F494567
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1526 | 528 | 1443 | 446 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000817|Ga0213875_1000081714 |
| Length | 490 |
| Sequence | VQAFKGSPCAASGATRPGARRVPSAAGQKTGLFSRYIVLIMTEFAVGGPGLPQQRRLVTEIPGPVSRELMARRSQAVARGVSSTMPVFATAAGGGVIVDADGNSLIDFGSGIAVVSVGNAAPRVVARAAEQAARFTHTCFMVTPYEGYVAVCEELARRTPGDHEKRSALFNSGAEAVENAVKIARYATGRQAVVAFDHAYHGRTNLTMALTAKNMPYKQGFGPFAGEIYRVPMAYPLRWPGGPDACRSDALRVVTELIHTQAGEENVAAVIIEPVQGEGGFIVPPPGFLPGLAEFCARHGIVLIADEIQSGFCRTGDWFACDHEGVVPDMVTTAKGIAGGLPLAAVTGRAEIMDAVHPGGLGGTYGGNPVACAAALGAIETMASEDLAGRARRIGEIMLPRLRKLAEKHPEIADVRGRGAMVAVELTVPGTLEPSPDVAARVARACHRAGLVVLTCGTFYNVLRFLPPLVIGEDLLEEGLSILEDAFSTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 3 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 4 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 5 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 6 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 7 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 8 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 9 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 10 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 11 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 12 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 13 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 14 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 15 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 16 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 17 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 18 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 19 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 20 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 21 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 22 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 23 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 24 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 25 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 26 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 27 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 28 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 29 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 30 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 31 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 32 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 33 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 34 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 35 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 36 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 37 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 38 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 39 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 40 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 41 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 42 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 43 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 44 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 45 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 46 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 47 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 48 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 49 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 50 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 51 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 52 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 53 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 54 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 55 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 56 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 57 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 58 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 59 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 60 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 61 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 62 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 63 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 64 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 65 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 66 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 67 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 68 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 69 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 70 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 71 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 72 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 73 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 74 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 75 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 76 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 81 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 82 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 88 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 92 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 120 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 121 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 126 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 129 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 137 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 139 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 140 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 141 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 143 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 144 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 145 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 146 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 147 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 148 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 149 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 150 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 151 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 152 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 153 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 154 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 155 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 156 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 158 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 159 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 160 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 161 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 163 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 164 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 165 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 167 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 168 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 169 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 170 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 171 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 172 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 173 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 174 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 175 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 177 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 203 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 208 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 209 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 210 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 211 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 212 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 213 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 214 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 215 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 279 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 283 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 284 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 285 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 286 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 287 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 288 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 289 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 290 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 291 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 292 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 293 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 294 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 295 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 296 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 297 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 298 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 299 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 300 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 301 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 302 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 303 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 304 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 305 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 306 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 307 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 308 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 309 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 310 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 311 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 312 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 313 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 314 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 315 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 316 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 317 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 318 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 320 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 321 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 322 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 323 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 324 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 325 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 326 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 328 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 329 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 331 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 332 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 333 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 334 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 335 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 336 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 337 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 338 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 339 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 340 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 341 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 342 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 343 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 344 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 345 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 346 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 347 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 348 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 349 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 350 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 351 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 352 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 353 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 354 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 355 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 356 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 357 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 358 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 359 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 360 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 361 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 362 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 363 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 364 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 365 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 366 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 367 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 368 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 369 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 370 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 371 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 372 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 373 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 374 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 375 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 376 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 377 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 378 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 379 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 430 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 431 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 432 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 433 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 434 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 435 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 438 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 439 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 440 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 441 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 442 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 443 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 444 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 445 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 446 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 452 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 453 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 486 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 487 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 488 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 489 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 499 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 506 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 507 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 508 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 509 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 510 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 511 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 512 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 513 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 514 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 517 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 518 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 519 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 520 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 521 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 522 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 523 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 524 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 525 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 526 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 527 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 528 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.77 |
| Metatranscriptomes | 0.79 |
| Isolates | 5.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 2.88 |
| Nodule | 0.79 |
| Rhizoplane | 4.91 |
| Rhizosphere | 83.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002891 | 3300000549 | Bacteria | 2338 |
| 2 | JGI24735J21928_10017543 | 3300002067 | Bacteria | 2213 |
| 3 | JGI24742J22300_10000738 | 3300002244 | Bacteria | 4950 |
| 4 | JGI24751J29686_10002307 | 3300002459 | Bacteria | 3862 |
| 5 | JGI25406J46586_10011869 | 3300003203 | Bacteria | 3803 |
| 6 | JGI25404J52841_10004701 | 3300003659 | Bacteria | 2786 |
| 7 | Ga0055540_1000151 | 3300003792 | Bacteria | 68564 |
| 8 | Ga0065714_10005169 | 3300005288 | Bacteria | 13494 |
| 9 | Ga0065714_10089059 | 3300005288 | Bacteria | 1994 |
| 10 | Ga0065712_10102081 | 3300005290 | Unclassified | 2018 |
| 11 | Ga0065707_10115361 | 3300005295 | Bacteria | 2269 |
| 12 | Ga0070658_10002566 | 3300005327 | Bacteria | 15138 |
| 13 | Ga0070658_10008436 | 3300005327 | Bacteria | 8287 |
| 14 | Ga0070658_10013145 | 3300005327 | Bacteria | 6643 |
| 15 | Ga0070658_10055535 | 3300005327 | Bacteria | 3217 |
| 16 | Ga0070658_10056797 | 3300005327 | Bacteria | 3182 |
| 17 | Ga0070676_10007535 | 3300005328 | Bacteria | 5846 |
| 18 | Ga0070676_10009094 | 3300005328 | Bacteria | 5373 |
| 19 | Ga0070676_10013240 | 3300005328 | Bacteria | 4518 |
| 20 | Ga0070683_100008479 | 3300005329 | Bacteria | 8731 |
| 21 | Ga0070683_100040518 | 3300005329 | Bacteria | 4283 |
| 22 | Ga0070683_100098967 | 3300005329 | Bacteria | 2745 |
| 23 | Ga0070690_100019006 | 3300005330 | Bacteria | 4162 |
| 24 | Ga0070690_100082287 | 3300005330 | Bacteria | 2108 |
| 25 | Ga0070670_100023299 | 3300005331 | Bacteria | 5329 |
| 26 | Ga0070670_100038542 | 3300005331 | Bacteria | 4110 |
| 27 | Ga0068869_100004828 | 3300005334 | Bacteria | 8417 |
| 28 | Ga0068869_100031873 | 3300005334 | Bacteria | 3711 |
| 29 | Ga0068869_100032174 | 3300005334 | Bacteria | 3695 |
| 30 | Ga0070666_10069723 | 3300005335 | Bacteria | 2391 |
| 31 | Ga0070680_100012295 | 3300005336 | Bacteria | 6647 |
| 32 | Ga0070680_100013556 | 3300005336 | Bacteria | 6353 |
| 33 | Ga0070682_100002099 | 3300005337 | Bacteria | 11076 |
| 34 | Ga0070682_100004601 | 3300005337 | Bacteria | 7673 |
| 35 | Ga0068868_100004201 | 3300005338 | Bacteria | 10070 |
| 36 | Ga0068868_100004550 | 3300005338 | Bacteria | 9736 |
| 37 | Ga0068868_100080677 | 3300005338 | Bacteria | 2607 |
| 38 | Ga0068868_100198584 | 3300005338 | Bacteria | 1671 |
| 39 | Ga0070660_100010741 | 3300005339 | Bacteria | 6482 |
| 40 | Ga0070660_100079459 | 3300005339 | Bacteria | 2573 |
| 41 | Ga0070660_100101530 | 3300005339 | Bacteria | 2280 |
| 42 | Ga0070660_100101912 | 3300005339 | Bacteria | 2275 |
| 43 | Ga0070660_100133600 | 3300005339 | Bacteria | 1987 |
| 44 | Ga0070689_100056212 | 3300005340 | Bacteria | 3051 |
| 45 | Ga0070691_10019439 | 3300005341 | Bacteria | 3134 |
| 46 | Ga0070691_10026776 | 3300005341 | Bacteria | 2689 |
| 47 | Ga0070687_100073648 | 3300005343 | Bacteria | 1841 |
| 48 | Ga0070661_100034296 | 3300005344 | Bacteria | 3680 |
| 49 | Ga0070661_100099719 | 3300005344 | Bacteria | 2159 |
| 50 | Ga0070661_100106607 | 3300005344 | Bacteria | 2089 |
| 51 | Ga0070692_10007890 | 3300005345 | Bacteria | 4719 |
| 52 | Ga0070692_10051972 | 3300005345 | Bacteria | 2133 |
| 53 | Ga0070668_100020218 | 3300005347 | Bacteria | 5022 |
| 54 | Ga0070668_100040980 | 3300005347 | Bacteria | 3546 |
| 55 | Ga0070675_100003751 | 3300005354 | Bacteria | 11544 |
| 56 | Ga0070675_100030129 | 3300005354 | Bacteria | 4378 |
| 57 | Ga0070675_100120429 | 3300005354 | Bacteria | 2229 |
| 58 | Ga0070675_100155834 | 3300005354 | Bacteria | 1961 |
| 59 | Ga0070671_100046235 | 3300005355 | Bacteria | 3620 |
| 60 | Ga0070671_100056340 | 3300005355 | Bacteria | 3270 |
| 61 | Ga0070674_100084710 | 3300005356 | Bacteria | 2273 |
| 62 | Ga0070673_100056609 | 3300005364 | Bacteria | 3094 |
| 63 | Ga0070673_100117278 | 3300005364 | Bacteria | 2215 |
| 64 | Ga0070688_100028259 | 3300005365 | Bacteria | 3346 |
| 65 | Ga0070688_100064023 | 3300005365 | Bacteria | 2332 |
| 66 | Ga0070659_100005597 | 3300005366 | Bacteria | 9029 |
| 67 | Ga0070659_100017222 | 3300005366 | Bacteria | 5433 |
| 68 | Ga0070659_100020191 | 3300005366 | Bacteria | 5058 |
| 69 | Ga0070659_100041213 | 3300005366 | Bacteria | 3608 |
| 70 | Ga0070659_100064120 | 3300005366 | Bacteria | 2907 |
| 71 | Ga0070659_100116379 | 3300005366 | Bacteria | 2161 |
| 72 | Ga0070659_100144114 | 3300005366 | Bacteria | 1940 |
| 73 | Ga0070667_100000274 | 3300005367 | Bacteria | 58415 |
| 74 | Ga0070667_100001524 | 3300005367 | Bacteria | 20730 |
| 75 | Ga0070667_100009171 | 3300005367 | Bacteria | 8192 |
| 76 | Ga0070667_100022147 | 3300005367 | Bacteria | 5272 |
| 77 | Ga0070667_100103299 | 3300005367 | Bacteria | 2463 |
| 78 | Ga0070709_10000165 | 3300005434 | Bacteria | 41860 |
| 79 | Ga0070709_10002330 | 3300005434 | Bacteria | 10293 |
| 80 | Ga0070709_10018668 | 3300005434 | Bacteria | 3999 |
| 81 | Ga0070709_10042489 | 3300005434 | Bacteria | 2808 |
| 82 | Ga0070709_10053489 | 3300005434 | Bacteria | 2542 |
| 83 | Ga0070714_100000011 | 3300005435 | Bacteria | 231268 |
| 84 | Ga0070714_100000434 | 3300005435 | Bacteria | 30291 |
| 85 | Ga0070714_100002703 | 3300005435 | Bacteria | 13066 |
| 86 | Ga0070714_100008744 | 3300005435 | Bacteria | 7916 |
| 87 | Ga0070714_100022873 | 3300005435 | Bacteria | 5129 |
| 88 | Ga0070714_100051017 | 3300005435 | Bacteria | 3527 |
| 89 | Ga0070714_100275073 | 3300005435 | Bacteria | 1563 |
| 90 | Ga0070713_100002252 | 3300005436 | Bacteria | 12524 |
| 91 | Ga0070713_100003155 | 3300005436 | Bacteria | 10854 |
| 92 | Ga0070713_100017302 | 3300005436 | Bacteria | 5448 |
| 93 | Ga0070713_100019979 | 3300005436 | Bacteria | 5127 |
| 94 | Ga0070713_100026414 | 3300005436 | Bacteria | 4558 |
| 95 | Ga0070713_100258183 | 3300005436 | Bacteria | 1592 |
| 96 | Ga0070710_10000171 | 3300005437 | Bacteria | 29726 |
| 97 | Ga0070710_10000463 | 3300005437 | Bacteria | 19074 |
| 98 | Ga0070710_10002152 | 3300005437 | Bacteria | 9322 |
| 99 | Ga0070710_10006810 | 3300005437 | Bacteria | 5512 |
| 100 | Ga0070710_10033019 | 3300005437 | Bacteria | 2808 |
| 101 | Ga0070710_10151189 | 3300005437 | Bacteria | 1432 |
| 102 | Ga0070701_10016314 | 3300005438 | Bacteria | 3450 |
| 103 | Ga0070701_10033478 | 3300005438 | Bacteria | 2568 |
| 104 | Ga0070701_10064642 | 3300005438 | Bacteria | 1940 |
| 105 | Ga0070711_100025824 | 3300005439 | Bacteria | 3845 |
| 106 | Ga0070711_100029945 | 3300005439 | Bacteria | 3598 |
| 107 | Ga0070705_100014840 | 3300005440 | Bacteria | 4017 |
| 108 | Ga0070705_100057691 | 3300005440 | Bacteria | 2291 |
| 109 | Ga0070700_100003624 | 3300005441 | Bacteria | 7989 |
| 110 | Ga0070700_100022011 | 3300005441 | Bacteria | 3711 |
| 111 | Ga0070694_100005751 | 3300005444 | Bacteria | 7525 |
| 112 | Ga0070708_100226332 | 3300005445 | Bacteria | 1755 |
| 113 | Ga0070663_100068386 | 3300005455 | Bacteria | 2579 |
| 114 | Ga0070678_100032623 | 3300005456 | Bacteria | 3606 |
| 115 | Ga0070678_100035992 | 3300005456 | Bacteria | 3462 |
| 116 | Ga0070662_100014295 | 3300005457 | Bacteria | 5300 |
| 117 | Ga0070662_100194584 | 3300005457 | Bacteria | 1606 |
| 118 | Ga0070681_10103138 | 3300005458 | Bacteria | 2797 |
| 119 | Ga0070681_10131380 | 3300005458 | Bacteria | 2436 |
| 120 | Ga0068867_100106614 | 3300005459 | Bacteria | 2147 |
| 121 | Ga0070685_10002766 | 3300005466 | Bacteria | 8969 |
| 122 | Ga0070685_10021688 | 3300005466 | Unclassified | 3494 |
| 123 | Ga0070685_10044787 | 3300005466 | Unclassified | 2534 |
| 124 | Ga0070685_10140487 | 3300005466 | Bacteria | 1520 |
| 125 | Ga0070706_100001237 | 3300005467 | Bacteria | 27336 |
| 126 | Ga0070706_100004718 | 3300005467 | Bacteria | 13070 |
| 127 | Ga0070706_100006955 | 3300005467 | Bacteria | 10670 |
| 128 | Ga0070706_100009075 | 3300005467 | Bacteria | 9259 |
| 129 | Ga0070706_100033151 | 3300005467 | Bacteria | 4766 |
| 130 | Ga0070706_100053432 | 3300005467 | Bacteria | 3729 |
| 131 | Ga0070707_100000043 | 3300005468 | Bacteria | 108893 |
| 132 | Ga0070707_100001600 | 3300005468 | Bacteria | 21940 |
| 133 | Ga0070707_100005735 | 3300005468 | Bacteria | 11584 |
| 134 | Ga0070707_100031950 | 3300005468 | Bacteria | 5015 |
| 135 | Ga0070707_100039318 | 3300005468 | Bacteria | 4520 |
| 136 | Ga0070707_100185944 | 3300005468 | Bacteria | 2026 |
| 137 | Ga0070698_100000072 | 3300005471 | Bacteria | 75715 |
| 138 | Ga0070698_100000718 | 3300005471 | Bacteria | 35574 |
| 139 | Ga0070698_100001150 | 3300005471 | Bacteria | 29264 |
| 140 | Ga0070698_100004671 | 3300005471 | Bacteria | 15059 |
| 141 | Ga0070698_100005554 | 3300005471 | Bacteria | 13783 |
| 142 | Ga0070698_100012415 | 3300005471 | Bacteria | 9020 |
| 143 | Ga0070698_100073119 | 3300005471 | Bacteria | 3435 |
| 144 | Ga0070679_100029150 | 3300005530 | Bacteria | 5444 |
| 145 | Ga0070679_100046281 | 3300005530 | Bacteria | 4336 |
| 146 | Ga0070679_100047220 | 3300005530 | Bacteria | 4292 |
| 147 | Ga0070679_100139525 | 3300005530 | Bacteria | 2404 |
| 148 | Ga0070679_100205955 | 3300005530 | Bacteria | 1932 |
| 149 | Ga0070684_100002011 | 3300005535 | Bacteria | 14959 |
| 150 | Ga0070684_100023514 | 3300005535 | Bacteria | 5157 |
| 151 | Ga0070684_100024465 | 3300005535 | Bacteria | 5066 |
| 152 | Ga0070684_100034101 | 3300005535 | Bacteria | 4350 |
| 153 | Ga0070684_100126666 | 3300005535 | Bacteria | 2301 |
| 154 | Ga0070684_100136438 | 3300005535 | Bacteria | 2216 |
| 155 | Ga0070684_100193870 | 3300005535 | Bacteria | 1849 |
| 156 | Ga0070697_100092625 | 3300005536 | Bacteria | 2501 |
| 157 | Ga0068853_100005343 | 3300005539 | Bacteria | 10057 |
| 158 | Ga0068853_100008349 | 3300005539 | Bacteria | 8313 |
| 159 | Ga0068853_100165585 | 3300005539 | Bacteria | 1997 |
| 160 | Ga0070672_100052179 | 3300005543 | Bacteria | 3192 |
| 161 | Ga0070686_100015848 | 3300005544 | Bacteria | 4376 |
| 162 | Ga0070686_100042436 | 3300005544 | Bacteria | 2849 |
| 163 | Ga0070686_100044871 | 3300005544 | Bacteria | 2781 |
| 164 | Ga0070695_100015011 | 3300005545 | Bacteria | 4673 |
| 165 | Ga0070696_100012182 | 3300005546 | Bacteria | 5763 |
| 166 | Ga0070693_100004316 | 3300005547 | Bacteria | 6711 |
| 167 | Ga0070693_100124834 | 3300005547 | Bacteria | 1601 |
| 168 | Ga0070665_100006685 | 3300005548 | Bacteria | 11724 |
| 169 | Ga0070665_100031508 | 3300005548 | Bacteria | 5337 |
| 170 | Ga0070665_100032143 | 3300005548 | Bacteria | 5281 |
| 171 | Ga0070665_100062684 | 3300005548 | Bacteria | 3727 |
| 172 | Ga0070665_100155578 | 3300005548 | Bacteria | 2288 |
| 173 | Ga0070704_100002347 | 3300005549 | Bacteria | 10618 |
| 174 | Ga0070704_100003385 | 3300005549 | Bacteria | 9138 |
| 175 | Ga0068855_100003043 | 3300005563 | Bacteria | 20537 |
| 176 | Ga0068855_100004547 | 3300005563 | Bacteria | 16940 |
| 177 | Ga0068855_100006713 | 3300005563 | Bacteria | 13966 |
| 178 | Ga0068855_100016017 | 3300005563 | Bacteria | 9018 |
| 179 | Ga0068855_100054597 | 3300005563 | Bacteria | 4696 |
| 180 | Ga0068855_100062487 | 3300005563 | Bacteria | 4347 |
| 181 | Ga0068855_100086849 | 3300005563 | Bacteria | 3616 |
| 182 | Ga0068855_100116992 | 3300005563 | Bacteria | 3055 |
| 183 | Ga0068855_100133514 | 3300005563 | Bacteria | 2833 |
| 184 | Ga0068855_100144212 | 3300005563 | Bacteria | 2712 |
| 185 | Ga0068855_100148108 | 3300005563 | Bacteria | 2671 |
| 186 | Ga0068855_100209765 | 3300005563 | Bacteria | 2189 |
| 187 | Ga0068855_100280728 | 3300005563 | Bacteria | 1849 |
| 188 | Ga0068855_100295895 | 3300005563 | Bacteria | 1793 |
| 189 | Ga0070664_100001657 | 3300005564 | Bacteria | 17808 |
| 190 | Ga0070664_100013266 | 3300005564 | Bacteria | 6711 |
| 191 | Ga0070664_100095244 | 3300005564 | Bacteria | 2582 |
| 192 | Ga0068857_100003425 | 3300005577 | Bacteria | 13229 |
| 193 | Ga0068857_100006889 | 3300005577 | Bacteria | 9784 |
| 194 | Ga0068857_100015539 | 3300005577 | Bacteria | 6651 |
| 195 | Ga0068857_100142969 | 3300005577 | Bacteria | 2163 |
| 196 | Ga0068857_100165186 | 3300005577 | Bacteria | 2010 |
| 197 | Ga0068854_100007727 | 3300005578 | Bacteria | 6873 |
| 198 | Ga0068854_100036762 | 3300005578 | Bacteria | 3434 |
| 199 | Ga0068854_100051958 | 3300005578 | Bacteria | 2937 |
| 200 | Ga0068856_100005605 | 3300005614 | Bacteria | 12355 |
| 201 | Ga0068856_100013115 | 3300005614 | Bacteria | 8029 |
| 202 | Ga0068856_100022233 | 3300005614 | Bacteria | 6165 |
| 203 | Ga0068856_100045686 | 3300005614 | Bacteria | 4313 |
| 204 | Ga0068856_100054151 | 3300005614 | Bacteria | 3957 |
| 205 | Ga0070702_100003327 | 3300005615 | Bacteria | 7172 |
| 206 | Ga0070702_100033771 | 3300005615 | Bacteria | 2815 |
| 207 | Ga0070702_100036204 | 3300005615 | Bacteria | 2732 |
| 208 | Ga0070702_100039852 | 3300005615 | Bacteria | 2624 |
| 209 | Ga0068852_100005871 | 3300005616 | Bacteria | 8822 |
| 210 | Ga0068852_100008555 | 3300005616 | Bacteria | 7547 |
| 211 | Ga0068852_100015780 | 3300005616 | Bacteria | 5873 |
| 212 | Ga0068852_100027507 | 3300005616 | Bacteria | 4636 |
| 213 | Ga0068852_100031952 | 3300005616 | Bacteria | 4353 |
| 214 | Ga0068852_100040501 | 3300005616 | Bacteria | 3931 |
| 215 | Ga0068852_100139191 | 3300005616 | Bacteria | 2244 |
| 216 | Ga0068852_100203944 | 3300005616 | Bacteria | 1872 |
| 217 | Ga0068859_100012755 | 3300005617 | Bacteria | 8446 |
| 218 | Ga0068859_100015246 | 3300005617 | Bacteria | 7718 |
| 219 | Ga0068859_100020598 | 3300005617 | Bacteria | 6617 |
| 220 | Ga0068859_100208887 | 3300005617 | Bacteria | 2038 |
| 221 | Ga0068864_100012916 | 3300005618 | Bacteria | 6910 |
| 222 | Ga0068864_100190358 | 3300005618 | Bacteria | 1880 |
| 223 | Ga0068866_10005193 | 3300005718 | Bacteria | 5363 |
| 224 | Ga0068861_100017127 | 3300005719 | Bacteria | 5137 |
| 225 | Ga0068861_100057183 | 3300005719 | Bacteria | 2979 |
| 226 | Ga0068851_10000005 | 3300005834 | Bacteria | 262808 |
| 227 | Ga0068851_10062942 | 3300005834 | Bacteria | 1904 |
| 228 | Ga0068870_10000471 | 3300005840 | Bacteria | 15325 |
| 229 | Ga0068870_10020159 | 3300005840 | Bacteria | 3243 |
| 230 | Ga0068863_100004781 | 3300005841 | Bacteria | 13343 |
| 231 | Ga0068863_100014598 | 3300005841 | Bacteria | 7562 |
| 232 | Ga0068863_100027875 | 3300005841 | Bacteria | 5391 |
| 233 | Ga0068863_100041663 | 3300005841 | Bacteria | 4366 |
| 234 | Ga0068858_100000058 | 3300005842 | Bacteria | 117238 |
| 235 | Ga0068858_100031487 | 3300005842 | Bacteria | 4927 |
| 236 | Ga0068858_100080479 | 3300005842 | Bacteria | 3027 |
| 237 | Ga0068858_100202669 | 3300005842 | Bacteria | 1876 |
| 238 | Ga0068860_100000451 | 3300005843 | Bacteria | 51981 |
| 239 | Ga0068860_100020377 | 3300005843 | Bacteria | 6423 |
| 240 | Ga0068860_100031992 | 3300005843 | Bacteria | 5058 |
| 241 | Ga0068860_100048640 | 3300005843 | Bacteria | 4041 |
| 242 | Ga0068862_100013889 | 3300005844 | Bacteria | 6676 |
| 243 | Ga0068862_100095958 | 3300005844 | Bacteria | 2587 |
| 244 | Ga0081455_10003611 | 3300005937 | Bacteria | 17731 |
| 245 | Ga0081455_10015161 | 3300005937 | Bacteria | 7500 |
| 246 | Ga0081455_10104478 | 3300005937 | Bacteria | 2266 |
| 247 | Ga0081540_1000058 | 3300005983 | Bacteria | 120635 |
| 248 | Ga0081540_1000120 | 3300005983 | Bacteria | 83032 |
| 249 | Ga0081540_1001571 | 3300005983 | Bacteria | 19515 |
| 250 | Ga0081540_1013835 | 3300005983 | Bacteria | 5218 |
| 251 | Ga0081540_1017505 | 3300005983 | Bacteria | 4434 |
| 252 | Ga0081540_1044975 | 3300005983 | Bacteria | 2247 |
| 253 | Ga0081539_10000846 | 3300005985 | Bacteria | 58555 |
| 254 | Ga0081539_10001386 | 3300005985 | Bacteria | 41825 |
| 255 | Ga0081539_10004997 | 3300005985 | Bacteria | 14019 |
| 256 | Ga0081539_10018904 | 3300005985 | Bacteria | 4747 |
| 257 | Ga0081539_10050241 | 3300005985 | Bacteria | 2360 |
| 258 | Ga0070717_10016290 | 3300006028 | Bacteria | 5761 |
| 259 | Ga0070717_10056734 | 3300006028 | Bacteria | 3237 |
| 260 | Ga0070717_10130606 | 3300006028 | Bacteria | 2160 |
| 261 | Ga0075365_10004303 | 3300006038 | Bacteria | 7516 |
| 262 | Ga0075365_10028765 | 3300006038 | Bacteria | 3546 |
| 263 | Ga0075365_10054164 | 3300006038 | Bacteria | 2659 |
| 264 | Ga0075368_10002325 | 3300006042 | Bacteria | 6175 |
| 265 | Ga0075363_100010515 | 3300006048 | Bacteria | 4400 |
| 266 | Ga0075363_100030288 | 3300006048 | Bacteria | 2800 |
| 267 | Ga0075363_100060382 | 3300006048 | Bacteria | 2041 |
| 268 | Ga0075364_10002585 | 3300006051 | Bacteria | 10145 |
| 269 | Ga0075364_10013755 | 3300006051 | Bacteria | 4984 |
| 270 | Ga0075364_10014100 | 3300006051 | Bacteria | 4932 |
| 271 | Ga0070715_10003185 | 3300006163 | Bacteria | 5163 |
| 272 | Ga0070715_10003914 | 3300006163 | Bacteria | 4817 |
| 273 | Ga0070716_100003680 | 3300006173 | Bacteria | 7255 |
| 274 | Ga0070716_100004282 | 3300006173 | Bacteria | 6799 |
| 275 | Ga0070716_100098018 | 3300006173 | Bacteria | 1790 |
| 276 | Ga0070712_100011158 | 3300006175 | Bacteria | 5686 |
| 277 | Ga0070712_100014200 | 3300006175 | Bacteria | 5112 |
| 278 | Ga0070712_100019304 | 3300006175 | Bacteria | 4444 |
| 279 | Ga0070712_100023628 | 3300006175 | Bacteria | 4063 |
| 280 | Ga0075367_10001320 | 3300006178 | Bacteria | 10513 |
| 281 | Ga0097621_100008180 | 3300006237 | Bacteria | 7522 |
| 282 | Ga0097621_100027509 | 3300006237 | Bacteria | 4473 |
| 283 | Ga0097621_100052359 | 3300006237 | Bacteria | 3326 |
| 284 | Ga0075370_10001552 | 3300006353 | Bacteria | 10058 |
| 285 | Ga0068871_100073400 | 3300006358 | Bacteria | 2821 |
| 286 | Ga0075428_100002554 | 3300006844 | Bacteria | 19788 |
| 287 | Ga0075428_100080788 | 3300006844 | Bacteria | 3548 |
| 288 | Ga0075430_100003453 | 3300006846 | Bacteria | 13222 |
| 289 | Ga0075430_100047619 | 3300006846 | Bacteria | 3621 |
| 290 | Ga0075431_100000676 | 3300006847 | Bacteria | 29173 |
| 291 | Ga0075431_100010144 | 3300006847 | Bacteria | 9468 |
| 292 | Ga0075431_100037448 | 3300006847 | Bacteria | 4996 |
| 293 | Ga0075431_100055387 | 3300006847 | Bacteria | 4090 |
| 294 | Ga0075431_100094076 | 3300006847 | Bacteria | 3093 |
| 295 | Ga0075433_10003602 | 3300006852 | Bacteria | 11968 |
| 296 | Ga0075433_10020156 | 3300006852 | Bacteria | 5569 |
| 297 | Ga0075434_100001339 | 3300006871 | Bacteria | 20648 |
| 298 | Ga0075434_100034046 | 3300006871 | Bacteria | 5029 |
| 299 | Ga0075434_100065272 | 3300006871 | Bacteria | 3625 |
| 300 | Ga0075429_100001358 | 3300006880 | Bacteria | 20005 |
| 301 | Ga0075429_100002730 | 3300006880 | Bacteria | 14898 |
| 302 | Ga0075436_100011469 | 3300006914 | Bacteria | 6083 |
| 303 | Ga0075436_100016125 | 3300006914 | Bacteria | 5115 |
| 304 | Ga0075436_100031803 | 3300006914 | Bacteria | 3636 |
| 305 | Ga0097620_100012754 | 3300006931 | Bacteria | 8446 |
| 306 | Ga0097620_100015246 | 3300006931 | Bacteria | 7718 |
| 307 | Ga0097620_100020599 | 3300006931 | Bacteria | 6617 |
| 308 | Ga0097620_100208887 | 3300006931 | Bacteria | 2038 |
| 309 | Ga0075435_100048134 | 3300007076 | Bacteria | 3424 |
| 310 | Ga0105240_10009128 | 3300009093 | Bacteria | 14078 |
| 311 | Ga0105240_10021145 | 3300009093 | Bacteria | 8662 |
| 312 | Ga0105240_10064152 | 3300009093 | Bacteria | 4565 |
| 313 | Ga0105240_10122631 | 3300009093 | Bacteria | 3128 |
| 314 | Ga0105240_10196807 | 3300009093 | Bacteria | 2365 |
| 315 | Ga0111539_10007834 | 3300009094 | Bacteria | 13642 |
| 316 | Ga0111539_10016741 | 3300009094 | Bacteria | 9086 |
| 317 | Ga0111539_10165209 | 3300009094 | Bacteria | 2588 |
| 318 | Ga0105245_10002916 | 3300009098 | Bacteria | 15349 |
| 319 | Ga0105245_10026061 | 3300009098 | Bacteria | 5144 |
| 320 | Ga0105245_10066101 | 3300009098 | Bacteria | 3272 |
| 321 | Ga0105245_10195087 | 3300009098 | Bacteria | 1942 |
| 322 | Ga0105245_10255111 | 3300009098 | Bacteria | 1705 |
| 323 | Ga0105247_10016500 | 3300009101 | Bacteria | 4427 |
| 324 | Ga0114129_10000459 | 3300009147 | Bacteria | 48751 |
| 325 | Ga0114129_10003492 | 3300009147 | Bacteria | 22098 |
| 326 | Ga0114129_10011584 | 3300009147 | Bacteria | 12556 |
| 327 | Ga0114129_10220626 | 3300009147 | Bacteria | 2558 |
| 328 | Ga0105243_10006996 | 3300009148 | Bacteria | 8685 |
| 329 | Ga0105243_10013454 | 3300009148 | Bacteria | 6187 |
| 330 | Ga0105243_10063408 | 3300009148 | Bacteria | 2961 |
| 331 | Ga0105243_10129134 | 3300009148 | Bacteria | 2142 |
| 332 | Ga0105243_10181781 | 3300009148 | Bacteria | 1829 |
| 333 | Ga0105241_10000772 | 3300009174 | Bacteria | 24349 |
| 334 | Ga0105241_10003418 | 3300009174 | Bacteria | 11818 |
| 335 | Ga0105241_10041881 | 3300009174 | Bacteria | 3462 |
| 336 | Ga0105241_10153317 | 3300009174 | Bacteria | 1887 |
| 337 | Ga0105242_10009563 | 3300009176 | Bacteria | 7429 |
| 338 | Ga0105242_10017039 | 3300009176 | Bacteria | 5657 |
| 339 | Ga0105242_10035350 | 3300009176 | Bacteria | 4008 |
| 340 | Ga0105248_10000784 | 3300009177 | Bacteria | 35696 |
| 341 | Ga0105248_10046208 | 3300009177 | Bacteria | 4880 |
| 342 | Ga0105248_10056078 | 3300009177 | Bacteria | 4420 |
| 343 | Ga0105248_10100427 | 3300009177 | Bacteria | 3261 |
| 344 | Ga0105237_10002853 | 3300009545 | Bacteria | 21014 |
| 345 | Ga0105237_10025822 | 3300009545 | Bacteria | 6006 |
| 346 | Ga0105237_10035761 | 3300009545 | Bacteria | 5025 |
| 347 | Ga0105237_10051012 | 3300009545 | Bacteria | 4157 |
| 348 | Ga0105237_10062059 | 3300009545 | Bacteria | 3736 |
| 349 | Ga0105237_10098934 | 3300009545 | Bacteria | 2908 |
| 350 | Ga0105238_10011164 | 3300009551 | Bacteria | 9034 |
| 351 | Ga0105238_10132824 | 3300009551 | Bacteria | 2467 |
| 352 | Ga0105238_10210488 | 3300009551 | Bacteria | 1920 |
| 353 | Ga0105249_10011505 | 3300009553 | Bacteria | 7773 |
| 354 | Ga0105249_10020772 | 3300009553 | Bacteria | 5872 |
| 355 | Ga0105249_10077841 | 3300009553 | Bacteria | 3076 |
| 356 | Ga0105249_10138850 | 3300009553 | Bacteria | 2328 |
| 357 | Ga0105239_10002033 | 3300010375 | Bacteria | 26242 |
| 358 | Ga0105239_10005653 | 3300010375 | Bacteria | 14609 |
| 359 | Ga0105239_10009408 | 3300010375 | Bacteria | 11019 |
| 360 | Ga0105239_10028033 | 3300010375 | Bacteria | 6197 |
| 361 | Ga0105239_10063730 | 3300010375 | Bacteria | 4047 |
| 362 | Ga0105239_10393219 | 3300010375 | Bacteria | 1568 |
| 363 | Ga0105246_10015649 | 3300011119 | Bacteria | 4792 |
| 364 | Ga0105246_10072017 | 3300011119 | Bacteria | 2435 |
| 365 | Ga0105246_10120991 | 3300011119 | Bacteria | 1940 |
| 366 | Ga0157373_10032874 | 3300013100 | Bacteria | 3733 |
| 367 | Ga0157371_10043457 | 3300013102 | Bacteria | 3201 |
| 368 | Ga0157371_10072602 | 3300013102 | Bacteria | 2437 |
| 369 | Ga0157370_10004680 | 3300013104 | Bacteria | 15608 |
| 370 | Ga0157370_10030047 | 3300013104 | Bacteria | 5326 |
| 371 | Ga0157370_10033203 | 3300013104 | Bacteria | 5031 |
| 372 | Ga0157370_10138642 | 3300013104 | Bacteria | 2266 |
| 373 | Ga0157370_10224709 | 3300013104 | Bacteria | 1738 |
| 374 | Ga0157369_10000631 | 3300013105 | Bacteria | 45670 |
| 375 | Ga0157369_10039681 | 3300013105 | Bacteria | 5144 |
| 376 | Ga0157369_10040006 | 3300013105 | Bacteria | 5121 |
| 377 | Ga0157369_10092850 | 3300013105 | Bacteria | 3222 |
| 378 | Ga0157369_10163930 | 3300013105 | Bacteria | 2345 |
| 379 | Ga0157374_10004456 | 3300013296 | Bacteria | 11758 |
| 380 | Ga0157374_10024129 | 3300013296 | Bacteria | 5449 |
| 381 | Ga0157374_10101872 | 3300013296 | Bacteria | 2753 |
| 382 | Ga0157374_10111570 | 3300013296 | Bacteria | 2631 |
| 383 | Ga0157378_10016267 | 3300013297 | Bacteria | 6514 |
| 384 | Ga0157378_10115653 | 3300013297 | Bacteria | 2465 |
| 385 | Ga0157378_10288786 | 3300013297 | Bacteria | 1583 |
| 386 | Ga0163162_10009743 | 3300013306 | Bacteria | 9352 |
| 387 | Ga0163162_10010744 | 3300013306 | Bacteria | 8907 |
| 388 | Ga0163162_10305408 | 3300013306 | Bacteria | 1723 |
| 389 | Ga0157372_10000006 | 3300013307 | Bacteria | 354669 |
| 390 | Ga0157372_10014423 | 3300013307 | Bacteria | 8453 |
| 391 | Ga0157372_10025730 | 3300013307 | Bacteria | 6402 |
| 392 | Ga0157372_10104477 | 3300013307 | Bacteria | 3238 |
| 393 | Ga0157375_10063593 | 3300013308 | Bacteria | 3672 |
| 394 | Ga0157375_10065285 | 3300013308 | Bacteria | 3628 |
| 395 | Ga0157375_10144658 | 3300013308 | Bacteria | 2507 |
| 396 | Ga0157375_10187845 | 3300013308 | Bacteria | 2220 |
| 397 | Ga0163163_10001963 | 3300014325 | Bacteria | 17382 |
| 398 | Ga0163163_10008595 | 3300014325 | Bacteria | 9079 |
| 399 | Ga0163163_10105894 | 3300014325 | Bacteria | 2838 |
| 400 | Ga0157380_10091050 | 3300014326 | Bacteria | 2517 |
| 401 | Ga0157380_10128422 | 3300014326 | Bacteria | 2159 |
| 402 | Ga0182008_10027165 | 3300014497 | Bacteria | 2901 |
| 403 | Ga0182008_10084003 | 3300014497 | Bacteria | 1568 |
| 404 | Ga0182008_10089599 | 3300014497 | Bacteria | 1516 |
| 405 | Ga0157377_10003806 | 3300014745 | Bacteria | 6855 |
| 406 | Ga0157377_10004860 | 3300014745 | Bacteria | 6248 |
| 407 | Ga0157377_10028980 | 3300014745 | Bacteria | 2985 |
| 408 | Ga0157377_10082550 | 3300014745 | Bacteria | 1882 |
| 409 | Ga0157379_10004864 | 3300014968 | Bacteria | 11538 |
| 410 | Ga0157379_10006071 | 3300014968 | Bacteria | 10405 |
| 411 | Ga0157379_10017719 | 3300014968 | Bacteria | 6275 |
| 412 | Ga0157379_10067044 | 3300014968 | Bacteria | 3209 |
| 413 | Ga0157376_10074672 | 3300014969 | Bacteria | 2891 |
| 414 | Ga0157376_10099772 | 3300014969 | Unclassified | 2534 |
| 415 | Ga0157376_10222520 | 3300014969 | Bacteria | 1749 |
| 416 | Ga0163161_10007930 | 3300017792 | Bacteria | 7350 |
| 417 | Ga0163161_10020533 | 3300017792 | Bacteria | 4636 |
| 418 | Ga0163161_10038949 | 3300017792 | Bacteria | 3411 |
| 419 | Ga0163161_10077287 | 3300017792 | Bacteria | 2445 |
| 420 | Ga0197907_10116683 | 3300020069 | Bacteria | 2334 |
| 421 | Ga0206351_10892666 | 3300020077 | Bacteria | 5622 |
| 422 | Ga0206354_10860617 | 3300020081 | Bacteria | 3538 |
| 423 | Ga0206353_10474610 | 3300020082 | Bacteria | 1859 |
| 424 | Ga0206353_10717049 | 3300020082 | Bacteria | 3676 |
| 425 | Ga0206353_11102129 | 3300020082 | Bacteria | 3327 |
| 426 | Ga0213873_10000163 | 3300021358 | Bacteria | 12443 |
| 427 | Ga0213876_10019674 | 3300021384 | Bacteria | 3566 |
| 428 | Ga0213875_10000817 | 3300021388 | Bacteria | 23214 |
| 429 | Ga0213875_10002928 | 3300021388 | Bacteria | 9960 |
| 430 | Ga0213875_10003242 | 3300021388 | Bacteria | 9334 |
| 431 | Ga0213875_10005790 | 3300021388 | Bacteria | 6578 |
| 432 | Ga0224712_10001022 | 3300022467 | Bacteria | 6122 |
| 433 | Ga0224712_10051737 | 3300022467 | Bacteria | 1601 |
| 434 | Ga0209148_1000907 | 3300025254 | Bacteria | 20039 |
| 435 | Ga0209051_1000075 | 3300025303 | Bacteria | 205011 |
| 436 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 437 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 438 | Ga0207656_10000004 | 3300025321 | Bacteria | 632320 |
| 439 | Ga0207655_1004585 | 3300025728 | Bacteria | 9731 |
| 440 | Ga0207692_10000523 | 3300025898 | Bacteria | 13619 |
| 441 | Ga0207692_10003276 | 3300025898 | Bacteria | 6308 |
| 442 | Ga0207692_10009178 | 3300025898 | Bacteria | 4120 |
| 443 | Ga0207692_10012558 | 3300025898 | Bacteria | 3641 |
| 444 | Ga0207692_10034204 | 3300025898 | Bacteria | 2459 |
| 445 | Ga0207642_10006583 | 3300025899 | Bacteria | 3874 |
| 446 | Ga0207642_10077937 | 3300025899 | Bacteria | 1600 |
| 447 | Ga0207710_10014744 | 3300025900 | Bacteria | 3299 |
| 448 | Ga0207688_10001124 | 3300025901 | Bacteria | 13757 |
| 449 | Ga0207688_10001953 | 3300025901 | Bacteria | 11045 |
| 450 | Ga0207688_10002486 | 3300025901 | Bacteria | 9918 |
| 451 | Ga0207688_10012847 | 3300025901 | Bacteria | 4552 |
| 452 | Ga0207688_10035841 | 3300025901 | Bacteria | 2749 |
| 453 | Ga0207688_10036234 | 3300025901 | Bacteria | 2735 |
| 454 | Ga0207688_10041401 | 3300025901 | Bacteria | 2562 |
| 455 | Ga0207680_10004471 | 3300025903 | Bacteria | 6631 |
| 456 | Ga0207680_10031683 | 3300025903 | Bacteria | 2997 |
| 457 | Ga0207680_10051419 | 3300025903 | Bacteria | 2464 |
| 458 | Ga0207680_10110254 | 3300025903 | Bacteria | 1784 |
| 459 | Ga0207647_10026494 | 3300025904 | Bacteria | 3793 |
| 460 | Ga0207647_10040660 | 3300025904 | Bacteria | 2927 |
| 461 | Ga0207699_10000393 | 3300025906 | Bacteria | 22711 |
| 462 | Ga0207699_10016294 | 3300025906 | Bacteria | 3885 |
| 463 | Ga0207699_10028655 | 3300025906 | Bacteria | 3097 |
| 464 | Ga0207699_10040045 | 3300025906 | Bacteria | 2697 |
| 465 | Ga0207643_10001695 | 3300025908 | Bacteria | 12362 |
| 466 | Ga0207643_10028173 | 3300025908 | Bacteria | 3118 |
| 467 | Ga0207705_10004458 | 3300025909 | Bacteria | 10575 |
| 468 | Ga0207705_10030066 | 3300025909 | Bacteria | 3874 |
| 469 | Ga0207705_10091463 | 3300025909 | Bacteria | 2228 |
| 470 | Ga0207705_10140811 | 3300025909 | Bacteria | 1801 |
| 471 | Ga0207684_10002760 | 3300025910 | Bacteria | 17486 |
| 472 | Ga0207684_10006264 | 3300025910 | Bacteria | 10862 |
| 473 | Ga0207684_10034871 | 3300025910 | Bacteria | 4274 |
| 474 | Ga0207684_10047506 | 3300025910 | Bacteria | 3640 |
| 475 | Ga0207684_10054822 | 3300025910 | Bacteria | 3383 |
| 476 | Ga0207684_10059824 | 3300025910 | Bacteria | 3235 |
| 477 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 478 | Ga0207654_10059581 | 3300025911 | Bacteria | 2227 |
| 479 | Ga0207707_10129896 | 3300025912 | Bacteria | 2204 |
| 480 | Ga0207707_10236968 | 3300025912 | Bacteria | 1587 |
| 481 | Ga0207695_10001477 | 3300025913 | Bacteria | 39315 |
| 482 | Ga0207695_10013965 | 3300025913 | Bacteria | 9543 |
| 483 | Ga0207695_10014175 | 3300025913 | Bacteria | 9458 |
| 484 | Ga0207695_10025708 | 3300025913 | Bacteria | 6585 |
| 485 | Ga0207695_10050781 | 3300025913 | Bacteria | 4360 |
| 486 | Ga0207695_10083572 | 3300025913 | Bacteria | 3225 |
| 487 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 488 | Ga0207671_10000445 | 3300025914 | Bacteria | 57046 |
| 489 | Ga0207671_10034894 | 3300025914 | Bacteria | 3736 |
| 490 | Ga0207671_10057228 | 3300025914 | Bacteria | 2890 |
| 491 | Ga0207671_10083588 | 3300025914 | Bacteria | 2397 |
| 492 | Ga0207671_10085080 | 3300025914 | Bacteria | 2376 |
| 493 | Ga0207693_10004329 | 3300025915 | Bacteria | 12016 |
| 494 | Ga0207693_10008492 | 3300025915 | Bacteria | 8408 |
| 495 | Ga0207693_10018010 | 3300025915 | Bacteria | 5629 |
| 496 | Ga0207693_10033132 | 3300025915 | Bacteria | 4078 |
| 497 | Ga0207663_10002048 | 3300025916 | Bacteria | 9599 |
| 498 | Ga0207663_10122342 | 3300025916 | Bacteria | 1784 |
| 499 | Ga0207660_10053263 | 3300025917 | Bacteria | 2883 |
| 500 | Ga0207660_10078396 | 3300025917 | Bacteria | 2421 |
| 501 | Ga0207660_10167495 | 3300025917 | Bacteria | 1699 |
| 502 | Ga0207662_10066563 | 3300025918 | Bacteria | 2171 |
| 503 | Ga0207657_10003219 | 3300025919 | Bacteria | 17487 |
| 504 | Ga0207657_10008017 | 3300025919 | Bacteria | 10770 |
| 505 | Ga0207657_10019911 | 3300025919 | Bacteria | 6359 |
| 506 | Ga0207657_10022980 | 3300025919 | Bacteria | 5818 |
| 507 | Ga0207657_10083944 | 3300025919 | Bacteria | 2671 |
| 508 | Ga0207657_10099648 | 3300025919 | Bacteria | 2413 |
| 509 | Ga0207657_10172647 | 3300025919 | Bacteria | 1751 |
| 510 | Ga0207649_10019926 | 3300025920 | Bacteria | 3840 |
| 511 | Ga0207652_10062722 | 3300025921 | Bacteria | 3212 |
| 512 | Ga0207652_10078970 | 3300025921 | Bacteria | 2874 |
| 513 | Ga0207652_10159508 | 3300025921 | Bacteria | 2022 |
| 514 | Ga0207646_10000455 | 3300025922 | Bacteria | 54634 |
| 515 | Ga0207646_10009604 | 3300025922 | Bacteria | 9543 |
| 516 | Ga0207646_10012030 | 3300025922 | Bacteria | 8337 |
| 517 | Ga0207646_10058309 | 3300025922 | Bacteria | 3448 |
| 518 | Ga0207646_10200697 | 3300025922 | Bacteria | 1801 |
| 519 | Ga0207681_10112658 | 3300025923 | Bacteria | 1982 |
| 520 | Ga0207694_10000039 | 3300025924 | Bacteria | 186164 |
| 521 | Ga0207694_10012986 | 3300025924 | Bacteria | 6271 |
| 522 | Ga0207650_10046281 | 3300025925 | Bacteria | 3204 |
| 523 | Ga0207659_10002929 | 3300025926 | Bacteria | 10167 |
| 524 | Ga0207659_10036838 | 3300025926 | Bacteria | 3392 |
| 525 | Ga0207687_10018558 | 3300025927 | Bacteria | 4595 |
| 526 | Ga0207687_10020145 | 3300025927 | Bacteria | 4424 |
| 527 | Ga0207687_10020433 | 3300025927 | Bacteria | 4392 |
| 528 | Ga0207687_10040450 | 3300025927 | Bacteria | 3195 |
| 529 | Ga0207700_10000029 | 3300025928 | Bacteria | 132615 |
| 530 | Ga0207700_10001933 | 3300025928 | Bacteria | 11790 |
| 531 | Ga0207700_10002047 | 3300025928 | Bacteria | 11530 |
| 532 | Ga0207700_10010489 | 3300025928 | Bacteria | 5851 |
| 533 | Ga0207700_10023791 | 3300025928 | Bacteria | 4232 |
| 534 | Ga0207700_10026278 | 3300025928 | Bacteria | 4058 |
| 535 | Ga0207700_10052281 | 3300025928 | Bacteria | 3054 |
| 536 | Ga0207700_10064913 | 3300025928 | Bacteria | 2783 |
| 537 | Ga0207700_10078908 | 3300025928 | Bacteria | 2562 |
| 538 | Ga0207700_10079066 | 3300025928 | Bacteria | 2560 |
| 539 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 540 | Ga0207664_10000110 | 3300025929 | Bacteria | 72637 |
| 541 | Ga0207664_10000648 | 3300025929 | Bacteria | 24123 |
| 542 | Ga0207664_10001639 | 3300025929 | Bacteria | 14743 |
| 543 | Ga0207664_10009269 | 3300025929 | Bacteria | 6898 |
| 544 | Ga0207664_10018463 | 3300025929 | Bacteria | 5136 |
| 545 | Ga0207664_10019628 | 3300025929 | Bacteria | 4999 |
| 546 | Ga0207664_10050041 | 3300025929 | Bacteria | 3293 |
| 547 | Ga0207664_10066907 | 3300025929 | Bacteria | 2881 |
| 548 | Ga0207664_10069855 | 3300025929 | Bacteria | 2825 |
| 549 | Ga0207664_10095245 | 3300025929 | Bacteria | 2449 |
| 550 | Ga0207664_10136096 | 3300025929 | Bacteria | 2073 |
| 551 | Ga0207690_10001473 | 3300025932 | Bacteria | 14697 |
| 552 | Ga0207690_10057859 | 3300025932 | Bacteria | 2620 |
| 553 | Ga0207690_10082994 | 3300025932 | Bacteria | 2242 |
| 554 | Ga0207706_10019341 | 3300025933 | Bacteria | 6125 |
| 555 | Ga0207706_10028367 | 3300025933 | Bacteria | 4999 |
| 556 | Ga0207706_10043648 | 3300025933 | Bacteria | 3973 |
| 557 | Ga0207686_10001569 | 3300025934 | Bacteria | 12891 |
| 558 | Ga0207686_10067540 | 3300025934 | Bacteria | 2288 |
| 559 | Ga0207709_10003866 | 3300025935 | Bacteria | 8771 |
| 560 | Ga0207709_10009207 | 3300025935 | Bacteria | 5439 |
| 561 | Ga0207709_10014342 | 3300025935 | Bacteria | 4375 |
| 562 | Ga0207665_10000995 | 3300025939 | Bacteria | 19125 |
| 563 | Ga0207665_10002740 | 3300025939 | Bacteria | 11815 |
| 564 | Ga0207665_10004600 | 3300025939 | Bacteria | 9162 |
| 565 | Ga0207665_10005087 | 3300025939 | Bacteria | 8775 |
| 566 | Ga0207665_10008216 | 3300025939 | Bacteria | 6891 |
| 567 | Ga0207665_10012993 | 3300025939 | Bacteria | 5472 |
| 568 | Ga0207665_10061089 | 3300025939 | Bacteria | 2553 |
| 569 | Ga0207691_10069059 | 3300025940 | Bacteria | 3192 |
| 570 | Ga0207691_10078880 | 3300025940 | Bacteria | 2964 |
| 571 | Ga0207691_10207000 | 3300025940 | Bacteria | 1706 |
| 572 | Ga0207711_10000881 | 3300025941 | Bacteria | 29003 |
| 573 | Ga0207711_10015199 | 3300025941 | Bacteria | 6392 |
| 574 | Ga0207711_10021967 | 3300025941 | Bacteria | 5332 |
| 575 | Ga0207689_10000812 | 3300025942 | Bacteria | 30156 |
| 576 | Ga0207689_10002842 | 3300025942 | Bacteria | 15975 |
| 577 | Ga0207689_10021795 | 3300025942 | Bacteria | 5387 |
| 578 | Ga0207689_10042117 | 3300025942 | Bacteria | 3779 |
| 579 | Ga0207689_10102201 | 3300025942 | Bacteria | 2354 |
| 580 | Ga0207661_10017684 | 3300025944 | Bacteria | 5283 |
| 581 | Ga0207661_10054690 | 3300025944 | Bacteria | 3199 |
| 582 | Ga0207661_10056544 | 3300025944 | Bacteria | 3150 |
| 583 | Ga0207661_10095635 | 3300025944 | Bacteria | 2484 |
| 584 | Ga0207679_10004464 | 3300025945 | Bacteria | 8720 |
| 585 | Ga0207679_10009676 | 3300025945 | Bacteria | 6179 |
| 586 | Ga0207667_10002609 | 3300025949 | Bacteria | 22348 |
| 587 | Ga0207667_10016601 | 3300025949 | Bacteria | 8310 |
| 588 | Ga0207667_10018589 | 3300025949 | Bacteria | 7789 |
| 589 | Ga0207667_10026581 | 3300025949 | Bacteria | 6318 |
| 590 | Ga0207667_10081943 | 3300025949 | Bacteria | 3342 |
| 591 | Ga0207667_10104838 | 3300025949 | Bacteria | 2917 |
| 592 | Ga0207667_10109884 | 3300025949 | Bacteria | 2844 |
| 593 | Ga0207667_10229988 | 3300025949 | Bacteria | 1899 |
| 594 | Ga0207667_10236499 | 3300025949 | Bacteria | 1870 |
| 595 | Ga0207651_10163247 | 3300025960 | Bacteria | 1749 |
| 596 | Ga0207712_10000976 | 3300025961 | Bacteria | 20527 |
| 597 | Ga0207712_10017414 | 3300025961 | Bacteria | 4666 |
| 598 | Ga0207712_10056219 | 3300025961 | Bacteria | 2772 |
| 599 | Ga0207668_10028789 | 3300025972 | Bacteria | 3636 |
| 600 | Ga0207640_10057688 | 3300025981 | Bacteria | 2555 |
| 601 | Ga0207658_10000423 | 3300025986 | Bacteria | 40097 |
| 602 | Ga0207658_10013608 | 3300025986 | Bacteria | 5565 |
| 603 | Ga0207658_10044590 | 3300025986 | Bacteria | 3229 |
| 604 | Ga0207677_10010033 | 3300026023 | Bacteria | 5344 |
| 605 | Ga0207677_10043878 | 3300026023 | Bacteria | 2975 |
| 606 | Ga0207677_10124562 | 3300026023 | Bacteria | 1945 |
| 607 | Ga0207703_10000026 | 3300026035 | Bacteria | 211591 |
| 608 | Ga0207703_10071745 | 3300026035 | Bacteria | 2861 |
| 609 | Ga0207703_10154816 | 3300026035 | Bacteria | 2002 |
| 610 | Ga0207703_10193937 | 3300026035 | Bacteria | 1801 |
| 611 | Ga0207639_10021897 | 3300026041 | Bacteria | 4596 |
| 612 | Ga0207639_10075785 | 3300026041 | Bacteria | 2646 |
| 613 | Ga0207639_10223339 | 3300026041 | Bacteria | 1628 |
| 614 | Ga0207678_10001903 | 3300026067 | Bacteria | 19059 |
| 615 | Ga0207678_10005054 | 3300026067 | Bacteria | 11834 |
| 616 | Ga0207678_10006493 | 3300026067 | Bacteria | 10380 |
| 617 | Ga0207678_10023040 | 3300026067 | Bacteria | 5449 |
| 618 | Ga0207678_10023107 | 3300026067 | Bacteria | 5441 |
| 619 | Ga0207678_10025591 | 3300026067 | Bacteria | 5151 |
| 620 | Ga0207678_10039000 | 3300026067 | Bacteria | 4124 |
| 621 | Ga0207678_10077611 | 3300026067 | Bacteria | 2845 |
| 622 | Ga0207678_10127003 | 3300026067 | Bacteria | 2175 |
| 623 | Ga0207708_10000002 | 3300026075 | Bacteria | 411071 |
| 624 | Ga0207708_10009740 | 3300026075 | Bacteria | 7129 |
| 625 | Ga0207708_10013892 | 3300026075 | Bacteria | 6019 |
| 626 | Ga0207708_10028771 | 3300026075 | Bacteria | 4208 |
| 627 | Ga0207702_10001341 | 3300026078 | Bacteria | 24610 |
| 628 | Ga0207702_10006747 | 3300026078 | Bacteria | 9855 |
| 629 | Ga0207702_10013428 | 3300026078 | Bacteria | 6808 |
| 630 | Ga0207702_10026441 | 3300026078 | Bacteria | 4817 |
| 631 | Ga0207702_10028954 | 3300026078 | Bacteria | 4606 |
| 632 | Ga0207702_10034660 | 3300026078 | Bacteria | 4221 |
| 633 | Ga0207702_10103335 | 3300026078 | Bacteria | 2520 |
| 634 | Ga0207702_10132370 | 3300026078 | Bacteria | 2245 |
| 635 | Ga0207641_10000947 | 3300026088 | Bacteria | 29805 |
| 636 | Ga0207641_10089947 | 3300026088 | Bacteria | 2683 |
| 637 | Ga0207648_10004840 | 3300026089 | Bacteria | 13732 |
| 638 | Ga0207648_10042554 | 3300026089 | Bacteria | 3986 |
| 639 | Ga0207648_10210766 | 3300026089 | Bacteria | 1725 |
| 640 | Ga0207676_10001905 | 3300026095 | Bacteria | 15233 |
| 641 | Ga0207676_10009539 | 3300026095 | Bacteria | 6910 |
| 642 | Ga0207676_10183316 | 3300026095 | Bacteria | 1835 |
| 643 | Ga0207674_10001048 | 3300026116 | Bacteria | 35994 |
| 644 | Ga0207674_10006493 | 3300026116 | Bacteria | 13753 |
| 645 | Ga0207674_10015449 | 3300026116 | Bacteria | 8388 |
| 646 | Ga0207674_10025821 | 3300026116 | Bacteria | 6254 |
| 647 | Ga0207674_10059551 | 3300026116 | Bacteria | 3864 |
| 648 | Ga0207674_10062578 | 3300026116 | Bacteria | 3759 |
| 649 | Ga0207674_10080496 | 3300026116 | Bacteria | 3261 |
| 650 | Ga0207674_10198274 | 3300026116 | Bacteria | 1957 |
| 651 | Ga0207674_10351489 | 3300026116 | Bacteria | 1425 |
| 652 | Ga0207675_100007636 | 3300026118 | Bacteria | 10214 |
| 653 | Ga0207675_100009536 | 3300026118 | Bacteria | 9078 |
| 654 | Ga0207675_100013715 | 3300026118 | Bacteria | 7563 |
| 655 | Ga0207675_100080852 | 3300026118 | Bacteria | 3047 |
| 656 | Ga0207675_100097026 | 3300026118 | Bacteria | 2775 |
| 657 | Ga0207683_10000772 | 3300026121 | Bacteria | 29159 |
| 658 | Ga0207683_10003905 | 3300026121 | Bacteria | 12920 |
| 659 | Ga0207683_10008837 | 3300026121 | Bacteria | 8593 |
| 660 | Ga0207683_10032299 | 3300026121 | Bacteria | 4548 |
| 661 | Ga0207683_10122255 | 3300026121 | Bacteria | 2338 |
| 662 | Ga0207698_10001479 | 3300026142 | Bacteria | 13677 |
| 663 | Ga0207698_10001813 | 3300026142 | Bacteria | 12478 |
| 664 | Ga0207698_10005852 | 3300026142 | Bacteria | 7639 |
| 665 | Ga0207698_10070822 | 3300026142 | Bacteria | 2764 |
| 666 | Ga0207698_10196066 | 3300026142 | Bacteria | 1804 |
| 667 | Ga0209813_10002341 | 3300027866 | Bacteria | 4345 |
| 668 | Ga0207428_10000976 | 3300027907 | Bacteria | 31618 |
| 669 | Ga0207428_10061848 | 3300027907 | Bacteria | 2963 |
| 670 | Ga0207428_10181296 | 3300027907 | Bacteria | 1591 |
| 671 | Ga0268266_10006262 | 3300028379 | Bacteria | 10918 |
| 672 | Ga0268266_10022863 | 3300028379 | Bacteria | 5321 |
| 673 | Ga0268266_10056335 | 3300028379 | Bacteria | 3382 |
| 674 | Ga0268266_10251610 | 3300028379 | Bacteria | 1634 |
| 675 | Ga0268265_10010662 | 3300028380 | Bacteria | 6207 |
| 676 | Ga0268265_10021583 | 3300028380 | Bacteria | 4514 |
| 677 | Ga0268264_10003254 | 3300028381 | Bacteria | 14049 |
| 678 | Ga0268264_10018989 | 3300028381 | Bacteria | 5620 |
| 679 | Ga0268264_10059778 | 3300028381 | Bacteria | 3194 |
| 680 | Ga0268264_10121427 | 3300028381 | Bacteria | 2303 |
| 681 | Ga0265337_1001378 | 3300028556 | Bacteria | 11957 |
| 682 | Ga0265326_10012682 | 3300028558 | Bacteria | 2472 |
| 683 | Ga0265319_1001043 | 3300028563 | Bacteria | 17329 |
| 684 | Ga0265334_10001867 | 3300028573 | Bacteria | 10016 |
| 685 | Ga0265334_10030060 | 3300028573 | Bacteria | 2175 |
| 686 | Ga0265318_10019527 | 3300028577 | Bacteria | 2747 |
| 687 | Ga0307515_10000027 | 3300028794 | Bacteria | 371624 |
| 688 | Ga0307515_10066071 | 3300028794 | Bacteria | 5018 |
| 689 | Ga0307515_10129340 | 3300028794 | Bacteria | 2793 |
| 690 | Ga0307515_10227977 | 3300028794 | Bacteria | 1663 |
| 691 | Ga0265338_10001035 | 3300028800 | Bacteria | 46510 |
| 692 | Ga0265338_10006264 | 3300028800 | Bacteria | 15225 |
| 693 | Ga0265338_10054763 | 3300028800 | Bacteria | 3553 |
| 694 | Ga0307511_10001301 | 3300030521 | Bacteria | 26468 |
| 695 | Ga0314311_1212962 | 3300030733 | Bacteria | 2018 |
| 696 | Ga0265325_10006702 | 3300031241 | Bacteria | 6968 |
| 697 | Ga0265340_10001983 | 3300031247 | Bacteria | 11708 |
| 698 | Ga0265340_10013753 | 3300031247 | Bacteria | 4244 |
| 699 | Ga0265340_10017009 | 3300031247 | Bacteria | 3761 |
| 700 | Ga0265340_10017262 | 3300031247 | Bacteria | 3731 |
| 701 | Ga0265339_10023224 | 3300031249 | Bacteria | 3587 |
| 702 | Ga0265327_10000303 | 3300031251 | Bacteria | 95597 |
| 703 | Ga0265327_10001438 | 3300031251 | Bacteria | 30041 |
| 704 | Ga0265316_10041947 | 3300031344 | Bacteria | 3659 |
| 705 | Ga0307513_10231673 | 3300031456 | Bacteria | 1659 |
| 706 | Ga0307509_10054677 | 3300031507 | Bacteria | 4248 |
| 707 | Ga0307508_10004026 | 3300031616 | Bacteria | 14548 |
| 708 | Ga0307514_10092337 | 3300031649 | Bacteria | 2202 |
| 709 | Ga0316575_10005460 | 3300031665 | Bacteria | 4533 |
| 710 | Ga0265314_10016524 | 3300031711 | Bacteria | 5822 |
| 711 | Ga0265342_10070307 | 3300031712 | Bacteria | 2042 |
| 712 | Ga0316576_10000208 | 3300031727 | Bacteria | 24680 |
| 713 | Ga0316576_10000264 | 3300031727 | Bacteria | 22816 |
| 714 | Ga0316576_10015164 | 3300031727 | Bacteria | 5165 |
| 715 | Ga0316576_10021294 | 3300031727 | Bacteria | 4482 |
| 716 | Ga0307516_10005562 | 3300031730 | Bacteria | 15026 |
| 717 | Ga0307405_10038551 | 3300031731 | Bacteria | 2882 |
| 718 | Ga0316577_10002961 | 3300031733 | Bacteria | 8500 |
| 719 | Ga0307413_10020698 | 3300031824 | Bacteria | 3506 |
| 720 | Ga0307413_10073600 | 3300031824 | Bacteria | 2160 |
| 721 | Ga0307410_10082099 | 3300031852 | Bacteria | 2267 |
| 722 | Ga0326468_10000319 | 3300031889 | Bacteria | 5101 |
| 723 | Ga0307406_10056841 | 3300031901 | Bacteria | 2508 |
| 724 | Ga0307406_10065433 | 3300031901 | Bacteria | 2363 |
| 725 | Ga0307407_10002637 | 3300031903 | Bacteria | 7092 |
| 726 | Ga0307407_10021731 | 3300031903 | Bacteria | 3316 |
| 727 | Ga0307409_100003188 | 3300031995 | Bacteria | 8819 |
| 728 | Ga0307409_100015666 | 3300031995 | Bacteria | 4984 |
| 729 | Ga0307409_100018133 | 3300031995 | Bacteria | 4718 |
| 730 | Ga0307409_100046231 | 3300031995 | Bacteria | 3294 |
| 731 | Ga0307409_100065113 | 3300031995 | Bacteria | 2866 |
| 732 | Ga0307409_100066141 | 3300031995 | Bacteria | 2848 |
| 733 | Ga0307409_100131339 | 3300031995 | Bacteria | 2141 |
| 734 | Ga0307409_100240190 | 3300031995 | Bacteria | 1648 |
| 735 | Ga0307416_100003741 | 3300032002 | Bacteria | 9028 |
| 736 | Ga0307416_100009098 | 3300032002 | Bacteria | 6472 |
| 737 | Ga0307416_100010065 | 3300032002 | Bacteria | 6227 |
| 738 | Ga0307416_100051807 | 3300032002 | Bacteria | 3282 |
| 739 | Ga0307416_100087560 | 3300032002 | Bacteria | 2659 |
| 740 | Ga0307416_100107698 | 3300032002 | Bacteria | 2447 |
| 741 | Ga0307416_100114950 | 3300032002 | Bacteria | 2382 |
| 742 | Ga0307416_100193370 | 3300032002 | Bacteria | 1922 |
| 743 | Ga0307416_100301960 | 3300032002 | Bacteria | 1592 |
| 744 | Ga0307414_10132602 | 3300032004 | Bacteria | 1937 |
| 745 | Ga0307411_10006601 | 3300032005 | Bacteria | 5822 |
| 746 | Ga0307415_100000071 | 3300032126 | Bacteria | 42220 |
| 747 | Ga0307415_100005737 | 3300032126 | Bacteria | 6619 |
| 748 | Ga0307415_100032960 | 3300032126 | Bacteria | 3357 |
| 749 | Ga0307415_100044564 | 3300032126 | Bacteria | 2967 |
| 750 | Ga0307415_100059026 | 3300032126 | Bacteria | 2644 |
| 751 | Ga0307415_100072424 | 3300032126 | Bacteria | 2427 |
| 752 | Ga0307415_100085540 | 3300032126 | Bacteria | 2266 |
| 753 | Ga0307415_100095214 | 3300032126 | Bacteria | 2167 |
| 754 | Ga0307415_100122703 | 3300032126 | Bacteria | 1951 |
| 755 | Ga0307507_10000001 | 3300033179 | Bacteria | 417520 |
| 756 | Ga0316587_1003395 | 3300033529 | Bacteria | 2228 |
| 757 | Ga0316587_1005033 | 3300033529 | Bacteria | 1957 |
| 758 | Ga0316587_1010829 | 3300033529 | Bacteria | 1463 |
| 759 | Ga0373950_0001388 | 3300034818 | Bacteria | 3153 |
| 760 | Ga0373938_0016100 | 3300034957 | Bacteria | 1457 |
| 761 | Ga0373926_0000182 | 3300035083 | Bacteria | 14126 |
| 762 | Ga0373926_0001667 | 3300035083 | Bacteria | 6864 |
| 763 | Ga0373926_0003441 | 3300035083 | Bacteria | 5100 |
| 764 | Ga0373926_0031073 | 3300035083 | Bacteria | 1882 |
| 765 | Ga0373934_0000109 | 3300035086 | Bacteria | 29409 |
| 766 | Ga0373934_0001845 | 3300035086 | Bacteria | 7778 |
| 767 | Ga0373934_0002127 | 3300035086 | Bacteria | 7268 |
| 768 | Ga0373934_0021094 | 3300035086 | Bacteria | 2509 |
| 769 | Ga0373934_0030713 | 3300035086 | Bacteria | 2101 |
| 770 | Ga0373934_0038057 | 3300035086 | Bacteria | 1894 |
| 771 | Ga0373934_0064473 | 3300035086 | Bacteria | 1462 |
| 772 | Ga0373951_0000180 | 3300035091 | Bacteria | 22725 |
| 773 | Ga0373952_0006560 | 3300035092 | Bacteria | 2154 |
| 774 | Ga0373923_0000129 | 3300035111 | Bacteria | 13969 |
| 775 | Ga0373923_0015564 | 3300035111 | Bacteria | 2874 |
| 776 | Ga0373923_0025003 | 3300035111 | Bacteria | 2362 |
| 777 | Ga0373923_0034811 | 3300035111 | Bacteria | 2046 |
| 778 | Ga0373923_0100727 | 3300035111 | Bacteria | 1273 |
| 779 | Ga0373932_0008770 | 3300035112 | Bacteria | 2420 |
| 780 | Ga0373932_0019184 | 3300035112 | Bacteria | 1779 |
| 781 | Ga0373936_0012109 | 3300035113 | Bacteria | 3275 |
| 782 | Ga0373936_0030205 | 3300035113 | Bacteria | 2137 |
| 783 | Ga0373939_0016970 | 3300035114 | Bacteria | 1927 |
| 784 | Ga0373945_0000108 | 3300035116 | Bacteria | 19713 |
| 785 | Ga0373945_0002663 | 3300035116 | Bacteria | 5597 |
| 786 | Ga0373945_0006241 | 3300035116 | Bacteria | 3838 |
| 787 | Ga0373953_0000026 | 3300035117 | Bacteria | 40030 |
| 788 | Ga0373953_0011211 | 3300035117 | Bacteria | 3140 |
| 789 | Ga0373953_0018750 | 3300035117 | Bacteria | 2565 |
| 790 | Ga0373953_0024094 | 3300035117 | Bacteria | 2310 |
| 791 | Ga0373954_0006046 | 3300035118 | Bacteria | 5264 |
| 792 | Ga0373954_0006922 | 3300035118 | Bacteria | 4949 |
| 793 | Ga0373954_0011406 | 3300035118 | Bacteria | 3938 |
| 794 | Ga0373954_0011949 | 3300035118 | Bacteria | 3857 |
| 795 | Ga0373954_0027261 | 3300035118 | Bacteria | 2621 |
| 796 | Ga0373954_0031152 | 3300035118 | Bacteria | 2461 |
| 797 | Ga0373956_0001484 | 3300035119 | Bacteria | 9701 |
| 798 | Ga0373956_0029611 | 3300035119 | Bacteria | 2388 |
| 799 | Ga0373956_0061514 | 3300035119 | Bacteria | 1701 |
| 800 | Ga0373957_0000038 | 3300035120 | Bacteria | 34200 |
| 801 | Ga0373957_0000972 | 3300035120 | Bacteria | 7524 |
| 802 | Ga0373943_0001545 | 3300035170 | Bacteria | 10430 |
| 803 | Ga0373943_0003488 | 3300035170 | Bacteria | 7161 |
| 804 | Ga0373943_0105497 | 3300035170 | Bacteria | 1479 |
| 805 | Ga0373946_0028410 | 3300035171 | Bacteria | 2218 |
| 806 | Ga0373955_0000841 | 3300035172 | Bacteria | 13157 |
| 807 | Ga0373955_0012628 | 3300035172 | Bacteria | 4062 |
| 808 | Ga0373955_0015149 | 3300035172 | Bacteria | 3769 |
| 809 | Ga0373955_0064649 | 3300035172 | Bacteria | 2028 |
| 810 | Ga0373955_0070526 | 3300035172 | Bacteria | 1952 |
| 811 | Ga0373942_0015698 | 3300035207 | Bacteria | 1849 |
| 812 | Ga0373962_0011166 | 3300035242 | Bacteria | 2247 |
| 813 | Ga0316574_0010285 | 3300035398 | Bacteria | 5280 |
| 814 | Ga0316574_0015276 | 3300035398 | Bacteria | 4453 |
| 815 | Ga0316574_0023786 | 3300035398 | Bacteria | 3661 |
| 816 | Ga0316574_0068299 | 3300035398 | Bacteria | 2241 |
| 817 | Ga0373924_0002452 | 3300035410 | Bacteria | 6241 |
| 818 | Ga0373924_0004584 | 3300035410 | Bacteria | 4834 |
| 819 | Ga0373924_0008148 | 3300035410 | Bacteria | 3797 |
| 820 | Ga0373924_0048402 | 3300035410 | Bacteria | 1756 |
| 821 | Ga0373931_0037655 | 3300035691 | Bacteria | 2525 |
| 822 | Ga0373931_0058559 | 3300035691 | Bacteria | 2069 |
| 823 | Ga0373935_0000541 | 3300035692 | Bacteria | 19633 |
| 824 | Ga0373935_0001486 | 3300035692 | Bacteria | 13024 |
| 825 | Ga0373935_0007408 | 3300035692 | Bacteria | 6567 |
| 826 | Ga0373935_0036971 | 3300035692 | Bacteria | 3054 |
| 827 | Ga0373935_0055524 | 3300035692 | Bacteria | 2523 |
| 828 | Ga0373927_0000680 | 3300035695 | Bacteria | 25895 |
| 829 | Ga0373927_0205419 | 3300035695 | Bacteria | 1293 |
| 830 | Ga0373933_0000188 | 3300035724 | Bacteria | 40947 |
| 831 | Ga0373933_0000604 | 3300035724 | Bacteria | 22424 |
| 832 | Ga0373933_0007701 | 3300035724 | Bacteria | 5881 |
| 833 | Ga0373933_0036485 | 3300035724 | Bacteria | 2878 |
| 834 | Ga0373933_0036606 | 3300035724 | Bacteria | 2873 |
| 835 | Ga0373933_0042571 | 3300035724 | Bacteria | 2684 |
| 836 | Ga0373933_0083526 | 3300035724 | Bacteria | 1961 |
| 837 | Ga0373947_0000003 | 3300035725 | Bacteria | 345338 |
| 838 | Ga0373947_0002803 | 3300035725 | Bacteria | 10417 |
| 839 | Ga0373947_0112580 | 3300035725 | Bacteria | 1721 |
| 840 | Ga0373947_0155331 | 3300035725 | Bacteria | 1476 |
| 841 | Ga0373937_0000138 | 3300036401 | Bacteria | 70068 |
| 842 | Ga0373937_0001588 | 3300036401 | Bacteria | 19105 |
| 843 | Ga0373937_0059365 | 3300036401 | Bacteria | 3515 |
| 844 | Ga0373937_0062370 | 3300036401 | Bacteria | 3427 |
| 845 | Ga0373937_0107679 | 3300036401 | Bacteria | 2591 |
| 846 | Ga0373937_0290635 | 3300036401 | Bacteria | 1544 |
| 847 | Ga0316582_0030200 | 3300036647 | Bacteria | 3299 |
| 848 | Ga0316584_0005941 | 3300036712 | Bacteria | 8239 |
| 849 | Ga0316584_0015706 | 3300036712 | Bacteria | 5419 |
| 850 | Ga0373925_0000400 | 3300037068 | Bacteria | 44261 |
| 851 | Ga0373925_0000699 | 3300037068 | Bacteria | 31424 |
| 852 | Ga0373925_0036510 | 3300037068 | Bacteria | 3627 |
| 853 | Ga0395899_0003096 | 3300037312 | Bacteria | 13237 |
| 854 | Ga0395899_0098042 | 3300037312 | Bacteria | 2118 |
| 855 | Ga0395900_0007778 | 3300037418 | Bacteria | 11058 |
| 856 | Ga0395900_0034891 | 3300037418 | Bacteria | 5182 |
| 857 | Ga0395900_0121921 | 3300037418 | Bacteria | 2675 |
| 858 | Ga0395898_0058456 | 3300037466 | Bacteria | 3753 |
| 859 | Ga0395898_0065076 | 3300037466 | Bacteria | 3535 |
| 860 | Ga0395898_0169526 | 3300037466 | Bacteria | 2087 |
| 861 | Ga0395905_0034235 | 3300037471 | Bacteria | 4769 |
| 862 | Ga0436364_0050345 | 3300037853 | Bacteria | 1318 |
| 863 | Ga0436364_0151261 | 3300037853 | Bacteria | 9936 |
| 864 | Ga0436364_0206485 | 3300037853 | Bacteria | 20706 |
| 865 | Ga0436364_0207639 | 3300037853 | Bacteria | 28695 |
| 866 | Ga0436364_0232843 | 3300037853 | Bacteria | 50861 |
| 867 | Ga0436364_0343519 | 3300037853 | Bacteria | 7214 |
| 868 | Ga0436364_0540807 | 3300037853 | Bacteria | 3855 |
| 869 | Ga0436364_1306745 | 3300037853 | Bacteria | 3959 |
| 870 | Ga0436364_1391037 | 3300037853 | Bacteria | 2099 |
| 871 | Ga0436364_1522620 | 3300037853 | Bacteria | 6371 |
| 872 | Ga0395901_0020378 | 3300038443 | Bacteria | 6788 |
| 873 | Ga0395901_0128065 | 3300038443 | Bacteria | 2668 |
| 874 | Ga0395901_0239284 | 3300038443 | Bacteria | 1893 |
| 875 | Ga0400488_46678 | 3300038741 | Bacteria | 2393 |
| 876 | Ga0400488_55885 | 3300038741 | Bacteria | 27888 |
| 877 | Ga0400483_037289 | 3300039062 | Bacteria | 5955 |
| 878 | Ga0400483_246361 | 3300039062 | Bacteria | 6457 |
| 879 | Ga0400489_90291 | 3300039093 | Bacteria | 9492 |
| 880 | Ga0400489_92236 | 3300039093 | Bacteria | 51082 |
| 881 | Ga0400487_46379 | 3300039110 | Bacteria | 4510 |
| 882 | Ga0400487_56871 | 3300039110 | Bacteria | 7932 |
| 883 | Ga0436365_0575809 | 3300039437 | Bacteria | 3680 |
| 884 | Ga0436365_1505452 | 3300039437 | Bacteria | 4297 |
| 885 | Ga0436363_0714317 | 3300039450 | Bacteria | 2203 |
| 886 | Ga0436363_0778823 | 3300039450 | Bacteria | 2097 |
| 887 | Ga0451833_1422046 | 3300041491 | Bacteria | 1998 |
| 888 | Ga0466969_0006927 | 3300044656 | Bacteria | 6031 |
| 889 | Ga0466969_0030015 | 3300044656 | Bacteria | 2772 |
| 890 | Ga0466972_0000561 | 3300044658 | Bacteria | 18133 |
| 891 | Ga0466972_0016381 | 3300044658 | Bacteria | 3707 |
| 892 | Ga0466972_0024084 | 3300044658 | Bacteria | 3022 |
| 893 | Ga0466972_0026321 | 3300044658 | Bacteria | 2883 |
| 894 | Ga0466965_0000033 | 3300044683 | Bacteria | 52298 |
| 895 | Ga0466965_0003444 | 3300044683 | Bacteria | 6939 |
| 896 | Ga0466965_0007762 | 3300044683 | Bacteria | 4939 |
| 897 | Ga0466965_0016329 | 3300044683 | Bacteria | 3531 |
| 898 | Ga0466965_0021631 | 3300044683 | Bacteria | 3098 |
| 899 | Ga0466965_0029880 | 3300044683 | Bacteria | 2653 |
| 900 | Ga0466966_0004604 | 3300044684 | Bacteria | 9083 |
| 901 | Ga0466966_0013174 | 3300044684 | Bacteria | 5476 |
| 902 | Ga0466966_0028566 | 3300044684 | Bacteria | 3631 |
| 903 | Ga0466966_0047307 | 3300044684 | Bacteria | 2743 |
| 904 | Ga0466966_0075640 | 3300044684 | Bacteria | 2104 |
| 905 | Ga0466961_0001757 | 3300044693 | Bacteria | 13456 |
| 906 | Ga0466961_0002160 | 3300044693 | Bacteria | 12237 |
| 907 | Ga0466961_0005395 | 3300044693 | Bacteria | 8050 |
| 908 | Ga0466961_0032277 | 3300044693 | Bacteria | 3364 |
| 909 | Ga0466961_0053842 | 3300044693 | Bacteria | 2567 |
| 910 | Ga0466961_0118351 | 3300044693 | Bacteria | 1664 |
| 911 | Ga0466963_0001901 | 3300044694 | Bacteria | 11416 |
| 912 | Ga0466963_0003409 | 3300044694 | Bacteria | 9096 |
| 913 | Ga0466963_0005394 | 3300044694 | Bacteria | 7485 |
| 914 | Ga0466963_0016029 | 3300044694 | Bacteria | 4653 |
| 915 | Ga0466963_0056721 | 3300044694 | Bacteria | 2607 |
| 916 | Ga0466963_0098471 | 3300044694 | Bacteria | 1999 |
| 917 | Ga0466963_0106439 | 3300044694 | Bacteria | 1923 |
| 918 | Ga0466964_0004578 | 3300044706 | Bacteria | 5114 |
| 919 | Ga0453684_0009878 | 3300044712 | Bacteria | 16506 |
| 920 | Ga0453684_0029978 | 3300044712 | Bacteria | 7701 |
| 921 | Ga0466971_0040714 | 3300044719 | Bacteria | 2087 |
| 922 | Ga0466968_0013176 | 3300044735 | Bacteria | 3248 |
| 923 | Ga0466970_0002336 | 3300044765 | Bacteria | 9173 |
| 924 | Ga0466970_0011058 | 3300044765 | Bacteria | 4594 |
| 925 | Ga0466970_0023147 | 3300044765 | Bacteria | 3243 |
| 926 | Ga0466970_0057098 | 3300044765 | Bacteria | 2087 |
| 927 | Ga0466957_0002955 | 3300044842 | Bacteria | 9218 |
| 928 | Ga0466957_0020263 | 3300044842 | Bacteria | 3913 |
| 929 | Ga0466957_0030002 | 3300044842 | Bacteria | 3246 |
| 930 | Ga0466957_0046861 | 3300044842 | Bacteria | 2626 |
| 931 | Ga0466957_0138971 | 3300044842 | Bacteria | 1564 |
| 932 | Ga0466960_0000745 | 3300044901 | Bacteria | 11417 |
| 933 | Ga0466960_0009176 | 3300044901 | Bacteria | 4070 |
| 934 | Ga0466960_0018156 | 3300044901 | Bacteria | 3078 |
| 935 | Ga0466960_0021518 | 3300044901 | Bacteria | 2872 |
| 936 | Ga0466960_0040212 | 3300044901 | Bacteria | 2210 |
| 937 | Ga0466960_0069360 | 3300044901 | Bacteria | 1751 |
| 938 | Ga0466960_0082756 | 3300044901 | Bacteria | 1621 |
| 939 | Ga0466959_0017177 | 3300045049 | Bacteria | 5298 |
| 940 | Ga0466959_0038424 | 3300045049 | Bacteria | 3537 |
| 941 | Ga0466959_0097432 | 3300045049 | Bacteria | 2108 |
| 942 | Ga0466959_0147916 | 3300045049 | Bacteria | 1657 |
| 943 | Ga0466958_0002571 | 3300045836 | Bacteria | 9161 |
| 944 | Ga0466958_0028022 | 3300045836 | Bacteria | 3337 |
| 945 | Ga0466958_0029484 | 3300045836 | Bacteria | 3256 |
| 946 | Ga0466958_0039593 | 3300045836 | Bacteria | 2833 |
| 947 | Ga0466958_0112114 | 3300045836 | Bacteria | 1703 |
| 948 | Ga0466958_0122299 | 3300045836 | Bacteria | 1630 |
| 949 | Ga0466967_0002082 | 3300045976 | Bacteria | 12246 |
| 950 | Ga0466967_0005091 | 3300045976 | Bacteria | 9024 |
| 951 | Ga0466967_0016571 | 3300045976 | Bacteria | 5817 |
| 952 | Ga0466967_0033243 | 3300045976 | Bacteria | 4364 |
| 953 | Ga0466967_0036222 | 3300045976 | Bacteria | 4210 |
| 954 | Ga0466967_0049038 | 3300045976 | Bacteria | 3691 |
| 955 | Ga0466967_0053897 | 3300045976 | Bacteria | 3537 |
| 956 | Ga0466967_0068868 | 3300045976 | Bacteria | 3161 |
| 957 | Ga0466967_0071041 | 3300045976 | Bacteria | 3116 |
| 958 | Ga0466967_0082103 | 3300045976 | Bacteria | 2912 |
| 959 | Ga0466967_0108688 | 3300045976 | Bacteria | 2545 |
| 960 | Ga0466967_0132620 | 3300045976 | Bacteria | 2314 |
| 961 | Ga0466967_0136992 | 3300045976 | Bacteria | 2277 |
| 962 | Ga0466967_0155512 | 3300045976 | Bacteria | 2141 |
| 963 | Ga0466967_0225251 | 3300045976 | Bacteria | 1783 |
| 964 | Ga0495592_0000041 | 3300046454 | Bacteria | 123431 |
| 965 | Ga0495592_0002850 | 3300046454 | Bacteria | 12278 |
| 966 | Ga0495592_0025383 | 3300046454 | Bacteria | 4499 |
| 967 | Ga0495592_0033870 | 3300046454 | Bacteria | 3852 |
| 968 | Ga0495592_0047303 | 3300046454 | Bacteria | 3203 |
| 969 | Ga0495592_0049321 | 3300046454 | Bacteria | 3129 |
| 970 | Ga0495603_0010135 | 3300046455 | Bacteria | 5703 |
| 971 | Ga0495629_0005572 | 3300046459 | Bacteria | 9400 |
| 972 | Ga0495629_0007344 | 3300046459 | Bacteria | 8123 |
| 973 | Ga0495629_0043776 | 3300046459 | Bacteria | 3143 |
| 974 | Ga0495629_0047902 | 3300046459 | Bacteria | 2997 |
| 975 | Ga0495629_0056443 | 3300046459 | Bacteria | 2745 |
| 976 | Ga0495641_0021199 | 3300046461 | Bacteria | 3274 |
| 977 | Ga0495641_0028361 | 3300046461 | Bacteria | 2710 |
| 978 | Ga0495641_0043813 | 3300046461 | Bacteria | 2068 |
| 979 | Ga0495641_0070729 | 3300046461 | Bacteria | 1567 |
| 980 | Ga0495651_0000018 | 3300046462 | Bacteria | 123195 |
| 981 | Ga0495651_0009202 | 3300046462 | Bacteria | 7584 |
| 982 | Ga0495651_0011383 | 3300046462 | Bacteria | 6835 |
| 983 | Ga0495651_0031225 | 3300046462 | Bacteria | 4155 |
| 984 | Ga0495651_0035162 | 3300046462 | Bacteria | 3902 |
| 985 | Ga0495651_0037714 | 3300046462 | Bacteria | 3763 |
| 986 | Ga0495651_0053368 | 3300046462 | Bacteria | 3112 |
| 987 | Ga0495651_0069311 | 3300046462 | Bacteria | 2686 |
| 988 | Ga0495651_0142234 | 3300046462 | Bacteria | 1738 |
| 989 | Ga0495653_0003023 | 3300046463 | Bacteria | 13488 |
| 990 | Ga0495653_0017016 | 3300046463 | Bacteria | 5914 |
| 991 | Ga0495653_0018739 | 3300046463 | Bacteria | 5619 |
| 992 | Ga0495653_0059305 | 3300046463 | Bacteria | 2905 |
| 993 | Ga0495653_0072340 | 3300046463 | Bacteria | 2574 |
| 994 | Ga0495582_0009586 | 3300046473 | Bacteria | 5332 |
| 995 | Ga0495582_0011706 | 3300046473 | Bacteria | 4834 |
| 996 | Ga0495582_0032044 | 3300046473 | Bacteria | 2891 |
| 997 | Ga0495582_0097833 | 3300046473 | Bacteria | 1641 |
| 998 | Ga0495662_0002680 | 3300046476 | Bacteria | 8992 |
| 999 | Ga0495662_0005429 | 3300046476 | Bacteria | 6382 |
| 1000 | Ga0495664_0001298 | 3300046477 | Bacteria | 13086 |
| 1001 | Ga0495664_0016579 | 3300046477 | Bacteria | 4199 |
| 1002 | Ga0495664_0027977 | 3300046477 | Bacteria | 3289 |
| 1003 | Ga0495664_0037228 | 3300046477 | Bacteria | 2871 |
| 1004 | Ga0495594_0021375 | 3300046499 | Bacteria | 3454 |
| 1005 | Ga0495594_0021541 | 3300046499 | Bacteria | 3440 |
| 1006 | Ga0495594_0027716 | 3300046499 | Bacteria | 3053 |
| 1007 | Ga0495596_0067415 | 3300046500 | Bacteria | 1391 |
| 1008 | Ga0495606_0013094 | 3300046507 | Bacteria | 6588 |
| 1009 | Ga0495608_0000039 | 3300046511 | Bacteria | 123195 |
| 1010 | Ga0495608_0007120 | 3300046511 | Bacteria | 7912 |
| 1011 | Ga0495608_0017964 | 3300046511 | Bacteria | 4887 |
| 1012 | Ga0495608_0030826 | 3300046511 | Bacteria | 3627 |
| 1013 | Ga0495608_0078393 | 3300046511 | Bacteria | 2149 |
| 1014 | Ga0495618_0001552 | 3300046514 | Bacteria | 15406 |
| 1015 | Ga0495618_0020662 | 3300046514 | Bacteria | 4053 |
| 1016 | Ga0495618_0054617 | 3300046514 | Bacteria | 2528 |
| 1017 | Ga0495618_0130751 | 3300046514 | Bacteria | 1606 |
| 1018 | Ga0495628_0000219 | 3300046516 | Bacteria | 50121 |
| 1019 | Ga0495628_0003347 | 3300046516 | Bacteria | 14334 |
| 1020 | Ga0495628_0011141 | 3300046516 | Bacteria | 7612 |
| 1021 | Ga0495628_0030202 | 3300046516 | Bacteria | 4389 |
| 1022 | Ga0495628_0124610 | 3300046516 | Bacteria | 1974 |
| 1023 | Ga0495630_0031062 | 3300046517 | Bacteria | 3975 |
| 1024 | Ga0495630_0064011 | 3300046517 | Bacteria | 2762 |
| 1025 | Ga0495630_0082178 | 3300046517 | Bacteria | 2431 |
| 1026 | Ga0495630_0110066 | 3300046517 | Bacteria | 2086 |
| 1027 | Ga0495652_0000092 | 3300046529 | Bacteria | 96258 |
| 1028 | Ga0495652_0024482 | 3300046529 | Bacteria | 5343 |
| 1029 | Ga0495652_0050293 | 3300046529 | Bacteria | 3563 |
| 1030 | Ga0495652_0074837 | 3300046529 | Bacteria | 2815 |
| 1031 | Ga0495652_0114558 | 3300046529 | Bacteria | 2162 |
| 1032 | Ga0495665_0000931 | 3300046531 | Bacteria | 15431 |
| 1033 | Ga0495665_0004607 | 3300046531 | Bacteria | 7439 |
| 1034 | Ga0495665_0006900 | 3300046531 | Bacteria | 6130 |
| 1035 | Ga0495665_0070809 | 3300046531 | Bacteria | 1837 |
| 1036 | Ga0495640_0009819 | 3300046533 | Bacteria | 7428 |
| 1037 | Ga0495640_0032645 | 3300046533 | Bacteria | 3707 |
| 1038 | Ga0495640_0034686 | 3300046533 | Bacteria | 3574 |
| 1039 | Ga0495640_0079305 | 3300046533 | Bacteria | 2186 |
| 1040 | Ga0495640_0112828 | 3300046533 | Bacteria | 1774 |
| 1041 | Ga0495586_0004920 | 3300046535 | Bacteria | 7146 |
| 1042 | Ga0495586_0008834 | 3300046535 | Bacteria | 5366 |
| 1043 | Ga0495586_0039928 | 3300046535 | Bacteria | 2524 |
| 1044 | Ga0495586_0057677 | 3300046535 | Bacteria | 2107 |
| 1045 | Ga0495587_0000034 | 3300046536 | Bacteria | 123432 |
| 1046 | Ga0495587_0000538 | 3300046536 | Bacteria | 26274 |
| 1047 | Ga0495587_0012295 | 3300046536 | Bacteria | 5395 |
| 1048 | Ga0495587_0012821 | 3300046536 | Bacteria | 5271 |
| 1049 | Ga0495587_0017071 | 3300046536 | Bacteria | 4512 |
| 1050 | Ga0495587_0045833 | 3300046536 | Bacteria | 2597 |
| 1051 | Ga0495645_0018528 | 3300046543 | Bacteria | 5002 |
| 1052 | Ga0495645_0034852 | 3300046543 | Bacteria | 3670 |
| 1053 | Ga0495645_0062902 | 3300046543 | Bacteria | 2687 |
| 1054 | Ga0495645_0143473 | 3300046543 | Bacteria | 1664 |
| 1055 | Ga0495667_0000150 | 3300046559 | Bacteria | 47612 |
| 1056 | Ga0495667_0000669 | 3300046559 | Bacteria | 21922 |
| 1057 | Ga0495667_0001777 | 3300046559 | Bacteria | 14303 |
| 1058 | Ga0495667_0013704 | 3300046559 | Bacteria | 5478 |
| 1059 | Ga0495667_0018638 | 3300046559 | Bacteria | 4686 |
| 1060 | Ga0495667_0036999 | 3300046559 | Bacteria | 3254 |
| 1061 | Ga0495667_0062859 | 3300046559 | Bacteria | 2432 |
| 1062 | Ga0495667_0138833 | 3300046559 | Bacteria | 1566 |
| 1063 | Ga0495668_0000182 | 3300046616 | Bacteria | 93763 |
| 1064 | Ga0495634_0003876 | 3300046642 | Bacteria | 11882 |
| 1065 | Ga0495634_0017558 | 3300046642 | Bacteria | 5103 |
| 1066 | Ga0495634_0028083 | 3300046642 | Bacteria | 3909 |
| 1067 | Ga0495634_0069487 | 3300046642 | Bacteria | 2323 |
| 1068 | Ga0495634_0082621 | 3300046642 | Bacteria | 2098 |
| 1069 | Ga0495625_0000464 | 3300046660 | Bacteria | 60878 |
| 1070 | Ga0495635_0000138 | 3300046663 | Bacteria | 44247 |
| 1071 | Ga0495635_0007591 | 3300046663 | Bacteria | 7567 |
| 1072 | Ga0495635_0046808 | 3300046663 | Bacteria | 2983 |
| 1073 | Ga0495657_0000247 | 3300046675 | Bacteria | 49117 |
| 1074 | Ga0495657_0016894 | 3300046675 | Bacteria | 5305 |
| 1075 | Ga0495657_0038707 | 3300046675 | Bacteria | 3280 |
| 1076 | Ga0495657_0045690 | 3300046675 | Bacteria | 2970 |
| 1077 | Ga0495657_0051156 | 3300046675 | Bacteria | 2774 |
| 1078 | Ga0495657_0059797 | 3300046675 | Bacteria | 2526 |
| 1079 | Ga0495657_0060132 | 3300046675 | Bacteria | 2518 |
| 1080 | Ga0495657_0170129 | 3300046675 | Bacteria | 1342 |
| 1081 | Ga0495599_0000108 | 3300046678 | Bacteria | 56078 |
| 1082 | Ga0495599_0001098 | 3300046678 | Bacteria | 15229 |
| 1083 | Ga0495599_0029060 | 3300046678 | Bacteria | 3464 |
| 1084 | Ga0495599_0082042 | 3300046678 | Bacteria | 2014 |
| 1085 | Ga0495599_0085122 | 3300046678 | Bacteria | 1974 |
| 1086 | Ga0495623_0000287 | 3300046679 | Bacteria | 32946 |
| 1087 | Ga0495623_0011210 | 3300046679 | Bacteria | 5798 |
| 1088 | Ga0495623_0016471 | 3300046679 | Bacteria | 4775 |
| 1089 | Ga0495623_0024688 | 3300046679 | Bacteria | 3870 |
| 1090 | Ga0495623_0030914 | 3300046679 | Bacteria | 3445 |
| 1091 | Ga0495623_0070403 | 3300046679 | Bacteria | 2179 |
| 1092 | Ga0495646_0008529 | 3300046680 | Bacteria | 6511 |
| 1093 | Ga0495646_0011228 | 3300046680 | Bacteria | 5687 |
| 1094 | Ga0495646_0029846 | 3300046680 | Bacteria | 3405 |
| 1095 | Ga0495646_0039786 | 3300046680 | Bacteria | 2897 |
| 1096 | Ga0495646_0048843 | 3300046680 | Bacteria | 2569 |
| 1097 | Ga0495647_0008900 | 3300046681 | Bacteria | 3384 |
| 1098 | Ga0495658_0004732 | 3300046683 | Bacteria | 6682 |
| 1099 | Ga0495658_0018605 | 3300046683 | Bacteria | 3614 |
| 1100 | Ga0495613_0003455 | 3300046689 | Bacteria | 11809 |
| 1101 | Ga0495613_0088523 | 3300046689 | Bacteria | 2243 |
| 1102 | Ga0495624_0038049 | 3300046690 | Bacteria | 3092 |
| 1103 | Ga0495624_0057818 | 3300046690 | Bacteria | 2438 |
| 1104 | Ga0495624_0097768 | 3300046690 | Bacteria | 1808 |
| 1105 | Ga0495600_0003753 | 3300046809 | Bacteria | 8988 |
| 1106 | Ga0495600_0024182 | 3300046809 | Bacteria | 3909 |
| 1107 | Ga0495600_0068710 | 3300046809 | Bacteria | 2315 |
| 1108 | Ga0495581_0028214 | 3300047315 | Bacteria | 3254 |
| 1109 | Ga0495581_0035097 | 3300047315 | Bacteria | 2902 |
| 1110 | Ga0495581_0038183 | 3300047315 | Bacteria | 2779 |
| 1111 | Ga0495581_0041912 | 3300047315 | Bacteria | 2649 |
| 1112 | Ga0495581_0080488 | 3300047315 | Bacteria | 1885 |
| 1113 | Ga0495604_0000039 | 3300047317 | Bacteria | 123431 |
| 1114 | Ga0495604_0004961 | 3300047317 | Bacteria | 10551 |
| 1115 | Ga0495604_0018417 | 3300047317 | Bacteria | 5592 |
| 1116 | Ga0495604_0031876 | 3300047317 | Bacteria | 4178 |
| 1117 | Ga0495604_0068694 | 3300047317 | Bacteria | 2688 |
| 1118 | Ga0495604_0094448 | 3300047317 | Bacteria | 2210 |
| 1119 | Ga0495674_0000235 | 3300047319 | Bacteria | 46762 |
| 1120 | Ga0495674_0012639 | 3300047319 | Bacteria | 7955 |
| 1121 | Ga0495674_0022562 | 3300047319 | Bacteria | 5804 |
| 1122 | Ga0495674_0061194 | 3300047319 | Bacteria | 3282 |
| 1123 | Ga0495674_0091225 | 3300047319 | Bacteria | 2602 |
| 1124 | Ga0495674_0094410 | 3300047319 | Bacteria | 2551 |
| 1125 | Ga0495674_0110789 | 3300047319 | Bacteria | 2327 |
| 1126 | Ga0495676_0003177 | 3300047321 | Bacteria | 14843 |
| 1127 | Ga0495676_0011200 | 3300047321 | Bacteria | 8106 |
| 1128 | Ga0495676_0045136 | 3300047321 | Bacteria | 3590 |
| 1129 | Ga0495680_0000028 | 3300047322 | Bacteria | 112865 |
| 1130 | Ga0495680_0001355 | 3300047322 | Bacteria | 26607 |
| 1131 | Ga0495680_0001817 | 3300047322 | Bacteria | 22541 |
| 1132 | Ga0495680_0003332 | 3300047322 | Bacteria | 15879 |
| 1133 | Ga0495680_0072835 | 3300047322 | Bacteria | 2612 |
| 1134 | Ga0495680_0084807 | 3300047322 | Bacteria | 2387 |
| 1135 | Ga0495680_0090669 | 3300047322 | Bacteria | 2292 |
| 1136 | Ga0495680_0100253 | 3300047322 | Bacteria | 2158 |
| 1137 | Ga0495680_0129163 | 3300047322 | Bacteria | 1858 |
| 1138 | Ga0495683_0016323 | 3300047323 | Bacteria | 3857 |
| 1139 | Ga0495675_0000355 | 3300047444 | Bacteria | 32066 |
| 1140 | Ga0495675_0007520 | 3300047444 | Bacteria | 6714 |
| 1141 | Ga0495675_0008588 | 3300047444 | Bacteria | 6332 |
| 1142 | Ga0495675_0027151 | 3300047444 | Bacteria | 3648 |
| 1143 | Ga0495684_0000154 | 3300047471 | Bacteria | 50763 |
| 1144 | Ga0495684_0010849 | 3300047471 | Bacteria | 7045 |
| 1145 | Ga0495684_0014031 | 3300047471 | Bacteria | 6163 |
| 1146 | Ga0495684_0043852 | 3300047471 | Bacteria | 3424 |
| 1147 | Ga0495684_0053559 | 3300047471 | Bacteria | 3078 |
| 1148 | Ga0495684_0064876 | 3300047471 | Bacteria | 2775 |
| 1149 | Ga0495593_0012122 | 3300047673 | Bacteria | 4933 |
| 1150 | Ga0495593_0012728 | 3300047673 | Bacteria | 4802 |
| 1151 | Ga0495593_0026923 | 3300047673 | Bacteria | 3168 |
| 1152 | Ga0495593_0080233 | 3300047673 | Bacteria | 1688 |
| 1153 | Ga0495602_0000043 | 3300048088 | Bacteria | 123431 |
| 1154 | Ga0495602_0008296 | 3300048088 | Bacteria | 10856 |
| 1155 | Ga0495602_0024111 | 3300048088 | Bacteria | 5906 |
| 1156 | Ga0495602_0035651 | 3300048088 | Bacteria | 4637 |
| 1157 | Ga0495602_0035718 | 3300048088 | Bacteria | 4632 |
| 1158 | Ga0495602_0055088 | 3300048088 | Bacteria | 3504 |
| 1159 | Ga0495602_0057893 | 3300048088 | Bacteria | 3396 |
| 1160 | Ga0495602_0061044 | 3300048088 | Bacteria | 3281 |
| 1161 | Ga0495602_0089421 | 3300048088 | Bacteria | 2560 |
| 1162 | Ga0495614_0014275 | 3300048089 | Bacteria | 3480 |
| 1163 | Ga0495626_0001774 | 3300048091 | Bacteria | 16389 |
| 1164 | Ga0496100_0000092 | 3300048903 | Bacteria | 50831 |
| 1165 | Ga0496100_0038256 | 3300048903 | Bacteria | 3039 |
| 1166 | Ga0496100_0050919 | 3300048903 | Bacteria | 2686 |
| 1167 | Ga0496100_0084442 | 3300048903 | Bacteria | 2152 |
| 1168 | Ga0496101_0000018 | 3300048904 | Bacteria | 236102 |
| 1169 | Ga0496101_0016361 | 3300048904 | Bacteria | 5009 |
| 1170 | Ga0496101_0028268 | 3300048904 | Bacteria | 3914 |
| 1171 | Ga0496102_0000013 | 3300048905 | Bacteria | 311668 |
| 1172 | Ga0496102_0000596 | 3300048905 | Bacteria | 37908 |
| 1173 | Ga0496102_0007973 | 3300048905 | Bacteria | 9049 |
| 1174 | Ga0496102_0086146 | 3300048905 | Bacteria | 2901 |
| 1175 | Ga0496102_0093133 | 3300048905 | Bacteria | 2791 |
| 1176 | Ga0496102_0129917 | 3300048905 | Bacteria | 2357 |
| 1177 | Ga0496103_0000039 | 3300048906 | Bacteria | 174284 |
| 1178 | Ga0496103_0000727 | 3300048906 | Bacteria | 24310 |
| 1179 | Ga0496103_0004802 | 3300048906 | Bacteria | 8171 |
| 1180 | Ga0496103_0054242 | 3300048906 | Bacteria | 2485 |
| 1181 | Ga0496103_0133693 | 3300048906 | Bacteria | 1585 |
| 1182 | Ga0496104_0009738 | 3300048907 | Bacteria | 8566 |
| 1183 | Ga0496104_0047128 | 3300048907 | Bacteria | 4061 |
| 1184 | Ga0496104_0093953 | 3300048907 | Bacteria | 2869 |
| 1185 | Ga0496104_0169183 | 3300048907 | Bacteria | 2096 |
| 1186 | Ga0496104_0350867 | 3300048907 | Bacteria | 1388 |
| 1187 | Ga0496105_0015802 | 3300048908 | Bacteria | 6022 |
| 1188 | Ga0496105_0075183 | 3300048908 | Bacteria | 2790 |
| 1189 | Ga0496105_0088810 | 3300048908 | Bacteria | 2554 |
| 1190 | Ga0496105_0092545 | 3300048908 | Bacteria | 2496 |
| 1191 | Ga0496106_0002072 | 3300048909 | Bacteria | 15020 |
| 1192 | Ga0496106_0009107 | 3300048909 | Bacteria | 7334 |
| 1193 | Ga0496106_0012275 | 3300048909 | Bacteria | 6323 |
| 1194 | Ga0496107_0000935 | 3300048910 | Bacteria | 17262 |
| 1195 | Ga0496107_0006564 | 3300048910 | Bacteria | 8004 |
| 1196 | Ga0496107_0048100 | 3300048910 | Bacteria | 3072 |
| 1197 | Ga0496107_0062574 | 3300048910 | Bacteria | 2696 |
| 1198 | Ga0496107_0118127 | 3300048910 | Bacteria | 1953 |
| 1199 | Ga0496107_0131628 | 3300048910 | Bacteria | 1846 |
| 1200 | Ga0496108_0000102 | 3300048911 | Bacteria | 88979 |
| 1201 | Ga0496108_0006454 | 3300048911 | Bacteria | 9507 |
| 1202 | Ga0496108_0008211 | 3300048911 | Bacteria | 8474 |
| 1203 | Ga0496108_0023924 | 3300048911 | Bacteria | 5028 |
| 1204 | Ga0496108_0039627 | 3300048911 | Bacteria | 3926 |
| 1205 | Ga0496108_0074019 | 3300048911 | Bacteria | 2875 |
| 1206 | Ga0496108_0075343 | 3300048911 | Bacteria | 2851 |
| 1207 | Ga0496108_0150524 | 3300048911 | Bacteria | 2008 |
| 1208 | Ga0496109_0000688 | 3300048912 | Bacteria | 28149 |
| 1209 | Ga0496109_0004908 | 3300048912 | Bacteria | 11164 |
| 1210 | Ga0496109_0019911 | 3300048912 | Bacteria | 5922 |
| 1211 | Ga0496109_0070694 | 3300048912 | Bacteria | 3203 |
| 1212 | Ga0496109_0251993 | 3300048912 | Bacteria | 1663 |
| 1213 | Ga0496110_0009673 | 3300048913 | Bacteria | 7808 |
| 1214 | Ga0496110_0011608 | 3300048913 | Bacteria | 7222 |
| 1215 | Ga0496110_0020138 | 3300048913 | Bacteria | 5627 |
| 1216 | Ga0496110_0029903 | 3300048913 | Bacteria | 4694 |
| 1217 | Ga0496110_0340763 | 3300048913 | Bacteria | 1366 |
| 1218 | Ga0496111_0002416 | 3300048914 | Bacteria | 11266 |
| 1219 | Ga0496111_0011805 | 3300048914 | Bacteria | 5898 |
| 1220 | Ga0496111_0013543 | 3300048914 | Bacteria | 5554 |
| 1221 | Ga0496111_0028665 | 3300048914 | Bacteria | 3947 |
| 1222 | Ga0496111_0054085 | 3300048914 | Bacteria | 2901 |
| 1223 | Ga0496111_0099368 | 3300048914 | Bacteria | 2137 |
| 1224 | Ga0496112_0005115 | 3300048915 | Bacteria | 11270 |
| 1225 | Ga0496112_0014288 | 3300048915 | Bacteria | 7356 |
| 1226 | Ga0496112_0014487 | 3300048915 | Bacteria | 7320 |
| 1227 | Ga0496114_0001339 | 3300048917 | Bacteria | 18667 |
| 1228 | Ga0496114_0021886 | 3300048917 | Bacteria | 5204 |
| 1229 | Ga0496114_0029190 | 3300048917 | Bacteria | 4531 |
| 1230 | Ga0496114_0048238 | 3300048917 | Bacteria | 3542 |
| 1231 | Ga0496114_0048817 | 3300048917 | Bacteria | 3521 |
| 1232 | Ga0496114_0187082 | 3300048917 | Bacteria | 1810 |
| 1233 | Ga0496114_0218840 | 3300048917 | Bacteria | 1671 |
