens | 0.9681 | 1 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hmcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9829 | 2 | 309 | 3.20.20.70 |
| 2hmcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9638 | 2 | 309 | 3.20.20.70 |
| 2yxgD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8896 | 6 | 297 | 3.20.20.70 |
| 3s5oA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.889 | 6 | 301 | 3.20.20.70 |
| 3pb2D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8815 | 4 | 301 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R3DXN8-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase | 0.9878 | 1 | 309 |
GO:0008840
|
| AF-V7D853-F1-model_v4 | Dihydrodipicolinate synthetase | 0.987 | 76 | 315 |
GO:0008840
|
| AF-A0A529HHF9-F1-model_v4 | deleted | 0.987 | 88 | 168 |
|
| AF-A0A6I1IT49-F1-model_v4 | deleted | 0.9869 | 113 | 311 |
|
| AF-A0A653HWC3-F1-model_v4 | deleted | 0.9866 | 1 | 314 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar