F494565

General Info

Members Datasets Scaffolds Average Seq Length
1525 1193 3048 274

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100026208|Ga0207675_1000262087
Length 294
Sequence MTAMTMTTPPTLVTMLMTRPKRIVGTIAHRGAILLYIFFALFPLYWLLKVSVTPNDLLYSEGVRLWPSRTSIQHYLFVLEHSDFPRFFRNSVIVSGATAFIVTILASCAGYALSRFTFRGKYWIVALMLLTQMFPLVMLVAPIFKMLSPLGLTNSLTGLVIVYVAFNVPFATFLMQSFFDGIPKDLEEAAMIDGATRFRAFSQIILPLTLPGIAATLGFVFTAAWSELLFALMLISSAGASTFPVGLLSFVSKFSVDFGQMMAAGVLALIPACLFFLFIQRYLVQGLTAGAVKG

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
91 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
104 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
105 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
106 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
109 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
110 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
111 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
167 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
189 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
202 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
205 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
206 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
207 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
307 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
308 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
309 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
310 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
311 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
312 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
313 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
314 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
317 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
318 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
319 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
324 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
325 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
329 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
337 2508501050 Microvirga lupini Lut6 Isolate Nodule
338 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
339 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
340 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
341 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
342 2509276019 Ensifer aridi TW10 Isolate Nodule
343 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
344 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
345 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
346 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
347 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
348 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
349 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
350 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
351 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
352 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
353 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
354 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
355 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
356 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
357 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
358 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
359 2512875024
360 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
361 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
362 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
363 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
364 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
365 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
366 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
367 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
368 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
369 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
370 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
371 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
372 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
373 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
374 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
375 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
376 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
377 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
378 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
379 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
380 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
381 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
382 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
383 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
384 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
385 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
386 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
387 2516143018 Ensifer sp. BR816 Isolate Nodule
388 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
389 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
390 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
391 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
392 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
393 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
394 2519899620 Rhizobium sp. Pop5 Isolate Nodule
395 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
396 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
397 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
398 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
399 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
400 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
401 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
402 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
403 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
404 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
405 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
406 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
407 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
408 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
409 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
410 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
411 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
412 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
413 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
414 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
415 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
416 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
417 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
418 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
419 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
420 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
421 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
422 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
423 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
424 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
425 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
426 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
427 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
428 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
429 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
430 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
431 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
432 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
433 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
434 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
435 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
436 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
437 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
438 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
439 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
440 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
441 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
442 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
443 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
444 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
445 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
446 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
447 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
448 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
449 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
450 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
451 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
452 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
453 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
454 2643221557 Ensifer sp. Root558 Isolate Unclassified
455 2643221568 Rhizobium sp. Root564 Isolate Unclassified
456 2643221582 Rhizobium sp. Root651 Isolate Unclassified
457 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
458 2643221599 Rhizobium sp. Root708 Isolate Unclassified
459 2643221607 Rhizobium sp. Root73 Isolate Unclassified
460 2643221610 Ensifer sp. Root74 Isolate Unclassified
461 2643221618 Ensifer sp. Root231 Isolate Unclassified
462 2643221626 Ensifer sp. Root31 Isolate Unclassified
463 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
464 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
465 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
466 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
467 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
468 2643221655 Ensifer sp. Root1252 Isolate Unclassified
469 2643221659 Ensifer sp. Root127 Isolate Unclassified
470 2643221668 Ensifer sp. Root423 Isolate Unclassified
471 2643221675 Ensifer sp. Root1298 Isolate Unclassified
472 2643221680 Ensifer sp. Root1312 Isolate Unclassified
473 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
474 2643221688 Rhizobium sp. Root482 Isolate Unclassified
475 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
476 2643221693 Rhizobium sp. Root491 Isolate Unclassified
477 2643221698 Ensifer sp. Root142 Isolate Unclassified
478 2643221712 Ensifer sp. Root258 Isolate Unclassified
479 2643221718 Rhizobium sp. Root268 Isolate Unclassified
480 2643221723 Ensifer sp. Root278 Isolate Unclassified
481 2643221726 Ensifer sp. Root954 Isolate Unclassified
482 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
483 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
484 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
485 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
486 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
487 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
488 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
489 2718217882 Rhizobium sp. N741 Isolate Nodule
490 2718217927 Rhizobium sp. N324 Isolate Nodule
491 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
492 2718218009 Rhizobium sp. N561 Isolate Nodule
493 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
494 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
495 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
496 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
497 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
498 2718218363 Rhizobium sp. N113 Isolate Nodule
499 2718218365 Rhizobium sp. N731 Isolate Nodule
500 2718218366 Rhizobium sp. N621 Isolate Nodule
501 2718218423 Rhizobium sp. N941 Isolate Nodule
502 2721755514 Rhizobium sp. N6212 Isolate Nodule
503 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
504 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
505 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
506 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
507 2721755809 Rhizobium sp. N541 Isolate Nodule
508 2721755810 Rhizobium sp. N871 Isolate Nodule
509 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
510 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
511 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
512 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
513 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
514 2728369365 Rhizobium sp. N1341 Isolate Nodule
515 2728369397 Rhizobium sp. N1314 Isolate Nodule
516 2738541293 Rhizobium sp. GV031 Isolate Unclassified
517 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
518 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
519 2738543024 Aminobacter sp. AP02 Isolate Unclassified
520 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
521 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
522 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
523 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
524 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
525 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
526 2773857925 Microvirga vignae BR3299 Isolate Unclassified
527 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
528 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
529 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
530 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
531 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
532 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
533 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
534 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
535 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
536 2791355256 Rhizobium sp. M10 Isolate Nodule
537 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
538 2791355260 Rhizobium sp. L9 Isolate Nodule
539 2791355261 Rhizobium sp. J15 Isolate Nodule
540 2791355262 Rhizobium sp. M1 Isolate Nodule
541 2791355263 Rhizobium chutanense C5 Isolate Nodule
542 2791355264 Rhizobium sp. S9 Isolate Nodule
543 2791355265 Rhizobium sp. H4 Isolate Nodule
544 2791355266 Rhizobium sp. L43 Isolate Nodule
545 2791355267 Rhizobium sp. L18 Isolate Nodule
546 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
547 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
548 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
549 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
550 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
551 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
552 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
553 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
554 2802429633 Rhizobium anhuiense J3 Isolate Nodule
555 2802429634 Rhizobium anhuiense S10 Isolate Nodule
556 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
557 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
558 2802429637 Rhizobium anhuiense C15 Isolate Nodule
559 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
560 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
561 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
562 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
563 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
564 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
565 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
566 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
567 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
568 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
569 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
570 2838048938 Rhizobium pisi 27/80 Isolate Nodule
571 2838061910 Rhizobium phaseoli L15 Isolate Nodule
572 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
573 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
574 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
575 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
576 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
577 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
578 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
579 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
580 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
581 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
582 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
583 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
584 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
585 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
586 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
587 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
588 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
589 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
590 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
591 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
592 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
593 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
594 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
595 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
596 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
597 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
598 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
599 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
600 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
601 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
602 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
603 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
604 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
605 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
606 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
607 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
608 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
609 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
610 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
611 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
612 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
613 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
614 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
615 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
616 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
617 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
618 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
619 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
620 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
621 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
622 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
623 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
624 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
625 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
626 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
627 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
628 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
629 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
630 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
631 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
632 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
633 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
634 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
635 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
636 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
637 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
638 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
639 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
640 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
641 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
642 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
643 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
644 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
645 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
646 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
647 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
648 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
649 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
650 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
651 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
652 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
653 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
654 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
655 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
656 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
657 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
658 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
659 2844163670 Ensifer sp. 1H6 Isolate Unclassified
660 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
661 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
662 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
663 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
664 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
665 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
666 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
667 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
668 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
669 2854911287 Brucella lupini LUP21 Isolate Unclassified
670 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
671 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
672 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
673 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
674 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
675 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
676 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
677 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
678 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
679 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
680 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
681 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
682 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
683 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
684 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
685 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
686 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
687 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
688 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
689 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
690 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
691 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
692 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
693 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
694 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
695 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
696 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
697 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
698 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
699 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
700 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
701 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
702 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
703 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
704 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
705 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
706 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
707 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
708 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
709 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
710 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
711 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
712 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
713 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
714 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
715 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
716 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
717 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
718 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
719 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
720 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
721 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
722 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
723 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
724 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
725 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
726 2876601092 Pantoea endophytica 596 Isolate Unclassified
727 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
728 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
729 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
730 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
731 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
732 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
733 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
734 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
735 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
736 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
737 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
738 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
739 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
740 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
741 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
742 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
743 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
744 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
745 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
746 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
747 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
748 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
749 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
750 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
751 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
752 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
753 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
754 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
755 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
756 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
757 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
758 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
759 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
760 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
761 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
762 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
763 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
764 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
765 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
766 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
767 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
768 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
769 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
770 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
771 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
772 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
773 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
774 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
775 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
776 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
777 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
778 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
779 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
780 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
781 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
782 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
783 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
784 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
785 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
786 2909042592 Labrys sp. LIt4 Isolate Nodule
787 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
788 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
789 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
790 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
791 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
792 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
793 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
794 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
795 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
796 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
797 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
798 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
799 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
800 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
801 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
802 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
803 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
804 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
805 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
806 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
807 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
808 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
809 2919150387 Rahnella aceris 1817 Isolate Unclassified
810 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
811 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
812 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
813 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
814 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
815 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
816 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
817 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
818 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
819 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
820 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
821 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
822 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
823 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
824 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
825 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
826 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
827 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
828 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
829 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
830 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
831 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
832 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
833 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
834 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
835 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
836 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
837 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
838 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
839 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
840 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
841 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
842 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
843 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
844 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
845 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
846 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
847 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
848 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
849 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
850 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
851 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
852 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
853 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
854 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
855 2927143783 Rahnella sp. 2050 Isolate Unclassified
856 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
857 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
858 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
859 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
860 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
861 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
862 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
863 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
864 2933599457 Rhizobium phaseoli M3 Isolate Nodule
865 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
866 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
867 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
868 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
869 2936381700 Rhizobium chutanense C16 Isolate Unclassified
870 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
871 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
872 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
873 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
874 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
875 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
876 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
877 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
878 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
879 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
880 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
881 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
882 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
883 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
884 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
885 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
886 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
887 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
888 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
889 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
890 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
891 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
892 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
893 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
894 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
895 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
896 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
897 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
898 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
899 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
900 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
901 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
902 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
903 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
904 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
905 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
906 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
907 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
908 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
909 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
910 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
911 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
912 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
913 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
914 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
915 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
916 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
917 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
918 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
919 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
920 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
921 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
922 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
923 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
924 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
925 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
926 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
927 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
928 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
929 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
930 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
931 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
932 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
933 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
934 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
935 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
936 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
937 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
938 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
939 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
940 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
941 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
942 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
943 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
944 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
945 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
946 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
947 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
948 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
949 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
950 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
951 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
952 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
953 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
954 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
955 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
956 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
957 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
958 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
959 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
960 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
961 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
962 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
963 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
964 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
965 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
966 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
967 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
968 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
969 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
970 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
971 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
972 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
973 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
974 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
975 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
976 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
977 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
978 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
979 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
980 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
981 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
982 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
983 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
984 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
985 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
986 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
987 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
988 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
989 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
990 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
991 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
992 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
993 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
994 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
995 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
996 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
997 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
998 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
999 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
1000 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
1001 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
1002 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
1003 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
1004 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
1005 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
1006 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
1007 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
1008 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
1009 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
1010 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
1011 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
1012 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1013 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1014 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1015 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1016 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1017 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1018 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1019 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
1020 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1021 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1022 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
1023 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1024 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1025 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
1026 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1027 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1028 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1029 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1030 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1031 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1032 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1033 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1034 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1035 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1036 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
1037 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1038 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1039 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
1040 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1041 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
1042 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1043 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1044 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1045 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1046 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1047 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1048 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1049 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1050 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1051 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1052 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1053 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1054 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1055 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1056 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1057 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
1058 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1059 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1060 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1061 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1062 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1063 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1064 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1065 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1066 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1067 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1068 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1069 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1070 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1071 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
1072 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1073 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1074 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
1075 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1076 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1077 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1078 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1079 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1080 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1081 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1082 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1083 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1084 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1085 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1086 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1087 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1088 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1089 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1090 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1091 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1092 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1093 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1094 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1095 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1096 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1097 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1098 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1099 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1100 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1101 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1102 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1103 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1104 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1105 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1106 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1107 2996887358 Rhizobium sp. R711 Isolate Nodule
1108 2996893221 Rhizobium sp. R635 Isolate Nodule
1109 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1110 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1111 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1112 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1113 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1114 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1115 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1116 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1117 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1118 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1119 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1120 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1121 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1122 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1123 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1124 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1125 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1126 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1127 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1128 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1129 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1130 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1131 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1132 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1133 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1134 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1135 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1136 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1137 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1138 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1139 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1140 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1141 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1142 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1143 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1144 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1145 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1146 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1147 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1148 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1149 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1150 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1151 8005258706 Rhizobium sp. R693 Isolate Nodule
1152 8005275841 Rhizobium sp. N4311 Isolate Nodule
1153 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1154 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1155 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1156 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1157 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1158 8005321885 Rhizobium sp. R72 Isolate Nodule
1159 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1160 8005382845 Rhizobium sp. R634 Isolate Nodule
1161 8005395548 Rhizobium sp. R339 Isolate Nodule
1162 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1163 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1164 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1165 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1166 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1167 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1168 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1169 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1170 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1171 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1172 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1173 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1174 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1175 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1176 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1177 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
1178 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1179 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1180 8018176218 Rhizobium sp. N122 Isolate Nodule
1181 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
1182 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1183 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1184 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1185 8024501048 Rhizobium sp. H4 Isolate Nodule
1186 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1187 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1188 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1189 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1190 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1191 8056382006 Rhizobium croatiense 13T Isolate Nodule
1192 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1193 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.41
Metatranscriptomes 0.07
Isolates 56.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 16.07
Nodule 44.52
Rhizoplane 1.38
Rhizosphere 22.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100026208 3300026118 Bacteria 5427
2 SwRhRL2b_contig_999527 2162886007 Bacteria 5204
3 JGI25155J39150_1000015 3300002704 Bacteria 178839
4 JGI25156J39149_1000007 3300002705 Bacteria 252108
5 JGI25156J39149_1009617 3300002705 Bacteria 2335
6 JGI25162J39368_1000009 3300002737 Bacteria 389795
7 JGI25162J39368_1000119 3300002737 Bacteria 87157
8 JGI25162J39368_1000489 3300002737 Bacteria 30241
9 JGI25154J39366_1000145 3300002738 Bacteria 55861
10 JGI25158J39367_1000094 3300002739 Bacteria 20606
11 JGI25157J39369_1000012 3300002741 Bacteria 205167
12 JGI25157J39369_1003024 3300002741 Bacteria 3672
13 JGI25163J39215_1000765 3300002771 Bacteria 7902
14 JGI25164J39214_1000002 3300002772 Bacteria 406570
15 JGI25152J39213_1002953 3300002773 Bacteria 6053
16 JGI25152J39213_1013083 3300002773 Bacteria 1746
17 JGI25152J39213_1015131 3300002773 Bacteria 1532
18 JGI25152J39213_1016662 3300002773 Bacteria 1410
19 JGI25150J39212_1000103 3300002774 Bacteria 49029
20 JGI25150J39212_1006873 3300002774 Bacteria 2318
21 JGI25150J39212_1014069 3300002774 Bacteria 1368
22 JGI25159J45721_1001078 3300002987 Bacteria 11655
23 JGI25159J45721_1003115 3300002987 Bacteria 5982
24 JGI25151J46595_10000085 3300003187 Bacteria 127212
25 JGI25151J46595_10001194 3300003187 Bacteria 18647
26 JGI25151J46595_10014672 3300003187 Bacteria 3481
27 JGI25165J46597_1000206 3300003214 Bacteria 84821
28 JGI25165J46597_1000211 3300003214 Bacteria 82463
29 JGI25165J46597_1001070 3300003214 Bacteria 17582
30 JGI25165J46597_1004826 3300003214 Bacteria 2755
31 JGI25153J46596_10000103 3300003215 Bacteria 96279
32 JGI25153J46596_10001488 3300003215 Bacteria 13974
33 JGI25153J46596_10005550 3300003215 Bacteria 6594
34 JGI25153J46596_10009848 3300003215 Bacteria 4386
35 JGI25153J46596_10022279 3300003215 Bacteria 2340
36 JGI25153J46596_10037724 3300003215 Bacteria 1532
37 JGI25153J46596_10037747 3300003215 Bacteria 1532
38 JGI25160J50197_1000023 3300003354 Bacteria 200692
39 JGI25160J50197_1000033 3300003354 Bacteria 172667
40 JGI25160J50197_1000726 3300003354 Bacteria 18068
41 JGI25160J50197_1001657 3300003354 Bacteria 10887
42 JGI25161J50226_1000012 3300003374 Bacteria 200668
43 JGI25161J50226_1000508 3300003374 Bacteria 17047
44 JGI25161J50226_1001989 3300003374 Bacteria 5608
45 JGI25161J50226_1004573 3300003374 Bacteria 2865
46 Ga0006562J51391_1050521 3300003578 Bacteria 2458
47 Ga0055538_1000015 3300003751 Bacteria 311166
48 Ga0055539_1000009 3300003752 Bacteria 406566
49 Ga0055533_1000012 3300003756 Bacteria 406566
50 Ga0055525_1000014 3300003759 Bacteria 406566
51 Ga0055542_1000947 3300003762 Bacteria 19060
52 Ga0055542_1001298 3300003762 Bacteria 13317
53 Ga0055529_1005284 3300003763 Bacteria 1881
54 Ga0055526_1002294 3300003771 Bacteria 13055
55 Ga0055526_1008324 3300003771 Bacteria 5199
56 Ga0055526_1016818 3300003771 Bacteria 2834
57 Ga0055526_1016912 3300003771 Bacteria 2820
58 Ga0055526_1017729 3300003771 Bacteria 2702
59 Ga0055526_1028335 3300003771 Bacteria 1697
60 Ga0055524_1003993 3300003775 Bacteria 6961
61 Ga0055524_1007275 3300003775 Bacteria 4724
62 Ga0055524_1014578 3300003775 Bacteria 2906
63 Ga0055524_1023454 3300003775 Bacteria 1985
64 Ga0055536_1012578 3300003781 Bacteria 3126
65 Ga0055528_1000519 3300003790 Bacteria 30154
66 Ga0055528_1004148 3300003790 Bacteria 7059
67 Ga0055528_1014232 3300003790 Bacteria 2957
68 Ga0055528_1027463 3300003790 Bacteria 1601
69 Ga0055528_1031970 3300003790 Bacteria 1356
70 Ga0055530_10022847 3300003791 Bacteria 1811
71 Ga0055540_1000050 3300003792 Bacteria 145565
72 Ga0055540_1005332 3300003792 Bacteria 5457
73 Ga0055540_1012166 3300003792 Bacteria 2721
74 Ga0055540_1022297 3300003792 Bacteria 1623
75 Ga0055531_10016516 3300003794 Bacteria 3179
76 Ga0055531_10017593 3300003794 Bacteria 3006
77 Ga0055541_1000006 3300003841 Bacteria 406566
78 Ga0058692_1008266 3300003856 Bacteria 2693
79 Ga0058692_1017728 3300003856 Bacteria 1556
80 Ga0055543_1000009 3300004625 Bacteria 200706
81 Ga0055543_1000021 3300004625 Bacteria 150116
82 Ga0055543_1000315 3300004625 Bacteria 33655
83 Ga0055543_1003043 3300004625 Bacteria 5170
84 Ga0065165_1000064 3300005262 Bacteria 175153
85 Ga0065165_1000513 3300005262 Bacteria 59506
86 Ga0065165_1005453 3300005262 Bacteria 7139
87 Ga0065165_1006135 3300005262 Bacteria 6429
88 Ga0065165_1008941 3300005262 Bacteria 4588
89 Ga0065165_1047904 3300005262 Bacteria 1231
90 Ga0065704_10000959 3300005289 Bacteria 34794
91 Ga0065715_10033325 3300005293 Bacteria 1939
92 Ga0065707_10026737 3300005295 Bacteria 1507
93 Ga0070670_100000287 3300005331 Bacteria 44454
94 Ga0068868_100250245 3300005338 Bacteria 1491
95 Ga0070660_100128224 3300005339 Bacteria 2029
96 Ga0070668_100127067 3300005347 Bacteria 2043
97 Ga0070669_100010155 3300005353 Bacteria 6694
98 Ga0070671_100380979 3300005355 Bacteria 1205
99 Ga0070674_100001722 3300005356 Bacteria 11851
100 Ga0070667_100442686 3300005367 Bacteria 1187
101 Ga0070711_100205272 3300005439 Bacteria 1523
102 Ga0068867_100270193 3300005459 Bacteria 1390
103 Ga0070707_100007996 3300005468 Bacteria 9825
104 Ga0070698_100496819 3300005471 Bacteria 1158
105 Ga0070699_100241157 3300005518 Bacteria 1614
106 Ga0068853_100357110 3300005539 Bacteria 1360
107 Ga0070696_100073348 3300005546 Bacteria 2411
108 Ga0070696_100341458 3300005546 Bacteria 1157
109 Ga0070665_100105349 3300005548 Bacteria 2822
110 Ga0070665_100177473 3300005548 Bacteria 2131
111 Ga0070665_100263818 3300005548 Bacteria 1724
112 Ga0070665_100483833 3300005548 Bacteria 1249
113 Ga0070665_100511960 3300005548 Bacteria 1212
114 Ga0068857_100169903 3300005577 Bacteria 1982
115 Ga0068854_100067701 3300005578 Bacteria 2602
116 Ga0068856_100022838 3300005614 Bacteria 6084
117 Ga0068856_100485317 3300005614 Bacteria 1257
118 Ga0068852_100237316 3300005616 Bacteria 1741
119 Ga0068861_100327653 3300005719 Bacteria 1336
120 Ga0068851_10135295 3300005834 Bacteria 1336
121 Ga0068862_100090252 3300005844 Bacteria 2667
122 Ga0068862_100157312 3300005844 Bacteria 2026
123 Ga0081455_10035366 3300005937 Bacteria 4466
124 Ga0081455_10124862 3300005937 Bacteria 2022
125 Ga0081538_10002181 3300005981 Bacteria 19427
126 Ga0081538_10015390 3300005981 Bacteria 5923
127 Ga0081540_1041947 3300005983 Bacteria 2366
128 Ga0081540_1071406 3300005983 Bacteria 1604
129 Ga0081539_10010083 3300005985 Bacteria 7761
130 Ga0075365_10010840 3300006038 Bacteria 5331
131 Ga0075365_10190182 3300006038 Bacteria 1436
132 Ga0075365_10303480 3300006038 Bacteria 1124
133 Ga0075368_10088341 3300006042 Bacteria 1266
134 Ga0075363_100129012 3300006048 Bacteria 1417
135 Ga0075363_100272121 3300006048 Bacteria 978
136 Ga0075364_10013563 3300006051 Bacteria 5014
137 Ga0075364_10096538 3300006051 Bacteria 1965
138 Ga0075364_10326887 3300006051 Bacteria 1044
139 Ga0075367_10021014 3300006178 Bacteria 3643
140 Ga0075369_10007134 3300006186 Bacteria 4247
141 Ga0075369_10035944 3300006186 Bacteria 2106
142 Ga0075366_10003448 3300006195 Bacteria 8344
143 Ga0075366_10151175 3300006195 Bacteria 1406
144 Ga0075370_10003108 3300006353 Bacteria 7837
145 Ga0075370_10070369 3300006353 Bacteria 2001
146 Ga0068865_100362889 3300006881 Bacteria 1177
147 Ga0068865_100577500 3300006881 Bacteria 947
148 Ga0079104_1001270 3300006946 Bacteria 17502
149 Ga0079104_1024320 3300006946 Bacteria 1596
150 Ga0099826_10000181 3300006948 Bacteria 26466
151 Ga0099826_10035342 3300006948 Bacteria 3556
152 Ga0105251_10030323 3300009011 Bacteria 2717
153 Ga0105251_10055843 3300009011 Bacteria 1871
154 Ga0105244_10001340 3300009036 Bacteria 20097
155 Ga0105244_10001791 3300009036 Bacteria 16834
156 Ga0105244_10014154 3300009036 Bacteria 4625
157 Ga0105244_10122047 3300009036 Bacteria 1261
158 Ga0105250_10004385 3300009092 Bacteria 6501
159 Ga0105240_10000217 3300009093 Bacteria 115649
160 Ga0105240_10330935 3300009093 Bacteria 1733
161 Ga0105240_10542647 3300009093 Bacteria 1287
162 Ga0111539_10000123 3300009094 Bacteria 87000
163 Ga0105245_10346920 3300009098 Bacteria 1470
164 Ga0105245_10601596 3300009098 Bacteria 1126
165 Ga0105245_10933278 3300009098 Bacteria 910
166 Ga0105243_10032808 3300009148 Bacteria 4014
167 Ga0105243_10293898 3300009148 Bacteria 1469
168 Ga0105243_10410444 3300009148 Bacteria 1260
169 Ga0105241_10032823 3300009174 Bacteria 3895
170 Ga0105241_10560250 3300009174 Bacteria 1027
171 Ga0105248_10046083 3300009177 Bacteria 4887
172 Ga0105248_10736661 3300009177 Bacteria 1112
173 Ga0105237_10001458 3300009545 Bacteria 31192
174 Ga0105237_10023149 3300009545 Bacteria 6369
175 Ga0105237_10283541 3300009545 Bacteria 1659
176 Ga0105238_10014472 3300009551 Bacteria 7979
177 Ga0105238_10377350 3300009551 Bacteria 1409
178 Ga0105238_10823791 3300009551 Bacteria 944
179 Ga0105249_10239161 3300009553 Bacteria 1794
180 Ga0105249_10353592 3300009553 Bacteria 1489
181 Ga0123341_1000109 3300009765 Bacteria 36496
182 Ga0123342_1014735 3300009766 Bacteria 7361
183 Ga0105239_10001164 3300010375 Bacteria 36154
184 Ga0105239_10078102 3300010375 Bacteria 3643
185 Ga0105239_10230990 3300010375 Bacteria 2075
186 Ga0105239_10440443 3300010375 Bacteria 1477
187 Ga0105239_10475843 3300010375 Bacteria 1419
188 Ga0105246_10010396 3300011119 Bacteria 5757
189 Ga0105246_10097688 3300011119 Bacteria 2132
190 Ga0157373_10004331 3300013100 Bacteria 10686
191 Ga0157373_10030840 3300013100 Bacteria 3858
192 Ga0157373_10240529 3300013100 Bacteria 1280
193 Ga0157371_10000002 3300013102 Bacteria 665040
194 Ga0157371_10001454 3300013102 Bacteria 24558
195 Ga0157370_10001439 3300013104 Bacteria 29445
196 Ga0157370_10001923 3300013104 Bacteria 25548
197 Ga0157369_10107178 3300013105 Bacteria 2973
198 Ga0171463_1007 3300013249 Bacteria 301198
199 Ga0157374_10469475 3300013296 Bacteria 1261
200 Ga0182008_10100750 3300014497 Bacteria 1427
201 Ga0182007_10000324 3300015262 Bacteria 30329
202 Ga0182005_1001504 3300015265 Bacteria 9294
203 Ga0183363_1153 3300015690 Bacteria 17205
204 Ga0214544_1000010 3300021320 Bacteria 270164
205 Ga0214542_1000023 3300021321 Bacteria 191557
206 Ga0214542_1018351 3300021321 Bacteria 5949
207 Ga0214543_1000019 3300021327 Bacteria 267908
208 Ga0214543_1001578 3300021327 Bacteria 44277
209 Ga0213872_10002824 3300021361 Bacteria 9940
210 Ga0213872_10009103 3300021361 Bacteria 4773
211 Ga0228711_1000017 3300022739 Bacteria 121084
212 Ga0228710_1000005 3300022740 Bacteria 233531
213 Ga0209435_100006 3300025206 Bacteria 542459
214 Ga0209760_100051 3300025207 Bacteria 105257
215 Ga0209436_101959 3300025208 Bacteria 6600
216 Ga0209436_109923 3300025208 Bacteria 1775
217 Ga0209784_100001 3300025224 Bacteria 3600592
218 Ga0209566_100001 3300025225 Bacteria 3600765
219 Ga0209674_100002 3300025226 Bacteria 3600592
220 Ga0209563_100002 3300025230 Bacteria 2045675
221 Ga0207427_100020 3300025231 Bacteria 507515
222 Ga0209437_100001 3300025233 Bacteria 2045675
223 Ga0209437_100042 3300025233 Bacteria 444095
224 Ga0209437_100062 3300025233 Bacteria 336900
225 Ga0207425_1000065 3300025245 Bacteria 127264
226 Ga0207425_1008594 3300025245 Bacteria 2599
227 Ga0207425_1009532 3300025245 Bacteria 2408
228 Ga0209646_1000015 3300025246 Bacteria 542459
229 Ga0209646_1003792 3300025246 Bacteria 2894
230 Ga0209026_1000046 3300025250 Bacteria 262031
231 Ga0209026_1000050 3300025250 Bacteria 254994
232 Ga0209677_100002 3300025253 Bacteria 2045675
233 Ga0209677_100429 3300025253 Bacteria 24814
234 Ga0209148_1000050 3300025254 Bacteria 413178
235 Ga0209759_1000005 3300025256 Bacteria 542459
236 Ga0209759_1000229 3300025256 Bacteria 83575
237 Ga0209129_1000019 3300025258 Bacteria 460802
238 Ga0209129_1000132 3300025258 Bacteria 127262
239 Ga0209129_1001521 3300025258 Bacteria 12809
240 Ga0209129_1002872 3300025258 Bacteria 7945
241 Ga0209129_1004004 3300025258 Bacteria 6048
242 Ga0209129_1006071 3300025258 Bacteria 4038
243 Ga0209129_1010911 3300025258 Bacteria 2218
244 Ga0209233_1000034 3300025261 Bacteria 578898
245 Ga0209233_1000082 3300025261 Bacteria 336320
246 Ga0209233_1000103 3300025261 Bacteria 284123
247 Ga0209233_1000288 3300025261 Bacteria 66882
248 Ga0209233_1005432 3300025261 Bacteria 4229
249 Ga0209455_1000507 3300025272 Bacteria 27901
250 Ga0209673_1000023 3300025273 Bacteria 411385
251 Ga0209673_1000132 3300025273 Bacteria 162349
252 Ga0209673_1001968 3300025273 Bacteria 16055
253 Ga0209673_1002729 3300025273 Bacteria 11649
254 Ga0209673_1002876 3300025273 Bacteria 10948
255 Ga0209673_1003829 3300025273 Bacteria 8509
256 Ga0209130_1000001 3300025284 Bacteria 831557
257 Ga0209130_1000017 3300025284 Bacteria 388431
258 Ga0209130_1000048 3300025284 Bacteria 233357
259 Ga0209130_1001748 3300025284 Bacteria 12937
260 Ga0209130_1010463 3300025284 Bacteria 2552
261 Ga0209130_1015688 3300025284 Bacteria 1857
262 Ga0209676_1021257 3300025292 Bacteria 2183
263 Ga0209025_1000072 3300025294 Bacteria 283452
264 Ga0209025_1000077 3300025294 Bacteria 271958
265 Ga0209025_1000153 3300025294 Bacteria 170548
266 Ga0209025_1000247 3300025294 Bacteria 127264
267 Ga0209025_1000666 3300025294 Bacteria 59408
268 Ga0209025_1002519 3300025294 Bacteria 19180
269 Ga0209025_1005892 3300025294 Bacteria 9796
270 Ga0209025_1019188 3300025294 Bacteria 3817
271 Ga0209025_1019195 3300025294 Bacteria 3816
272 Ga0209025_1049715 3300025294 Bacteria 1683
273 Ga0209564_1000100 3300025295 Bacteria 224016
274 Ga0209564_1000372 3300025295 Bacteria 83053
275 Ga0209564_1001437 3300025295 Bacteria 24420
276 Ga0209564_1002441 3300025295 Bacteria 14707
277 Ga0209564_1011402 3300025295 Bacteria 3987
278 Ga0209564_1034239 3300025295 Bacteria 1493
279 Ga0209758_1000053 3300025297 Bacteria 337751
280 Ga0209758_1000212 3300025297 Bacteria 127597
281 Ga0209758_1000239 3300025297 Bacteria 114761
282 Ga0209758_1000712 3300025297 Bacteria 49095
283 Ga0209758_1002011 3300025297 Bacteria 21870
284 Ga0209758_1002735 3300025297 Bacteria 17345
285 Ga0209758_1004308 3300025297 Bacteria 11994
286 Ga0209758_1005005 3300025297 Bacteria 10575
287 Ga0209758_1014984 3300025297 Bacteria 4056
288 Ga0209758_1022928 3300025297 Bacteria 2841
289 Ga0209758_1030212 3300025297 Bacteria 2249
290 Ga0209758_1034485 3300025297 Bacteria 2011
291 Ga0209758_1049788 3300025297 Bacteria 1475
292 Ga0209050_1002669 3300025298 Bacteria 14559
293 Ga0209050_1006906 3300025298 Bacteria 6569
294 Ga0209050_1009761 3300025298 Bacteria 4848
295 Ga0209256_1000401 3300025299 Bacteria 68618
296 Ga0209256_1000458 3300025299 Bacteria 61611
297 Ga0209256_1000735 3300025299 Bacteria 43205
298 Ga0209256_1000818 3300025299 Bacteria 39749
299 Ga0209256_1002923 3300025299 Bacteria 12843
300 Ga0209256_1003989 3300025299 Bacteria 9683
301 Ga0207426_1000005 3300025302 Bacteria 1037188
302 Ga0207426_1000006 3300025302 Bacteria 1025969
303 Ga0207426_1000035 3300025302 Bacteria 448327
304 Ga0207426_1000136 3300025302 Bacteria 201401
305 Ga0207426_1000141 3300025302 Bacteria 194453
306 Ga0207426_1028627 3300025302 Bacteria 1845
307 Ga0209051_1000062 3300025303 Bacteria 251081
308 Ga0209051_1003152 3300025303 Bacteria 11077
309 Ga0209051_1005006 3300025303 Bacteria 7897
310 Ga0209051_1035479 3300025303 Bacteria 1855
311 Ga0209257_1001119 3300025304 Bacteria 34613
312 Ga0209257_1010746 3300025304 Bacteria 4556
313 Ga0207696_1000076 3300025711 Bacteria 210418
314 Ga0207696_1000396 3300025711 Bacteria 40779
315 Ga0207655_1000413 3300025728 Bacteria 58877
316 Ga0207655_1014385 3300025728 Bacteria 4475
317 Ga0207655_1071084 3300025728 Bacteria 1293
318 Ga0207713_1038463 3300025735 Bacteria 2029
319 Ga0207680_10246153 3300025903 Bacteria 1234
320 Ga0207647_10081824 3300025904 Bacteria 1934
321 Ga0207645_10056949 3300025907 Bacteria 2495
322 Ga0207695_10000613 3300025913 Bacteria 71568
323 Ga0207695_10011879 3300025913 Bacteria 10494
324 Ga0207671_10001160 3300025914 Bacteria 31428
325 Ga0207671_10088960 3300025914 Bacteria 2324
326 Ga0207657_10054577 3300025919 Bacteria 3455
327 Ga0207646_10047164 3300025922 Bacteria 3865
328 Ga0207694_10032771 3300025924 Bacteria 3978
329 Ga0207650_10001289 3300025925 Bacteria 18184
330 Ga0207700_10206085 3300025928 Bacteria 1660
331 Ga0207709_10036345 3300025935 Bacteria 2919
332 Ga0207669_10006701 3300025937 Bacteria 5282
333 Ga0207704_10346230 3300025938 Bacteria 1155
334 Ga0207691_10187455 3300025940 Bacteria 1805
335 Ga0207711_10334835 3300025941 Bacteria 1400
336 Ga0207712_10181007 3300025961 Bacteria 1655
337 Ga0207668_10106081 3300025972 Bacteria 2098
338 Ga0207668_10510421 3300025972 Bacteria 1036
339 Ga0207678_10159191 3300026067 Bacteria 1928
340 Ga0207708_10110635 3300026075 Bacteria 2132
341 Ga0207702_10014348 3300026078 Bacteria 6578
342 Ga0207702_10487839 3300026078 Bacteria 1200
343 Ga0207648_10236538 3300026089 Bacteria 1626
344 Ga0207648_10613942 3300026089 Bacteria 1003
345 Ga0207674_10432554 3300026116 Bacteria 1272
346 Ga0207675_100122019 3300026118 Bacteria 2466
347 Ga0207683_10039107 3300026121 Bacteria 4138
348 Ga0207683_10198925 3300026121 Bacteria 1821
349 Ga0207698_10084832 3300026142 Bacteria 2569
350 Ga0209281_1000082 3300027111 Bacteria 257684
351 Ga0209281_1001229 3300027111 Bacteria 17082
352 Ga0209371_1004328 3300027312 Bacteria 6261
353 Ga0209371_1004561 3300027312 Bacteria 5941
354 Ga0209371_1004841 3300027312 Bacteria 5645
355 Ga0209282_1000006 3300027666 Bacteria 276998
356 Ga0209282_1000176 3300027666 Bacteria 35300
357 Ga0209282_1036197 3300027666 Bacteria 2982
358 Ga0207428_10000133 3300027907 Bacteria 100902
359 Ga0268266_10005342 3300028379 Bacteria 12018
360 Ga0268266_10127196 3300028379 Bacteria 2275
361 Ga0268266_10190337 3300028379 Bacteria 1873
362 Ga0268266_10198257 3300028379 Bacteria 1836
363 Ga0268266_10240919 3300028379 Bacteria 1669
364 Ga0268266_10361384 3300028379 Bacteria 1366
365 Ga0268265_10171350 3300028380 Bacteria 1855
366 Ga0268265_10392935 3300028380 Bacteria 1280
367 Ga0307517_10207732 3300028786 Bacteria 1212
368 Ga0307515_10002150 3300028794 Bacteria 43260
369 Ga0307515_10033865 3300028794 Bacteria 8393
370 Ga0307515_10168799 3300028794 Bacteria 2192
371 Ga0268256_1003641 3300030500 Bacteria 6841
372 Ga0268256_1003966 3300030500 Bacteria 6378
373 Ga0268256_1004619 3300030500 Bacteria 5645
374 Ga0268256_1015885 3300030500 Bacteria 2178
375 Ga0316181_1067070 3300030744 Bacteria 2047
376 Ga0265330_10046801 3300031235 Bacteria 1905
377 Ga0307513_10000463 3300031456 Bacteria 58389
378 Ga0307513_10028096 3300031456 Bacteria 6441
379 Ga0307513_10166943 3300031456 Bacteria 2084
380 Ga0307513_10185890 3300031456 Bacteria 1935
381 Ga0307513_10355592 3300031456 Bacteria 1211
382 Ga0307508_10081823 3300031616 Bacteria 2810
383 Ga0307508_10210604 3300031616 Bacteria 1544
384 Ga0307508_10335188 3300031616 Bacteria 1104
385 Ga0265314_10018857 3300031711 Bacteria 5359
386 Ga0307413_10050395 3300031824 Bacteria 2501
387 Ga0307410_10203197 3300031852 Bacteria 1514
388 Ga0307412_10019356 3300031911 Bacteria 4120
389 Ga0307412_10286358 3300031911 Bacteria 1296
390 Ga0315914_1000003 3300031967 Bacteria 314370
391 Ga0307409_100033770 3300031995 Bacteria 3727
392 Ga0307409_100116671 3300031995 Bacteria 2251
393 Ga0307409_100653424 3300031995 Bacteria 1046
394 Ga0307416_100202641 3300032002 Bacteria 1884
395 Ga0307414_10365263 3300032004 Bacteria 1243
396 Ga0307411_10060082 3300032005 Bacteria 2522
397 Ga0315913_1000001 3300033430 Bacteria 284459
398 Ga0315915_1000008 3300033464 Bacteria 258517
399 Ga0373927_0000266 3300035695 Bacteria 41356
400 Ga0373947_0133152 3300035725 Bacteria 1589
401 Ga0373937_0593115 3300036401 Bacteria 1052
402 Ga0373925_0001672 3300037068 Bacteria 18664
403 Ga0373925_0060324 3300037068 Bacteria 2849
404 Ga0395900_0018190 3300037418 Bacteria 7169
405 Ga0395905_0002837 3300037471 Bacteria 18981
406 Ga0395905_0003927 3300037471 Bacteria 15643
407 Ga0395905_0048313 3300037471 Bacteria 3988
408 Ga0395905_0093038 3300037471 Bacteria 2827
409 Ga0395905_0122973 3300037471 Bacteria 2440
410 Ga0395901_0108026 3300038443 Bacteria 2921
411 Ga0395901_0116451 3300038443 Bacteria 2807
412 Ga0400483_065417 3300039062 Bacteria 3409
413 Ga0436365_0671760 3300039437 Bacteria 1347
414 Ga0436361_0027550 3300039447 Bacteria 11259
415 Ga0436361_0034602 3300039447 Bacteria 1517
416 Ga0436361_0137889 3300039447 Bacteria 2935
417 Ga0436361_0570105 3300039447 Bacteria 9679
418 Ga0436363_0274728 3300039450 Bacteria 6466
419 Ga0436363_1315970 3300039450 Bacteria 3880
420 Ga0439436_0000195 3300041404 Bacteria 14462
421 Ga0439447_048680 3300041407 Bacteria 1017
422 Ga0439465_0075847 3300041413 Bacteria 1133
423 Ga0439465_0142491 3300041413 Bacteria 852
424 Ga0451835_0331121 3300041492 Bacteria 1390
425 Ga0451839_0268492 3300041496 Bacteria 1451
426 Ga0451845_0189427 3300041501 Bacteria 2701
427 Ga0451847_0010441 3300041503 Bacteria 1131
428 Ga0451843_0065299 3300041509 Bacteria 1037
429 Ga0451853_2758235 3300041512 Bacteria 1143
430 Ga0439449_0017545 3300042007 Bacteria 2688
431 Ga0439455_0022511 3300042012 Bacteria 1511
432 Ga0439462_0027122 3300042015 Bacteria 1511
433 Ga0439462_0042290 3300042015 Bacteria 1217
434 Ga0450906_029307 3300042145 Bacteria 973
435 Ga0466972_0046222 3300044658 Bacteria 2108
436 Ga0466972_0084169 3300044658 Bacteria 1512
437 Ga0466970_0169294 3300044765 Bacteria 1210
438 Ga0466960_0168679 3300044901 Bacteria 1180
439 Ga0466959_0052281 3300045049 Bacteria 2993
440 Ga0495592_0075679 3300046454 Bacteria 2444
441 Ga0495591_000803 3300046458 Bacteria 22249
442 Ga0495629_0040880 3300046459 Bacteria 3262
443 Ga0495638_0123397 3300046460 Bacteria 1528
444 Ga0495638_0210983 3300046460 Bacteria 1091
445 Ga0495650_0000043 3300046471 Bacteria 357197
446 Ga0495650_0000113 3300046471 Bacteria 196536
447 Ga0495605_0099869 3300046474 Bacteria 1335
448 Ga0495639_0081012 3300046475 Bacteria 1512
449 Ga0495662_0007616 3300046476 Bacteria 5343
450 Ga0495584_0002744 3300046491 Bacteria 9858
451 Ga0495585_0140841 3300046492 Bacteria 1263
452 Ga0495606_0000374 3300046507 Bacteria 76132
453 Ga0495606_0001618 3300046507 Bacteria 29389
454 Ga0495606_0023645 3300046507 Bacteria 4446
455 Ga0495610_0009644 3300046512 Bacteria 6081
456 Ga0495616_0116708 3300046513 Bacteria 1235
457 Ga0495620_0107319 3300046515 Bacteria 1109
458 Ga0495631_0036456 3300046518 Bacteria 2196
459 Ga0495631_0077215 3300046518 Bacteria 1437
460 Ga0495632_0086599 3300046519 Bacteria 1490
461 Ga0495643_0088441 3300046522 Bacteria 1601
462 Ga0495644_0001112 3300046523 Bacteria 11067
463 Ga0495648_0018790 3300046524 Bacteria 4878
464 Ga0495654_0000124 3300046530 Bacteria 86154
465 Ga0495654_0000694 3300046530 Bacteria 26403
466 Ga0495587_0121886 3300046536 Bacteria 1493
467 Ga0495622_0023211 3300046557 Bacteria 2892
468 Ga0495633_0005760 3300046558 Bacteria 7486
469 Ga0495656_0110939 3300046615 Bacteria 1283
470 Ga0495668_0196902 3300046616 Bacteria 1103
471 Ga0495625_0082577 3300046660 Bacteria 2234
472 Ga0495625_0105065 3300046660 Bacteria 1935
473 Ga0495625_0110977 3300046660 Bacteria 1874
474 Ga0495625_0371288 3300046660 Bacteria 900
475 Ga0495588_0073614 3300046674 Bacteria 1779
476 Ga0495657_0149954 3300046675 Bacteria 1448
477 Ga0495649_0158143 3300046694 Bacteria 1189
478 Ga0495589_0039901 3300046794 Bacteria 2345
479 Ga0495660_0000012 3300046810 Bacteria 350701
480 Ga0495660_0000034 3300046810 Bacteria 201261
481 Ga0495660_0051547 3300046810 Bacteria 2239
482 Ga0495604_0021553 3300047317 Bacteria 5143
483 Ga0495674_0451548 3300047319 Bacteria 1033
484 Ga0495672_0000029 3300047320 Bacteria 305231
485 Ga0495673_0000092 3300047469 Bacteria 187963
486 Ga0495681_0002695 3300047470 Bacteria 12583
487 Ga0495681_0061718 3300047470 Bacteria 1726
488 Ga0495686_0000795 3300047472 Bacteria 41055
489 Ga0495615_0040446 3300048090 Bacteria 1161
490 Ga0496101_0000023 3300048904 Bacteria 209923
491 Ga0496104_0131911 3300048907 Bacteria 2400
492 Ga0496105_0294200 3300048908 Bacteria 1307
493 Ga0496106_0351713 3300048909 Bacteria 1183
494 Ga0496110_0283493 3300048913 Bacteria 1509
495 Ga0496111_0123945 3300048914 Bacteria 1910
496 Ga0496112_0028761 3300048915 Bacteria 5369
497 Ga0496112_0047536 3300048915 Bacteria 4210
498 Ga0496112_0622845 3300048915 Bacteria 1010
499 Ga0496115_0100983 3300048918 Bacteria 2365
500 Ga0496116_0000042 3300048919 Bacteria 330516
501 Ga0496116_0000066 3300048919 Bacteria 264035
502 Ga0496116_0005820 3300048919 Bacteria 11323
503 Ga0496116_0007217 3300048919 Bacteria 9916
504 Ga0496116_0009455 3300048919 Bacteria 8303
505 Ga0496116_0019687 3300048919 Bacteria 5159
506 Ga0496116_0120858 3300048919 Bacteria 1516
507 Ga0496117_0000036 3300048920 Bacteria 325635
508 Ga0496117_0013982 3300048920 Bacteria 6954
509 Ga0496117_0019866 3300048920 Bacteria 5499
510 Ga0496117_0026327 3300048920 Bacteria 4553
511 Ga0496117_0070372 3300048920 Bacteria 2350
512 Ga0496117_0160660 3300048920 Bacteria 1317
513 Ga0496118_0012231 3300048921 Bacteria 8269
514 Ga0496118_0015347 3300048921 Bacteria 7096
515 Ga0496118_0022829 3300048921 Bacteria 5454
516 Ga0496118_0041334 3300048921 Bacteria 3651
517 Ga0496119_0004655 3300048922 Bacteria 13530
518 Ga0496119_0010451 3300048922 Bacteria 7812
519 Ga0496119_0011716 3300048922 Bacteria 7217
520 Ga0496119_0015192 3300048922 Bacteria 5957
521 Ga0496119_0016484 3300048922 Bacteria 5621
522 Ga0496119_0028726 3300048922 Bacteria 3788
523 Ga0496119_0045882 3300048922 Bacteria 2734
524 Ga0496119_0058948 3300048922 Bacteria 2310
525 Ga0496120_0000032 3300048923 Bacteria 220255
526 Ga0496120_0000777 3300048923 Bacteria 46134
527 Ga0496120_0001086 3300048923 Bacteria 35695
528 Ga0496120_0001523 3300048923 Bacteria 27295
529 Ga0496120_0001949 3300048923 Bacteria 22617
530 Ga0496120_0008032 3300048923 Bacteria 7762
531 Ga0496120_0008096 3300048923 Bacteria 7725
532 Ga0496121_0000001 3300048924 Bacteria 1830318
533 Ga0496121_0000239 3300048924 Bacteria 118051
534 Ga0496121_0002342 3300048924 Bacteria 29248
535 Ga0496121_0018876 3300048924 Bacteria 6922
536 Ga0496122_0000002 3300048925 Bacteria 905834
537 Ga0496122_0000072 3300048925 Bacteria 222436
538 Ga0496122_0000110 3300048925 Bacteria 190142
539 Ga0496122_0006562 3300048925 Bacteria 13298
540 Ga0496122_0022649 3300048925 Bacteria 5575
541 Ga0496122_0024700 3300048925 Bacteria 5250
542 Ga0496122_0038214 3300048925 Bacteria 3850
543 Ga0496122_0055595 3300048925 Bacteria 2959
544 Ga0496122_0102534 3300048925 Bacteria 1907
545 Ga0496123_0000002 3300048926 Bacteria 1811682
546 Ga0496123_0000035 3300048926 Bacteria 267288
547 Ga0496123_0000081 3300048926 Bacteria 190142
548 Ga0496123_0019603 3300048926 Bacteria 5327
549 Ga0496123_0131675 3300048926 Bacteria 1384
550 Ga0496123_0169793 3300048926 Bacteria 1152
551 Ga0496124_0000530 3300048927 Bacteria 65033
552 Ga0496124_0003541 3300048927 Bacteria 18992
553 Ga0496124_0010305 3300048927 Bacteria 9485
554 Ga0496124_0015678 3300048927 Bacteria 7249
555 Ga0496124_0018541 3300048927 Bacteria 6514
556 Ga0496124_0034006 3300048927 Bacteria 4479
557 Ga0496124_0236713 3300048927 Bacteria 1361
558 Ga0496124_0265687 3300048927 Bacteria 1260
559 Ga0496125_0000001 3300048928 Bacteria 1766138
560 Ga0496125_0000033 3300048928 Bacteria 351850
561 Ga0496125_0032307 3300048928 Bacteria 4650
562 Ga0496125_0106619 3300048928 Bacteria 2044
563 Ga0496126_0000053 3300048929 Bacteria 311989
564 Ga0496126_0001066 3300048929 Bacteria 46225
565 Ga0496126_0048035 3300048929 Bacteria 3905
566 Ga0496126_0050721 3300048929 Bacteria 3781
567 Ga0496126_0061199 3300048929 Bacteria 3382
568 Ga0496126_0082583 3300048929 Bacteria 2838
569 Ga0496126_0186957 3300048929 Bacteria 1756
570 Ga0496126_0241908 3300048929 Bacteria 1507
571 Ga0496126_0342842 3300048929 Bacteria 1224
572 Ga0495678_001299 3300049459 Bacteria 20174
573 Ga0495678_036076 3300049459 Bacteria 2021
574 Ga0495682_0000003 3300049460 Bacteria 515787
575 Ga0501031_0182755 3300049568 Bacteria 1370
576 Ga0501032_0256322 3300049569 Bacteria 1135
577 Ga0501034_0001016 3300049571 Bacteria 40222
578 Ga0501038_0097401 3300049574 Bacteria 2454
579 Ga0501042_0062880 3300049578 Bacteria 2653
580 Ga0501043_0159367 3300049579 Bacteria 1764
581 Ga0501046_0129194 3300049580 Bacteria 1917
582 Ga0501047_0015869 3300049581 Bacteria 7177
583 Ga0501067_0081931 3300049583 Bacteria 1789
584 Ga0501073_0001099 3300049589 Bacteria 19587
585 Ga0501075_0334746 3300049591 Bacteria 1154
586 Ga0501080_0022705 3300049742 Bacteria 5813
587 Ga0501080_0043791 3300049742 Bacteria 4168
588 Ga0501083_0019699 3300049744 Bacteria 4698
589 Ga0501035_0112926 3300049822 Bacteria 2380
590 Ga0501035_0448403 3300049822 Bacteria 1068
591 Ga0501044_0007436 3300049823 Bacteria 12046
592 Ga0501044_0017995 3300049823 Bacteria 7577
593 Ga0501044_0019019 3300049823 Bacteria 7355
594 Ga0501044_0063397 3300049823 Bacteria 3776
595 nmdc:mga03n38_21958_c1 3300050490 Bacteria 2576
596 nmdc:mga03n38_92522_c1 3300050490 Bacteria 1443
597 nmdc:mga00v17_152240_c1 3300050491 Bacteria 1486
598 nmdc:mga00v17_18899_c1 3300050491 Bacteria 3923
599 nmdc:mga00v17_230_c1 3300050491 Bacteria 33351
600 nmdc:mga00v17_24063_c1 3300050491 Bacteria 3528
601 nmdc:mga00v17_24964_c1 3300050491 Bacteria 3469
602 nmdc:mga0yw44_13281_c2 3300050492 Bacteria 3956
603 nmdc:mga0yw44_184551_c1 3300050492 Bacteria 1374
604 nmdc:mga0yw44_36719_c1 3300050492 Bacteria 2889
605 nmdc:mga0yw44_53094_c1 3300050492 Bacteria 2460
606 nmdc:mga06z11_243744_c1 3300050494 Bacteria 1056
607 nmdc:mga06z11_67034_c1 3300050494 Bacteria 1889
608 nmdc:mga04h51_76042_c1 3300050495 Bacteria 1183
609 nmdc:mga07m45_31123_c1 3300050496 Bacteria 2956
610 nmdc:mga07m45_50630_c1 3300050496 Bacteria 2341
611 nmdc:mga07m45_65030_c1 3300050496 Bacteria 2070
612 nmdc:mga05p37_305941_c1 3300050507 Bacteria 1886
613 nmdc:mga08y16_44_c1 3300050511 Bacteria 121496
614 nmdc:mga0sz30_107108_c1 3300050516 Bacteria 1223
615 nmdc:mga0sz30_16417_c1 3300050516 Bacteria 2940
616 nmdc:mga0sz30_6234_c1 3300050516 Bacteria 4422
617 Ga0500610_0050322 3300053079 Bacteria 2168
618 Ga0495619_0058978 3300053085 Bacteria 2549
619 Ga0500578_0041834 3300053086 Bacteria 2942
620 Ga0500646_0002763 3300053090 Bacteria 4529
621 Ga0500651_0086229 3300053093 Bacteria 1940
622 Ga0500641_0055833 3300053096 Bacteria 1635
623 Ga0500555_026090 3300053103 Bacteria 1670
624 Ga0500557_026116 3300053105 Bacteria 1725
625 Ga0500594_0033298 3300053118 Bacteria 1370
626 Ga0500595_006666 3300053119 Bacteria 4871
627 Ga0500621_000006 3300053126 Bacteria 245480
628 Ga0500642_0002981 3300053130 Bacteria 5046
629 Ga0500658_0001819 3300053134 Bacteria 8407
630 Ga0500561_0000110 3300053137 Bacteria 15825
631 Ga0500568_0000109 3300053139 Bacteria 76714
632 Ga0500568_0021697 3300053139 Bacteria 2759
633 Ga0500573_0018384 3300053140 Bacteria 3985
634 Ga0500588_0008069 3300053146 Bacteria 2446
635 Ga0500588_0049259 3300053146 Bacteria 1306
636 Ga0500588_0063539 3300053146 Bacteria 1190
637 Ga0500590_000792 3300053148 Bacteria 11720
638 Ga0500604_0002453 3300053151 Bacteria 5056
639 Ga0500604_0014031 3300053151 Bacteria 2177
640 Ga0500616_0001121 3300053153 Bacteria 27611
641 Ga0500616_0002733 3300053153 Bacteria 14294
642 Ga0500616_0035927 3300053153 Bacteria 2692
643 Ga0500616_0039388 3300053153 Bacteria 2548
644 Ga0500620_000841 3300053155 Bacteria 5328
645 Ga0500622_0002690 3300053156 Bacteria 12594
646 Ga0500624_000296 3300053157 Bacteria 17030
647 Ga0500627_0098481 3300053158 Bacteria 1312
648 Ga0500633_0085069 3300053160 Bacteria 1149
649 Ga0500634_0000796 3300053161 Bacteria 11018
650 Ga0500634_0010247 3300053161 Bacteria 4780
651 Ga0500636_0000026 3300053177 Bacteria 84046
652 Ga0500636_0000083 3300053177 Bacteria 47142
653 Ga0500611_028575 3300053727 Bacteria 1133
654 Ga0500609_000048 3300053731 Bacteria 15782
655 Ga0500609_012055 3300053731 Bacteria 1169
656 Ga0501084_0218865 3300054114 Bacteria 1607
657 Ga0590071_004505 3300059421 Bacteria 3380
658 Ga0590075_002537 3300059424 Bacteria 4364
659 Ga0590077_010994 3300059426 Bacteria 1866
660 Ga0501082_0116708 3300060353 Bacteria 2312
661 Ga0501082_0131532 3300060353 Bacteria 2171
662 Ga0530510_0214334 3300061734 Bacteria 1431
663 2503202144 2503198000 Bacteria 6884444
664 2508733346 2508501050 Bacteria 9633614
665 2509107964 2508501122 Bacteria 6292184
666 2509117071 2508501123 Bacteria 6283661
667 2509141454 2508501127 Bacteria 7037543
668 2509370790 2509276018 Bacteria 6910194
669 2509376860 2509276019 Bacteria 6802256
670 2509385493 2509276021 Bacteria 7634384
671 2509396788 2509276022 Bacteria 6200534
672 2509448466 2509276033 Bacteria 7180565
673 2510136503 2510065019 Bacteria 6903379
674 2510304151 2510065057 Bacteria 6649661
675 2510317575 2510065059 Bacteria 6847884
676 2510839081 2510461069 Bacteria 5505000
677 2510900235 2510461076 Bacteria 8618824
678 2511135646 2510917022 Bacteria 6504556
679 2511184343 2510917028 Bacteria 6185411
680 2511197550 2510917030 Bacteria 7460662
681 2511391245 2511231027 Bacteria 5013807
682 2511435636 2511231035 Bacteria 5341610
683 2511502588 2511231052 Bacteria 6974333
684 2512533957 2512047086 Bacteria 6850303
685 2512930959 2512875016 Bacteria 6529530
686 2512958688 2512875024 Bacteria 7195110
687 2512970284 2512875026 Bacteria 6861065
688 2513569646 2513237084 Bacteria 7231967
689 2513576471 2513237085 Bacteria 7695351
690 2513583219 2513237086 Bacteria 7265287
691 2513595060 2513237088 Bacteria 6927906
692 2513601348 2513237089 Bacteria 6553624
693 2513609730 2513237090 Bacteria 7096802
694 2513620915 2513237091 Bacteria 6900273
695 2513635126 2513237093 Bacteria 7545552
696 2513709794 2513237103 Bacteria 7647401
697 2513871326 2513237138 Bacteria 7368160
698 2513881729 2513237140 Bacteria 7076289
699 2513904873 2513237143 Bacteria 6664116
700 2513911556 2513237144 Bacteria 7530820
701 2513929073 2513237146 Bacteria 7166346
702 2513986639 2513237156 Bacteria 6402557
703 2513999225 2513237159 Bacteria 6810126
704 2514003205 2513237160 Bacteria 6650282
705 2514018772 2513237162 Bacteria 7468464
706 2514034898 2513237164 Bacteria 7563725
707 2514421914 2513237305 Bacteria 7293571
708 2515115074 2515075009 Bacteria 7288508
709 2515609371 2515154107 Bacteria 6795637
710 2515633250 2515154113 Bacteria 7807172
711 2515642476 2515154114 Bacteria 7848616
712 2515658452 2515154116 Bacteria 7552979
713 2515741926 2515154134 Bacteria 7220242
714 2516205991 2516143018 Bacteria 6951533
715 2516893964 2516653046 Bacteria 6989037
716 2517041925 2516653077 Bacteria 7555578
717 2517081044 2516653085 Bacteria 7346596
718 2517098616 2517093000 Bacteria 7412387
719 2517410836 2517287029 Bacteria 6905599
720 2517570678 2517487022 Bacteria 7227575
721 2520380739 2519899620 Bacteria 6499161
722 2523468242 2523231067 Bacteria 5230452
723 2524448216 2524023207 Bacteria 6813453
724 2524457344 2524023209 Bacteria 6679728
725 2530644495 2529292951 Bacteria 6916614
726 2535520002 2534681796 Bacteria 7146037
727 2537877750 2537561587 Bacteria 5425293
728 2551675353 2551306084 Bacteria 8942552
729 2551676763 2551306084 Bacteria 8942552
730 2551689363 2551306085 Bacteria 7347181
731 2551695507 2551306086 Bacteria 6843938
732 2551700998 2551306087 Bacteria 7351905
733 2551711112 2551306089 Bacteria 7162724
734 2551722007 2551306090 Bacteria 7953713
735 2551724378 2551306091 Bacteria 7086830
736 2551736474 2551306092 Bacteria 6992595
737 2551739982 2551306093 Bacteria 7064773
738 2554245787 2554235003 Bacteria 5877155
739 2558865782 2558860100 Bacteria 8458965
740 2559296446 2558860242 Bacteria 5568029
741 2585169049 2582581283 Bacteria 6030556
742 2585202767 2582581294 Bacteria 6626667
743 2585221616 2582581298 Bacteria 7315509
744 2585233303 2582581299 Bacteria 6518058
745 2585255305 2582581304 Bacteria 5831370
746 2585270229 2582581306 Bacteria 6450535
747 2585272721 2582581307 Bacteria 6597605
748 2585281237 2582581308 Bacteria 7413247
749 2585327345 2582581315 Bacteria 7318924
750 2585335301 2582581316 Bacteria 7774528
751 2585390451 2582581865 Bacteria 6644329
752 2585395812 2582581866 Bacteria 6859583
753 2585401686 2582581867 Bacteria 7184437
754 2585524176 2585427526 Bacteria 7258840
755 2585536102 2585427527 Bacteria 7273426
756 2585539212 2585427528 Bacteria 6842387
757 2585544214 2585427529 Bacteria 7395659
758 2585557413 2585427530 Bacteria 7383882
759 2585562389 2585427531 Bacteria 6992870
760 2585821381 2585427590 Bacteria 6824633
761 2585829462 2585427591 Bacteria 5482980
762 2585834827 2585427592 Bacteria 5370892
763 2585837165 2585427593 Bacteria 7141551
764 2585842471 2585427594 Bacteria 6180594
765 2585896829 2585427608 Bacteria 6544331
766 2585906444 2585427609 Bacteria 6667127
767 2587981866 2585428125 Bacteria 6662905
768 2588516644 2588253730 Bacteria 6881675
769 2597814999 2597489875 Bacteria 7010078
770 2599334020 2599185156 Bacteria 5403036
771 2599414714 2599185170 Bacteria 7295545
772 2599603066 2599185210 Bacteria 5624189
773 2599717816 2599185236 Bacteria 6875203
774 2599935530 2599185301 Bacteria 6161860
775 2600196889 2599185352 Bacteria 7228948
776 2601610683 2600255279 Bacteria 5605316
777 2601746987 2600255308 Bacteria 5611129
778 2616295200 2615840624 Bacteria 6557588
779 2616310961 2615840626 Bacteria 7921970
780 2616551887 2615840698 Bacteria 7319877
781 2617382883 2617270742 Bacteria 6808054
782 2643804484 2643221557 Bacteria 7184309
783 2643857039 2643221568 Bacteria 5187270
784 2643922190 2643221582 Bacteria 5804683
785 2643989318 2643221595 Bacteria 6565519
786 2644003366 2643221599 Bacteria 6292121
787 2644051210 2643221607 Bacteria 6314006
788 2644065255 2643221610 Bacteria 7480339
789 2644105548 2643221618 Bacteria 7717186
790 2644146551 2643221626 Bacteria 8069654
791 2644152890 2643221627 Bacteria 6761570
792 2644194443 2643221634 Bacteria 6705461
793 2644200881 2643221636 Bacteria 6583769
794 2644210824 2643221637 Bacteria 5345260
795 2644240821 2643221643 Bacteria 5749658
796 2644308299 2643221655 Bacteria 7722067
797 2644334126 2643221659 Bacteria 7890716
798 2644377664 2643221668 Bacteria 7306521
799 2644418139 2643221675 Bacteria 7473456
800 2644451395 2643221680 Bacteria 7473610
801 2644484114 2643221686 Bacteria 6310811
802 2644494936 2643221688 Bacteria 5260751
803 2644497933 2643221689 Bacteria 6042950
804 2644520572 2643221693 Bacteria 5513853
805 2644541720 2643221698 Bacteria 7756764
806 2644615581 2643221712 Bacteria 7729434
807 2644654358 2643221718 Bacteria 5345506
808 2644672679 2643221723 Bacteria 7095460
809 2644691625 2643221726 Bacteria 7455827
810 2671109943 2667528173 Bacteria 5375747
811 2671116756 2667528174 Bacteria 6435400
812 2671693577 2671180139 Bacteria 4196045
813 2688599505 2687453392 Bacteria 6880454
814 2692315091 2690316117 Bacteria 6800650
815 2694628273 2693429783 Bacteria 7019804
816 2694640870 2693429784 Bacteria 7241525
817 2719183761 2718217882 Bacteria 6556348
818 2719388440 2718217927 Bacteria 6972593
819 2719668060 2718217997 Bacteria 6740740
820 2719728202 2718218009 Bacteria 6478651
821 2720494823 2718218199 Bacteria 6740745
822 2720611145 2718218232 Bacteria 6720332
823 2720616317 2718218233 Bacteria 6662049
824 2720629392 2718218235 Bacteria 6630699
825 2720771963 2718218269 Bacteria 6906114
826 2721145063 2718218363 Bacteria 6524337
827 2721155800 2718218365 Bacteria 6274507
828 2721167150 2718218366 Bacteria 6425255
829 2721403063 2718218423 Bacteria 6438183
830 2722838128 2721755514 Bacteria 6424414
831 2723029393 2721755556 Bacteria 6745503
832 2723563009 2721755684 Bacteria 6859907
833 2723570990 2721755685 Bacteria 6704835
834 2723572800 2721755686 Bacteria 7343952
835 2724035420 2721755809 Bacteria 6438790
836 2724042396 2721755810 Bacteria 6479005
837 2724086783 2721755819 Bacteria 6906405
838 2724106941 2721755822 Bacteria 6726041
839 2724107750 2721755823 Bacteria 6752556
840 2725952224 2724679232 Bacteria 7646494
841 2730105707 2728369352 Bacteria 6745171
842 2730161901 2728369365 Bacteria 6555560
843 2730300907 2728369397 Bacteria 6274511
844 2738802543 2738541293 Bacteria 7065685
845 2738944977 2738541317 Bacteria 5340176
846 2739033659 2738541333 Bacteria 7106503
847 2739305846 2738543024 Bacteria 5603683
848 2753463267 2751185821 Bacteria 6189929
849 2756677219 2756170246 Bacteria 7451806
850 2758640843 2758568016 Bacteria 5645291
851 2765468569 2765235802 Bacteria 5618596
852 2766068382 2765235942 Bacteria 7445910
853 2770198940 2767802442 Bacteria 5747986
854 2774872485 2773857925 Bacteria 6472445
855 2776272851 2775506902 Bacteria 6208009
856 2776283256 2775506904 Bacteria 5954060
857 2778175158 2775507266 Bacteria 7392367
858 2792581604 2791355082 Bacteria 5973319
859 2792620398 2791355091 Bacteria 6135441
860 2792625756 2791355092 Bacteria 6248105
861 2792641827 2791355094 Bacteria 7011481
862 2792748622 2791355123 Bacteria 8049106
863 2793281230 2791355253 Bacteria 5171699
864 2793296422 2791355256 Bacteria 6798008
865 2793317210 2791355259 Bacteria 7254731
866 2793324054 2791355260 Bacteria 6598818
867 2793325642 2791355261 Bacteria 6661293
868 2793333065 2791355262 Bacteria 6774204
869 2793340130 2791355263 Bacteria 6872478
870 2793346237 2791355264 Bacteria 6429314
871 2793355457 2791355265 Bacteria 6539969
872 2793357802 2791355266 Bacteria 7116587
873 2793366540 2791355267 Bacteria 7222458
874 2802716641 2802428858 Bacteria 6636079
875 2802725452 2802428859 Bacteria 6667919
876 2802730456 2802428860 Bacteria 6525526
877 2802737572 2802428861 Bacteria 6534206
878 2802743038 2802428862 Bacteria 6633353
879 2802750462 2802428863 Bacteria 6410669
880 2805929051 2802429605 Bacteria 6875453
881 2805937247 2802429606 Bacteria 6346811
882 2806044842 2802429633 Bacteria 7341974
883 2806053998 2802429634 Bacteria 7083200
884 2806059910 2802429635 Bacteria 7650140
885 2806066037 2802429636 Bacteria 7597525
886 2806073381 2802429637 Bacteria 7067217
887 2808990160 2808606387 Bacteria 5697198
888 2819244924 2818991272 Bacteria 4622173
889 2819607525 2818991448 Bacteria 6772224
890 2819643922 2818991453 Bacteria 7181617
891 2821126607 2821123053 Bacteria 7836056
892 2821449605 2821443989 Bacteria 7658172
893 2838019455 2838016132 Bacteria 6577831
894 2838025081 2838022645 Bacteria 6494267
895 2838032024 2838029111 Bacteria 6603031
896 2838039567 2838035591 Bacteria 7166484
897 2838045955 2838042994 Bacteria 6046894
898 2838050561 2838048938 Bacteria 6044578
899 2838062855 2838061910 Bacteria 6794874
900 2838071803 2838068647 Bacteria 6208656
901 2838080550 2838074704 Bacteria 6785777
902 2838667956 2838661181 Bacteria 7385261
903 2838671489 2838668709 Bacteria 6671819
904 2838679983 2838675328 Bacteria 4909118
905 2838684410 2838680041 Bacteria 6545511
906 2838693562 2838686498 Bacteria 7807632
907 2838699901 2838694306 Bacteria 6853137
908 2838704244 2838701080 Bacteria 6669771
909 2838711814 2838707686 Bacteria 6619912
910 2838717398 2838714209 Bacteria 5525906
911 2838721992 2838719591 Bacteria 5523910
912 2838728148 2838724970 Bacteria 4908691
913 2838735455 2838729681 Bacteria 7400765
914 2838739989 2838736955 Bacteria 5760694
915 2838748357 2838742623 Bacteria 7396178
916 2839996536 2839993093 Bacteria 5512535
917 2840770270 2840764183 Bacteria 6358399
918 2841741108 2841734538 Bacteria 6784580
919 2841843887 2841840854 Bacteria 5761912
920 2841850709 2841846520 Bacteria 5345850
921 2841858421 2841851746 Bacteria 7532261
922 2841864183 2841859092 Bacteria 5436171
923 2841869756 2841864319 Bacteria 6742987
924 2842081877 2842077413 Bacteria 6508645
925 2842117609 2842110456 Bacteria 7656360
926 2842122453 2842118031 Bacteria 7033875
927 2842129514 2842124991 Bacteria 5346824
928 2842134886 2842130223 Bacteria 4909145
929 2842143608 2842140634 Bacteria 5759631
930 2842149138 2842146304 Bacteria 5957337
931 2842156903 2842152218 Bacteria 4908957
932 2842162669 2842156927 Bacteria 6894975
933 2842167040 2842163707 Bacteria 6916235
934 2842173081 2842170452 Bacteria 5525737
935 2842180521 2842175837 Bacteria 4908771
936 2842186173 2842180545 Bacteria 6888678
937 2842190505 2842187318 Bacteria 5524014
938 2842195256 2842192696 Bacteria 6147454
939 2842203281 2842198810 Bacteria 6608673
940 2842210272 2842205361 Bacteria 6340321
941 2842214819 2842211629 Bacteria 5523832
942 2842222260 2842217011 Bacteria 7497767
943 2842227540 2842224351 Bacteria 5524473
944 2842236048 2842229732 Bacteria 7475766
945 2842241226 2842237096 Bacteria 6620661
946 2842249979 2842243621 Bacteria 7421798
947 2842253695 2842250916 Bacteria 6579627
948 2842263275 2842257432 Bacteria 7401195
949 2842268006 2842264693 Bacteria 6472963
950 2842278031 2842271015 Bacteria 7807131
951 2842283726 2842278818 Bacteria 6340002
952 2842289697 2842285085 Bacteria 6011953
953 2842295532 2842291075 Bacteria 7076806
954 2842299100 2842298080 Bacteria 6123127
955 2842310047 2842304105 Bacteria 7023636
956 2842311773 2842311132 Bacteria 6616990
957 2842318998 2842317721 Bacteria 6793725
958 2842343994 2842341865 Bacteria 7003929
959 2842358566 2842357229 Bacteria 6485165
960 2842369694 2842363717 Bacteria 6844742
961 2842376676 2842370503 Bacteria 7038661
962 2842381692 2842377471 Bacteria 7140707
963 2842389001 2842384541 Bacteria 7057858
964 2842396355 2842395702 Bacteria 6780583
965 2842407162 2842402390 Bacteria 6681310
966 2842414054 2842409023 Bacteria 6687331
967 2842420695 2842415677 Bacteria 6596907
968 2842425436 2842422224 Bacteria 6239196
969 2842432169 2842428310 Bacteria 6767288
970 2842438281 2842434925 Bacteria 6502746
971 2842443977 2842441272 Bacteria 6769273
972 2842450151 2842447887 Bacteria 6754142
973 2842466267 2842462802 Bacteria 6588055
974 2842472749 2842469257 Bacteria 6752936
975 2842478756 2842475841 Bacteria 6603183
976 2842487522 2842482326 Bacteria 7212537
977 2842491448 2842489311 Bacteria 6620893
978 2842499516 2842495871 Bacteria 6820686
979 2842505925 2842502639 Bacteria 6604161
980 2842511959 2842509118 Bacteria 6850950
981 2842521070 2842515876 Bacteria 5436280
982 2842524972 2842521101 Bacteria 6569494
983 2842875762 2842871566 Bacteria 4827117
984 2842925700 2842922631 Bacteria 5824079
985 2844006363 2844002411 Bacteria 7168230
986 2844014779 2844009547 Bacteria 6728125
987 2844166464 2844163670 Bacteria 7266046
988 2844461106 2844454524 Bacteria 7952546
989 2844537546 2844533157 Bacteria 7517899
990 2847419848 2847417321 Bacteria 6913799
991 2847673130 2847670302 Bacteria 6165597
992 2847689652 2847686936 Bacteria 6278406
993 2848994865 2848992105 Bacteria 6810864
994 2850081864 2850079185 Bacteria 6848280
995 2852394991 2852387548 Bacteria 8025568
996 2854899983 2854896431 Bacteria 5869725
997 2854914164 2854911287 Bacteria 5582813
998 2854921102 2854916844 Bacteria 5725939
999 2855826685 2855825444 Bacteria 6785811
1000 2855842078 2855839649 Bacteria 7135830
1001 2855877364 2855872281 Bacteria 6964271
1002 2856319837 2856314179 Bacteria 6477897
1003 2856325775 2856320880 Bacteria 7263508
1004 2856329056 2856328259 Bacteria 6528202
1005 2856341621 2856334872 Bacteria 7037011
1006 2856346836 2856342000 Bacteria 7176905
1007 2856351571 2856349417 Bacteria 6230045
1008 2856360916 2856356410 Bacteria 6297484
1009 2856366096 2856364286 Bacteria 6939991
1010 2857352554 2857349434 Bacteria 7926032
1011 2857373068 2857367948 Bacteria 6965560
1012 2857519183 2857516855 Bacteria 7787325
1013 2857536699 2857531043 Bacteria 6754041
1014 2858802753 2858800743 Bacteria 6603254
1015 2869167452 2869162929 Bacteria 6399702
1016 2869175846 2869169390 Bacteria 6659796
1017 2869237262 2869234852 Bacteria 6654993
1018 2869247277 2869242130 Bacteria 6609239
1019 2869250990 2869249662 Bacteria 6868783
1020 2869260570 2869256925 Bacteria 6981691
1021 2869264232 2869264136 Bacteria 6880765
1022 2869271353 2869271264 Bacteria 6908218
1023 2869279393 2869278585 Bacteria 7077053
1024 2869291049 2869285874 Bacteria 6901219
1025 2871433331 2871429161 Bacteria 6547891
1026 2871441477 2871435913 Bacteria 6880295
1027 2871449730 2871444079 Bacteria 6423508
1028 2871453017 2871451962 Bacteria 7336357
1029 2871464452 2871459585 Bacteria 6866887
1030 2871469772 2871466892 Bacteria 6923287
1031 2871478495 2871474448 Bacteria 6806570
1032 2871488220 2871481445 Bacteria 6700002
1033 2871491030 2871488783 Bacteria 6929816
1034 2871498873 2871495908 Bacteria 6935695
1035 2874107880 2874102143 Bacteria 6342645
1036 2874109344 2874109183 Bacteria 6517025
1037 2874118292 2874116593 Bacteria 6674494
1038 2874124905 2874123672 Bacteria 7238285
1039 2874133410 2874131515 Bacteria 6820270
1040 2874145142 2874139085 Bacteria 7021506
1041 2874148726 2874146452 Bacteria 7533118
1042 2874160773 2874155637 Bacteria 6724144
1043 2874166728 2874162495 Bacteria 6174670
1044 2874176129 2874168670 Bacteria 8062617
1045 2876365892 2876363079 Bacteria 6544991
1046 2876377575 2876369609 Bacteria 6807521
1047 2876381931 2876377896 Bacteria 6565995
1048 2876391637 2876386047 Bacteria 6698674
1049 2876397384 2876392853 Bacteria 6660880
1050 2876402590 2876399893 Bacteria 6927900
1051 2876408260 2876406927 Bacteria 6191900
1052 2876418813 2876413966 Bacteria 6831344
1053 2876422175 2876420981 Bacteria 6687741
1054 2876604989 2876601092 Bacteria 5114497
1055 2878035734 2878035449 Bacteria 6555736
1056 2878732984 2878730984 Bacteria 6380721
1057 2878743339 2878738818 Bacteria 7136951
1058 2878750944 2878745973 Bacteria 6867388
1059 2878755439 2878753008 Bacteria 6922523
1060 2878763086 2878760144 Bacteria 6823465
1061 2878770061 2878767105 Bacteria 6898628
1062 2878779542 2878774303 Bacteria 6108671
1063 2878786524 2878781027 Bacteria 6834456
1064 2881147855 2881147464 Bacteria 7779814
1065 2881158933 2881155292 Bacteria 6461656
1066 2881164620 2881161766 Bacteria 7127907
1067 2881848663 2881845957 Bacteria 6611900
1068 2881867316 2881861095 Bacteria 7128710
1069 2882460008 2882456835 Bacteria 6863978
1070 2882634840 2882632389 Bacteria 8154593
1071 2882912412 2882912400 Bacteria 6801539
1072 2885306474 2885305155 Bacteria 7348390
1073 2885316413 2885312484 Bacteria 6415165
1074 2885318994 2885318864 Bacteria 6729568
1075 2885333316 2885326080 Bacteria 7134805
1076 2885335408 2885334103 Bacteria 7216818
1077 2885349103 2885342637 Bacteria 7011821
1078 2885351315 2885350715 Bacteria 6787678
1079 2888340070 2888337043 Bacteria 6629336
1080 2888348474 2888343758 Bacteria 6611049
1081 2888352737 2888350351 Bacteria 7372807
1082 2889014508 2889010040 Bacteria 6749192
1083 2889020506 2889016732 Bacteria 6700763
1084 2889790744 2889790730 Bacteria 5689708
1085 2889915128 2889914905 Bacteria 5702301
1086 2894236834 2894232714 Bacteria 8834183
1087 2894656838 2894652903 Bacteria 4587256
1088 2894821315 2894817345 Bacteria 4892941
1089 2896391298 2896384573 Bacteria 7700774
1090 2899793443 2899792073 Bacteria 4926588
1091 2899847644 2899845264 Bacteria 5672268
1092 2903451963 2903448605 Bacteria 7357801
1093 2903499085 2903492973 Bacteria 13473544
1094 2903500236 2903492973 Bacteria 13473544
1095 2903520302 2903513507 Bacteria 6344008
1096 2903523784 2903521522 Bacteria 6525694
1097 2903534355 2903528002 Bacteria 6586099
1098 2903543672 2903540706 Bacteria 7062119
1099 2904477225 2904474040 Bacteria 5504324
1100 2904582474 2904578770 Bacteria 5302906
1101 2904664138 2904659560 Bacteria 6685615
1102 2906313869 2906308376 Bacteria 6841989
1103 2906326578 2906321335 Bacteria 6579571
1104 2906334846 2906328253 Bacteria 6585166
1105 2906361767 2906354277 Bacteria 6991324
1106 2906370587 2906363423 Bacteria 6856682
1107 2906377254 2906370794 Bacteria 6881062
1108 2906378624 2906378014 Bacteria 6911440
1109 2906397990 2906393657 Bacteria 6790866
1110 2906403551 2906401398 Bacteria 6693206
1111 2906410357 2906408224 Bacteria 6162342
1112 2906420613 2906414383 Bacteria 6580790
1113 2906432880 2906427513 Bacteria 6375796
1114 2908673145 2908669403 Bacteria 5740494
1115 2909043879 2909042592 Bacteria 6499737
1116 2913301710 2913295892 Bacteria 6333755
1117 2913309602 2913308742 Bacteria 5350706
1118 2915651048 2915650412 Bacteria 4288180
1119 2915981222 2915980308 Bacteria 6624279
1120 2915992233 2915986958 Bacteria 6739310
1121 2915998593 2915993759 Bacteria 7016183
1122 2916005669 2916000859 Bacteria 6865702
1123 2916013523 2916007675 Bacteria 6898660
1124 2916021438 2916014648 Bacteria 6946486
1125 2916026840 2916021584 Bacteria 6854472
1126 2916033036 2916028427 Bacteria 6748433
1127 2916039279 2916035215 Bacteria 6755766
1128 2916046500 2916041962 Bacteria 6820487
1129 2916050504 2916048683 Bacteria 6543552
1130 2916055951 2916055098 Bacteria 6758838
1131 2916062083 2916061851 Bacteria 6737736
1132 2916070755 2916068649 Bacteria 6943657
1133 2916082653 2916076590 Bacteria 6596108
1134 2917556392 2917554339 Bacteria 4987857
1135 2919103463 2919100787 Bacteria 7710546
1136 2919119151 2919114240 Bacteria 5700270
1137 2919123953 2919119836 Bacteria 5208557
1138 2919153392 2919150387 Bacteria 5500879
1139 2919170185 2919166419 Bacteria 4952238
1140 2919413120 2919408235 Bacteria 6149349
1141 2920761099 2920760137 Bacteria 7427611
1142 2920825722 2920822456 Bacteria 6897201
1143 2921204232 2921201388 Bacteria 6926299
1144 2921210305 2921208531 Bacteria 6745326
1145 2921239341 2921237296 Bacteria 6876710
1146 2921249951 2921244191 Bacteria 6568419
1147 2921251728 2921250672 Bacteria 6677771
1148 2921258882 2921257292 Bacteria 6808382
1149 2921270254 2921263974 Bacteria 6864552
1150 2921287217 2921282425 Bacteria 6826397
1151 2921292025 2921289301 Bacteria 7316391
1152 2921302383 2921296804 Bacteria 7176999
1153 2922138307 2922130491 Bacteria 7173936
1154 2922153102 2922151315 Bacteria 6902399
1155 2922165361 2922158528 Bacteria 6573167
1156 2922178035 2922172374 Bacteria 6167644
1157 2922184152 2922178524 Bacteria 6025201
1158 2922194028 2922185730 Bacteria 7113964
1159 2923556728 2923556063 Bacteria 6793593
1160 2924144924 2924144063 Bacteria 6883928
1161 2924156115 2924150972 Bacteria 7169444
1162 2924159968 2924158325 Bacteria 7188855
1163 2924169480 2924165586 Bacteria 7260590
1164 2924173545 2924172951 Bacteria 6749356
1165 2924183367 2924179722 Bacteria 6843264
1166 2924193172 2924186466 Bacteria 6876637
1167 2924195095 2924193448 Bacteria 6955718
1168 2924201593 2924200457 Bacteria 6757188
1169 2924208206 2924207177 Bacteria 6917007
1170 2924216930 2924214083 Bacteria 7080103
1171 2924227452 2924221636 Bacteria 7113495
1172 2924235221 2924228884 Bacteria 6633132
1173 2924716816 2924710171 Bacteria 6752351
1174 2924726398 2924718760 Bacteria 6331356
1175 2924727946 2924726620 Bacteria 6271473
1176 2924737033 2924733363 Bacteria 7574837
1177 2924746336 2924741084 Bacteria 6661321
1178 2924756723 2924754689 Bacteria 6774424
1179 2924764992 2924762789 Bacteria 6561353
1180 2924781150 2924776078 Bacteria 7492003
1181 2924791589 2924784321 Bacteria 7416538
1182 2926759180 2926754445 Bacteria 5964435
1183 2926763394 2926760298 Bacteria 5505990
1184 2927144018 2927143783 Bacteria 5504251
1185 2928524811 2928521798 Bacteria 4960112
1186 2929138670 2929138655 Bacteria 5810547
1187 2933010033 2933006813 Bacteria 4912075
1188 2933011518 2933011516 Bacteria 5439334
1189 2933017614 2933016740 Bacteria 6355406
1190 2933576488 2933570622 Bacteria 7023390
1191 2933591783 2933586486 Bacteria 7667493
1192 2933595994 2933594066 Bacteria 5594265
1193 2933602598 2933599457 Bacteria 5858799
1194 2935898250 2935894831 Bacteria 6620579
1195 2935905752 2935901341 Bacteria 7341747
1196 2936370190 2936367885 Bacteria 7324495
1197 2936377862 2936375103 Bacteria 6652732
1198 2936384150 2936381700 Bacteria 7006523
1199 2937001224 2936996657 Bacteria 6298727
1200 2937003934 2937002841 Bacteria 6934057
1201 2937010756 2937009748 Bacteria 6746052
1202 2937021795 2937016420 Bacteria 6782579
1203 2937027411 2937023124 Bacteria 6815156
1204 2937035710 2937029754 Bacteria 6424026
1205 2937039373 2937036028 Bacteria 6846469
1206 2937042930 2937042894 Bacteria 6741576
1207 2937050361 2937049772 Bacteria 6757901
1208 2937062850 2937056579 Bacteria 7107896
1209 2937064569 2937063883 Bacteria 7199456
1210 2937073262 2937071275 Bacteria 6984483
1211 2937080772 2937078374 Bacteria 6610289
1212 2937085374 2937084907 Bacteria 6618516
1213 2937098124 2937091812 Bacteria 6979387
1214 2937105570 2937098957 Bacteria 7249374
1215 2937110904 2937106411 Bacteria 6947143
1216 2937117604 2937113482 Bacteria 6505872
1217 2937124435 2937119839 Bacteria 6597547
1218 2937131493 2937126314 Bacteria 6771275
1219 2937819825 2937813078 Bacteria 7783518
1220 2937824323 2937822353 Bacteria 7290551
1221 2937840483 2937836603 Bacteria 6811263
1222 2937854941 2937848649 Bacteria 6983481
1223 2937866658 2937861824 Bacteria 6660327
1224 2937870345 2937868953 Bacteria 6639878
1225 2937877574 2937877337 Bacteria 7246526
1226 2937894248 2937891427 Bacteria 6357007
1227 2937975343 2937972304 Bacteria 7532020
1228 2937981607 2937980651 Bacteria 6517427
1229 2937997521 2937994558 Bacteria 7036190
1230 2938021671 2938014810 Bacteria 6700592
1231 2939605381 2939602548 Bacteria 4950493
1232 2939673710 2939669807 Bacteria 5028511
1233 2941504507 2941499720 Bacteria 7599444
1234 2954011230 2954011201 Bacteria 4762601
1235 2957380615 2957375807 Bacteria 6425588
1236 2957382593 2957382221 Bacteria 6737050
1237 2957389429 2957388812 Bacteria 6778072
1238 2957401973 2957395598 Bacteria 6822399
1239 2957408395 2957402308 Bacteria 6741770
1240 2957410150 2957408893 Bacteria 6558585
1241 2957420039 2957415311 Bacteria 6991633
1242 2957424793 2957422303 Bacteria 7172205
1243 2957433654 2957430029 Bacteria 7022557
1244 2957437525 2957437181 Bacteria 6568994
1245 2957450647 2957443900 Bacteria 6869977
1246 2957452240 2957450854 Bacteria 6765715
1247 2957462656 2957457609 Bacteria 6967680
1248 2957465611 2957464669 Bacteria 6568877
1249 2957475715 2957471148 Bacteria 6797643
1250 2957478983 2957478035 Bacteria 6756658
1251 2957488882 2957484790 Bacteria 6703082
1252 2957497915 2957491536 Bacteria 6695180
1253 2957501767 2957498199 Bacteria 7126688
1254 2957509920 2957505466 Bacteria 7253085
1255 2958035533 2958034702 Bacteria 6989922
1256 2958043720 2958041894 Bacteria 13082850
1257 2958052539 2958041894 Bacteria 13082850
1258 2958066917 2958064165 Bacteria 7158582
1259 2958071392 2958071322 Bacteria 6815895
1260 2958084682 2958084443 Bacteria 7312792
1261 2958096630 2958092219 Bacteria 6861151
1262 2958101872 2958100919 Bacteria 6800575
1263 2958110322 2958108152 Bacteria 6681128
1264 2958119461 2958115193 Bacteria 6923548
1265 2958127135 2958122699 Bacteria 7280457
1266 2958135449 2958130278 Bacteria 6897202
1267 2958150398 2958144490 Bacteria 6677056
1268 2958161333 2958158011 Bacteria 6058449
1269 2958167994 2958165035 Bacteria 6906348
1270 2958177415 2958172287 Bacteria 6716688
1271 2958184478 2958179912 Bacteria 6874908
1272 2960590583 2960584000 Bacteria 6864594
1273 2960591885 2960591022 Bacteria 6622873
1274 2960602031 2960597568 Bacteria 6550735
1275 2960607908 2960603979 Bacteria 6898737
1276 2960614790 2960610863 Bacteria 6691244
1277 2960618073 2960617483 Bacteria 6727748
1278 2960630024 2960624210 Bacteria 6875384
1279 2960633906 2960631154 Bacteria 6732508
1280 2960642603 2960637947 Bacteria 7296468
1281 2960651188 2960645483 Bacteria 7211087
1282 2960659469 2960652885 Bacteria 7083688
1283 2960667202 2960660292 Bacteria 7041660
1284 2960669932 2960667422 Bacteria 6763020
1285 2960675287 2960674078 Bacteria 6609048
1286 2960680729 2960680706 Bacteria 6624464
1287 2960688671 2960687367 Bacteria 6535474
1288 2960696512 2960693952 Bacteria 6749742
1289 2961082533 2961077736 Bacteria 7079850
1290 2961118722 2961114664 Bacteria 6680456
1291 2961132463 2961127735 Bacteria 7196641
1292 2961139302 2961136820 Bacteria 6775228
1293 2961166460 2961163497 Bacteria 6901077
1294 2961176618 2961170736 Bacteria 7072258
1295 2961185623 2961183825 Bacteria 6688536
1296 2963648267 2963644680 Bacteria 6530403
1297 2964614879 2964607997 Bacteria 7101408
1298 2964617099 2964615318 Bacteria 6809089
1299 2964627196 2964621998 Bacteria 6834995
1300 2964630389 2964628898 Bacteria 7083044
1301 2964637710 2964636051 Bacteria 7091832
1302 2964646325 2964643177 Bacteria 6820887
1303 2964651173 2964649959 Bacteria 6675118
1304 2964663289 2964656573 Bacteria 7100150
1305 2964666285 2964663802 Bacteria 7019362
1306 2964672664 2964670856 Bacteria 6851364
1307 2964682453 2964678106 Bacteria 6792020
1308 2964689375 2964685014 Bacteria 6839111
1309 2964693915 2964691889 Bacteria 6802758
1310 2964704777 2964698721 Bacteria 6765331
1311 2964706424 2964705432 Bacteria 7114648
1312 2964716461 2964712639 Bacteria 6695970
1313 2964725738 2964719344 Bacteria 7286602
1314 2965021280 2965018300 Bacteria 6883036
1315 2965029605 2965025482 Bacteria 6532201
1316 2965038414 2965032056 Bacteria 6887443
1317 2965043753 2965040258 Bacteria 6855979
1318 2965064279 2965062239 Bacteria 7412989
1319 2965090560 2965089291 Bacteria 6866420
1320 2965107386 2965102966 Bacteria 6800987
1321 2965113533 2965110997 Bacteria 6693150
1322 2965121413 2965119406 Bacteria 6956431
1323 2967668423 2967664464 Bacteria 6948836
1324 2967676207 2967671571 Bacteria 7021409
1325 2967685898 2967678726 Bacteria 7264382
1326 2967691001 2967686174 Bacteria 6678622
1327 2967698984 2967693043 Bacteria 6804451
1328 2967704340 2967699805 Bacteria 6854538
1329 2967711601 2967706974 Bacteria 7186053
1330 2967720461 2967714385 Bacteria 7000047
1331 2967724396 2967721400 Bacteria 7073753
1332 2967730999 2967728569 Bacteria 6641507
1333 2967739938 2967735183 Bacteria 6827012
1334 2967744523 2967742019 Bacteria 6794534
1335 2967749382 2967748971 Bacteria 6733771
1336 2967759580 2967755722 Bacteria 6814706
1337 2967767208 2967762386 Bacteria 6923502
1338 2967770500 2967769361 Bacteria 6587838
1339 2967782433 2967775926 Bacteria 6738189
1340 2968001367 2967996073 Bacteria 6787468
1341 2968007420 2968003550 Bacteria 6929263
1342 2968017919 2968016561 Bacteria 7022047
1343 2968087663 2968083720 Bacteria 7351627
1344 2968093895 2968091066 Bacteria 6052692
1345 2968101374 2968097103 Bacteria 6107094
1346 2968115277 2968110612 Bacteria 6814636
1347 2968121897 2968117919 Bacteria 6536078
1348 2968134172 2968128360 Bacteria 6270294
1349 2968142729 2968138860 Bacteria 6605449
1350 2968174864 2968171901 Bacteria 6894245
1351 2970025757 2970019648 Bacteria 7072033
1352 2970027509 2970026789 Bacteria 6785236
1353 2970036058 2970033650 Bacteria 7118744
1354 2970046115 2970040964 Bacteria 6731123
1355 2970048396 2970047711 Bacteria 7088379
1356 2970057258 2970054988 Bacteria 6611507
1357 2970064734 2970061556 Bacteria 7099761
1358 2970071067 2970068827 Bacteria 7123112
1359 2970082493 2970076120 Bacteria 6697332
1360 2970083632 2970082768 Bacteria 6183754
1361 2970094197 2970088815 Bacteria 6933825
1362 2970102144 2970095765 Bacteria 6936963
1363 2970104445 2970102677 Bacteria 6812532
1364 2970115035 2970109326 Bacteria 6863976
1365 2970120633 2970116247 Bacteria 6501857
1366 2970123419 2970122695 Bacteria 6625855
1367 2970135925 2970129317 Bacteria 6806560
1368 2970140850 2970136068 Bacteria 7207982
1369 2970144806 2970143518 Bacteria 6446480
1370 2970154926 2970149975 Bacteria 6779706
1371 2970161342 2970156795 Bacteria 7168044
1372 2970168349 2970164137 Bacteria 6861252
1373 2970173880 2970170962 Bacteria 6876229
1374 2970181033 2970177841 Bacteria 6768001
1375 2970184972 2970184632 Bacteria 7054431
1376 2970196075 2970191845 Bacteria 7032787
1377 2970471906 2970469710 Bacteria 6969209
1378 2970492695 2970489779 Bacteria 6517260
1379 2970509289 2970503327 Bacteria 7099517
1380 2970513065 2970510686 Bacteria 7006402
1381 2970529723 2970524798 Bacteria 6840927
1382 2970545327 2970540015 Bacteria 6977556
1383 2970549392 2970547951 Bacteria 6931819
1384 2970557934 2970554993 Bacteria 6814252
1385 2970593989 2970593180 Bacteria 7073582
1386 2970620327 2970619444 Bacteria 6986144
1387 2970631339 2970627176 Bacteria 6680862
1388 2977519385 2977516862 Bacteria 6940108
1389 2977530476 2977523885 Bacteria 6960446
1390 2977536319 2977530762 Bacteria 6951399
1391 2977543263 2977537788 Bacteria 6929320
1392 2977546458 2977544691 Bacteria 6875412
1393 2977553099 2977551784 Bacteria 7125765
1394 2977565217 2977558990 Bacteria 6863948
1395 2977567022 2977565890 Bacteria 6901543
1396 2977574372 2977572785 Bacteria 6763888
1397 2977585872 2977579622 Bacteria 6772100
1398 2977824578 2977821940 Bacteria 6906439
1399 2977831351 2977828996 Bacteria 7007971
1400 2977845546 2977843712 Bacteria 6753583
1401 2977864694 2977858184 Bacteria 6215359
1402 2977866551 2977864932 Bacteria 7534097
1403 2977874770 2977872689 Bacteria 7270173
1404 2977904808 2977898635 Bacteria 6675551
1405 2977913177 2977907340 Bacteria 6577984
1406 2977916355 2977915119 Bacteria 6829656
1407 2977929388 2977922695 Bacteria 6956781
1408 2977940154 2977935797 Bacteria 6252826
1409 2977950632 2977942078 Bacteria 7570577
1410 2977951457 2977950692 Bacteria 6893264
1411 2977963069 2977957713 Bacteria 6877875
1412 2977978364 2977971508 Bacteria 7472917
1413 2977987596 2977986579 Bacteria 6581278
1414 2978970187 2978969890 Bacteria 5400756
1415 2979091573 2979089926 Bacteria 5670289
1416 2979097094 2979095461 Bacteria 5669583
1417 2979717195 2979710463 Bacteria 6785254
1418 2979750779 2979742915 Bacteria 7301278
1419 2979770021 2979764755 Bacteria 6610066
1420 2979778464 2979772303 Bacteria 6618277
1421 2979782976 2979779861 Bacteria 6219781
1422 2979799555 2979793036 Bacteria 6808957
1423 2979813968 2979808191 Bacteria 7179355
1424 2984587214 2984587000 Bacteria 5263363
1425 2987641146 2987636660 Bacteria 8088555
1426 2987652061 2987645492 Bacteria 6117018
1427 2987659187 2987652177 Bacteria 6969023
1428 2987662470 2987659509 Bacteria 6966464
1429 2987667898 2987666974 Bacteria 6509233
1430 2987675014 2987673487 Bacteria 6884027
1431 2989352529 2989349275 Bacteria 6349068
1432 2989773983 2989771324 Bacteria 5605128
1433 2989780771 2989776772 Bacteria 4843317
1434 2996347779 2996341866 Bacteria 6643098
1435 2996350835 2996348954 Bacteria 7239054
1436 2996392996 2996386984 Bacteria 6978667
1437 2996888650 2996887358 Bacteria 5795980
1438 2996896961 2996893221 Bacteria 5823108
1439 3000138562 3000135777 Bacteria 6891109
1440 3000139733 3000135777 Bacteria 6891109
1441 3002145481 3002141150 Bacteria 5254435
1442 3003935539 3003930520 Bacteria 5667563
1443 3004169505 3004167301 Bacteria 8330599
1444 3004191520 3004188549 Bacteria 6952365
1445 3004198594 3004195979 Bacteria 6776956
1446 3004209959 3004203850 Bacteria 7307914
1447 3004211754 3004211236 Bacteria 7417683
1448 3004219001 3004218560 Bacteria 7421728
1449 3004235921 3004232784 Bacteria 6662140
1450 3004245669 3004239961 Bacteria 6892290
1451 3004254023 3004248173 Bacteria 6563236
1452 3004274658 3004268573 Bacteria 7043476
1453 3004277533 3004275668 Bacteria 7114440
1454 3004341093 3004334049 Bacteria 8449246
1455 3005416287 3005409236 Bacteria 7188837
1456 3005421943 3005416602 Bacteria 7064308
1457 3005451458 3005445848 Bacteria 6906074
1458 3005456761 3005452660 Bacteria 5889319
1459 637074002 637000159 Bacteria 7596297
1460 639651715 639633055 Bacteria 7751309
1461 643826744 643692032 Bacteria 6891900
1462 648738782 648276728 Bacteria 6968865
1463 649874008 649633066 Bacteria 6690028
1464 650842843 650716007 Bacteria 5573770
1465 8002287276 8002285264 Bacteria 6717907
1466 8003574443 8003570095 Bacteria 5747666
1467 8003994521 8003992118 Bacteria 7266902
1468 8004002216 8003999396 Bacteria 7063185
1469 8004307448 8004300914 Bacteria 6132239
1470 8004320804 8004312739 Bacteria 7444653
1471 8004369132 8004361976 Bacteria 6858373
1472 8004377018 8004374579 Bacteria 6898112
1473 8004393338 8004387939 Bacteria 7049250
1474 8004446339 8004445564 Bacteria 6322258
1475 8004633320 8004633249 Bacteria 6723080
1476 8004644320 8004640170 Bacteria 6723001
1477 8004698225 8004695233 Bacteria 6731676
1478 8004707045 8004703790 Bacteria 8006957
1479 8004720125 8004714634 Bacteria 6776161
1480 8004734272 8004727605 Bacteria 6643904
1481 8005250597 8005246636 Bacteria 4933972
1482 8005264418 8005258706 Bacteria 6184835
1483 8005277155 8005275841 Bacteria 6929066
1484 8005287841 8005282627 Bacteria 6675747
1485 8005290653 8005289223 Bacteria 6634003
1486 8005305025 8005301065 Bacteria 6614431
1487 8005313120 8005307578 Bacteria 7395396
1488 8005321225 8005314921 Bacteria 7072929
1489 8005323177 8005321885 Bacteria 5795980
1490 8005381871 8005376324 Bacteria 6590079
1491 8005388479 8005382845 Bacteria 6732062
1492 8005397645 8005395548 Bacteria 6806915
1493 8005436996 8005430974 Bacteria 6689030
1494 8005466801 8005460587 Bacteria 7157962
1495 8005490034 8005484373 Bacteria 6297373
1496 8005503072 8005497431 Bacteria 6477605
1497 8005547732 8005542996 Bacteria 7077758
1498 8005562113 8005556819 Bacteria 6908598
1499 8005567131 8005563573 Bacteria 7153261
1500 8005576298 8005570704 Bacteria 6957481
1501 8005625591 8005619151 Bacteria 7030230
1502 8005630614 8005626139 Bacteria 6534237
1503 8005650910 8005645114 Bacteria 6950293
1504 8005674990 8005668836 Bacteria 6953162
1505 8005688170 8005682033 Bacteria 6726518
1506 8005689431 8005688590 Bacteria 6610080
1507 8005701933 8005695170 Bacteria 6912330
1508 8016738591 8016733728 Bacteria 5274317
1509 8018130455 8018127388 Bacteria 7351159
1510 8018165904 8018163183 Bacteria 7277977
1511 8018182230 8018176218 Bacteria 6896178
1512 8019500238 8019499862 Bacteria 5169538
1513 8023682367 8023680758 Bacteria 7729763
1514 8024484155 8024479707 Bacteria 6954785
1515 8024492855 8024486573 Bacteria 6540512
1516 8024505581 8024501048 Bacteria 6427847
1517 8046773915 8046767195 Bacteria 7547379
1518 8049295688 8049293176 Bacteria 6128433
1519 8054560445 8054558443 Bacteria 5204801
1520 8055622683 8055617313 Bacteria 7548464
1521 8056375187 8056375014 Bacteria 7006639
1522 8056383516 8056382006 Bacteria 6408074
1523 8057576258 8057575449 Bacteria 7367519
1524 8057878337 8057874678 Bacteria 7494653
1525 Ga0207675_100026208
1526 SwRhRL2b_contig_999527
1527 JGI25155J39150_1000015
1528 JGI25156J39149_1000007
1529 JGI25156J39149_1009617
1530 JGI25162J39368_1000009
1531 JGI25162J39368_1000119
1532 JGI25162J39368_1000489
1533 JGI25154J39366_1000145
1534 JGI25158J39367_1000094
1535 JGI25157J39369_1000012
1536 JGI25157J39369_1003024
1537 JGI25163J39215_1000765
1538 JGI25164J39214_1000002
1539 JGI25152J39213_1002953
1540 JGI25152J39213_1013083
1541 JGI25152J39213_1015131
1542 JGI25152J39213_1016662
1543 JGI25150J39212_1000103
1544 JGI25150J39212_1006873
1545 JGI25150J39212_1014069
1546 JGI25159J45721_1001078
1547 JGI25159J45721_1003115
1548 JGI25151J46595_10000085
1549 JGI25151J46595_10001194
1550 JGI25151J46595_10014672
1551 JGI25165J46597_1000206
1552 JGI25165J46597_1000211
1553 JGI25165J46597_1001070
1554 JGI25165J46597_1004826
1555 JGI25153J46596_10000103
1556 JGI25153J46596_10001488
1557 JGI25153J46596_10005550
1558 JGI25153J46596_10009848
1559 JGI25153J46596_10022279
1560 JGI25153J46596_10037724
1561 JGI25153J46596_10037747
1562 JGI25160J50197_1000023
1563 JGI25160J50197_1000033
1564 JGI25160J50197_1000726
1565 JGI25160J50197_1001657
1566 JGI25161J50226_1000012
1567 JGI25161J50226_1000508
1568 JGI25161J50226_1001989
1569 JGI25161J50226_1004573
1570 Ga0006562J51391_1050521
1571 Ga0055538_1000015
1572 Ga0055539_1000009
1573 Ga0055533_1000012
1574 Ga0055525_1000014
1575 Ga0055542_1000947
1576 Ga0055542_1001298
1577 Ga0055529_1005284
1578 Ga0055526_1002294
1579 Ga0055526_1008324
1580 Ga0055526_1016818
1581 Ga0055526_1016912
1582 Ga0055526_1017729
1583 Ga0055526_1028335
1584 Ga0055524_1003993
1585 Ga0055524_1007275
1586 Ga0055524_1014578
1587 Ga0055524_1023454
1588 Ga0055536_1012578
1589 Ga0055528_1000519
1590 Ga0055528_1004148
1591 Ga0055528_1014232
1592 Ga0055528_1027463
1593 Ga0055528_1031970
1594 Ga0055530_10022847
1595 Ga0055540_1000050
1596 Ga0055540_1005332
1597 Ga0055540_1012166
1598 Ga0055540_1022297
1599 Ga0055531_10016516
1600 Ga0055531_10017593
1601 Ga0055541_1000006
1602 Ga0058692_1008266
1603 Ga0058692_1017728
1604 Ga0055543_1000009
1605 Ga0055543_1000021
1606 Ga0055543_1000315
1607 Ga0055543_1003043
1608 Ga0065165_1000064
1609 Ga0065165_1000513
1610 Ga0065165_1005453
1611 Ga0065165_1006135
1612 Ga0065165_1008941
1613 Ga0065165_1047904
1614 Ga0065704_10000959
1615 Ga0065715_10033325
1616 Ga0065707_10026737
1617 Ga0070670_100000287
1618 Ga0068868_100250245
1619 Ga0070660_100128224
1620 Ga0070668_100127067
1621 Ga0070669_100010155
1622 Ga0070671_100380979
1623 Ga0070674_100001722
1624 Ga0070667_100442686
1625 Ga0070711_100205272
1626 Ga0068867_100270193
1627 Ga0070707_100007996
1628 Ga0070698_100496819
1629 Ga0070699_100241157
1630 Ga0068853_100357110
1631 Ga0070696_100073348
1632 Ga0070696_100341458
1633 Ga0070665_100105349
1634 Ga0070665_100177473
1635 Ga0070665_100263818
1636 Ga0070665_100483833
1637 Ga0070665_100511960
1638 Ga0068857_100169903
1639 Ga0068854_100067701
1640 Ga0068856_100022838
1641 Ga0068856_100485317
1642 Ga0068852_100237316
1643 Ga0068861_100327653
1644 Ga0068851_10135295
1645 Ga0068862_100090252
1646 Ga0068862_100157312
1647 Ga0081455_10035366
1648 Ga0081455_10124862
1649 Ga0081538_10002181
1650 Ga0081538_10015390
1651 Ga0081540_1041947
1652 Ga0081540_1071406
1653 Ga0081539_10010083
1654 Ga0075365_10010840
1655 Ga0075365_10190182
1656 Ga0075365_10303480
1657 Ga0075368_10088341
1658 Ga0075363_100129012
1659 Ga0075363_100272121
1660 Ga0075364_10013563
1661 Ga0075364_10096538
1662 Ga0075364_10326887
1663 Ga0075367_10021014
1664 Ga0075369_10007134
1665 Ga0075369_10035944
1666 Ga0075366_10003448
1667 Ga0075366_10151175
1668 Ga0075370_10003108
1669 Ga0075370_10070369
1670 Ga0068865_100362889
1671 Ga0068865_100577500
1672 Ga0079104_1001270
1673 Ga0079104_1024320
1674 Ga0099826_10000181
1675 Ga0099826_10035342
1676 Ga0105251_10030323
1677 Ga0105251_10055843
1678 Ga0105244_10001340
1679 Ga0105244_10001791
1680 Ga0105244_10014154
1681 Ga0105244_10122047
1682 Ga0105250_10004385
1683 Ga0105240_10000217
1684 Ga0105240_10330935
1685 Ga0105240_10542647
1686 Ga0111539_10000123
1687 Ga0105245_10346920
1688 Ga0105245_10601596
1689 Ga0105245_10933278
1690 Ga0105243_10032808
1691 Ga0105243_10293898
1692 Ga0105243_10410444
1693 Ga0105241_10032823
1694 Ga0105241_10560250
1695 Ga0105248_10046083
1696 Ga0105248_10736661
1697 Ga0105237_10001458
1698 Ga0105237_10023149
1699 Ga0105237_10283541
1700 Ga0105238_10014472
1701 Ga0105238_10377350
1702 Ga0105238_10823791
1703 Ga0105249_10239161
1704 Ga0105249_10353592
1705 Ga0123341_1000109
1706 Ga0123342_1014735
1707 Ga0105239_10001164
1708 Ga0105239_10078102
1709 Ga0105239_10230990
1710 Ga0105239_10440443
1711 Ga0105239_10475843
1712 Ga0105246_10010396
1713 Ga0105246_10097688
1714 Ga0157373_10004331
1715 Ga0157373_10030840
1716 Ga0157373_10240529
1717 Ga0157371_10000002
1718 Ga0157371_10001454
1719 Ga0157370_10001439
1720 Ga0157370_10001923
1721 Ga0157369_10107178
1722 Ga0171463_1007
1723 Ga0157374_10469475
1724 Ga0182008_10100750
1725 Ga0182007_10000324
1726 Ga0182005_1001504
1727 Ga0183363_1153
1728 Ga0214544_1000010
1729 Ga0214542_1000023
1730 Ga0214542_1018351
1731 Ga0214543_1000019
1732 Ga0214543_1001578
1733 Ga0213872_10002824
1734 Ga0213872_10009103
1735 Ga0228711_1000017
1736 Ga0228710_1000005
1737 Ga0209435_100006
1738 Ga0209760_100051
1739 Ga0209436_101959
1740 Ga0209436_109923
1741 Ga0209784_100001
1742 Ga0209566_100001
1743 Ga0209674_100002
1744 Ga0209563_100002
1745 Ga0207427_100020
1746 Ga0209437_100001
1747 Ga0209437_100042
1748 Ga0209437_100062
1749 Ga0207425_1000065
1750 Ga0207425_1008594
1751 Ga0207425_1009532
1752 Ga0209646_1000015
1753 Ga0209646_1003792
1754 Ga0209026_1000046
1755 Ga0209026_1000050
1756 Ga0209677_100002
1757 Ga0209677_100429
1758 Ga0209148_1000050
1759 Ga0209759_1000005
1760 Ga0209759_1000229
1761 Ga0209129_1000019
1762 Ga0209129_1000132
1763 Ga0209129_1001521
1764 Ga0209129_1002872
1765 Ga0209129_1004004
1766 Ga0209129_1006071
1767 Ga0209129_1010911
1768 Ga0209233_1000034
1769 Ga0209233_1000082
1770 Ga0209233_1000103
1771 Ga0209233_1000288
1772 Ga0209233_1005432
1773 Ga0209455_1000507
1774 Ga0209673_1000023
1775 Ga0209673_1000132
1776 Ga0209673_1001968
1777 Ga0209673_1002729
1778 Ga0209673_1002876
1779 Ga0209673_1003829
1780 Ga0209130_1000001
1781 Ga0209130_1000017
1782 Ga0209130_1000048
1783 Ga0209130_1001748
1784 Ga0209130_1010463
1785 Ga0209130_1015688
1786 Ga0209676_1021257
1787 Ga0209025_1000072
1788 Ga0209025_1000077
1789 Ga0209025_1000153
1790 Ga0209025_1000247
1791 Ga0209025_1000666
1792 Ga0209025_1002519
1793 Ga0209025_1005892
1794 Ga0209025_1019188
1795 Ga0209025_1019195
1796 Ga0209025_1049715
1797 Ga0209564_1000100
1798 Ga0209564_1000372
1799 Ga0209564_1001437
1800 Ga0209564_1002441
1801 Ga0209564_1011402
1802 Ga0209564_1034239
1803 Ga0209758_1000053
1804 Ga0209758_1000212
1805 Ga0209758_1000239
1806 Ga0209758_1000712
1807 Ga0209758_1002011
1808 Ga0209758_1002735
1809 Ga0209758_1004308
1810 Ga0209758_1005005
1811 Ga0209758_1014984
1812 Ga0209758_1022928
1813 Ga0209758_1030212
1814 Ga0209758_1034485
1815 Ga0209758_1049788
1816 Ga0209050_1002669
1817 Ga0209050_1006906
1818 Ga0209050_1009761
1819 Ga0209256_1000401
1820 Ga0209256_1000458
1821 Ga0209256_1000735
1822 Ga0209256_1000818
1823 Ga0209256_1002923
1824 Ga0209256_1003989
1825 Ga0207426_1000005
1826 Ga0207426_1000006
1827 Ga0207426_1000035
1828 Ga0207426_1000136
1829 Ga0207426_1000141
1830 Ga0207426_1028627
1831 Ga0209051_1000062
1832 Ga0209051_1003152
1833 Ga0209051_1005006
1834 Ga0209051_1035479
1835 Ga0209257_1001119
1836 Ga0209257_1010746
1837 Ga0207696_1000076
1838 Ga0207696_1000396
1839 Ga0207655_1000413
1840 Ga0207655_1014385
1841 Ga0207655_1071084
1842 Ga0207713_1038463
1843 Ga0207680_10246153
1844 Ga0207647_10081824
1845 Ga0207645_10056949
1846 Ga0207695_10000613
1847 Ga0207695_10011879
1848 Ga0207671_10001160
1849 Ga0207671_10088960
1850 Ga0207657_10054577
1851 Ga0207646_10047164
1852 Ga0207694_10032771
1853 Ga0207650_10001289
1854 Ga0207700_10206085
1855 Ga0207709_10036345
1856 Ga0207669_10006701
1857 Ga0207704_10346230
1858 Ga0207691_10187455
1859 Ga0207711_10334835
1860 Ga0207712_10181007
1861 Ga0207668_10106081
1862 Ga0207668_10510421
1863 Ga0207678_10159191
1864 Ga0207708_10110635
1865 Ga0207702_10014348
1866 Ga0207702_10487839
1867 Ga0207648_10236538
1868 Ga0207648_10613942
1869 Ga0207674_10432554
1870 Ga0207675_100122019
1871 Ga0207683_10039107
1872 Ga0207683_10198925
1873 Ga0207698_10084832
1874 Ga0209281_1000082
1875 Ga0209281_1001229
1876 Ga0209371_1004328
1877 Ga0209371_1004561
1878 Ga0209371_1004841
1879 Ga0209282_1000006
1880 Ga0209282_1000176
1881 Ga0209282_1036197
1882 Ga0207428_10000133
1883 Ga0268266_10005342
1884 Ga0268266_10127196
1885 Ga0268266_10190337
1886 Ga0268266_10198257
1887 Ga0268266_10240919
1888 Ga0268266_10361384
1889 Ga0268265_10171350
1890 Ga0268265_10392935
1891 Ga0307517_10207732
1892 Ga0307515_10002150
1893 Ga0307515_10033865
1894 Ga0307515_10168799
1895 Ga0268256_1003641
1896 Ga0268256_1003966
1897 Ga0268256_1004619
1898 Ga0268256_1015885
1899 Ga0316181_1067070
1900 Ga0265330_10046801
1901 Ga0307513_10000463
1902 Ga0307513_10028096
1903 Ga0307513_10166943
1904 Ga0307513_10185890
1905 Ga0307513_10355592
1906 Ga0307508_10081823
1907 Ga0307508_10210604
1908 Ga0307508_10335188
1909 Ga0265314_10018857
1910 Ga0307413_10050395
1911 Ga0307410_10203197
1912 Ga0307412_10019356
1913 Ga0307412_10286358
1914 Ga0315914_1000003
1915 Ga0307409_100033770
1916 Ga0307409_100116671
1917 Ga0307409_100653424
1918 Ga0307416_100202641
1919 Ga0307414_10365263
1920 Ga0307411_10060082
1921 Ga0315913_1000001
1922 Ga0315915_1000008
1923 Ga0373927_0000266
1924 Ga0373947_0133152
1925 Ga0373937_0593115
1926 Ga0373925_0001672
1927 Ga0373925_0060324
1928 Ga0395900_0018190
1929 Ga0395905_0002837
1930 Ga0395905_0003927
1931 Ga0395905_0048313
1932 Ga0395905_0093038
1933 Ga0395905_0122973
1934 Ga0395901_0108026
1935 Ga0395901_0116451
1936 Ga0400483_065417
1937 Ga0436365_0671760
1938 Ga0436361_0027550
1939 Ga0436361_0034602
1940 Ga0436361_0137889
1941 Ga0436361_0570105
1942 Ga0436363_0274728
1943 Ga0436363_1315970
1944 Ga0439436_0000195
1945 Ga0439447_048680
1946 Ga0439465_0075847
1947 Ga0439465_0142491
1948 Ga0451835_0331121
1949 Ga0451839_0268492
1950 Ga0451845_0189427
1951 Ga0451847_0010441
1952 Ga0451843_0065299
1953 Ga0451853_2758235
1954 Ga0439449_0017545
1955 Ga0439455_0022511
1956 Ga0439462_0027122
1957 Ga0439462_0042290
1958 Ga0450906_029307
1959 Ga0466972_0046222
1960 Ga0466972_0084169
1961 Ga0466970_0169294
1962 Ga0466960_0168679
1963 Ga0466959_0052281
1964 Ga0495592_0075679
1965 Ga0495591_000803
1966 Ga0495629_0040880
1967 Ga0495638_0123397
1968 Ga0495638_0210983
1969 Ga0495650_0000043
1970 Ga0495650_0000113
1971 Ga0495605_0099869
1972 Ga0495639_0081012
1973 Ga0495662_0007616
1974 Ga0495584_0002744
1975 Ga0495585_0140841
1976 Ga0495606_0000374
1977 Ga0495606_0001618
1978 Ga0495606_0023645
1979 Ga0495610_0009644
1980 Ga0495616_0116708
1981 Ga0495620_0107319
1982 Ga0495631_0036456
1983 Ga0495631_0077215
1984 Ga0495632_0086599
1985 Ga0495643_0088441
1986 Ga0495644_0001112
1987 Ga0495648_0018790
1988 Ga0495654_0000124
1989 Ga0495654_0000694
1990 Ga0495587_0121886
1991 Ga0495622_0023211
1992 Ga0495633_0005760
1993 Ga0495656_0110939
1994 Ga0495668_0196902
1995 Ga0495625_0082577
1996 Ga0495625_0105065
1997 Ga0495625_0110977
1998 Ga0495625_0371288
1999 Ga0495588_0073614
2000 Ga0495657_0149954
2001 Ga0495649_0158143
2002 Ga0495589_0039901
2003 Ga0495660_0000012
2004 Ga0495660_0000034
2005 Ga0495660_0051547
2006 Ga0495604_0021553
2007 Ga0495674_0451548
2008 Ga0495672_0000029
2009 Ga0495673_0000092
2010 Ga0495681_0002695
2011 Ga0495681_0061718
2012 Ga0495686_0000795
2013 Ga0495615_0040446
2014 Ga0496101_0000023
2015 Ga0496104_0131911
2016 Ga0496105_0294200
2017 Ga0496106_0351713
2018 Ga0496110_0283493
2019 Ga0496111_0123945
2020 Ga0496112_0028761
2021 Ga0496112_0047536
2022 Ga0496112_0622845
2023 Ga0496115_0100983
2024 Ga0496116_0000042
2025 Ga0496116_0000066
2026 Ga0496116_0005820
2027 Ga0496116_0007217
2028 Ga0496116_0009455
2029 Ga0496116_0019687
2030 Ga0496116_0120858
2031 Ga0496117_0000036
2032 Ga0496117_0013982
2033 Ga0496117_0019866
2034 Ga0496117_0026327
2035 Ga0496117_0070372
2036 Ga0496117_0160660
2037 Ga0496118_0012231
2038 Ga0496118_0015347
2039 Ga0496118_0022829
2040 Ga0496118_0041334
2041 Ga0496119_0004655
2042 Ga0496119_0010451
2043 Ga0496119_0011716
2044 Ga0496119_0015192
2045 Ga0496119_0016484
2046 Ga0496119_0028726
2047 Ga0496119_0045882
2048 Ga0496119_0058948
2049 Ga0496120_0000032
2050 Ga0496120_0000777
2051 Ga0496120_0001086
2052 Ga0496120_0001523
2053 Ga0496120_0001949
2054 Ga0496120_0008032
2055 Ga0496120_0008096
2056 Ga0496121_0000001
2057 Ga0496121_0000239
2058 Ga0496121_0002342
2059 Ga0496121_0018876
2060 Ga0496122_0000002
2061 Ga0496122_0000072
2062 Ga0496122_0000110
2063 Ga0496122_0006562
2064 Ga0496122_0022649
2065 Ga0496122_0024700
2066 Ga0496122_0038214
2067 Ga0496122_0055595
2068 Ga0496122_0102534
2069 Ga0496123_0000002
2070 Ga0496123_0000035
2071 Ga0496123_0000081
2072 Ga0496123_0019603
2073 Ga0496123_0131675
2074 Ga0496123_0169793
2075 Ga0496124_0000530
2076 Ga0496124_0003541
2077 Ga0496124_0010305
2078 Ga0496124_0015678
2079 Ga0496124_0018541
2080 Ga0496124_0034006
2081 Ga0496124_0236713
2082 Ga0496124_0265687
2083 Ga0496125_0000001
2084 Ga0496125_0000033
2085 Ga0496125_0032307
2086 Ga0496125_0106619
2087 Ga0496126_0000053
2088 Ga0496126_0001066
2089 Ga0496126_0048035
2090 Ga0496126_0050721
2091 Ga0496126_0061199
2092 Ga0496126_0082583
2093 Ga0496126_0186957
2094 Ga0496126_0241908
2095 Ga0496126_0342842
2096 Ga0495678_001299
2097 Ga0495678_036076
2098 Ga0495682_0000003
2099 Ga0501031_0182755
2100 Ga0501032_0256322
2101 Ga0501034_0001016
2102 Ga0501038_0097401
2103 Ga0501042_0062880
2104 Ga0501043_0159367
2105 Ga0501046_0129194
2106 Ga0501047_0015869
2107 Ga0501067_0081931
2108 Ga0501073_0001099
2109 Ga0501075_0334746
2110 Ga0501080_0022705
2111 Ga0501080_0043791
2112 Ga0501083_0019699
2113 Ga0501035_0112926
2114 Ga0501035_0448403
2115 Ga0501044_0007436
2116 Ga0501044_0017995
2117 Ga0501044_0019019
2118 Ga0501044_0063397
2119 nmdc:mga03n38_21958_c1
2120 nmdc:mga03n38_92522_c1
2121 nmdc:mga00v17_152240_c1
2122 nmdc:mga00v17_18899_c1
2123 nmdc:mga00v17_230_c1
2124 nmdc:mga00v17_24063_c1
2125 nmdc:mga00v17_24964_c1
2126 nmdc:mga0yw44_13281_c2
2127 nmdc:mga0yw44_184551_c1
2128 nmdc:mga0yw44_36719_c1
2129 nmdc:mga0yw44_53094_c1
2130 nmdc:mga06z11_243744_c1
2131 nmdc:mga06z11_67034_c1
2132 nmdc:mga04h51_76042_c1
2133 nmdc:mga07m45_31123_c1
2134 nmdc:mga07m45_50630_c1
2135 nmdc:mga07m45_65030_c1
2136 nmdc:mga05p37_305941_c1
2137 nmdc:mga08y16_44_c1
2138 nmdc:mga0sz30_107108_c1
2139 nmdc:mga0sz30_16417_c1
2140 nmdc:mga0sz30_6234_c1
2141 Ga0500610_0050322
2142 Ga0495619_0058978
2143 Ga0500578_0041834
2144 Ga0500646_0002763
2145 Ga0500651_0086229
2146 Ga0500641_0055833
2147 Ga0500555_026090
2148 Ga0500557_026116
2149 Ga0500594_0033298
2150 Ga0500595_006666
2151 Ga0500621_000006
2152 Ga0500642_0002981
2153 Ga0500658_0001819
2154 Ga0500561_0000110
2155 Ga0500568_0000109
2156 Ga0500568_0021697
2157 Ga0500573_0018384
2158 Ga0500588_0008069
2159 Ga0500588_0049259
2160 Ga0500588_0063539
2161 Ga0500590_000792
2162 Ga0500604_0002453
2163 Ga0500604_0014031
2164 Ga0500616_0001121
2165 Ga0500616_0002733
2166 Ga0500616_0035927
2167 Ga0500616_0039388
2168 Ga0500620_000841
2169 Ga0500622_0002690
2170 Ga0500624_000296
2171 Ga0500627_0098481
2172 Ga0500633_0085069
2173 Ga0500634_0000796
2174 Ga0500634_0010247
2175 Ga0500636_0000026
2176 Ga0500636_0000083
2177 Ga0500611_028575
2178 Ga0500609_000048
2179 Ga0500609_012055
2180 Ga0501084_0218865
2181 Ga0590071_004505
2182 Ga0590075_002537
2183 Ga0590077_010994
2184 Ga0501082_0116708
2185 Ga0501082_0131532
2186 Ga0530510_0214334
2187 2503202144
2188 2508733346
2189 2509107964
2190 2509117071
2191 2509141454
2192 2509370790
2193 2509376860
2194 2509385493
2195 2509396788
2196 2509448466
2197 2510136503
2198 2510304151
2199 2510317575
2200 2510839081
2201 2510900235
2202 2511135646
2203 2511184343
2204 2511197550
2205 2511391245
2206 2511435636
2207 2511502588
2208 2512533957
2209 2512930959
2210 2512958688
2211 2512970284
2212 2513569646
2213 2513576471
2214 2513583219
2215 2513595060
2216 2513601348
2217 2513609730
2218 2513620915
2219 2513635126
2220 2513709794
2221 2513871326
2222 2513881729
2223 2513904873
2224 2513911556
2225 2513929073
2226 2513986639
2227 2513999225
2228 2514003205
2229 2514018772
2230 2514034898
2231 2514421914
2232 2515115074
2233 2515609371
2234 2515633250
2235 2515642476
2236 2515658452
2237 2515741926
2238 2516205991
2239 2516893964
2240 2517041925
2241 2517081044
2242 2517098616
2243 2517410836
2244 2517570678
2245 2520380739
2246 2523468242
2247 2524448216
2248 2524457344
2249 2530644495
2250 2535520002
2251 2537877750
2252 2551675353
2253 2551676763
2254 2551689363
2255 2551695507
2256 2551700998
2257 2551711112
2258 2551722007
2259 2551724378
2260 2551736474
2261 2551739982
2262 2554245787
2263 2558865782
2264 2559296446
2265 2585169049
2266 2585202767
2267 2585221616
2268 2585233303
2269 2585255305
2270 2585270229
2271 2585272721
2272 2585281237
2273 2585327345
2274 2585335301
2275 2585390451
2276 2585395812
2277 2585401686
2278 2585524176
2279 2585536102
2280 2585539212
2281 2585544214
2282 2585557413
2283 2585562389
2284 2585821381
2285 2585829462
2286 2585834827
2287 2585837165
2288 2585842471
2289 2585896829
2290 2585906444
2291 2587981866
2292 2588516644
2293 2597814999
2294 2599334020
2295 2599414714
2296 2599603066
2297 2599717816
2298 2599935530
2299 2600196889
2300 2601610683
2301 2601746987
2302 2616295200
2303 2616310961
2304 2616551887
2305 2617382883
2306 2643804484
2307 2643857039
2308 2643922190
2309 2643989318
2310 2644003366
2311 2644051210
2312 2644065255
2313 2644105548
2314 2644146551
2315 2644152890
2316 2644194443
2317 2644200881
2318 2644210824
2319 2644240821
2320 2644308299
2321 2644334126
2322 2644377664
2323 2644418139
2324 2644451395
2325 2644484114
2326 2644494936
2327 2644497933
2328 2644520572
2329 2644541720
2330 2644615581
2331 2644654358
2332 2644672679
2333 2644691625
2334 2671109943
2335 2671116756
2336 2671693577
2337 2688599505
2338 2692315091
2339 2694628273
2340 2694640870
2341 2719183761
2342 2719388440
2343 2719668060
2344 2719728202
2345 2720494823
2346 2720611145
2347 2720616317
2348 2720629392
2349 2720771963
2350 2721145063
2351 2721155800
2352 2721167150
2353 2721403063
2354 2722838128
2355 2723029393
2356 2723563009
2357 2723570990
2358 2723572800
2359 2724035420
2360 2724042396
2361 2724086783
2362 2724106941
2363 2724107750
2364 2725952224
2365 2730105707
2366 2730161901
2367 2730300907
2368 2738802543
2369 2738944977
2370 2739033659
2371 2739305846
2372 2753463267
2373 2756677219
2374 2758640843
2375 2765468569
2376 2766068382
2377 2770198940
2378 2774872485
2379 2776272851
2380 2776283256
2381 2778175158
2382 2792581604
2383 2792620398
2384 2792625756
2385 2792641827
2386 2792748622
2387 2793281230
2388 2793296422
2389 2793317210
2390 2793324054
2391 2793325642
2392 2793333065
2393 2793340130
2394 2793346237
2395 2793355457
2396 2793357802
2397 2793366540
2398 2802716641
2399 2802725452
2400 2802730456
2401 2802737572
2402 2802743038
2403 2802750462
2404 2805929051
2405 2805937247
2406 2806044842
2407 2806053998
2408 2806059910
2409 2806066037
2410 2806073381
2411 2808990160
2412 2819244924
2413 2819607525
2414 2819643922
2415 2821126607
2416 2821449605
2417 2838019455
2418 2838025081
2419 2838032024
2420 2838039567
2421 2838045955
2422 2838050561
2423 2838062855
2424 2838071803
2425 2838080550
2426 2838667956
2427 2838671489
2428 2838679983
2429 2838684410
2430 2838693562
2431 2838699901
2432 2838704244
2433 2838711814
2434 2838717398
2435 2838721992
2436 2838728148
2437 2838735455
2438 2838739989
2439 2838748357
2440 2839996536
2441 2840770270
2442 2841741108
2443 2841843887
2444 2841850709
2445 2841858421
2446 2841864183
2447 2841869756
2448 2842081877
2449 2842117609
2450 2842122453
2451 2842129514
2452 2842134886
2453 2842143608
2454 2842149138
2455 2842156903
2456 2842162669
2457 2842167040
2458 2842173081
2459 2842180521
2460 2842186173
2461 2842190505
2462 2842195256
2463 2842203281
2464 2842210272
2465 2842214819
2466 2842222260
2467 2842227540
2468 2842236048
2469 2842241226
2470 2842249979
2471 2842253695
2472 2842263275
2473 2842268006
2474 2842278031
2475 2842283726
2476 2842289697
2477 2842295532
2478 2842299100
2479 2842310047
2480 2842311773
2481 2842318998
2482 2842343994
2483 2842358566
2484 2842369694
2485 2842376676
2486 2842381692
2487 2842389001
2488 2842396355
2489 2842407162
2490 2842414054
2491 2842420695
2492 2842425436
2493 2842432169
2494 2842438281
2495 2842443977
2496 2842450151
2497 2842466267
2498 2842472749
2499 2842478756
2500 2842487522
2501 2842491448
2502 2842499516
2503 2842505925
2504 2842511959
2505 2842521070
2506 2842524972
2507 2842875762
2508 2842925700
2509 2844006363
2510 2844014779
2511 2844166464
2512 2844461106
2513 2844537546
2514 2847419848
2515 2847673130
2516 2847689652
2517 2848994865
2518 2850081864
2519 2852394991
2520 2854899983
2521 2854914164
2522 2854921102
2523 2855826685
2524 2855842078
2525 2855877364
2526 2856319837
2527 2856325775
2528 2856329056
2529 2856341621
2530 2856346836
2531 2856351571
2532 2856360916
2533 2856366096
2534 2857352554
2535 2857373068
2536 2857519183
2537 2857536699
2538 2858802753
2539 2869167452
2540 2869175846
2541 2869237262
2542 2869247277
2543 2869250990
2544 2869260570
2545 2869264232
2546 2869271353
2547 2869279393
2548 2869291049
2549 2871433331
2550 2871441477
2551 2871449730
2552 2871453017
2553 2871464452
2554 2871469772
2555 2871478495
2556 2871488220
2557 2871491030
2558 2871498873
2559 2874107880
2560 2874109344
2561 2874118292
2562 2874124905
2563 2874133410
2564 2874145142
2565 2874148726
2566 2874160773
2567 2874166728
2568 2874176129
2569 2876365892
2570 2876377575
2571 2876381931
2572 2876391637
2573 2876397384
2574 2876402590
2575 2876408260
2576 2876418813
2577 2876422175
2578 2876604989
2579 2878035734
2580 2878732984
2581 2878743339
2582 2878750944
2583 2878755439
2584 2878763086
2585 2878770061
2586 2878779542
2587 2878786524
2588 2881147855
2589 2881158933
2590 2881164620
2591 2881848663
2592 2881867316
2593 2882460008
2594 2882634840
2595 2882912412
2596 2885306474
2597 2885316413
2598 2885318994
2599 2885333316
2600 2885335408
2601 2885349103
2602 2885351315
2603 2888340070
2604 2888348474
2605 2888352737
2606 2889014508
2607 2889020506
2608 2889790744
2609 2889915128
2610 2894236834
2611 2894656838
2612 2894821315
2613 2896391298
2614 2899793443
2615 2899847644
2616 2903451963
2617 2903499085
2618 2903500236
2619 2903520302
2620 2903523784
2621 2903534355
2622 2903543672
2623 2904477225
2624 2904582474
2625 2904664138
2626 2906313869
2627 2906326578
2628 2906334846
2629 2906361767
2630 2906370587
2631 2906377254
2632 2906378624
2633 2906397990
2634 2906403551
2635 2906410357
2636 2906420613
2637 2906432880
2638 2908673145
2639 2909043879
2640 2913301710
2641 2913309602
2642 2915651048
2643 2915981222
2644 2915992233
2645 2915998593
2646 2916005669
2647 2916013523
2648 2916021438
2649 2916026840
2650 2916033036
2651 2916039279
2652 2916046500
2653 2916050504
2654 2916055951
2655 2916062083
2656 2916070755
2657 2916082653
2658 2917556392
2659 2919103463
2660 2919119151
2661 2919123953
2662 2919153392
2663 2919170185
2664 2919413120
2665 2920761099
2666 2920825722
2667 2921204232
2668 2921210305
2669 2921239341
2670 2921249951
2671 2921251728
2672 2921258882
2673 2921270254
2674 2921287217
2675 2921292025
2676 2921302383
2677 2922138307
2678 2922153102
2679 2922165361
2680 2922178035
2681 2922184152
2682 2922194028
2683 2923556728
2684 2924144924
2685 2924156115
2686 2924159968
2687 2924169480
2688 2924173545
2689 2924183367
2690 2924193172
2691 2924195095
2692 2924201593
2693 2924208206
2694 2924216930
2695 2924227452
2696 2924235221
2697 2924716816
2698 2924726398
2699 2924727946
2700 2924737033
2701 2924746336
2702 2924756723
2703 2924764992
2704 2924781150
2705 2924791589
2706 2926759180
2707 2926763394
2708 2927144018
2709 2928524811
2710 2929138670
2711 2933010033
2712 2933011518
2713 2933017614
2714 2933576488
2715 2933591783
2716 2933595994
2717 2933602598
2718 2935898250
2719 2935905752
2720 2936370190
2721 2936377862
2722 2936384150
2723 2937001224
2724 2937003934
2725 2937010756
2726 2937021795
2727 2937027411
2728 2937035710
2729 2937039373
2730 2937042930
2731 2937050361
2732 2937062850
2733 2937064569
2734 2937073262
2735 2937080772
2736 2937085374
2737 2937098124
2738 2937105570
2739 2937110904
2740 2937117604
2741 2937124435
2742 2937131493
2743 2937819825
2744 2937824323
2745 2937840483
2746 2937854941
2747 2937866658
2748 2937870345
2749 2937877574
2750 2937894248
2751 2937975343
2752 2937981607
2753 2937997521
2754 2938021671
2755 2939605381
2756 2939673710
2757 2941504507
2758 2954011230
2759 2957380615
2760 2957382593
2761 2957389429
2762 2957401973
2763 2957408395
2764 2957410150
2765 2957420039
2766 2957424793
2767 2957433654
2768 2957437525
2769 2957450647
2770 2957452240
2771 2957462656
2772 2957465611
2773 2957475715
2774 2957478983
2775 2957488882
2776 2957497915
2777 2957501767
2778 2957509920
2779 2958035533
2780 2958043720
2781 2958052539
2782 2958066917
2783 2958071392
2784 2958084682
2785 2958096630
2786 2958101872
2787 2958110322
2788 2958119461
2789 2958127135
2790 2958135449
2791 2958150398
2792 2958161333
2793 2958167994
2794 2958177415
2795 2958184478
2796 2960590583
2797 2960591885
2798 2960602031
2799 2960607908
2800 2960614790
2801 2960618073
2802 2960630024
2803 2960633906
2804 2960642603
2805 2960651188
2806 2960659469
2807 2960667202
2808 2960669932
2809 2960675287
2810 2960680729
2811 2960688671
2812 2960696512
2813 2961082533
2814 2961118722
2815 2961132463
2816 2961139302
2817 2961166460
2818 2961176618
2819 2961185623
2820 2963648267
2821 2964614879
2822 2964617099
2823 2964627196
2824 2964630389
2825 2964637710
2826 2964646325
2827 2964651173
2828 2964663289
2829 2964666285
2830 2964672664
2831 2964682453
2832 2964689375
2833 2964693915
2834 2964704777
2835 2964706424
2836 2964716461
2837 2964725738
2838 2965021280
2839 2965029605
2840 2965038414
2841 2965043753
2842 2965064279
2843 2965090560
2844 2965107386
2845 2965113533
2846 2965121413
2847 2967668423
2848 2967676207
2849 2967685898
2850 2967691001
2851 2967698984
2852 2967704340
2853 2967711601
2854 2967720461
2855 2967724396
2856 2967730999
2857 2967739938
2858 2967744523
2859 2967749382
2860 2967759580
2861 2967767208
2862 2967770500
2863 2967782433
2864 2968001367
2865 2968007420
2866 2968017919
2867 2968087663
2868 2968093895
2869 2968101374
2870 2968115277
2871 2968121897
2872 2968134172
2873 2968142729
2874 2968174864
2875 2970025757
2876 2970027509
2877 2970036058
2878 2970046115
2879 2970048396
2880 2970057258
2881 2970064734
2882 2970071067
2883 2970082493
2884 2970083632
2885 2970094197
2886 2970102144
2887 2970104445
2888 2970115035
2889 2970120633
2890 2970123419
2891 2970135925
2892 2970140850
2893 2970144806
2894 2970154926
2895 2970161342
2896 2970168349
2897 2970173880
2898 2970181033
2899 2970184972
2900 2970196075
2901 2970471906
2902 2970492695
2903 2970509289
2904 2970513065
2905 2970529723
2906 2970545327
2907 2970549392
2908 2970557934
2909 2970593989
2910 2970620327
2911 2970631339
2912 2977519385
2913 2977530476
2914 2977536319
2915 2977543263
2916 2977546458
2917 2977553099
2918 2977565217
2919 2977567022
2920 2977574372
2921 2977585872
2922 2977824578
2923 2977831351
2924 2977845546
2925 2977864694
2926 2977866551
2927 2977874770
2928 2977904808
2929 2977913177
2930 2977916355
2931 2977929388
2932 2977940154
2933 2977950632
2934 2977951457
2935 2977963069
2936 2977978364
2937 2977987596
2938 2978970187
2939 2979091573
2940 2979097094
2941 2979717195
2942 2979750779
2943 2979770021
2944 2979778464
2945 2979782976
2946 2979799555
2947 2979813968
2948 2984587214
2949 2987641146
2950 2987652061
2951 2987659187
2952 2987662470
2953 2987667898
2954 2987675014
2955 2989352529
2956 2989773983
2957 2989780771
2958 2996347779
2959 2996350835
2960 2996392996
2961 2996888650
2962 2996896961
2963 3000138562
2964 3000139733
2965 3002145481
2966 3003935539
2967 3004169505
2968 3004191520
2969 3004198594
2970 3004209959
2971 3004211754
2972 3004219001
2973 3004235921
2974 3004245669
2975 3004254023
2976 3004274658
2977 3004277533
2978 3004341093
2979 3005416287
2980 3005421943
2981 3005451458
2982 3005456761
2983 637074002
2984 639651715
2985 643826744
2986 648738782
2987 649874008
2988 650842843
2989 8002287276
2990 8003574443
2991 8003994521
2992 8004002216
2993 8004307448
2994 8004320804
2995 8004369132
2996 8004377018
2997 8004393338
2998 8004446339
2999 8004633320
3000 8004644320
3001 8004698225
3002 8004707045
3003 8004720125
3004 8004734272
3005 8005250597
3006 8005264418
3007 8005277155
3008 8005287841
3009 8005290653
3010 8005305025
3011 8005313120
3012 8005321225
3013 8005323177
3014 8005381871
3015 8005388479
3016 8005397645
3017 8005436996
3018 8005466801
3019 8005490034
3020 8005503072
3021 8005547732
3022 8005562113
3023 8005567131
3024 8005576298
3025 8005625591
3026 8005630614
3027 8005650910
3028 8005674990
3029 8005688170
3030 8005689431
3031 8005701933
3032 8016738591
3033 8018130455
3034 8018165904
3035 8018182230
3036 8019500238
3037 8023682367
3038 8024484155
3039 8024492855
3040 8024505581
3041 8046773915
3042 8049295688
3043 8054560445
3044 8055622683
3045 8056375187
3046 8056383516
3047 8057576258
3048 8057878337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

102

289

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.7628 11 254
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.7593 9 246
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.7348 11 262
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7292 11 262
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7179 11 258
ID Description Score Start End Superfamily
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7849 4 248 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7716 10 252 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7637 14 252 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7579 4 252 1.10.3720.10
2r6gG01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7457 11 248 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7C4D325-F1-model_v4 Carbohydrate ABC transporter permease 0.8315 7 262 GO:0005886
GO:0055085
AF-A0A5Q4G8K8-F1-model_v4 Carbohydrate ABC transporter permease 0.83 16 262 GO:0005886
GO:0055085
AF-A0A316JGE5-F1-model_v4 Carbohydrate ABC transporter permease 0.8227 10 258 GO:0005886
GO:0055085
AF-A0A6B1D8H8-F1-model_v4 Carbohydrate ABC transporter permease 0.8226 1 262 GO:0005886
GO:0055085
AF-A0A6B1D8H8-F1-model_v4 Carbohydrate ABC transporter permease 0.8197 1 262 GO:0005886
GO:0055085

Map