| 1234 | Ga0496115_0012391 | 3300048918 | Bacteria | 6415 |
| 1235 | Ga0496115_0037599 | 3300048918 | Bacteria | 3837 |
| 1236 | Ga0496115_0074859 | 3300048918 | Bacteria | 2750 |
| 1237 | Ga0496115_0264022 | 3300048918 | Bacteria | 1415 |
| 1238 | Ga0496116_0005632 | 3300048919 | Bacteria | 11534 |
| 1239 | Ga0496117_0011653 | 3300048920 | Bacteria | 7853 |
| 1240 | Ga0496117_0065167 | 3300048920 | Bacteria | 2478 |
| 1241 | Ga0496118_0015918 | 3300048921 | Bacteria | 6929 |
| 1242 | Ga0496118_0036390 | 3300048921 | Bacteria | 3981 |
| 1243 | Ga0496118_0039440 | 3300048921 | Bacteria | 3768 |
| 1244 | Ga0496118_0090072 | 3300048921 | Bacteria | 2115 |
| 1245 | Ga0496119_0000022 | 3300048922 | Bacteria | 269878 |
| 1246 | Ga0496119_0002150 | 3300048922 | Bacteria | 22146 |
| 1247 | Ga0496119_0008239 | 3300048922 | Bacteria | 9212 |
| 1248 | Ga0496119_0009414 | 3300048922 | Bacteria | 8389 |
| 1249 | Ga0496119_0009570 | 3300048922 | Bacteria | 8286 |
| 1250 | Ga0496120_0000856 | 3300048923 | Bacteria | 43060 |
| 1251 | Ga0496120_0001757 | 3300048923 | Bacteria | 24522 |
| 1252 | Ga0496120_0002970 | 3300048923 | Bacteria | 16139 |
| 1253 | Ga0496120_0033465 | 3300048923 | Bacteria | 3089 |
| 1254 | Ga0496121_0000023 | 3300048924 | Bacteria | 463448 |
| 1255 | Ga0496121_0000040 | 3300048924 | Bacteria | 348494 |
| 1256 | Ga0496121_0081195 | 3300048924 | Bacteria | 2567 |
| 1257 | Ga0496122_0000022 | 3300048925 | Bacteria | 388704 |
| 1258 | Ga0496122_0000164 | 3300048925 | Bacteria | 158055 |
| 1259 | Ga0496122_0005660 | 3300048925 | Bacteria | 14751 |
| 1260 | Ga0496123_0000016 | 3300048926 | Bacteria | 424330 |
| 1261 | Ga0496124_0000014 | 3300048927 | Bacteria | 463448 |
| 1262 | Ga0496124_0024555 | 3300048927 | Bacteria | 5476 |
| 1263 | Ga0496125_0000020 | 3300048928 | Bacteria | 463448 |
| 1264 | Ga0496125_0004443 | 3300048928 | Bacteria | 16177 |
| 1265 | Ga0496125_0020299 | 3300048928 | Bacteria | 6237 |
| 1266 | Ga0496126_0000023 | 3300048929 | Bacteria | 463448 |
| 1267 | Ga0496126_0000055 | 3300048929 | Bacteria | 297958 |
| 1268 | Ga0496126_0000090 | 3300048929 | Bacteria | 210538 |
| 1269 | Ga0496126_0017091 | 3300048929 | Bacteria | 7234 |
| 1270 | Ga0496126_0029368 | 3300048929 | Bacteria | 5223 |
| 1271 | Ga0496126_0065298 | 3300048929 | Bacteria | 3257 |
| 1272 | Ga0496126_0098756 | 3300048929 | Bacteria | 2558 |
| 1273 | Ga0501318_003400 | 3300049534 | Bacteria | 1456 |
| 1274 | Ga0501031_0005397 | 3300049568 | Bacteria | 8322 |
| 1275 | Ga0501031_0026500 | 3300049568 | Bacteria | 3779 |
| 1276 | Ga0501032_0006594 | 3300049569 | Bacteria | 8524 |
| 1277 | Ga0501032_0046696 | 3300049569 | Bacteria | 2926 |
| 1278 | Ga0501032_0054738 | 3300049569 | Bacteria | 2685 |
| 1279 | Ga0501032_0086591 | 3300049569 | Bacteria | 2082 |
| 1280 | Ga0501032_0104282 | 3300049569 | Bacteria | 1878 |
| 1281 | Ga0501033_0000494 | 3300049570 | Bacteria | 37191 |
| 1282 | Ga0501033_0028033 | 3300049570 | Bacteria | 4232 |
| 1283 | Ga0501033_0036462 | 3300049570 | Bacteria | 3685 |
| 1284 | Ga0501034_0000419 | 3300049571 | Bacteria | 71157 |
| 1285 | Ga0501034_0006558 | 3300049571 | Bacteria | 12501 |
| 1286 | Ga0501034_0019166 | 3300049571 | Bacteria | 7005 |
| 1287 | Ga0501034_0026165 | 3300049571 | Bacteria | 5941 |
| 1288 | Ga0501034_0059905 | 3300049571 | Bacteria | 3824 |
| 1289 | Ga0501034_0078355 | 3300049571 | Bacteria | 3309 |
| 1290 | Ga0501034_0107146 | 3300049571 | Bacteria | 2787 |
| 1291 | Ga0501034_0131140 | 3300049571 | Bacteria | 2489 |
| 1292 | Ga0501036_0004897 | 3300049572 | Bacteria | 10817 |
| 1293 | Ga0501036_0005514 | 3300049572 | Bacteria | 10261 |
| 1294 | Ga0501036_0042038 | 3300049572 | Bacteria | 3869 |
| 1295 | Ga0501037_0051933 | 3300049573 | Bacteria | 2998 |
| 1296 | Ga0501037_0125969 | 3300049573 | Bacteria | 1839 |
| 1297 | Ga0501038_0000874 | 3300049574 | Bacteria | 26668 |
| 1298 | Ga0501038_0005310 | 3300049574 | Bacteria | 11969 |
| 1299 | Ga0501038_0029892 | 3300049574 | Bacteria | 4827 |
| 1300 | Ga0501038_0054638 | 3300049574 | Bacteria | 3434 |
| 1301 | Ga0501039_0003402 | 3300049575 | Bacteria | 11891 |
| 1302 | Ga0501039_0037459 | 3300049575 | Bacteria | 3743 |
| 1303 | Ga0501039_0047074 | 3300049575 | Bacteria | 3333 |
| 1304 | Ga0501040_0008855 | 3300049576 | Bacteria | 6540 |
| 1305 | Ga0501040_0054321 | 3300049576 | Bacteria | 2746 |
| 1306 | Ga0501040_0085641 | 3300049576 | Bacteria | 2187 |
| 1307 | Ga0501041_0064103 | 3300049577 | Bacteria | 2250 |
| 1308 | Ga0501042_0004599 | 3300049578 | Bacteria | 8810 |
| 1309 | Ga0501042_0021978 | 3300049578 | Bacteria | 4453 |
| 1310 | Ga0501042_0035811 | 3300049578 | Bacteria | 3521 |
| 1311 | Ga0501042_0041130 | 3300049578 | Bacteria | 3286 |
| 1312 | Ga0501043_0240324 | 3300049579 | Bacteria | 1397 |
| 1313 | Ga0501046_0007799 | 3300049580 | Bacteria | 9391 |
| 1314 | Ga0501046_0035397 | 3300049580 | Bacteria | 4024 |
| 1315 | Ga0501046_0168778 | 3300049580 | Bacteria | 1643 |
| 1316 | Ga0501047_0001249 | 3300049581 | Bacteria | 25187 |
| 1317 | Ga0501047_0001409 | 3300049581 | Bacteria | 23584 |
| 1318 | Ga0501047_0040928 | 3300049581 | Bacteria | 4480 |
| 1319 | Ga0501047_0068887 | 3300049581 | Bacteria | 3408 |
| 1320 | Ga0501047_0073300 | 3300049581 | Bacteria | 3296 |
| 1321 | Ga0501047_0284257 | 3300049581 | Bacteria | 1498 |
| 1322 | Ga0501048_0000373 | 3300049582 | Bacteria | 31068 |
| 1323 | Ga0501048_0001597 | 3300049582 | Bacteria | 17210 |
| 1324 | Ga0501048_0010469 | 3300049582 | Bacteria | 6925 |
| 1325 | Ga0501067_0041410 | 3300049583 | Bacteria | 2558 |
| 1326 | Ga0501070_0030864 | 3300049586 | Bacteria | 4489 |
| 1327 | Ga0501070_0076909 | 3300049586 | Bacteria | 2763 |
| 1328 | Ga0501070_0166188 | 3300049586 | Bacteria | 1818 |
| 1329 | Ga0501071_0011093 | 3300049587 | Bacteria | 6057 |
| 1330 | Ga0501072_0011323 | 3300049588 | Bacteria | 6814 |
| 1331 | Ga0501072_0016427 | 3300049588 | Bacteria | 5683 |
| 1332 | Ga0501073_0000222 | 3300049589 | Bacteria | 37299 |
| 1333 | Ga0501073_0026792 | 3300049589 | Bacteria | 4127 |
| 1334 | Ga0501074_0007071 | 3300049590 | Bacteria | 8108 |
| 1335 | Ga0501075_0013707 | 3300049591 | Bacteria | 5793 |
| 1336 | Ga0501075_0077991 | 3300049591 | Bacteria | 2507 |
| 1337 | Ga0501076_0007625 | 3300049592 | Bacteria | 7881 |
| 1338 | Ga0501076_0029351 | 3300049592 | Bacteria | 4277 |
| 1339 | Ga0501076_0155067 | 3300049592 | Bacteria | 1864 |
| 1340 | Ga0501077_0007115 | 3300049593 | Bacteria | 6899 |
| 1341 | Ga0501079_0025288 | 3300049741 | Bacteria | 4555 |
| 1342 | Ga0501079_0026643 | 3300049741 | Bacteria | 4432 |
| 1343 | Ga0501080_0035655 | 3300049742 | Bacteria | 4643 |
| 1344 | Ga0501080_0059984 | 3300049742 | Bacteria | 3540 |
| 1345 | Ga0501080_0119003 | 3300049742 | Bacteria | 2449 |
| 1346 | Ga0501080_0184613 | 3300049742 | Bacteria | 1918 |
| 1347 | Ga0501081_0042748 | 3300049743 | Bacteria | 3106 |
| 1348 | Ga0501083_0126874 | 3300049744 | Bacteria | 1673 |
| 1349 | Ga0501035_0001462 | 3300049822 | Bacteria | 24206 |
| 1350 | Ga0501035_0009678 | 3300049822 | Bacteria | 8964 |
| 1351 | Ga0501035_0076257 | 3300049822 | Bacteria | 2965 |
| 1352 | Ga0501035_0101828 | 3300049822 | Bacteria | 2520 |
| 1353 | Ga0501044_0000898 | 3300049823 | Bacteria | 35963 |
| 1354 | Ga0501044_0015179 | 3300049823 | Bacteria | 8298 |
| 1355 | Ga0501044_0212884 | 3300049823 | Bacteria | 1886 |
| 1356 | Ga0501045_0015883 | 3300049824 | Bacteria | 5340 |
| 1357 | Ga0501045_0034276 | 3300049824 | Bacteria | 3685 |
| 1358 | Ga0501045_0054980 | 3300049824 | Bacteria | 2911 |
| 1359 | Ga0501045_0080160 | 3300049824 | Bacteria | 2407 |
| 1360 | Ga0501045_0121296 | 3300049824 | Bacteria | 1941 |
| 1361 | nmdc:mga00v17_2173_c1 | 3300050491 | Bacteria | 10081 |
| 1362 | nmdc:mga00v17_31322_c1 | 3300050491 | Bacteria | 3136 |
| 1363 | nmdc:mga00v17_65464_c1 | 3300050491 | Bacteria | 2242 |
| 1364 | nmdc:mga0yw44_3567_c1 | 3300050492 | Bacteria | 6937 |
| 1365 | nmdc:mga0yw44_37400_c1 | 3300050492 | Bacteria | 2865 |
| 1366 | nmdc:mga0yw44_44144_c1 | 3300050492 | Bacteria | 2665 |
| 1367 | nmdc:mga06z11_2278_c1 | 3300050494 | Bacteria | 7302 |
| 1368 | nmdc:mga06z11_49292_c1 | 3300050494 | Bacteria | 2148 |
| 1369 | nmdc:mga04h51_7778_c1 | 3300050495 | Bacteria | 2843 |
| 1370 | nmdc:mga05p37_182605_c1 | 3300050507 | Bacteria | 2552 |
| 1371 | nmdc:mga05p37_52804_c1 | 3300050507 | Bacteria | 4998 |
| 1372 | nmdc:mga09592_41508_c1 | 3300050508 | Bacteria | 3869 |
| 1373 | nmdc:mga09592_45588_c1 | 3300050508 | Bacteria | 3694 |
| 1374 | nmdc:mga09592_5723_c1 | 3300050508 | Bacteria | 10135 |
| 1375 | nmdc:mga0qj67_10513_c1 | 3300050509 | Bacteria | 6912 |
| 1376 | nmdc:mga0qj67_112058_c1 | 3300050509 | Bacteria | 2203 |
| 1377 | nmdc:mga0qj67_27993_c1 | 3300050509 | Bacteria | 4373 |
| 1378 | nmdc:mga0qj67_39034_c1 | 3300050509 | Bacteria | 3727 |
| 1379 | nmdc:mga06r32_214624_c1 | 3300050510 | Unclassified | 1912 |
| 1380 | nmdc:mga06r32_78017_c1 | 3300050510 | Bacteria | 3219 |
| 1381 | nmdc:mga06r32_7811_c1 | 3300050510 | Bacteria | 9616 |
| 1382 | nmdc:mga06r32_907_c1 | 3300050510 | Bacteria | 26417 |
| 1383 | nmdc:mga08y16_144330_c1 | 3300050511 | Bacteria | 2474 |
| 1384 | nmdc:mga08y16_16524_c1 | 3300050511 | Bacteria | 7764 |
| 1385 | nmdc:mga08y16_296204_c1 | 3300050511 | Bacteria | 1668 |
| 1386 | nmdc:mga08y16_3908_c1 | 3300050511 | Bacteria | 15520 |
| 1387 | nmdc:mga08y16_52421_c1 | 3300050511 | Bacteria | 4268 |
| 1388 | nmdc:mga0n895_19316_c1 | 3300050512 | Bacteria | 6332 |
| 1389 | nmdc:mga0n895_303769_c1 | 3300050512 | Bacteria | 1618 |
| 1390 | nmdc:mga0n895_3126_c1 | 3300050512 | Bacteria | 13199 |
| 1391 | nmdc:mga0n895_5628_c1 | 3300050512 | Bacteria | 10500 |
| 1392 | nmdc:mga0rr50_23628_c1 | 3300050513 | Bacteria | 4243 |
| 1393 | nmdc:mga0rr50_5853_c1 | 3300050513 | Bacteria | 7393 |
| 1394 | nmdc:mga0rr50_9814_c1 | 3300050513 | Bacteria | 6045 |
| 1395 | nmdc:mga08x19_4958_c1 | 3300050514 | Bacteria | 7862 |
| 1396 | nmdc:mga08x19_60972_c1 | 3300050514 | Bacteria | 2444 |
| 1397 | nmdc:mga0a205_99676_c1 | 3300050515 | Bacteria | 2804 |
| 1398 | nmdc:mga0sz30_39630_c1 | 3300050516 | Bacteria | 1977 |
| 1399 | nmdc:mga0sz30_57802_c1 | 3300050516 | Bacteria | 1653 |
| 1400 | Ga0495601_0026034 | 3300053077 | Bacteria | 3609 |
| 1401 | Ga0495601_0059509 | 3300053077 | Bacteria | 2423 |
| 1402 | Ga0495601_0081449 | 3300053077 | Bacteria | 2077 |
| 1403 | Ga0495612_0012517 | 3300053078 | Bacteria | 3420 |
| 1404 | Ga0495612_0016357 | 3300053078 | Bacteria | 2973 |
| 1405 | Ga0495612_0035606 | 3300053078 | Bacteria | 2018 |
| 1406 | Ga0495612_0057063 | 3300053078 | Bacteria | 1612 |
| 1407 | Ga0495595_0004992 | 3300053084 | Bacteria | 5357 |
| 1408 | Ga0495595_0007305 | 3300053084 | Bacteria | 4520 |
| 1409 | Ga0495595_0009778 | 3300053084 | Bacteria | 3975 |
| 1410 | Ga0495595_0010465 | 3300053084 | Bacteria | 3855 |
| 1411 | Ga0495619_0003503 | 3300053085 | Bacteria | 10118 |
| 1412 | Ga0495619_0008758 | 3300053085 | Bacteria | 6397 |
| 1413 | Ga0495619_0022642 | 3300053085 | Bacteria | 4023 |
| 1414 | Ga0500644_0000090 | 3300053088 | Bacteria | 56710 |
| 1415 | Ga0500556_0000421 | 3300053104 | Bacteria | 30523 |
| 1416 | Ga0500556_0000698 | 3300053104 | Bacteria | 20621 |
| 1417 | Ga0500562_002205 | 3300053108 | Bacteria | 4872 |
| 1418 | Ga0500593_000189 | 3300053117 | Bacteria | 25029 |
| 1419 | Ga0500593_011246 | 3300053117 | Bacteria | 3775 |
| 1420 | Ga0500559_0000561 | 3300053136 | Bacteria | 25730 |
| 1421 | Ga0500568_0000098 | 3300053139 | Bacteria | 80393 |
| 1422 | Ga0500568_0000970 | 3300053139 | Bacteria | 19744 |
| 1423 | Ga0500573_0024571 | 3300053140 | Bacteria | 3464 |
| 1424 | Ga0500573_0037001 | 3300053140 | Bacteria | 2819 |
| 1425 | Ga0500577_0025316 | 3300053142 | Bacteria | 2006 |
| 1426 | Ga0500590_004738 | 3300053148 | Bacteria | 6461 |
| 1427 | Ga0500616_0000740 | 3300053153 | Bacteria | 37626 |
| 1428 | Ga0500616_0001673 | 3300053153 | Bacteria | 20432 |
| 1429 | Ga0500616_0005443 | 3300053153 | Bacteria | 8638 |
| 1430 | Ga0500620_001941 | 3300053155 | Bacteria | 4009 |
| 1431 | Ga0501084_0006238 | 3300054114 | Bacteria | 9804 |
| 1432 | Ga0501084_0146062 | 3300054114 | Bacteria | 1992 |
| 1433 | Ga0501082_0009270 | 3300060353 | Bacteria | 8484 |
| 1434 | Ga0501082_0106390 | 3300060353 | Bacteria | 2427 |
| 1435 | Ga0501082_0173233 | 3300060353 | Bacteria | 1876 |
| 1436 | Ga0501082_0335787 | 3300060353 | Bacteria | 1317 |
| 1437 | Ga0466962_0007440 | 3300061719 | Bacteria | 5256 |
| 1438 | Ga0466962_0010186 | 3300061719 | Bacteria | 4515 |
| 1439 | Ga0466962_0030612 | 3300061719 | Bacteria | 2578 |
| 1440 | Ga0466962_0064430 | 3300061719 | Bacteria | 1750 |
| 1441 | Ga0530510_0004246 | 3300061734 | Bacteria | 9906 |
| 1442 | Ga0530510_0073077 | 3300061734 | Bacteria | 2489 |
| 1443 | Ga0530510_0095460 | 3300061734 | Bacteria | 2172 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0251993 | Ga0496109_0251993_570_1631 | 347 |
| 2 | 3300026116 | Ga0207674_10351489 | Ga0207674_103514892 | 357 |
| 3 | 3300037853 | Ga0436364_0343519 | Ga0436364_0343519_6100_7200 | 363 |
| 4 | 3300049573 | Ga0501037_0125969 | Ga0501037_0125969_728_1825 | 364 |
| 5 | 3300049581 | Ga0501047_0284257 | Ga0501047_0284257_17_1114 | 364 |
| 6 | 3300005983 | Ga0081540_1044975 | Ga0081540_10449751 | 377 |
| 7 | 3300005288 | Ga0065714_10005169 | Ga0065714_100051696 | 378 |
| 8 | 3300035398 | Ga0316574_0068299 | Ga0316574_0068299_520_1872 | 391 |
| 9 | 3300036712 | Ga0316584_0015706 | Ga0316584_0015706_2587_3939 | 391 |
| 10 | 3300048918 | Ga0496115_0264022 | Ga0496115_0264022_206_1402 | 392 |
| 11 | 3300046675 | Ga0495657_0170129 | Ga0495657_0170129_32_1300 | 395 |
| 12 | 3300035119 | Ga0373956_0061514 | Ga0373956_0061514_38_1306 | 397 |
| 13 | 3300036401 | Ga0373937_0290635 | Ga0373937_0290635_287_1534 | 399 |
| 14 | 3300049571 | Ga0501034_0059905 | Ga0501034_0059905_667_1872 | 399 |
| 15 | 3300049572 | Ga0501036_0004897 | Ga0501036_0004897_8983_10185 | 399 |
| 16 | 3300049580 | Ga0501046_0007799 | Ga0501046_0007799_4401_5603 | 399 |
| 17 | 3300049583 | Ga0501067_0041410 | Ga0501067_0041410_26_1228 | 399 |
| 18 | 3300049589 | Ga0501073_0026792 | Ga0501073_0026792_450_1652 | 399 |
| 19 | 3300049822 | Ga0501035_0076257 | Ga0501035_0076257_1712_2917 | 399 |
| 20 | 3300049824 | Ga0501045_0121296 | Ga0501045_0121296_449_1651 | 399 |
| 21 | 3300054114 | Ga0501084_0146062 | Ga0501084_0146062_642_1844 | 399 |
| 22 | 3300035111 | Ga0373923_0100727 | Ga0373923_0100727_15_1229 | 400 |
| 23 | 3300048928 | Ga0496125_0020299 | Ga0496125_0020299_100_1470 | 402 |
| 24 | 3300005435 | Ga0070714_100008744 | Ga0070714_1000087441 | 403 |
| 25 | 3300021388 | Ga0213875_10002928 | Ga0213875_100029287 | 404 |
| 26 | 3300025944 | Ga0207661_10054690 | Ga0207661_100546902 | 404 |
| 27 | 3300035695 | Ga0373927_0205419 | Ga0373927_0205419_48_1277 | 404 |
| 28 | 3300037418 | Ga0395900_0034891 | Ga0395900_0034891_657_1940 | 404 |
| 29 | 3300037466 | Ga0395898_0065076 | Ga0395898_0065076_1810_3093 | 404 |
| 30 | 3300038443 | Ga0395901_0239284 | Ga0395901_0239284_160_1443 | 404 |
| 31 | 3300046500 | Ga0495596_0067415 | Ga0495596_0067415_73_1287 | 404 |
| 32 | 3300049579 | Ga0501043_0240324 | Ga0501043_0240324_12_1226 | 404 |
| 33 | 3300049571 | Ga0501034_0019166 | Ga0501034_0019166_2726_4099 | 406 |
| 34 | 3300005290 | Ga0065712_10102081 | Ga0065712_101020812 | 407 |
| 35 | 3300005354 | Ga0070675_100120429 | Ga0070675_1001204291 | 407 |
| 36 | 3300005435 | Ga0070714_100051017 | Ga0070714_1000510172 | 407 |
| 37 | 3300005466 | Ga0070685_10021688 | Ga0070685_100216883 | 407 |
| 38 | 3300005466 | Ga0070685_10044787 | Ga0070685_100447873 | 407 |
| 39 | 3300013308 | Ga0157375_10065285 | Ga0157375_100652852 | 407 |
| 40 | 3300014969 | Ga0157376_10099772 | Ga0157376_100997723 | 407 |
| 41 | 3300025961 | Ga0207712_10000976 | Ga0207712_1000097618 | 407 |
| 42 | 3300049576 | Ga0501040_0054321 | Ga0501040_0054321_1085_2392 | 407 |
| 43 | 3300002459 | JGI24751J29686_10002307 | JGI24751J29686_100023073 | 408 |
| 44 | 3300005295 | Ga0065707_10115361 | Ga0065707_101153612 | 408 |
| 45 | 3300005331 | Ga0070670_100023299 | Ga0070670_1000232992 | 408 |
| 46 | 3300005471 | Ga0070698_100001150 | Ga0070698_1000011503 | 408 |
| 47 | 3300005471 | Ga0070698_100004671 | Ga0070698_1000046716 | 408 |
| 48 | 3300005618 | Ga0068864_100012916 | Ga0068864_1000129164 | 408 |
| 49 | 3300006358 | Ga0068871_100073400 | Ga0068871_1000734003 | 408 |
| 50 | 3300006844 | Ga0075428_100080788 | Ga0075428_1000807882 | 408 |
| 51 | 3300006846 | Ga0075430_100047619 | Ga0075430_1000476193 | 408 |
| 52 | 3300006847 | Ga0075431_100037448 | Ga0075431_1000374484 | 408 |
| 53 | 3300006847 | Ga0075431_100094076 | Ga0075431_1000940763 | 408 |
| 54 | 3300009176 | Ga0105242_10009563 | Ga0105242_100095632 | 408 |
| 55 | 3300009553 | Ga0105249_10011505 | Ga0105249_100115052 | 408 |
| 56 | 3300025923 | Ga0207681_10112658 | Ga0207681_101126582 | 408 |
| 57 | 3300025934 | Ga0207686_10001569 | Ga0207686_100015695 | 408 |
| 58 | 3300025961 | Ga0207712_10017414 | Ga0207712_100174142 | 408 |
| 59 | 3300026088 | Ga0207641_10000947 | Ga0207641_1000094710 | 408 |
| 60 | 3300026095 | Ga0207676_10009539 | Ga0207676_100095394 | 408 |
| 61 | 3300044684 | Ga0466966_0075640 | Ga0466966_0075640_635_1996 | 408 |
| 62 | 3300050508 | nmdc:mga09592_45588_c1 | nmdc:mga09592_45588_c1_1425_2771 | 408 |
| 63 | 3300050509 | nmdc:mga0qj67_112058_c1 | nmdc:mga0qj67_112058_c1_65_1411 | 408 |
| 64 | 3300050509 | nmdc:mga0qj67_39034_c1 | nmdc:mga0qj67_39034_c1_1511_2857 | 408 |
| 65 | 3300050510 | nmdc:mga06r32_214624_c1 | nmdc:mga06r32_214624_c1_304_1650 | 408 |
| 66 | 3300044656 | Ga0466969_0030015 | Ga0466969_0030015_1238_2569 | 409 |
| 67 | 3300031456 | Ga0307513_10231673 | Ga0307513_102316732 | 410 |
| 68 | 3300037312 | Ga0395899_0098042 | Ga0395899_0098042_95_1390 | 410 |
| 69 | 3300037418 | Ga0395900_0007778 | Ga0395900_0007778_2374_3669 | 410 |
| 70 | 3300037471 | Ga0395905_0034235 | Ga0395905_0034235_2403_3698 | 410 |
| 71 | 3300005577 | Ga0068857_100165186 | Ga0068857_1001651862 | 411 |
| 72 | 3300026116 | Ga0207674_10198274 | Ga0207674_101982743 | 411 |
| 73 | 3300037853 | Ga0436364_0050345 | Ga0436364_0050345_37_1287 | 411 |
| 74 | 3300044656 | Ga0466969_0006927 | Ga0466969_0006927_4769_6013 | 411 |
| 75 | 3300044693 | Ga0466961_0032277 | Ga0466961_0032277_1708_3039 | 411 |
| 76 | 3300039062 | Ga0400483_037289 | Ga0400483_037289_1565_2806 | 412 |
| 77 | 3300039062 | Ga0400483_246361 | Ga0400483_246361_1252_2493 | 412 |
| 78 | 3300044735 | Ga0466968_0013176 | Ga0466968_0013176_826_2184 | 412 |
| 79 | 3300048910 | Ga0496107_0048100 | Ga0496107_0048100_1182_2525 | 412 |
| 80 | 3300049571 | Ga0501034_0006558 | Ga0501034_0006558_9293_10666 | 413 |
| 81 | 3300010375 | Ga0105239_10002033 | Ga0105239_1000203321 | 414 |
| 82 | 3300014745 | Ga0157377_10004860 | Ga0157377_100048602 | 414 |
| 83 | 3300028573 | Ga0265334_10001867 | Ga0265334_100018675 | 414 |
| 84 | 3300031852 | Ga0307410_10082099 | Ga0307410_100820992 | 415 |
| 85 | 3300032126 | Ga0307415_100085540 | Ga0307415_1000855402 | 415 |
| 86 | 3300049581 | Ga0501047_0001409 | Ga0501047_0001409_587_1909 | 415 |
| 87 | 3300049822 | Ga0501035_0001462 | Ga0501035_0001462_5843_7165 | 415 |
| 88 | 3300049823 | Ga0501044_0000898 | Ga0501044_0000898_19733_21055 | 415 |
| 89 | 3300053104 | Ga0500556_0000698 | Ga0500556_0000698_6566_7909 | 415 |
| 90 | iso_pu_bacteria | 2740891818 | 2740990748 | 415 |
| 91 | 3300031649 | Ga0307514_10092337 | Ga0307514_100923372 | 416 |
| 92 | 3300031889 | Ga0326468_10000319 | Ga0326468_100003193 | 416 |
| 93 | 3300053117 | Ga0500593_000189 | Ga0500593_000189_16426_17769 | 416 |
| 94 | 3300005336 | Ga0070680_100012295 | Ga0070680_1000122952 | 417 |
| 95 | 3300005530 | Ga0070679_100029150 | Ga0070679_1000291502 | 417 |
| 96 | 3300005530 | Ga0070679_100047220 | Ga0070679_1000472203 | 417 |
| 97 | 3300005535 | Ga0070684_100034101 | Ga0070684_1000341013 | 417 |
| 98 | 3300020082 | Ga0206353_10474610 | Ga0206353_104746101 | 417 |
| 99 | 3300026067 | Ga0207678_10025591 | Ga0207678_100255912 | 417 |
| 100 | 3300028556 | Ga0265337_1001378 | Ga0265337_100137811 | 417 |
| 101 | 3300028558 | Ga0265326_10012682 | Ga0265326_100126822 | 417 |
| 102 | 3300028563 | Ga0265319_1001043 | Ga0265319_10010433 | 417 |
| 103 | 3300028573 | Ga0265334_10030060 | Ga0265334_100300602 | 417 |
| 104 | 3300028577 | Ga0265318_10019527 | Ga0265318_100195272 | 417 |
| 105 | 3300028800 | Ga0265338_10001035 | Ga0265338_1000103531 | 417 |
| 106 | 3300031241 | Ga0265325_10006702 | Ga0265325_100067021 | 417 |
| 107 | 3300031247 | Ga0265340_10013753 | Ga0265340_100137535 | 417 |
| 108 | 3300031249 | Ga0265339_10023224 | Ga0265339_100232243 | 417 |
| 109 | 3300031344 | Ga0265316_10041947 | Ga0265316_100419473 | 417 |
| 110 | 3300031711 | Ga0265314_10016524 | Ga0265314_100165243 | 417 |
| 111 | 3300031995 | Ga0307409_100065113 | Ga0307409_1000651132 | 417 |
| 112 | 3300032002 | Ga0307416_100010065 | Ga0307416_1000100654 | 417 |
| 113 | 3300032126 | Ga0307415_100032960 | Ga0307415_1000329602 | 417 |
| 114 | 3300048913 | Ga0496110_0340763 | Ga0496110_0340763_22_1284 | 417 |
| 115 | 3300049570 | Ga0501033_0000494 | Ga0501033_0000494_32953_34215 | 417 |
| 116 | iso_pu_bacteria | 2858868258 | 2858873870 | 417 |
| 117 | 3300028380 | Ga0268265_10021583 | Ga0268265_100215833 | 418 |
| 118 | 3300035398 | Ga0316574_0023786 | Ga0316574_0023786_2025_3293 | 418 |
| 119 | 3300045976 | Ga0466967_0053897 | Ga0466967_0053897_1010_2284 | 418 |
| 120 | 3300048929 | Ga0496126_0000055 | Ga0496126_0000055_186450_187724 | 418 |
| 121 | 3300049569 | Ga0501032_0086591 | Ga0501032_0086591_714_1991 | 418 |
| 122 | iso_pu_bacteria | 2501939600 | 2501943259 | 418 |
| 123 | iso_pu_bacteria | 2831935698 | 2831938686 | 418 |
| 124 | iso_pu_bacteria | 2855683550 | 2855684854 | 418 |
| 125 | iso_pu_bacteria | 2856858025 | 2856860657 | 418 |
| 126 | iso_pu_bacteria | 2867302475 | 2867306586 | 418 |
| 127 | iso_pu_bacteria | 2902582711 | 2902585597 | 418 |
| 128 | iso_pu_bacteria | 649633069 | 649811392 | 418 |
| 129 | 3300005435 | Ga0070714_100000434 | Ga0070714_1000004346 | 419 |
| 130 | 3300014745 | Ga0157377_10082550 | Ga0157377_100825502 | 419 |
| 131 | 3300005329 | Ga0070683_100008479 | Ga0070683_1000084794 | 420 |
| 132 | 3300005535 | Ga0070684_100023514 | Ga0070684_1000235142 | 420 |
| 133 | 3300005985 | Ga0081539_10018904 | Ga0081539_100189043 | 420 |
| 134 | 3300025944 | Ga0207661_10017684 | Ga0207661_100176842 | 420 |
| 135 | 3300031995 | Ga0307409_100240190 | Ga0307409_1002401902 | 420 |
| 136 | 3300033179 | Ga0307507_10000001 | Ga0307507_10000001190 | 420 |
| 137 | 3300035091 | Ga0373951_0000180 | Ga0373951_0000180_15801_17093 | 420 |
| 138 | iso_pu_bacteria | 2675903059 | 2676480395 | 420 |
| 139 | 3300005445 | Ga0070708_100226332 | Ga0070708_1002263322 | 421 |
| 140 | 3300032126 | Ga0307415_100044564 | Ga0307415_1000445642 | 421 |
| 141 | 3300038741 | Ga0400488_55885 | Ga0400488_55885_25956_27227 | 421 |
| 142 | 3300044683 | Ga0466965_0029880 | Ga0466965_0029880_933_2294 | 421 |
| 143 | 3300046461 | Ga0495641_0043813 | Ga0495641_0043813_20_1297 | 421 |
| 144 | 3300046499 | Ga0495594_0021541 | Ga0495594_0021541_1793_3115 | 421 |
| 145 | 3300049569 | Ga0501032_0054738 | Ga0501032_0054738_765_2033 | 421 |
| 146 | 3300049572 | Ga0501036_0042038 | Ga0501036_0042038_941_2302 | 421 |
| 147 | 3300049574 | Ga0501038_0054638 | Ga0501038_0054638_128_1396 | 421 |
| 148 | 3300049575 | Ga0501039_0003402 | Ga0501039_0003402_140_1408 | 421 |
| 149 | 3300049576 | Ga0501040_0085641 | Ga0501040_0085641_254_1615 | 421 |
| 150 | 3300049578 | Ga0501042_0035811 | Ga0501042_0035811_2127_3395 | 421 |
| 151 | 3300049578 | Ga0501042_0041130 | Ga0501042_0041130_663_2024 | 421 |
| 152 | 3300049581 | Ga0501047_0073300 | Ga0501047_0073300_824_2092 | 421 |
| 153 | 3300049582 | Ga0501048_0001597 | Ga0501048_0001597_14228_15496 | 421 |
| 154 | 3300049591 | Ga0501075_0077991 | Ga0501075_0077991_263_1624 | 421 |
| 155 | 3300049592 | Ga0501076_0029351 | Ga0501076_0029351_2483_3844 | 421 |
| 156 | 3300049742 | Ga0501080_0059984 | Ga0501080_0059984_309_1577 | 421 |
| 157 | 3300060353 | Ga0501082_0106390 | Ga0501082_0106390_263_1624 | 421 |
| 158 | 3300061734 | Ga0530510_0073077 | Ga0530510_0073077_321_1682 | 421 |
| 159 | iso_pu_bacteria | 2751185782 | 2753270470 | 421 |
| 160 | iso_pu_bacteria | 2887478801 | 2887483970 | 421 |
| 161 | 3300005437 | Ga0070710_10151189 | Ga0070710_101511891 | 422 |
| 162 | 3300005468 | Ga0070707_100185944 | Ga0070707_1001859442 | 422 |
| 163 | 3300005564 | Ga0070664_100095244 | Ga0070664_1000952442 | 422 |
| 164 | 3300009147 | Ga0114129_10000459 | Ga0114129_100004599 | 422 |
| 165 | 3300025922 | Ga0207646_10058309 | Ga0207646_100583092 | 422 |
| 166 | 3300028794 | Ga0307515_10000027 | Ga0307515_10000027291 | 422 |
| 167 | 3300028794 | Ga0307515_10066071 | Ga0307515_100660714 | 422 |
| 168 | 3300031730 | Ga0307516_10005562 | Ga0307516_100055626 | 422 |
| 169 | 3300032002 | Ga0307416_100107698 | Ga0307416_1001076982 | 422 |
| 170 | 3300032126 | Ga0307415_100005737 | Ga0307415_1000057372 | 422 |
| 171 | 3300048911 | Ga0496108_0000102 | Ga0496108_0000102_25734_27011 | 422 |
| 172 | 3300050507 | nmdc:mga05p37_182605_c1 | nmdc:mga05p37_182605_c1_559_1830 | 422 |
| 173 | 3300005618 | Ga0068864_100190358 | Ga0068864_1001903582 | 423 |
| 174 | 3300005841 | Ga0068863_100014598 | Ga0068863_1000145983 | 423 |
| 175 | 3300005985 | Ga0081539_10001386 | Ga0081539_1000138627 | 423 |
| 176 | 3300026088 | Ga0207641_10089947 | Ga0207641_100899472 | 423 |
| 177 | 3300026116 | Ga0207674_10025821 | Ga0207674_100258213 | 423 |
| 178 | 3300032002 | Ga0307416_100051807 | Ga0307416_1000518072 | 423 |
| 179 | 3300035086 | Ga0373934_0038057 | Ga0373934_0038057_108_1466 | 423 |
| 180 | 3300047322 | Ga0495680_0100253 | Ga0495680_0100253_639_1997 | 423 |
| 181 | 3300048088 | Ga0495602_0024111 | Ga0495602_0024111_4011_5369 | 423 |
| 182 | 3300048907 | Ga0496104_0350867 | Ga0496104_0350867_11_1282 | 423 |
| 183 | 3300048915 | Ga0496112_0005115 | Ga0496112_0005115_8564_9835 | 423 |
| 184 | 3300048915 | Ga0496112_0014288 | Ga0496112_0014288_232_1503 | 423 |
| 185 | 3300060353 | Ga0501082_0335787 | Ga0501082_0335787_15_1289 | 423 |
| 186 | 3300005548 | Ga0070665_100031508 | Ga0070665_1000315082 | 424 |
| 187 | 3300005983 | Ga0081540_1017505 | Ga0081540_10175053 | 424 |
| 188 | 3300028379 | Ga0268266_10056335 | Ga0268266_100563352 | 424 |
| 189 | 3300031616 | Ga0307508_10004026 | Ga0307508_100040269 | 424 |
| 190 | 3300032126 | Ga0307415_100072424 | Ga0307415_1000724242 | 424 |
| 191 | 3300009177 | Ga0105248_10056078 | Ga0105248_100560782 | 425 |
| 192 | 3300013306 | Ga0163162_10305408 | Ga0163162_103054082 | 425 |
| 193 | 3300025941 | Ga0207711_10021967 | Ga0207711_100219672 | 425 |
| 194 | 3300028381 | Ga0268264_10018989 | Ga0268264_100189894 | 425 |
| 195 | 3300031507 | Ga0307509_10054677 | Ga0307509_100546773 | 425 |
| 196 | 3300031731 | Ga0307405_10038551 | Ga0307405_100385512 | 425 |
| 197 | 3300031733 | Ga0316577_10002961 | Ga0316577_100029611 | 425 |
| 198 | 3300031903 | Ga0307407_10021731 | Ga0307407_100217314 | 425 |
| 199 | 3300031995 | Ga0307409_100003188 | Ga0307409_1000031884 | 425 |
| 200 | 3300031995 | Ga0307409_100018133 | Ga0307409_1000181333 | 425 |
| 201 | 3300032002 | Ga0307416_100003741 | Ga0307416_1000037412 | 425 |
| 202 | 3300032126 | Ga0307415_100000071 | Ga0307415_1000000716 | 425 |
| 203 | 3300032126 | Ga0307415_100059026 | Ga0307415_1000590262 | 425 |
| 204 | 3300033529 | Ga0316587_1003395 | Ga0316587_10033951 | 425 |
| 205 | 3300033529 | Ga0316587_1005033 | Ga0316587_10050331 | 425 |
| 206 | 3300033529 | Ga0316587_1010829 | Ga0316587_10108291 | 425 |
| 207 | 3300035117 | Ga0373953_0018750 | Ga0373953_0018750_204_1529 | 425 |
| 208 | 3300035398 | Ga0316574_0015276 | Ga0316574_0015276_1875_3185 | 425 |
| 209 | 3300035692 | Ga0373935_0007408 | Ga0373935_0007408_3329_4633 | 425 |
| 210 | 3300035724 | Ga0373933_0036485 | Ga0373933_0036485_198_1556 | 425 |
| 211 | 3300038741 | Ga0400488_46678 | Ga0400488_46678_341_1651 | 425 |
| 212 | 3300039093 | Ga0400489_90291 | Ga0400489_90291_1157_2479 | 425 |
| 213 | 3300039093 | Ga0400489_92236 | Ga0400489_92236_15463_16773 | 425 |
| 214 | 3300039110 | Ga0400487_46379 | Ga0400487_46379_23_1333 | 425 |
| 215 | 3300039110 | Ga0400487_56871 | Ga0400487_56871_6048_7358 | 425 |
| 216 | 3300044712 | Ga0453684_0009878 | Ga0453684_0009878_5192_6502 | 425 |
| 217 | 3300044712 | Ga0453684_0029978 | Ga0453684_0029978_1741_3051 | 425 |
| 218 | 3300046462 | Ga0495651_0053368 | Ga0495651_0053368_820_2178 | 425 |
| 219 | 3300048088 | Ga0495602_0035651 | Ga0495602_0035651_1673_3031 | 425 |
| 220 | 3300048905 | Ga0496102_0129917 | Ga0496102_0129917_721_2058 | 425 |
| 221 | 3300048921 | Ga0496118_0090072 | Ga0496118_0090072_324_1661 | 425 |
| 222 | 3300049571 | Ga0501034_0000419 | Ga0501034_0000419_24800_26173 | 425 |
| 223 | 3300005437 | Ga0070710_10000463 | Ga0070710_100004633 | 426 |
| 224 | 3300025898 | Ga0207692_10000523 | Ga0207692_100005237 | 426 |
| 225 | 3300030733 | Ga0314311_1212962 | Ga0314311_12129622 | 426 |
| 226 | 3300044683 | Ga0466965_0003444 | Ga0466965_0003444_4731_6026 | 426 |
| 227 | 3300044683 | Ga0466965_0007762 | Ga0466965_0007762_559_1842 | 426 |
| 228 | 3300044683 | Ga0466965_0021631 | Ga0466965_0021631_1138_2421 | 426 |
| 229 | 3300045976 | Ga0466967_0225251 | Ga0466967_0225251_216_1547 | 426 |
| 230 | 3300046559 | Ga0495667_0013704 | Ga0495667_0013704_3737_5050 | 426 |
| 231 | 3300026067 | Ga0207678_10039000 | Ga0207678_100390002 | 427 |
| 232 | 3300046507 | Ga0495606_0013094 | Ga0495606_0013094_2866_4149 | 427 |
| 233 | 3300046616 | Ga0495668_0000182 | Ga0495668_0000182_80215_81498 | 427 |
| 234 | 3300046660 | Ga0495625_0000464 | Ga0495625_0000464_42775_44058 | 427 |
| 235 | 3300047323 | Ga0495683_0016323 | Ga0495683_0016323_2381_3664 | 427 |
| 236 | 3300048091 | Ga0495626_0001774 | Ga0495626_0001774_12272_13555 | 427 |
| 237 | 3300002244 | JGI24742J22300_10000738 | JGI24742J22300_100007383 | 428 |
| 238 | 3300005288 | Ga0065714_10089059 | Ga0065714_100890592 | 428 |
| 239 | 3300005328 | Ga0070676_10013240 | Ga0070676_100132404 | 428 |
| 240 | 3300005330 | Ga0070690_100082287 | Ga0070690_1000822872 | 428 |
| 241 | 3300005334 | Ga0068869_100032174 | Ga0068869_1000321742 | 428 |
| 242 | 3300005338 | Ga0068868_100080677 | Ga0068868_1000806771 | 428 |
| 243 | 3300005340 | Ga0070689_100056212 | Ga0070689_1000562122 | 428 |
| 244 | 3300005341 | Ga0070691_10026776 | Ga0070691_100267762 | 428 |
| 245 | 3300005355 | Ga0070671_100046235 | Ga0070671_1000462352 | 428 |
| 246 | 3300005365 | Ga0070688_100028259 | Ga0070688_1000282593 | 428 |
| 247 | 3300005366 | Ga0070659_100017222 | Ga0070659_1000172223 | 428 |
| 248 | 3300005434 | Ga0070709_10042489 | Ga0070709_100424892 | 428 |
| 249 | 3300005438 | Ga0070701_10016314 | Ga0070701_100163142 | 428 |
| 250 | 3300005439 | Ga0070711_100029945 | Ga0070711_1000299452 | 428 |
| 251 | 3300005440 | Ga0070705_100014840 | Ga0070705_1000148402 | 428 |
| 252 | 3300005441 | Ga0070700_100003624 | Ga0070700_1000036248 | 428 |
| 253 | 3300005456 | Ga0070678_100032623 | Ga0070678_1000326232 | 428 |
| 254 | 3300005457 | Ga0070662_100194584 | Ga0070662_1001945842 | 428 |
| 255 | 3300005539 | Ga0068853_100008349 | Ga0068853_1000083493 | 428 |
| 256 | 3300005544 | Ga0070686_100042436 | Ga0070686_1000424362 | 428 |
| 257 | 3300005546 | Ga0070696_100012182 | Ga0070696_1000121823 | 428 |
| 258 | 3300005548 | Ga0070665_100062684 | Ga0070665_1000626841 | 428 |
| 259 | 3300005549 | Ga0070704_100003385 | Ga0070704_1000033854 | 428 |
| 260 | 3300005563 | Ga0068855_100054597 | Ga0068855_1000545972 | 428 |
| 261 | 3300005578 | Ga0068854_100036762 | Ga0068854_1000367622 | 428 |
| 262 | 3300005616 | Ga0068852_100027507 | Ga0068852_1000275073 | 428 |
| 263 | 3300005617 | Ga0068859_100012755 | Ga0068859_1000127556 | 428 |
| 264 | 3300005719 | Ga0068861_100017127 | Ga0068861_1000171273 | 428 |
| 265 | 3300005843 | Ga0068860_100048640 | Ga0068860_1000486402 | 428 |
| 266 | 3300005985 | Ga0081539_10004997 | Ga0081539_100049973 | 428 |
| 267 | 3300006163 | Ga0070715_10003185 | Ga0070715_100031853 | 428 |
| 268 | 3300006173 | Ga0070716_100003680 | Ga0070716_1000036803 | 428 |
| 269 | 3300006175 | Ga0070712_100011158 | Ga0070712_1000111583 | 428 |
| 270 | 3300006931 | Ga0097620_100012754 | Ga0097620_1000127546 | 428 |
| 271 | 3300009098 | Ga0105245_10026061 | Ga0105245_100260613 | 428 |
| 272 | 3300009101 | Ga0105247_10016500 | Ga0105247_100165003 | 428 |
| 273 | 3300009148 | Ga0105243_10013454 | Ga0105243_100134543 | 428 |
| 274 | 3300009176 | Ga0105242_10017039 | Ga0105242_100170393 | 428 |
| 275 | 3300009545 | Ga0105237_10035761 | Ga0105237_100357612 | 428 |
| 276 | 3300010375 | Ga0105239_10028033 | Ga0105239_100280333 | 428 |
| 277 | 3300013297 | Ga0157378_10288786 | Ga0157378_102887861 | 428 |
| 278 | 3300014326 | Ga0157380_10091050 | Ga0157380_100910502 | 428 |
| 279 | 3300014745 | Ga0157377_10028980 | Ga0157377_100289803 | 428 |
| 280 | 3300017792 | Ga0163161_10007930 | Ga0163161_100079305 | 428 |
| 281 | 3300025898 | Ga0207692_10003276 | Ga0207692_100032765 | 428 |
| 282 | 3300025899 | Ga0207642_10006583 | Ga0207642_100065833 | 428 |
| 283 | 3300025901 | Ga0207688_10001124 | Ga0207688_100011244 | 428 |
| 284 | 3300025903 | Ga0207680_10051419 | Ga0207680_100514192 | 428 |
| 285 | 3300025915 | Ga0207693_10008492 | Ga0207693_100084926 | 428 |
| 286 | 3300025932 | Ga0207690_10082994 | Ga0207690_100829942 | 428 |
| 287 | 3300025933 | Ga0207706_10028367 | Ga0207706_100283676 | 428 |
| 288 | 3300025934 | Ga0207686_10067540 | Ga0207686_100675401 | 428 |
| 289 | 3300025935 | Ga0207709_10009207 | Ga0207709_100092073 | 428 |
| 290 | 3300025939 | Ga0207665_10002740 | Ga0207665_100027408 | 428 |
| 291 | 3300025940 | Ga0207691_10207000 | Ga0207691_102070001 | 428 |
| 292 | 3300025942 | Ga0207689_10042117 | Ga0207689_100421172 | 428 |
| 293 | 3300025986 | Ga0207658_10044590 | Ga0207658_100445902 | 428 |
| 294 | 3300026035 | Ga0207703_10071745 | Ga0207703_100717452 | 428 |
| 295 | 3300026041 | Ga0207639_10021897 | Ga0207639_100218975 | 428 |
| 296 | 3300026067 | Ga0207678_10023040 | Ga0207678_100230403 | 428 |
| 297 | 3300026075 | Ga0207708_10009740 | Ga0207708_100097404 | 428 |
| 298 | 3300026089 | Ga0207648_10004840 | Ga0207648_100048404 | 428 |
| 299 | 3300026118 | Ga0207675_100009536 | Ga0207675_1000095364 | 428 |
| 300 | 3300026121 | Ga0207683_10003905 | Ga0207683_100039053 | 428 |
| 301 | 3300035691 | Ga0373931_0058559 | Ga0373931_0058559_704_2035 | 428 |
| 302 | 3300048903 | Ga0496100_0038256 | Ga0496100_0038256_1516_2847 | 428 |
| 303 | 3300048904 | Ga0496101_0016361 | Ga0496101_0016361_2285_3616 | 428 |
| 304 | 3300048906 | Ga0496103_0004802 | Ga0496103_0004802_2775_4106 | 428 |
| 305 | 3300048909 | Ga0496106_0012275 | Ga0496106_0012275_1296_2627 | 428 |
| 306 | 3300048910 | Ga0496107_0006564 | Ga0496107_0006564_3312_4643 | 428 |
| 307 | 3300048917 | Ga0496114_0021886 | Ga0496114_0021886_3658_4989 | 428 |
| 308 | 3300053078 | Ga0495612_0035606 | Ga0495612_0035606_46_1377 | 428 |
| 309 | 3300045049 | Ga0466959_0147916 | Ga0466959_0147916_295_1626 | 429 |
| 310 | 3300003792 | Ga0055540_1000151 | Ga0055540_100015127 | 430 |
| 311 | 3300005367 | Ga0070667_100000274 | Ga0070667_10000027422 | 430 |
| 312 | 3300005434 | Ga0070709_10053489 | Ga0070709_100534892 | 430 |
| 313 | 3300005535 | Ga0070684_100136438 | Ga0070684_1001364382 | 430 |
| 314 | 3300005535 | Ga0070684_100193870 | Ga0070684_1001938701 | 430 |
| 315 | 3300009545 | Ga0105237_10025822 | Ga0105237_100258222 | 430 |
| 316 | 3300010375 | Ga0105239_10009408 | Ga0105239_100094083 | 430 |
| 317 | 3300020069 | Ga0197907_10116683 | Ga0197907_101166832 | 430 |
| 318 | 3300025303 | Ga0209051_1000075 | Ga0209051_1000075165 | 430 |
| 319 | 3300025903 | Ga0207680_10004471 | Ga0207680_100044715 | 430 |
| 320 | 3300025914 | Ga0207671_10083588 | Ga0207671_100835882 | 430 |
| 321 | 3300025944 | Ga0207661_10056544 | Ga0207661_100565443 | 430 |
| 322 | 3300025986 | Ga0207658_10000423 | Ga0207658_1000042322 | 430 |
| 323 | 3300028800 | Ga0265338_10006264 | Ga0265338_100062648 | 430 |
| 324 | 3300031251 | Ga0265327_10001438 | Ga0265327_1000143816 | 430 |
| 325 | 3300044842 | Ga0466957_0030002 | Ga0466957_0030002_750_2054 | 430 |
| 326 | 3300048903 | Ga0496100_0000092 | Ga0496100_0000092_29806_31146 | 430 |
| 327 | 3300048904 | Ga0496101_0000018 | Ga0496101_0000018_29680_31020 | 430 |
| 328 | 3300048905 | Ga0496102_0007973 | Ga0496102_0007973_3868_5208 | 430 |
| 329 | 3300048906 | Ga0496103_0000727 | Ga0496103_0000727_17626_18966 | 430 |
| 330 | 3300048909 | Ga0496106_0002072 | Ga0496106_0002072_285_1625 | 430 |
| 331 | 3300048910 | Ga0496107_0000935 | Ga0496107_0000935_10015_11355 | 430 |
| 332 | 3300048911 | Ga0496108_0008211 | Ga0496108_0008211_6910_8250 | 430 |
| 333 | 3300048912 | Ga0496109_0000688 | Ga0496109_0000688_7021_8361 | 430 |
| 334 | 3300048913 | Ga0496110_0020138 | Ga0496110_0020138_3968_5308 | 430 |
| 335 | 3300048914 | Ga0496111_0028665 | Ga0496111_0028665_1911_3251 | 430 |
| 336 | 3300048917 | Ga0496114_0001339 | Ga0496114_0001339_9022_10362 | 430 |
| 337 | 3300048919 | Ga0496116_0005632 | Ga0496116_0005632_2846_4186 | 430 |
| 338 | 3300048921 | Ga0496118_0015918 | Ga0496118_0015918_2847_4187 | 430 |
| 339 | 3300048923 | Ga0496120_0033465 | Ga0496120_0033465_242_1582 | 430 |
| 340 | 3300048924 | Ga0496121_0000023 | Ga0496121_0000023_422485_423825 | 430 |
| 341 | 3300048925 | Ga0496122_0000164 | Ga0496122_0000164_126822_128162 | 430 |
| 342 | 3300048927 | Ga0496124_0000014 | Ga0496124_0000014_422485_423825 | 430 |
| 343 | 3300048928 | Ga0496125_0000020 | Ga0496125_0000020_39624_40964 | 430 |
| 344 | 3300048929 | Ga0496126_0000023 | Ga0496126_0000023_422485_423825 | 430 |
| 345 | iso_pu_bacteria | 2791354901 | 2791915920 | 430 |
| 346 | 3300014497 | Ga0182008_10084003 | Ga0182008_100840031 | 431 |
| 347 | 3300044901 | Ga0466960_0000745 | Ga0466960_0000745_7907_9220 | 431 |
| 348 | 3300048912 | Ga0496109_0019911 | Ga0496109_0019911_920_2251 | 431 |
| 349 | 3300048924 | Ga0496121_0000040 | Ga0496121_0000040_341087_342409 | 431 |
| 350 | 3300049568 | Ga0501031_0005397 | Ga0501031_0005397_1119_2468 | 431 |
| 351 | 3300049572 | Ga0501036_0005514 | Ga0501036_0005514_8551_9900 | 431 |
| 352 | 3300049576 | Ga0501040_0008855 | Ga0501040_0008855_4652_6001 | 431 |
| 353 | 3300049578 | Ga0501042_0004599 | Ga0501042_0004599_1595_2944 | 431 |
| 354 | 3300049582 | Ga0501048_0010469 | Ga0501048_0010469_2472_3821 | 431 |
| 355 | 3300049587 | Ga0501071_0011093 | Ga0501071_0011093_4422_5771 | 431 |
| 356 | 3300049588 | Ga0501072_0011323 | Ga0501072_0011323_3084_4433 | 431 |
| 357 | 3300049590 | Ga0501074_0007071 | Ga0501074_0007071_3684_5033 | 431 |
| 358 | 3300049591 | Ga0501075_0013707 | Ga0501075_0013707_2884_4233 | 431 |
| 359 | 3300049592 | Ga0501076_0007625 | Ga0501076_0007625_5743_7092 | 431 |
| 360 | 3300049593 | Ga0501077_0007115 | Ga0501077_0007115_2423_3772 | 431 |
| 361 | 3300049741 | Ga0501079_0026643 | Ga0501079_0026643_1957_3306 | 431 |
| 362 | 3300049743 | Ga0501081_0042748 | Ga0501081_0042748_1574_2923 | 431 |
| 363 | 3300049822 | Ga0501035_0101828 | Ga0501035_0101828_835_2184 | 431 |
| 364 | 3300049824 | Ga0501045_0015883 | Ga0501045_0015883_2126_3475 | 431 |
| 365 | 3300050492 | nmdc:mga0yw44_3567_c1 | nmdc:mga0yw44_3567_c1_1533_2864 | 431 |
| 366 | 3300054114 | Ga0501084_0006238 | Ga0501084_0006238_2362_3711 | 431 |
| 367 | 3300060353 | Ga0501082_0173233 | Ga0501082_0173233_216_1565 | 431 |
| 368 | 3300061734 | Ga0530510_0004246 | Ga0530510_0004246_4424_5773 | 431 |
| 369 | 3300005466 | Ga0070685_10140487 | Ga0070685_101404871 | 432 |
| 370 | 3300009545 | Ga0105237_10062059 | Ga0105237_100620593 | 432 |
| 371 | 3300013105 | Ga0157369_10040006 | Ga0157369_100400064 | 432 |
| 372 | 3300025913 | Ga0207695_10014175 | Ga0207695_100141754 | 432 |
| 373 | 3300025914 | Ga0207671_10034894 | Ga0207671_100348943 | 432 |
| 374 | 3300026078 | Ga0207702_10028954 | Ga0207702_100289544 | 432 |
| 375 | 3300044658 | Ga0466972_0016381 | Ga0466972_0016381_432_1733 | 432 |
| 376 | 3300045976 | Ga0466967_0033243 | Ga0466967_0033243_17_1327 | 432 |
| 377 | 3300048907 | Ga0496104_0093953 | Ga0496104_0093953_43_1422 | 432 |
| 378 | 3300048917 | Ga0496114_0029190 | Ga0496114_0029190_1063_2442 | 432 |
| 379 | 3300048918 | Ga0496115_0074859 | Ga0496115_0074859_1113_2492 | 432 |
| 380 | 3300049824 | Ga0501045_0034276 | Ga0501045_0034276_1886_3217 | 432 |
| 381 | 3300050492 | nmdc:mga0yw44_44144_c1 | nmdc:mga0yw44_44144_c1_977_2296 | 432 |
| 382 | iso_pu_bacteria | 2857479173 | 2857479889 | 433 |
| 383 | iso_pu_bacteria | 2857632687 | 2857633258 | 433 |
| 384 | iso_pu_bacteria | 2870801768 | 2870802621 | 433 |
| 385 | iso_pu_bacteria | 2870804320 | 2870804702 | 433 |
| 386 | iso_pu_bacteria | 8056207758 | 8056212039 | 433 |
| 387 | iso_pu_bacteria | 2582581312 | 2585299721 | 434 |
| 388 | iso_pu_bacteria | 2558860280 | 2559431129 | 435 |
| 389 | iso_pu_bacteria | 2643221615 | 2644089766 | 435 |
| 390 | iso_pu_bacteria | 2643221657 | 2644319611 | 435 |
| 391 | iso_pu_bacteria | 2893684298 | 2893686605 | 435 |
| 392 | iso_pu_bacteria | 8054704163 | 8054710913 | 435 |
| 393 | iso_pu_bacteria | 8056060235 | 8056063949 | 435 |
| 394 | 3300005343 | Ga0070687_100073648 | Ga0070687_1000736481 | 436 |
| 395 | 3300005347 | Ga0070668_100040980 | Ga0070668_1000409802 | 436 |
| 396 | 3300005365 | Ga0070688_100064023 | Ga0070688_1000640232 | 436 |
| 397 | 3300005366 | Ga0070659_100064120 | Ga0070659_1000641202 | 436 |
| 398 | 3300005436 | Ga0070713_100258183 | Ga0070713_1002581832 | 436 |
| 399 | 3300005539 | Ga0068853_100005343 | Ga0068853_1000053434 | 436 |
| 400 | 3300005544 | Ga0070686_100044871 | Ga0070686_1000448713 | 436 |
| 401 | 3300005563 | Ga0068855_100280728 | Ga0068855_1002807282 | 436 |
| 402 | 3300005577 | Ga0068857_100142969 | Ga0068857_1001429692 | 436 |
| 403 | 3300005615 | Ga0070702_100033771 | Ga0070702_1000337712 | 436 |
| 404 | 3300005616 | Ga0068852_100031952 | Ga0068852_1000319522 | 436 |
| 405 | 3300005718 | Ga0068866_10005193 | Ga0068866_100051935 | 436 |
| 406 | 3300006844 | Ga0075428_100002554 | Ga0075428_10000255411 | 436 |
| 407 | 3300006846 | Ga0075430_100003453 | Ga0075430_1000034532 | 436 |
| 408 | 3300006847 | Ga0075431_100010144 | Ga0075431_1000101443 | 436 |
| 409 | 3300006880 | Ga0075429_100001358 | Ga0075429_10000135818 | 436 |
| 410 | 3300009147 | Ga0114129_10003492 | Ga0114129_1000349219 | 436 |
| 411 | 3300009551 | Ga0105238_10210488 | Ga0105238_102104882 | 436 |
| 412 | 3300009553 | Ga0105249_10077841 | Ga0105249_100778415 | 436 |
| 413 | 3300011119 | Ga0105246_10120991 | Ga0105246_101209912 | 436 |
| 414 | 3300014968 | Ga0157379_10067044 | Ga0157379_100670444 | 436 |
| 415 | 3300021388 | Ga0213875_10005790 | Ga0213875_100057903 | 436 |
| 416 | 3300025901 | Ga0207688_10041401 | Ga0207688_100414012 | 436 |
| 417 | 3300025914 | Ga0207671_10085080 | Ga0207671_100850802 | 436 |
| 418 | 3300025917 | Ga0207660_10078396 | Ga0207660_100783962 | 436 |
| 419 | 3300025919 | Ga0207657_10099648 | Ga0207657_100996482 | 436 |
| 420 | 3300025927 | Ga0207687_10020433 | Ga0207687_100204335 | 436 |
| 421 | 3300025942 | Ga0207689_10021795 | Ga0207689_100217955 | 436 |
| 422 | 3300025960 | Ga0207651_10163247 | Ga0207651_101632471 | 436 |
| 423 | 3300025972 | Ga0207668_10028789 | Ga0207668_100287893 | 436 |
| 424 | 3300026067 | Ga0207678_10006493 | Ga0207678_1000649310 | 436 |
| 425 | 3300026116 | Ga0207674_10059551 | Ga0207674_100595513 | 436 |
| 426 | 3300026118 | Ga0207675_100080852 | Ga0207675_1000808522 | 436 |
| 427 | 3300026142 | Ga0207698_10196066 | Ga0207698_101960661 | 436 |
| 428 | 3300028379 | Ga0268266_10022863 | Ga0268266_100228634 | 436 |
| 429 | 3300030521 | Ga0307511_10001301 | Ga0307511_1000130110 | 436 |
| 430 | 3300031727 | Ga0316576_10000208 | Ga0316576_100002085 | 436 |
| 431 | 3300044684 | Ga0466966_0004604 | Ga0466966_0004604_2776_4107 | 436 |
| 432 | 3300044693 | Ga0466961_0002160 | Ga0466961_0002160_8952_10283 | 436 |
| 433 | 3300045049 | Ga0466959_0017177 | Ga0466959_0017177_2314_3645 | 436 |
| 434 | 3300050508 | nmdc:mga09592_41508_c1 | nmdc:mga09592_41508_c1_1660_3018 | 436 |
| 435 | 3300050509 | nmdc:mga0qj67_27993_c1 | nmdc:mga0qj67_27993_c1_1226_2584 | 436 |
| 436 | 3300050510 | nmdc:mga06r32_78017_c1 | nmdc:mga06r32_78017_c1_1367_2725 | 436 |
| 437 | 3300050511 | nmdc:mga08y16_144330_c1 | nmdc:mga08y16_144330_c1_794_2143 | 436 |
| 438 | iso_pu_bacteria | 2687453737 | 2689955885 | 436 |
| 439 | iso_pu_bacteria | 2738541264 | 2738667586 | 436 |
| 440 | iso_pu_bacteria | 2738541356 | 2739146656 | 436 |
| 441 | iso_pu_bacteria | 2784132109 | 2784473296 | 436 |
| 442 | iso_pu_bacteria | 2939582691 | 2939584442 | 436 |
| 443 | 3300013296 | Ga0157374_10101872 | Ga0157374_101018722 | 437 |
| 444 | 3300017792 | Ga0163161_10038949 | Ga0163161_100389493 | 437 |
| 445 | 3300025901 | Ga0207688_10035841 | Ga0207688_100358413 | 437 |
| 446 | 3300026089 | Ga0207648_10210766 | Ga0207648_102107662 | 437 |
| 447 | 3300037853 | Ga0436364_0206485 | Ga0436364_0206485_4535_5881 | 437 |
| 448 | 3300044765 | Ga0466970_0002336 | Ga0466970_0002336_7089_8414 | 437 |
| 449 | 3300048905 | Ga0496102_0000596 | Ga0496102_0000596_21936_23264 | 437 |
| 450 | 3300048906 | Ga0496103_0054242 | Ga0496103_0054242_122_1450 | 437 |
| 451 | 3300048927 | Ga0496124_0024555 | Ga0496124_0024555_100_1422 | 437 |
| 452 | 3300049571 | Ga0501034_0026165 | Ga0501034_0026165_2467_3807 | 437 |
| 453 | 3300053077 | Ga0495601_0059509 | Ga0495601_0059509_103_1452 | 437 |
| 454 | iso_pu_bacteria | 2643221632 | 2644184016 | 437 |
| 455 | iso_pu_bacteria | 2738543005 | 2739203666 | 437 |
| 456 | iso_pu_bacteria | 2739367653 | 2739604111 | 437 |
| 457 | iso_pu_bacteria | 2816332305 | 2817509876 | 437 |
| 458 | iso_pu_bacteria | 2857727296 | 2857727535 | 437 |
| 459 | iso_pu_bacteria | 2857729791 | 2857732304 | 437 |
| 460 | iso_pu_bacteria | 2870622029 | 2870622359 | 437 |
| 461 | iso_pu_bacteria | 2902810491 | 2902812340 | 437 |
| 462 | iso_pu_bacteria | 2920879853 | 2920883143 | 437 |
| 463 | iso_pu_bacteria | 2928121344 | 2928124804 | 437 |
| 464 | iso_pu_bacteria | 8046352972 | 8046355678 | 437 |
| 465 | 3300002067 | JGI24735J21928_10017543 | JGI24735J21928_100175432 | 438 |
| 466 | 3300005327 | Ga0070658_10013145 | Ga0070658_100131453 | 438 |
| 467 | 3300005327 | Ga0070658_10055535 | Ga0070658_100555352 | 438 |
| 468 | 3300005338 | Ga0068868_100004201 | Ga0068868_10000420111 | 438 |
| 469 | 3300005339 | Ga0070660_100101530 | Ga0070660_1001015301 | 438 |
| 470 | 3300005344 | Ga0070661_100099719 | Ga0070661_1000997193 | 438 |
| 471 | 3300005344 | Ga0070661_100106607 | Ga0070661_1001066071 | 438 |
| 472 | 3300005347 | Ga0070668_100020218 | Ga0070668_1000202185 | 438 |
| 473 | 3300005354 | Ga0070675_100155834 | Ga0070675_1001558341 | 438 |
| 474 | 3300005356 | Ga0070674_100084710 | Ga0070674_1000847101 | 438 |
| 475 | 3300005366 | Ga0070659_100005597 | Ga0070659_1000055973 | 438 |
| 476 | 3300005366 | Ga0070659_100020191 | Ga0070659_1000201911 | 438 |
| 477 | 3300005367 | Ga0070667_100001524 | Ga0070667_10000152417 | 438 |
| 478 | 3300005436 | Ga0070713_100017302 | Ga0070713_1000173023 | 438 |
| 479 | 3300005438 | Ga0070701_10033478 | Ga0070701_100334784 | 438 |
| 480 | 3300005440 | Ga0070705_100057691 | Ga0070705_1000576913 | 438 |
| 481 | 3300005444 | Ga0070694_100005751 | Ga0070694_1000057515 | 438 |
| 482 | 3300005466 | Ga0070685_10002766 | Ga0070685_100027664 | 438 |
| 483 | 3300005535 | Ga0070684_100126666 | Ga0070684_1001266662 | 438 |
| 484 | 3300005539 | Ga0068853_100165585 | Ga0068853_1001655852 | 438 |
| 485 | 3300005545 | Ga0070695_100015011 | Ga0070695_1000150111 | 438 |
| 486 | 3300005549 | Ga0070704_100002347 | Ga0070704_10000234711 | 438 |
| 487 | 3300005563 | Ga0068855_100004547 | Ga0068855_1000045475 | 438 |
| 488 | 3300005563 | Ga0068855_100006713 | Ga0068855_1000067133 | 438 |
| 489 | 3300005563 | Ga0068855_100086849 | Ga0068855_1000868492 | 438 |
| 490 | 3300005563 | Ga0068855_100209765 | Ga0068855_1002097653 | 438 |
| 491 | 3300005577 | Ga0068857_100003425 | Ga0068857_1000034259 | 438 |
| 492 | 3300005614 | Ga0068856_100005605 | Ga0068856_1000056059 | 438 |
| 493 | 3300005614 | Ga0068856_100022233 | Ga0068856_1000222333 | 438 |
| 494 | 3300005615 | Ga0070702_100003327 | Ga0070702_1000033275 | 438 |
| 495 | 3300005616 | Ga0068852_100005871 | Ga0068852_1000058712 | 438 |
| 496 | 3300005616 | Ga0068852_100040501 | Ga0068852_1000405013 | 438 |
| 497 | 3300005616 | Ga0068852_100139191 | Ga0068852_1001391914 | 438 |
| 498 | 3300005719 | Ga0068861_100057183 | Ga0068861_1000571833 | 438 |
| 499 | 3300005834 | Ga0068851_10000005 | Ga0068851_10000005120 | 438 |
| 500 | 3300005840 | Ga0068870_10020159 | Ga0068870_100201592 | 438 |
| 501 | 3300005842 | Ga0068858_100000058 | Ga0068858_10000005883 | 438 |
| 502 | 3300005842 | Ga0068858_100202669 | Ga0068858_1002026691 | 438 |
| 503 | 3300005843 | Ga0068860_100020377 | Ga0068860_1000203772 | 438 |
| 504 | 3300005983 | Ga0081540_1001571 | Ga0081540_100157117 | 438 |
| 505 | 3300006028 | Ga0070717_10016290 | Ga0070717_100162904 | 438 |
| 506 | 3300006237 | Ga0097621_100027509 | Ga0097621_1000275093 | 438 |
| 507 | 3300009093 | Ga0105240_10009128 | Ga0105240_100091289 | 438 |
| 508 | 3300009093 | Ga0105240_10064152 | Ga0105240_100641524 | 438 |
| 509 | 3300009093 | Ga0105240_10196807 | Ga0105240_101968073 | 438 |
| 510 | 3300009148 | Ga0105243_10181781 | Ga0105243_101817812 | 438 |
| 511 | 3300009174 | Ga0105241_10000772 | Ga0105241_100007727 | 438 |
| 512 | 3300009176 | Ga0105242_10035350 | Ga0105242_100353502 | 438 |
| 513 | 3300009177 | Ga0105248_10046208 | Ga0105248_100462083 | 438 |
| 514 | 3300009177 | Ga0105248_10100427 | Ga0105248_101004273 | 438 |
| 515 | 3300009545 | Ga0105237_10002853 | Ga0105237_1000285312 | 438 |
| 516 | 3300009545 | Ga0105237_10051012 | Ga0105237_100510121 | 438 |
| 517 | 3300010375 | Ga0105239_10393219 | Ga0105239_103932192 | 438 |
| 518 | 3300011119 | Ga0105246_10072017 | Ga0105246_100720173 | 438 |
| 519 | 3300013102 | Ga0157371_10043457 | Ga0157371_100434571 | 438 |
| 520 | 3300013104 | Ga0157370_10033203 | Ga0157370_100332032 | 438 |
| 521 | 3300013296 | Ga0157374_10111570 | Ga0157374_101115702 | 438 |
| 522 | 3300013297 | Ga0157378_10016267 | Ga0157378_100162675 | 438 |
| 523 | 3300013306 | Ga0163162_10010744 | Ga0163162_100107444 | 438 |
| 524 | 3300013307 | Ga0157372_10014423 | Ga0157372_100144234 | 438 |
| 525 | 3300014326 | Ga0157380_10128422 | Ga0157380_101284223 | 438 |
| 526 | 3300014968 | Ga0157379_10017719 | Ga0157379_100177193 | 438 |
| 527 | 3300014969 | Ga0157376_10222520 | Ga0157376_102225202 | 438 |
| 528 | 3300017792 | Ga0163161_10020533 | Ga0163161_100205334 | 438 |
| 529 | 3300020082 | Ga0206353_10717049 | Ga0206353_107170492 | 438 |
| 530 | 3300025254 | Ga0209148_1000907 | Ga0209148_100090713 | 438 |
| 531 | 3300025321 | Ga0207656_10000001 | Ga0207656_10000001181 | 438 |
| 532 | 3300025321 | Ga0207656_10000003 | Ga0207656_10000003287 | 438 |
| 533 | 3300025321 | Ga0207656_10000004 | Ga0207656_10000004144 | 438 |
| 534 | 3300025901 | Ga0207688_10001953 | Ga0207688_100019531 | 438 |
| 535 | 3300025903 | Ga0207680_10031683 | Ga0207680_100316833 | 438 |
| 536 | 3300025909 | Ga0207705_10004458 | Ga0207705_1000445811 | 438 |
| 537 | 3300025909 | Ga0207705_10140811 | Ga0207705_101408112 | 438 |
| 538 | 3300025911 | Ga0207654_10000003 | Ga0207654_10000003501 | 438 |
| 539 | 3300025913 | Ga0207695_10013965 | Ga0207695_100139653 | 438 |
| 540 | 3300025913 | Ga0207695_10050781 | Ga0207695_100507814 | 438 |
| 541 | 3300025914 | Ga0207671_10000001 | Ga0207671_10000001179 | 438 |
| 542 | 3300025915 | Ga0207693_10018010 | Ga0207693_100180102 | 438 |
| 543 | 3300025919 | Ga0207657_10003219 | Ga0207657_100032198 | 438 |
| 544 | 3300025919 | Ga0207657_10172647 | Ga0207657_101726472 | 438 |
| 545 | 3300025920 | Ga0207649_10019926 | Ga0207649_100199262 | 438 |
| 546 | 3300025924 | Ga0207694_10000039 | Ga0207694_10000039167 | 438 |
| 547 | 3300025927 | Ga0207687_10020145 | Ga0207687_100201454 | 438 |
| 548 | 3300025932 | Ga0207690_10001473 | Ga0207690_100014737 | 438 |
| 549 | 3300025932 | Ga0207690_10057859 | Ga0207690_100578593 | 438 |
| 550 | 3300025935 | Ga0207709_10014342 | Ga0207709_100143422 | 438 |
| 551 | 3300025939 | Ga0207665_10000995 | Ga0207665_1000099520 | 438 |
| 552 | 3300025941 | Ga0207711_10015199 | Ga0207711_100151994 | 438 |
| 553 | 3300025949 | Ga0207667_10002609 | Ga0207667_1000260911 | 438 |
| 554 | 3300025949 | Ga0207667_10018589 | Ga0207667_100185893 | 438 |
| 555 | 3300025949 | Ga0207667_10104838 | Ga0207667_101048382 | 438 |
| 556 | 3300025949 | Ga0207667_10236499 | Ga0207667_102364992 | 438 |
| 557 | 3300025981 | Ga0207640_10057688 | Ga0207640_100576881 | 438 |
| 558 | 3300026035 | Ga0207703_10000026 | Ga0207703_100000267 | 438 |
| 559 | 3300026067 | Ga0207678_10001903 | Ga0207678_1000190317 | 438 |
| 560 | 3300026078 | Ga0207702_10026441 | Ga0207702_100264412 | 438 |
| 561 | 3300026078 | Ga0207702_10103335 | Ga0207702_101033352 | 438 |
| 562 | 3300026078 | Ga0207702_10132370 | Ga0207702_101323701 | 438 |
| 563 | 3300026116 | Ga0207674_10006493 | Ga0207674_100064938 | 438 |
| 564 | 3300026116 | Ga0207674_10080496 | Ga0207674_100804963 | 438 |
| 565 | 3300026118 | Ga0207675_100013715 | Ga0207675_1000137152 | 438 |
| 566 | 3300026121 | Ga0207683_10008837 | Ga0207683_100088375 | 438 |
| 567 | 3300026142 | Ga0207698_10001479 | Ga0207698_100014798 | 438 |
| 568 | 3300028381 | Ga0268264_10121427 | Ga0268264_101214273 | 438 |
| 569 | 3300031247 | Ga0265340_10017009 | Ga0265340_100170093 | 438 |
| 570 | 3300035112 | Ga0373932_0008770 | Ga0373932_0008770_915_2324 | 438 |
| 571 | 3300037466 | Ga0395898_0169526 | Ga0395898_0169526_190_1515 | 438 |
| 572 | 3300037853 | Ga0436364_0540807 | Ga0436364_0540807_1065_2402 | 438 |
| 573 | 3300044683 | Ga0466965_0000033 | Ga0466965_0000033_27937_29259 | 438 |
| 574 | 3300044693 | Ga0466961_0053842 | Ga0466961_0053842_405_1736 | 438 |
| 575 | 3300044842 | Ga0466957_0138971 | Ga0466957_0138971_153_1484 | 438 |
| 576 | 3300048907 | Ga0496104_0047128 | Ga0496104_0047128_762_2171 | 438 |
| 577 | 3300048911 | Ga0496108_0023924 | Ga0496108_0023924_2326_3735 | 438 |
| 578 | 3300048917 | Ga0496114_0218840 | Ga0496114_0218840_231_1640 | 438 |
| 579 | 3300048929 | Ga0496126_0000090 | Ga0496126_0000090_180429_181760 | 438 |
| 580 | 3300049569 | Ga0501032_0006594 | Ga0501032_0006594_3742_5064 | 438 |
| 581 | 3300049570 | Ga0501033_0028033 | Ga0501033_0028033_810_2132 | 438 |
| 582 | 3300049570 | Ga0501033_0036462 | Ga0501033_0036462_1364_2686 | 438 |
| 583 | 3300049571 | Ga0501034_0078355 | Ga0501034_0078355_1657_2979 | 438 |
| 584 | 3300049571 | Ga0501034_0107146 | Ga0501034_0107146_366_1688 | 438 |
| 585 | 3300049573 | Ga0501037_0051933 | Ga0501037_0051933_1190_2512 | 438 |
| 586 | 3300049574 | Ga0501038_0005310 | Ga0501038_0005310_2139_3461 | 438 |
| 587 | 3300049581 | Ga0501047_0040928 | Ga0501047_0040928_2929_4251 | 438 |
| 588 | 3300050512 | nmdc:mga0n895_19316_c1 | nmdc:mga0n895_19316_c1_603_2012 | 438 |
| 589 | 3300050513 | nmdc:mga0rr50_23628_c1 | nmdc:mga0rr50_23628_c1_2819_4228 | 438 |
| 590 | 3300053139 | Ga0500568_0000970 | Ga0500568_0000970_1134_2456 | 438 |
| 591 | 3300053140 | Ga0500573_0024571 | Ga0500573_0024571_1835_3157 | 438 |
| 592 | 3300053140 | Ga0500573_0037001 | Ga0500573_0037001_71_1393 | 438 |
| 593 | 3300053148 | Ga0500590_004738 | Ga0500590_004738_3507_4829 | 438 |
| 594 | 3300053155 | Ga0500620_001941 | Ga0500620_001941_2472_3794 | 438 |
| 595 | 3300005366 | Ga0070659_100116379 | Ga0070659_1001163792 | 439 |
| 596 | 3300005435 | Ga0070714_100000011 | Ga0070714_100000011194 | 439 |
| 597 | 3300005435 | Ga0070714_100275073 | Ga0070714_1002750731 | 439 |
| 598 | 3300005543 | Ga0070672_100052179 | Ga0070672_1000521792 | 439 |
| 599 | 3300005548 | Ga0070665_100032143 | Ga0070665_1000321433 | 439 |
| 600 | 3300005563 | Ga0068855_100016017 | Ga0068855_1000160178 | 439 |
| 601 | 3300005563 | Ga0068855_100062487 | Ga0068855_1000624873 | 439 |
| 602 | 3300005563 | Ga0068855_100116992 | Ga0068855_1001169922 | 439 |
| 603 | 3300005578 | Ga0068854_100007727 | Ga0068854_1000077274 | 439 |
| 604 | 3300005614 | Ga0068856_100054151 | Ga0068856_1000541513 | 439 |
| 605 | 3300005616 | Ga0068852_100008555 | Ga0068852_1000085553 | 439 |
| 606 | 3300005616 | Ga0068852_100015780 | Ga0068852_1000157802 | 439 |
| 607 | 3300005616 | Ga0068852_100203944 | Ga0068852_1002039442 | 439 |
| 608 | 3300005617 | Ga0068859_100015246 | Ga0068859_1000152463 | 439 |
| 609 | 3300006051 | Ga0075364_10002585 | Ga0075364_100025853 | 439 |
| 610 | 3300006931 | Ga0097620_100015246 | Ga0097620_1000152466 | 439 |
| 611 | 3300009093 | Ga0105240_10021145 | Ga0105240_100211454 | 439 |
| 612 | 3300009098 | Ga0105245_10066101 | Ga0105245_100661012 | 439 |
| 613 | 3300009098 | Ga0105245_10195087 | Ga0105245_101950872 | 439 |
| 614 | 3300009174 | Ga0105241_10003418 | Ga0105241_100034182 | 439 |
| 615 | 3300009177 | Ga0105248_10000784 | Ga0105248_1000078415 | 439 |
| 616 | 3300009551 | Ga0105238_10011164 | Ga0105238_100111646 | 439 |
| 617 | 3300013296 | Ga0157374_10024129 | Ga0157374_100241292 | 439 |
| 618 | 3300013307 | Ga0157372_10000006 | Ga0157372_10000006166 | 439 |
| 619 | 3300014325 | Ga0163163_10001963 | Ga0163163_100019632 | 439 |
| 620 | 3300020077 | Ga0206351_10892666 | Ga0206351_108926663 | 439 |
| 621 | 3300025911 | Ga0207654_10059581 | Ga0207654_100595813 | 439 |
| 622 | 3300025913 | Ga0207695_10001477 | Ga0207695_1000147733 | 439 |
| 623 | 3300025913 | Ga0207695_10025708 | Ga0207695_100257084 | 439 |
| 624 | 3300025914 | Ga0207671_10000445 | Ga0207671_1000044533 | 439 |
| 625 | 3300025916 | Ga0207663_10122342 | Ga0207663_101223421 | 439 |
| 626 | 3300025924 | Ga0207694_10012986 | Ga0207694_100129864 | 439 |
| 627 | 3300025927 | Ga0207687_10040450 | Ga0207687_100404503 | 439 |
| 628 | 3300025928 | Ga0207700_10052281 | Ga0207700_100522812 | 439 |
| 629 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001317 | 439 |
| 630 | 3300025929 | Ga0207664_10001639 | Ga0207664_100016399 | 439 |
| 631 | 3300025940 | Ga0207691_10069059 | Ga0207691_100690592 | 439 |
| 632 | 3300025941 | Ga0207711_10000881 | Ga0207711_100008819 | 439 |
| 633 | 3300025949 | Ga0207667_10016601 | Ga0207667_100166012 | 439 |
| 634 | 3300025949 | Ga0207667_10081943 | Ga0207667_100819433 | 439 |
| 635 | 3300026041 | Ga0207639_10223339 | Ga0207639_102233391 | 439 |
| 636 | 3300026067 | Ga0207678_10127003 | Ga0207678_101270031 | 439 |
| 637 | 3300026075 | Ga0207708_10000002 | Ga0207708_10000002229 | 439 |
| 638 | 3300026078 | Ga0207702_10034660 | Ga0207702_100346602 | 439 |
| 639 | 3300026142 | Ga0207698_10001813 | Ga0207698_1000181311 | 439 |
| 640 | 3300026142 | Ga0207698_10005852 | Ga0207698_100058522 | 439 |
| 641 | 3300026142 | Ga0207698_10070822 | Ga0207698_100708221 | 439 |
| 642 | 3300028794 | Ga0307515_10227977 | Ga0307515_102279771 | 439 |
| 643 | 3300031665 | Ga0316575_10005460 | Ga0316575_100054602 | 439 |
| 644 | 3300031727 | Ga0316576_10000264 | Ga0316576_100002645 | 439 |
| 645 | 3300032002 | Ga0307416_100087560 | Ga0307416_1000875602 | 439 |
| 646 | 3300032002 | Ga0307416_100301960 | Ga0307416_1003019601 | 439 |
| 647 | 3300035118 | Ga0373954_0031152 | Ga0373954_0031152_514_1881 | 439 |
| 648 | 3300035724 | Ga0373933_0007701 | Ga0373933_0007701_1925_3292 | 439 |
| 649 | 3300036647 | Ga0316582_0030200 | Ga0316582_0030200_1001_2362 | 439 |
| 650 | 3300036712 | Ga0316584_0005941 | Ga0316584_0005941_4660_6021 | 439 |
| 651 | 3300037853 | Ga0436364_0151261 | Ga0436364_0151261_3987_5339 | 439 |
| 652 | 3300044658 | Ga0466972_0000561 | Ga0466972_0000561_11205_12539 | 439 |
| 653 | 3300044658 | Ga0466972_0024084 | Ga0466972_0024084_1123_2454 | 439 |
| 654 | 3300044683 | Ga0466965_0016329 | Ga0466965_0016329_1621_2952 | 439 |
| 655 | 3300044684 | Ga0466966_0013174 | Ga0466966_0013174_435_1766 | 439 |
| 656 | 3300044684 | Ga0466966_0047307 | Ga0466966_0047307_676_2007 | 439 |
| 657 | 3300044693 | Ga0466961_0001757 | Ga0466961_0001757_6797_8128 | 439 |
| 658 | 3300044693 | Ga0466961_0005395 | Ga0466961_0005395_2001_3332 | 439 |
| 659 | 3300044693 | Ga0466961_0118351 | Ga0466961_0118351_16_1347 | 439 |
| 660 | 3300044694 | Ga0466963_0001901 | Ga0466963_0001901_9089_10423 | 439 |
| 661 | 3300044694 | Ga0466963_0003409 | Ga0466963_0003409_4287_5621 | 439 |
| 662 | 3300044694 | Ga0466963_0005394 | Ga0466963_0005394_1634_2968 | 439 |
| 663 | 3300044694 | Ga0466963_0016029 | Ga0466963_0016029_1847_3178 | 439 |
| 664 | 3300044694 | Ga0466963_0056721 | Ga0466963_0056721_761_2092 | 439 |
| 665 | 3300044694 | Ga0466963_0098471 | Ga0466963_0098471_116_1447 | 439 |
| 666 | 3300044719 | Ga0466971_0040714 | Ga0466971_0040714_614_1957 | 439 |
| 667 | 3300044842 | Ga0466957_0020263 | Ga0466957_0020263_1317_2648 | 439 |
| 668 | 3300044901 | Ga0466960_0009176 | Ga0466960_0009176_329_1684 | 439 |
| 669 | 3300044901 | Ga0466960_0021518 | Ga0466960_0021518_693_2024 | 439 |
| 670 | 3300044901 | Ga0466960_0069360 | Ga0466960_0069360_381_1700 | 439 |
| 671 | 3300044901 | Ga0466960_0082756 | Ga0466960_0082756_153_1484 | 439 |
| 672 | 3300045049 | Ga0466959_0038424 | Ga0466959_0038424_2076_3407 | 439 |
| 673 | 3300045836 | Ga0466958_0002571 | Ga0466958_0002571_3370_4701 | 439 |
| 674 | 3300045836 | Ga0466958_0029484 | Ga0466958_0029484_69_1400 | 439 |
| 675 | 3300045836 | Ga0466958_0039593 | Ga0466958_0039593_504_1838 | 439 |
| 676 | 3300045836 | Ga0466958_0112114 | Ga0466958_0112114_191_1525 | 439 |
| 677 | 3300045836 | Ga0466958_0122299 | Ga0466958_0122299_44_1378 | 439 |
| 678 | 3300045976 | Ga0466967_0002082 | Ga0466967_0002082_7928_9259 | 439 |
| 679 | 3300045976 | Ga0466967_0005091 | Ga0466967_0005091_1020_2354 | 439 |
| 680 | 3300045976 | Ga0466967_0082103 | Ga0466967_0082103_426_1757 | 439 |
| 681 | 3300045976 | Ga0466967_0108688 | Ga0466967_0108688_673_2013 | 439 |
| 682 | 3300045976 | Ga0466967_0132620 | Ga0466967_0132620_390_1730 | 439 |
| 683 | 3300045976 | Ga0466967_0136992 | Ga0466967_0136992_476_1807 | 439 |
| 684 | 3300046454 | Ga0495592_0002850 | Ga0495592_0002850_4424_5755 | 439 |
| 685 | 3300046459 | Ga0495629_0005572 | Ga0495629_0005572_1546_2877 | 439 |
| 686 | 3300046462 | Ga0495651_0011383 | Ga0495651_0011383_53_1384 | 439 |
| 687 | 3300046462 | Ga0495651_0142234 | Ga0495651_0142234_317_1648 | 439 |
| 688 | 3300046463 | Ga0495653_0018739 | Ga0495653_0018739_414_1781 | 439 |
| 689 | 3300046477 | Ga0495664_0037228 | Ga0495664_0037228_965_2296 | 439 |
| 690 | 3300046511 | Ga0495608_0017964 | Ga0495608_0017964_3074_4441 | 439 |
| 691 | 3300046514 | Ga0495618_0130751 | Ga0495618_0130751_34_1365 | 439 |
| 692 | 3300046516 | Ga0495628_0011141 | Ga0495628_0011141_6241_7572 | 439 |
| 693 | 3300046516 | Ga0495628_0030202 | Ga0495628_0030202_2144_3475 | 439 |
| 694 | 3300046529 | Ga0495652_0050293 | Ga0495652_0050293_2149_3480 | 439 |
| 695 | 3300046529 | Ga0495652_0074837 | Ga0495652_0074837_1085_2416 | 439 |
| 696 | 3300046533 | Ga0495640_0079305 | Ga0495640_0079305_741_2108 | 439 |
| 697 | 3300046543 | Ga0495645_0034852 | Ga0495645_0034852_2209_3540 | 439 |
| 698 | 3300046559 | Ga0495667_0018638 | Ga0495667_0018638_2449_3816 | 439 |
| 699 | 3300046559 | Ga0495667_0062859 | Ga0495667_0062859_499_1830 | 439 |
| 700 | 3300046642 | Ga0495634_0003876 | Ga0495634_0003876_4247_5578 | 439 |
| 701 | 3300046675 | Ga0495657_0016894 | Ga0495657_0016894_294_1661 | 439 |
| 702 | 3300046679 | Ga0495623_0070403 | Ga0495623_0070403_462_1793 | 439 |
| 703 | 3300046689 | Ga0495613_0003455 | Ga0495613_0003455_4434_5765 | 439 |
| 704 | 3300046690 | Ga0495624_0097768 | Ga0495624_0097768_351_1682 | 439 |
| 705 | 3300046809 | Ga0495600_0024182 | Ga0495600_0024182_1485_2816 | 439 |
| 706 | 3300047315 | Ga0495581_0028214 | Ga0495581_0028214_948_2279 | 439 |
| 707 | 3300047317 | Ga0495604_0031876 | Ga0495604_0031876_1807_3138 | 439 |
| 708 | 3300047321 | Ga0495676_0003177 | Ga0495676_0003177_8718_10049 | 439 |
| 709 | 3300047471 | Ga0495684_0014031 | Ga0495684_0014031_4464_5831 | 439 |
| 710 | 3300048088 | Ga0495602_0061044 | Ga0495602_0061044_1467_2834 | 439 |
| 711 | 3300048904 | Ga0496101_0028268 | Ga0496101_0028268_1238_2569 | 439 |
| 712 | 3300048905 | Ga0496102_0000013 | Ga0496102_0000013_73802_75133 | 439 |
| 713 | 3300048906 | Ga0496103_0000039 | Ga0496103_0000039_20234_21565 | 439 |
| 714 | 3300048917 | Ga0496114_0187082 | Ga0496114_0187082_328_1659 | 439 |
| 715 | 3300048920 | Ga0496117_0011653 | Ga0496117_0011653_3896_5221 | 439 |
| 716 | 3300048921 | Ga0496118_0036390 | Ga0496118_0036390_2361_3692 | 439 |
| 717 | 3300048921 | Ga0496118_0039440 | Ga0496118_0039440_692_2017 | 439 |
| 718 | 3300048922 | Ga0496119_0000022 | Ga0496119_0000022_196674_198008 | 439 |
| 719 | 3300048922 | Ga0496119_0008239 | Ga0496119_0008239_4243_5568 | 439 |
| 720 | 3300048922 | Ga0496119_0009570 | Ga0496119_0009570_5614_6945 | 439 |
| 721 | 3300048923 | Ga0496120_0000856 | Ga0496120_0000856_30519_31844 | 439 |
| 722 | 3300048923 | Ga0496120_0002970 | Ga0496120_0002970_1862_3196 | 439 |
| 723 | 3300048924 | Ga0496121_0081195 | Ga0496121_0081195_739_2070 | 439 |
| 724 | 3300049569 | Ga0501032_0046696 | Ga0501032_0046696_1207_2541 | 439 |
| 725 | 3300049574 | Ga0501038_0000874 | Ga0501038_0000874_11710_13044 | 439 |
| 726 | 3300049581 | Ga0501047_0001249 | Ga0501047_0001249_10463_11797 | 439 |
| 727 | 3300049582 | Ga0501048_0000373 | Ga0501048_0000373_8813_10147 | 439 |
| 728 | 3300049586 | Ga0501070_0166188 | Ga0501070_0166188_350_1684 | 439 |
| 729 | 3300049589 | Ga0501073_0000222 | Ga0501073_0000222_24661_25986 | 439 |
| 730 | 3300049742 | Ga0501080_0035655 | Ga0501080_0035655_3230_4555 | 439 |
| 731 | 3300050491 | nmdc:mga00v17_2173_c1 | nmdc:mga00v17_2173_c1_1840_3165 | 439 |
| 732 | 3300050491 | nmdc:mga00v17_65464_c1 | nmdc:mga00v17_65464_c1_65_1390 | 439 |
| 733 | 3300050516 | nmdc:mga0sz30_39630_c1 | nmdc:mga0sz30_39630_c1_339_1664 | 439 |
| 734 | 3300050516 | nmdc:mga0sz30_57802_c1 | nmdc:mga0sz30_57802_c1_263_1588 | 439 |
| 735 | 3300053085 | Ga0495619_0008758 | Ga0495619_0008758_3174_4505 | 439 |
| 736 | 3300053104 | Ga0500556_0000421 | Ga0500556_0000421_17210_18535 | 439 |
| 737 | 3300053108 | Ga0500562_002205 | Ga0500562_002205_3406_4731 | 439 |
| 738 | 3300053117 | Ga0500593_011246 | Ga0500593_011246_2282_3607 | 439 |
| 739 | 3300053136 | Ga0500559_0000561 | Ga0500559_0000561_3148_4473 | 439 |
| 740 | 3300053139 | Ga0500568_0000098 | Ga0500568_0000098_51897_53225 | 439 |
| 741 | 3300053142 | Ga0500577_0025316 | Ga0500577_0025316_294_1628 | 439 |
| 742 | 3300053153 | Ga0500616_0001673 | Ga0500616_0001673_1756_3207 | 439 |
| 743 | 3300061719 | Ga0466962_0010186 | Ga0466962_0010186_2379_3710 | 439 |
| 744 | 3300061719 | Ga0466962_0064430 | Ga0466962_0064430_135_1475 | 439 |
| 745 | iso_pu_bacteria | 2643221576 | 2643889583 | 439 |
| 746 | iso_pu_bacteria | 2643221590 | 2643958639 | 439 |
| 747 | iso_pu_bacteria | 2643221679 | 2644446523 | 439 |
| 748 | iso_pu_bacteria | 2808606365 | 2808872930 | 439 |
| 749 | 3300005328 | Ga0070676_10007535 | Ga0070676_100075354 | 440 |
| 750 | 3300005331 | Ga0070670_100038542 | Ga0070670_1000385423 | 440 |
| 751 | 3300005334 | Ga0068869_100004828 | Ga0068869_1000048286 | 440 |
| 752 | 3300005338 | Ga0068868_100004550 | Ga0068868_1000045502 | 440 |
| 753 | 3300005339 | Ga0070660_100133600 | Ga0070660_1001336002 | 440 |
| 754 | 3300005354 | Ga0070675_100003751 | Ga0070675_1000037514 | 440 |
| 755 | 3300005455 | Ga0070663_100068386 | Ga0070663_1000683862 | 440 |
| 756 | 3300005457 | Ga0070662_100014295 | Ga0070662_1000142953 | 440 |
| 757 | 3300005530 | Ga0070679_100205955 | Ga0070679_1002059552 | 440 |
| 758 | 3300005535 | Ga0070684_100024465 | Ga0070684_1000244653 | 440 |
| 759 | 3300005547 | Ga0070693_100124834 | Ga0070693_1001248341 | 440 |
| 760 | 3300005564 | Ga0070664_100001657 | Ga0070664_1000016574 | 440 |
| 761 | 3300005564 | Ga0070664_100013266 | Ga0070664_1000132662 | 440 |
| 762 | 3300005577 | Ga0068857_100006889 | Ga0068857_1000068894 | 440 |
| 763 | 3300005615 | Ga0070702_100039852 | Ga0070702_1000398522 | 440 |
| 764 | 3300005844 | Ga0068862_100013889 | Ga0068862_1000138895 | 440 |
| 765 | 3300009094 | Ga0111539_10016741 | Ga0111539_100167412 | 440 |
| 766 | 3300009098 | Ga0105245_10255111 | Ga0105245_102551112 | 440 |
| 767 | 3300021358 | Ga0213873_10000163 | Ga0213873_100001633 | 440 |
| 768 | 3300021388 | Ga0213875_10003242 | Ga0213875_100032424 | 440 |
| 769 | 3300025910 | Ga0207684_10059824 | Ga0207684_100598242 | 440 |
| 770 | 3300025919 | Ga0207657_10083944 | Ga0207657_100839443 | 440 |
| 771 | 3300025925 | Ga0207650_10046281 | Ga0207650_100462812 | 440 |
| 772 | 3300025926 | Ga0207659_10002929 | Ga0207659_100029299 | 440 |
| 773 | 3300025933 | Ga0207706_10019341 | Ga0207706_100193413 | 440 |
| 774 | 3300025942 | Ga0207689_10002842 | Ga0207689_1000284215 | 440 |
| 775 | 3300025945 | Ga0207679_10004464 | Ga0207679_100044644 | 440 |
| 776 | 3300026023 | Ga0207677_10010033 | Ga0207677_100100332 | 440 |
| 777 | 3300026067 | Ga0207678_10077611 | Ga0207678_100776112 | 440 |
| 778 | 3300026075 | Ga0207708_10028771 | Ga0207708_100287713 | 440 |
| 779 | 3300026116 | Ga0207674_10015449 | Ga0207674_100154494 | 440 |
| 780 | 3300026121 | Ga0207683_10122255 | Ga0207683_101222552 | 440 |
| 781 | 3300027907 | Ga0207428_10181296 | Ga0207428_101812962 | 440 |
| 782 | 3300028380 | Ga0268265_10010662 | Ga0268265_100106624 | 440 |
| 783 | 3300031901 | Ga0307406_10065433 | Ga0307406_100654332 | 440 |
| 784 | 3300031995 | Ga0307409_100046231 | Ga0307409_1000462312 | 440 |
| 785 | 3300032126 | Ga0307415_100095214 | Ga0307415_1000952142 | 440 |
| 786 | 3300037853 | Ga0436364_1391037 | Ga0436364_1391037_71_1447 | 440 |
| 787 | 3300037853 | Ga0436364_1522620 | Ga0436364_1522620_2287_3636 | 440 |
| 788 | 3300039437 | Ga0436365_1505452 | Ga0436365_1505452_603_1952 | 440 |
| 789 | 3300048914 | Ga0496111_0013543 | Ga0496111_0013543_2660_3994 | 440 |
| 790 | 3300050511 | nmdc:mga08y16_296204_c1 | nmdc:mga08y16_296204_c1_186_1520 | 440 |
| 791 | 3300053153 | Ga0500616_0005443 | Ga0500616_0005443_64_1395 | 440 |
| 792 | iso_pu_bacteria | 2643221690 | 2644506582 | 440 |
| 793 | iso_pu_bacteria | 2643221694 | 2644526504 | 440 |
| 794 | iso_pu_bacteria | 2643221722 | 2644671170 | 440 |
| 795 | iso_pu_bacteria | 2857481737 | 2857482011 | 440 |
| 796 | 3300005327 | Ga0070658_10008436 | Ga0070658_100084368 | 441 |
| 797 | 3300005367 | Ga0070667_100009171 | Ga0070667_1000091712 | 441 |
| 798 | 3300013105 | Ga0157369_10000631 | Ga0157369_1000063116 | 441 |
| 799 | 3300013105 | Ga0157369_10092850 | Ga0157369_100928504 | 441 |
| 800 | 3300025909 | Ga0207705_10091463 | Ga0207705_100914632 | 441 |
| 801 | 3300031251 | Ga0265327_10000303 | Ga0265327_1000030341 | 441 |
| 802 | 3300045976 | Ga0466967_0155512 | Ga0466967_0155512_471_1907 | 441 |
| 803 | 3300048929 | Ga0496126_0065298 | Ga0496126_0065298_1734_3068 | 441 |
| 804 | 3300048929 | Ga0496126_0098756 | Ga0496126_0098756_618_1952 | 441 |
| 805 | 3300049569 | Ga0501032_0104282 | Ga0501032_0104282_249_1586 | 441 |
| 806 | 3300049580 | Ga0501046_0035397 | Ga0501046_0035397_2606_3952 | 441 |
| 807 | 3300061719 | Ga0466962_0030612 | Ga0466962_0030612_340_1710 | 441 |
| 808 | iso_pu_bacteria | 8053945823 | 8053950053 | 441 |
| 809 | 3300005328 | Ga0070676_10009094 | Ga0070676_100090943 | 442 |
| 810 | 3300005336 | Ga0070680_100013556 | Ga0070680_1000135564 | 442 |
| 811 | 3300005337 | Ga0070682_100002099 | Ga0070682_1000020992 | 442 |
| 812 | 3300005339 | Ga0070660_100101912 | Ga0070660_1001019122 | 442 |
| 813 | 3300005345 | Ga0070692_10007890 | Ga0070692_100078903 | 442 |
| 814 | 3300005354 | Ga0070675_100030129 | Ga0070675_1000301292 | 442 |
| 815 | 3300005355 | Ga0070671_100056340 | Ga0070671_1000563402 | 442 |
| 816 | 3300005364 | Ga0070673_100056609 | Ga0070673_1000566092 | 442 |
| 817 | 3300005366 | Ga0070659_100144114 | Ga0070659_1001441142 | 442 |
| 818 | 3300005436 | Ga0070713_100026414 | Ga0070713_1000264143 | 442 |
| 819 | 3300005456 | Ga0070678_100035992 | Ga0070678_1000359922 | 442 |
| 820 | 3300005530 | Ga0070679_100046281 | Ga0070679_1000462812 | 442 |
| 821 | 3300005547 | Ga0070693_100004316 | Ga0070693_1000043165 | 442 |
| 822 | 3300005563 | Ga0068855_100295895 | Ga0068855_1002958952 | 442 |
| 823 | 3300005578 | Ga0068854_100051958 | Ga0068854_1000519582 | 442 |
| 824 | 3300005614 | Ga0068856_100013115 | Ga0068856_1000131153 | 442 |
| 825 | 3300005617 | Ga0068859_100020598 | Ga0068859_1000205984 | 442 |
| 826 | 3300005834 | Ga0068851_10062942 | Ga0068851_100629422 | 442 |
| 827 | 3300005840 | Ga0068870_10000471 | Ga0068870_100004712 | 442 |
| 828 | 3300005841 | Ga0068863_100004781 | Ga0068863_1000047817 | 442 |
| 829 | 3300005842 | Ga0068858_100080479 | Ga0068858_1000804792 | 442 |
| 830 | 3300006028 | Ga0070717_10130606 | Ga0070717_101306062 | 442 |
| 831 | 3300006048 | Ga0075363_100010515 | Ga0075363_1000105153 | 442 |
| 832 | 3300006237 | Ga0097621_100052359 | Ga0097621_1000523592 | 442 |
| 833 | 3300006852 | Ga0075433_10003602 | Ga0075433_100036022 | 442 |
| 834 | 3300006871 | Ga0075434_100001339 | Ga0075434_10000133911 | 442 |
| 835 | 3300006931 | Ga0097620_100020599 | Ga0097620_1000205994 | 442 |
| 836 | 3300007076 | Ga0075435_100048134 | Ga0075435_1000481343 | 442 |
| 837 | 3300009148 | Ga0105243_10063408 | Ga0105243_100634082 | 442 |
| 838 | 3300009551 | Ga0105238_10132824 | Ga0105238_101328242 | 442 |
| 839 | 3300013100 | Ga0157373_10032874 | Ga0157373_100328742 | 442 |
| 840 | 3300013104 | Ga0157370_10030047 | Ga0157370_100300473 | 442 |
| 841 | 3300013307 | Ga0157372_10104477 | Ga0157372_101044772 | 442 |
| 842 | 3300013308 | Ga0157375_10063593 | Ga0157375_100635932 | 442 |
| 843 | 3300014497 | Ga0182008_10027165 | Ga0182008_100271653 | 442 |
| 844 | 3300014745 | Ga0157377_10003806 | Ga0157377_100038064 | 442 |
| 845 | 3300025900 | Ga0207710_10014744 | Ga0207710_100147442 | 442 |
| 846 | 3300025901 | Ga0207688_10002486 | Ga0207688_100024862 | 442 |
| 847 | 3300025903 | Ga0207680_10110254 | Ga0207680_101102542 | 442 |
| 848 | 3300025908 | Ga0207643_10001695 | Ga0207643_1000169510 | 442 |
| 849 | 3300025912 | Ga0207707_10129896 | Ga0207707_101298962 | 442 |
| 850 | 3300025917 | Ga0207660_10053263 | Ga0207660_100532632 | 442 |
| 851 | 3300025919 | Ga0207657_10008017 | Ga0207657_100080176 | 442 |
| 852 | 3300025921 | Ga0207652_10078970 | Ga0207652_100789702 | 442 |
| 853 | 3300025926 | Ga0207659_10036838 | Ga0207659_100368382 | 442 |
| 854 | 3300025929 | Ga0207664_10000648 | Ga0207664_1000064810 | 442 |
| 855 | 3300025929 | Ga0207664_10066907 | Ga0207664_100669071 | 442 |
| 856 | 3300025942 | Ga0207689_10000812 | Ga0207689_100008125 | 442 |
| 857 | 3300025945 | Ga0207679_10009676 | Ga0207679_100096764 | 442 |
| 858 | 3300026023 | Ga0207677_10043878 | Ga0207677_100438782 | 442 |
| 859 | 3300026067 | Ga0207678_10005054 | Ga0207678_100050543 | 442 |
| 860 | 3300026078 | Ga0207702_10001341 | Ga0207702_100013418 | 442 |
| 861 | 3300026078 | Ga0207702_10006747 | Ga0207702_100067472 | 442 |
| 862 | 3300026095 | Ga0207676_10001905 | Ga0207676_100019052 | 442 |
| 863 | 3300026121 | Ga0207683_10000772 | Ga0207683_1000077212 | 442 |
| 864 | 3300027866 | Ga0209813_10002341 | Ga0209813_100023413 | 442 |
| 865 | 3300027907 | Ga0207428_10061848 | Ga0207428_100618482 | 442 |
| 866 | 3300031824 | Ga0307413_10073600 | Ga0307413_100736001 | 442 |
| 867 | 3300044765 | Ga0466970_0057098 | Ga0466970_0057098_239_1612 | 442 |
| 868 | 3300045049 | Ga0466959_0097432 | Ga0466959_0097432_547_1920 | 442 |
| 869 | 3300045976 | Ga0466967_0071041 | Ga0466967_0071041_1043_2416 | 442 |
| 870 | 3300048905 | Ga0496102_0086146 | Ga0496102_0086146_595_1938 | 442 |
| 871 | 3300048905 | Ga0496102_0093133 | Ga0496102_0093133_69_1439 | 442 |
| 872 | 3300048906 | Ga0496103_0133693 | Ga0496103_0133693_192_1562 | 442 |
| 873 | 3300048908 | Ga0496105_0015802 | Ga0496105_0015802_3944_5314 | 442 |
| 874 | 3300048908 | Ga0496105_0075183 | Ga0496105_0075183_1394_2737 | 442 |
| 875 | 3300048909 | Ga0496106_0009107 | Ga0496106_0009107_1442_2812 | 442 |
| 876 | 3300048911 | Ga0496108_0039627 | Ga0496108_0039627_1000_2343 | 442 |
| 877 | 3300048912 | Ga0496109_0004908 | Ga0496109_0004908_2103_3446 | 442 |
| 878 | 3300048912 | Ga0496109_0070694 | Ga0496109_0070694_1130_2500 | 442 |
| 879 | 3300048913 | Ga0496110_0029903 | Ga0496110_0029903_3338_4681 | 442 |
| 880 | 3300048914 | Ga0496111_0002416 | Ga0496111_0002416_5974_7317 | 442 |
| 881 | 3300048915 | Ga0496112_0014487 | Ga0496112_0014487_3555_4898 | 442 |
| 882 | 3300048917 | Ga0496114_0048817 | Ga0496114_0048817_1168_2511 | 442 |
| 883 | 3300048918 | Ga0496115_0037599 | Ga0496115_0037599_1924_3294 | 442 |
| 884 | 3300050494 | nmdc:mga06z11_2278_c1 | nmdc:mga06z11_2278_c1_410_1762 | 442 |
| 885 | 3300050511 | nmdc:mga08y16_16524_c1 | nmdc:mga08y16_16524_c1_1927_3297 | 442 |
| 886 | 3300050512 | nmdc:mga0n895_5628_c1 | nmdc:mga0n895_5628_c1_4969_6339 | 442 |
| 887 | 3300050513 | nmdc:mga0rr50_5853_c1 | nmdc:mga0rr50_5853_c1_1522_2892 | 442 |
| 888 | 3300050514 | nmdc:mga08x19_4958_c1 | nmdc:mga08x19_4958_c1_4923_6293 | 442 |
| 889 | iso_pu_bacteria | 2579778521 | 2579852800 | 442 |
| 890 | iso_pu_bacteria | 2619618881 | 2619856613 | 442 |
| 891 | iso_pu_bacteria | 2619619003 | 2620348820 | 442 |
| 892 | iso_pu_bacteria | 2626541554 | 2626636116 | 442 |
| 893 | iso_pu_bacteria | 2626541554 | 2626640275 | 442 |
| 894 | iso_pu_bacteria | 2728369276 | 2729905574 | 442 |
| 895 | iso_pu_bacteria | 2773857758 | 2774381069 | 442 |
| 896 | iso_pu_bacteria | 2862705112 | 2862706851 | 442 |
| 897 | iso_pu_bacteria | 2867346516 | 2867350915 | 442 |
| 898 | iso_pu_bacteria | 2904509784 | 2904511047 | 442 |
| 899 | iso_pu_bacteria | 2908678064 | 2908680203 | 442 |
| 900 | iso_pu_bacteria | 2919069694 | 2919072404 | 442 |
| 901 | iso_pu_bacteria | 2974294766 | 2974296360 | 442 |
| 902 | iso_pu_bacteria | 2974324384 | 2974327405 | 442 |
| 903 | iso_pu_bacteria | 2977228692 | 2977229027 | 442 |
| 904 | iso_pu_bacteria | 2984542743 | 2984544404 | 442 |
| 905 | iso_pu_bacteria | 2990044586 | 2990045954 | 442 |
| 906 | iso_pu_bacteria | 8008485437 | 8008487276 | 442 |
| 907 | iso_pu_bacteria | 8025524527 | 8025526291 | 442 |
| 908 | 3300005327 | Ga0070658_10002566 | Ga0070658_1000256614 | 443 |
| 909 | 3300005329 | Ga0070683_100098967 | Ga0070683_1000989673 | 443 |
| 910 | 3300005367 | Ga0070667_100022147 | Ga0070667_1000221474 | 443 |
| 911 | 3300005548 | Ga0070665_100155578 | Ga0070665_1001555782 | 443 |
| 912 | 3300005563 | Ga0068855_100133514 | Ga0068855_1001335142 | 443 |
| 913 | 3300005843 | Ga0068860_100000451 | Ga0068860_10000045135 | 443 |
| 914 | 3300005937 | Ga0081455_10003611 | Ga0081455_100036117 | 443 |
| 915 | 3300005937 | Ga0081455_10104478 | Ga0081455_101044782 | 443 |
| 916 | 3300005983 | Ga0081540_1013835 | Ga0081540_10138355 | 443 |
| 917 | 3300005985 | Ga0081539_10050241 | Ga0081539_100502411 | 443 |
| 918 | 3300006038 | Ga0075365_10054164 | Ga0075365_100541643 | 443 |
| 919 | 3300006178 | Ga0075367_10001320 | Ga0075367_100013209 | 443 |
| 920 | 3300006847 | Ga0075431_100055387 | Ga0075431_1000553871 | 443 |
| 921 | 3300006880 | Ga0075429_100002730 | Ga0075429_10000273012 | 443 |
| 922 | 3300009094 | Ga0111539_10007834 | Ga0111539_100078345 | 443 |
| 923 | 3300009147 | Ga0114129_10220626 | Ga0114129_102206262 | 443 |
| 924 | 3300010375 | Ga0105239_10063730 | Ga0105239_100637303 | 443 |
| 925 | 3300013104 | Ga0157370_10138642 | Ga0157370_101386421 | 443 |
| 926 | 3300013308 | Ga0157375_10187845 | Ga0157375_101878452 | 443 |
| 927 | 3300025909 | Ga0207705_10030066 | Ga0207705_100300663 | 443 |
| 928 | 3300025944 | Ga0207661_10095635 | Ga0207661_100956351 | 443 |
| 929 | 3300025949 | Ga0207667_10109884 | Ga0207667_101098843 | 443 |
| 930 | 3300025986 | Ga0207658_10013608 | Ga0207658_100136082 | 443 |
| 931 | 3300027907 | Ga0207428_10000976 | Ga0207428_1000097627 | 443 |
| 932 | 3300028381 | Ga0268264_10003254 | Ga0268264_1000325413 | 443 |
| 933 | 3300032002 | Ga0307416_100193370 | Ga0307416_1001933702 | 443 |
| 934 | 3300037312 | Ga0395899_0003096 | Ga0395899_0003096_10967_12325 | 443 |
| 935 | 3300048907 | Ga0496104_0169183 | Ga0496104_0169183_625_1956 | 443 |
| 936 | 3300048920 | Ga0496117_0065167 | Ga0496117_0065167_544_1899 | 443 |
| 937 | 3300048922 | Ga0496119_0002150 | Ga0496119_0002150_5543_6904 | 443 |
| 938 | 3300048922 | Ga0496119_0009414 | Ga0496119_0009414_5591_6946 | 443 |
| 939 | 3300048923 | Ga0496120_0001757 | Ga0496120_0001757_14595_15950 | 443 |
| 940 | 3300048925 | Ga0496122_0000022 | Ga0496122_0000022_22223_23578 | 443 |
| 941 | 3300048926 | Ga0496123_0000016 | Ga0496123_0000016_69170_70525 | 443 |
| 942 | 3300048928 | Ga0496125_0004443 | Ga0496125_0004443_13778_15133 | 443 |
| 943 | 3300048929 | Ga0496126_0017091 | Ga0496126_0017091_4384_5739 | 443 |
| 944 | 3300049571 | Ga0501034_0131140 | Ga0501034_0131140_644_1984 | 443 |
| 945 | 3300050491 | nmdc:mga00v17_31322_c1 | nmdc:mga00v17_31322_c1_640_1971 | 443 |
| 946 | 3300050507 | nmdc:mga05p37_52804_c1 | nmdc:mga05p37_52804_c1_1208_2554 | 443 |
| 947 | 3300050508 | nmdc:mga09592_5723_c1 | nmdc:mga09592_5723_c1_2346_3692 | 443 |
| 948 | 3300050509 | nmdc:mga0qj67_10513_c1 | nmdc:mga0qj67_10513_c1_181_1527 | 443 |
| 949 | 3300050510 | nmdc:mga06r32_907_c1 | nmdc:mga06r32_907_c1_12475_13821 | 443 |
| 950 | 3300050511 | nmdc:mga08y16_3908_c1 | nmdc:mga08y16_3908_c1_10088_11434 | 443 |
| 951 | 3300060353 | Ga0501082_0009270 | Ga0501082_0009270_2156_3496 | 443 |
| 952 | iso_pu_bacteria | 2855386786 | 2855387662 | 443 |
| 953 | iso_pu_bacteria | 2857720070 | 2857722450 | 443 |
| 954 | iso_pu_bacteria | 2928090899 | 2928092673 | 443 |
| 955 | iso_pu_bacteria | 2984580707 | 2984583790 | 443 |
| 956 | iso_pu_bacteria | 8055157932 | 8055162478 | 443 |
| 957 | 3300005434 | Ga0070709_10018668 | Ga0070709_100186682 | 444 |
| 958 | 3300005437 | Ga0070710_10006810 | Ga0070710_100068102 | 444 |
| 959 | 3300005439 | Ga0070711_100025824 | Ga0070711_1000258242 | 444 |
| 960 | 3300005467 | Ga0070706_100053432 | Ga0070706_1000534323 | 444 |
| 961 | 3300005468 | Ga0070707_100031950 | Ga0070707_1000319503 | 444 |
| 962 | 3300005471 | Ga0070698_100073119 | Ga0070698_1000731194 | 444 |
| 963 | 3300005536 | Ga0070697_100092625 | Ga0070697_1000926252 | 444 |
| 964 | 3300005937 | Ga0081455_10015161 | Ga0081455_100151616 | 444 |
| 965 | 3300006163 | Ga0070715_10003914 | Ga0070715_100039145 | 444 |
| 966 | 3300006847 | Ga0075431_100000676 | Ga0075431_1000006767 | 444 |
| 967 | 3300006871 | Ga0075434_100065272 | Ga0075434_1000652723 | 444 |
| 968 | 3300009147 | Ga0114129_10011584 | Ga0114129_100115847 | 444 |
| 969 | 3300009148 | Ga0105243_10006996 | Ga0105243_100069967 | 444 |
| 970 | 3300013104 | Ga0157370_10224709 | Ga0157370_102247092 | 444 |
| 971 | 3300021388 | Ga0213875_10000817 | Ga0213875_1000081714 | 444 |
| 972 | 3300025728 | Ga0207655_1004585 | Ga0207655_10045855 | 444 |
| 973 | 3300025901 | Ga0207688_10036234 | Ga0207688_100362342 | 444 |
| 974 | 3300025906 | Ga0207699_10016294 | Ga0207699_100162942 | 444 |
| 975 | 3300025912 | Ga0207707_10236968 | Ga0207707_102369681 | 444 |
| 976 | 3300025921 | Ga0207652_10062722 | Ga0207652_100627222 | 444 |
| 977 | 3300025928 | Ga0207700_10010489 | Ga0207700_100104894 | 444 |
| 978 | 3300025928 | Ga0207700_10078908 | Ga0207700_100789082 | 444 |
| 979 | 3300025928 | Ga0207700_10079066 | Ga0207700_100790663 | 444 |
| 980 | 3300025929 | Ga0207664_10095245 | Ga0207664_100952452 | 444 |
| 981 | 3300025935 | Ga0207709_10003866 | Ga0207709_100038662 | 444 |
| 982 | 3300025939 | Ga0207665_10005087 | Ga0207665_100050877 | 444 |
| 983 | 3300025939 | Ga0207665_10061089 | Ga0207665_100610892 | 444 |
| 984 | 3300028800 | Ga0265338_10054763 | Ga0265338_100547633 | 444 |
| 985 | 3300031712 | Ga0265342_10070307 | Ga0265342_100703072 | 444 |
| 986 | 3300031727 | Ga0316576_10021294 | Ga0316576_100212942 | 444 |
| 987 | 3300031824 | Ga0307413_10020698 | Ga0307413_100206983 | 444 |
| 988 | 3300031995 | Ga0307409_100015666 | Ga0307409_1000156663 | 444 |
| 989 | 3300032002 | Ga0307416_100114950 | Ga0307416_1001149502 | 444 |
| 990 | 3300032126 | Ga0307415_100122703 | Ga0307415_1001227032 | 444 |
| 991 | 3300035111 | Ga0373923_0015564 | Ga0373923_0015564_90_1535 | 444 |
| 992 | 3300035113 | Ga0373936_0030205 | Ga0373936_0030205_698_2050 | 444 |
| 993 | 3300035118 | Ga0373954_0011949 | Ga0373954_0011949_897_2342 | 444 |
| 994 | 3300035398 | Ga0316574_0010285 | Ga0316574_0010285_1493_2854 | 444 |
| 995 | 3300035410 | Ga0373924_0008148 | Ga0373924_0008148_1545_2990 | 444 |
| 996 | 3300035724 | Ga0373933_0036606 | Ga0373933_0036606_900_2345 | 444 |
| 997 | 3300036401 | Ga0373937_0107679 | Ga0373937_0107679_1101_2546 | 444 |
| 998 | 3300037068 | Ga0373925_0000400 | Ga0373925_0000400_2406_3758 | 444 |
| 999 | 3300037068 | Ga0373925_0036510 | Ga0373925_0036510_412_1857 | 444 |
| 1000 | 3300037418 | Ga0395900_0121921 | Ga0395900_0121921_1242_2591 | 444 |
| 1001 | 3300037853 | Ga0436364_0207639 | Ga0436364_0207639_17253_18725 | 444 |
| 1002 | 3300038443 | Ga0395901_0128065 | Ga0395901_0128065_931_2280 | 444 |
| 1003 | 3300044842 | Ga0466957_0046861 | Ga0466957_0046861_103_1488 | 444 |
| 1004 | 3300045976 | Ga0466967_0036222 | Ga0466967_0036222_126_1526 | 444 |
| 1005 | 3300046454 | Ga0495592_0025383 | Ga0495592_0025383_219_1664 | 444 |
| 1006 | 3300046462 | Ga0495651_0037714 | Ga0495651_0037714_2114_3559 | 444 |
| 1007 | 3300046533 | Ga0495640_0032645 | Ga0495640_0032645_623_2068 | 444 |
| 1008 | 3300046535 | Ga0495586_0039928 | Ga0495586_0039928_352_1797 | 444 |
| 1009 | 3300046536 | Ga0495587_0012821 | Ga0495587_0012821_541_1986 | 444 |
| 1010 | 3300046559 | Ga0495667_0036999 | Ga0495667_0036999_178_1623 | 444 |
| 1011 | 3300046642 | Ga0495634_0017558 | Ga0495634_0017558_3263_4708 | 444 |
| 1012 | 3300046663 | Ga0495635_0046808 | Ga0495635_0046808_770_2215 | 444 |
| 1013 | 3300046680 | Ga0495646_0039786 | Ga0495646_0039786_1392_2837 | 444 |
| 1014 | 3300047319 | Ga0495674_0091225 | Ga0495674_0091225_398_1843 | 444 |
| 1015 | 3300047471 | Ga0495684_0053559 | Ga0495684_0053559_1160_2605 | 444 |
| 1016 | 3300048088 | Ga0495602_0035718 | Ga0495602_0035718_318_1763 | 444 |
| 1017 | 3300048929 | Ga0496126_0029368 | Ga0496126_0029368_676_2028 | 444 |
| 1018 | 3300049534 | Ga0501318_003400 | Ga0501318_003400_30_1385 | 444 |
| 1019 | 3300049581 | Ga0501047_0068887 | Ga0501047_0068887_1992_3344 | 444 |
| 1020 | 3300049822 | Ga0501035_0009678 | Ga0501035_0009678_6036_7388 | 444 |
| 1021 | 3300049823 | Ga0501044_0015179 | Ga0501044_0015179_5956_7308 | 444 |
| 1022 | 3300050510 | nmdc:mga06r32_7811_c1 | nmdc:mga06r32_7811_c1_792_2141 | 444 |
| 1023 | 3300050512 | nmdc:mga0n895_3126_c1 | nmdc:mga0n895_3126_c1_1046_2398 | 444 |
| 1024 | 3300053077 | Ga0495601_0081449 | Ga0495601_0081449_280_1752 | 444 |
| 1025 | iso_pu_bacteria | 2643221546 | 2643753920 | 444 |
| 1026 | 3300005434 | Ga0070709_10002330 | Ga0070709_100023304 | 445 |
| 1027 | 3300005436 | Ga0070713_100003155 | Ga0070713_1000031557 | 445 |
| 1028 | 3300005437 | Ga0070710_10002152 | Ga0070710_100021525 | 445 |
| 1029 | 3300005467 | Ga0070706_100004718 | Ga0070706_1000047185 | 445 |
| 1030 | 3300005467 | Ga0070706_100033151 | Ga0070706_1000331512 | 445 |
| 1031 | 3300005468 | Ga0070707_100001600 | Ga0070707_1000016008 | 445 |
| 1032 | 3300006914 | Ga0075436_100031803 | Ga0075436_1000318032 | 445 |
| 1033 | 3300025910 | Ga0207684_10034871 | Ga0207684_100348712 | 445 |
| 1034 | 3300025921 | Ga0207652_10159508 | Ga0207652_101595081 | 445 |
| 1035 | 3300025922 | Ga0207646_10012030 | Ga0207646_100120306 | 445 |
| 1036 | 3300025929 | Ga0207664_10069855 | Ga0207664_100698552 | 445 |
| 1037 | 3300026035 | Ga0207703_10154816 | Ga0207703_101548162 | 445 |
| 1038 | 3300031247 | Ga0265340_10017262 | Ga0265340_100172624 | 445 |
| 1039 | 3300031727 | Ga0316576_10015164 | Ga0316576_100151642 | 445 |
| 1040 | 3300032004 | Ga0307414_10132602 | Ga0307414_101326022 | 445 |
| 1041 | 3300035083 | Ga0373926_0001667 | Ga0373926_0001667_4545_5900 | 445 |
| 1042 | 3300035692 | Ga0373935_0000541 | Ga0373935_0000541_16960_18315 | 445 |
| 1043 | 3300035725 | Ga0373947_0000003 | Ga0373947_0000003_31515_32870 | 445 |
| 1044 | 3300044765 | Ga0466970_0011058 | Ga0466970_0011058_2140_3477 | 445 |
| 1045 | 3300044901 | Ga0466960_0040212 | Ga0466960_0040212_251_1588 | 445 |
| 1046 | 3300048914 | Ga0496111_0054085 | Ga0496111_0054085_1464_2819 | 445 |
| 1047 | 3300049578 | Ga0501042_0021978 | Ga0501042_0021978_1871_3226 | 445 |
| 1048 | 3300049586 | Ga0501070_0030864 | Ga0501070_0030864_1534_2946 | 445 |
| 1049 | 3300050514 | nmdc:mga08x19_60972_c1 | nmdc:mga08x19_60972_c1_19_1374 | 445 |
| 1050 | 3300053153 | Ga0500616_0000740 | Ga0500616_0000740_16125_17507 | 445 |
| 1051 | iso_pu_bacteria | 3002998708 | 3002998973 | 445 |
| 1052 | 3300003203 | JGI25406J46586_10011869 | JGI25406J46586_100118692 | 446 |
| 1053 | 3300003659 | JGI25404J52841_10004701 | JGI25404J52841_100047012 | 446 |
| 1054 | 3300005327 | Ga0070658_10056797 | Ga0070658_100567972 | 446 |
| 1055 | 3300005329 | Ga0070683_100040518 | Ga0070683_1000405182 | 446 |
| 1056 | 3300005330 | Ga0070690_100019006 | Ga0070690_1000190062 | 446 |
| 1057 | 3300005334 | Ga0068869_100031873 | Ga0068869_1000318735 | 446 |
| 1058 | 3300005335 | Ga0070666_10069723 | Ga0070666_100697232 | 446 |
| 1059 | 3300005338 | Ga0068868_100198584 | Ga0068868_1001985841 | 446 |
| 1060 | 3300005339 | Ga0070660_100079459 | Ga0070660_1000794592 | 446 |
| 1061 | 3300005341 | Ga0070691_10019439 | Ga0070691_100194392 | 446 |
| 1062 | 3300005344 | Ga0070661_100034296 | Ga0070661_1000342961 | 446 |
| 1063 | 3300005345 | Ga0070692_10051972 | Ga0070692_100519722 | 446 |
| 1064 | 3300005364 | Ga0070673_100117278 | Ga0070673_1001172781 | 446 |
| 1065 | 3300005366 | Ga0070659_100041213 | Ga0070659_1000412132 | 446 |
| 1066 | 3300005367 | Ga0070667_100103299 | Ga0070667_1001032992 | 446 |
| 1067 | 3300005434 | Ga0070709_10000165 | Ga0070709_100001658 | 446 |
| 1068 | 3300005435 | Ga0070714_100002703 | Ga0070714_1000027037 | 446 |
| 1069 | 3300005436 | Ga0070713_100002252 | Ga0070713_1000022527 | 446 |
| 1070 | 3300005436 | Ga0070713_100019979 | Ga0070713_1000199793 | 446 |
| 1071 | 3300005437 | Ga0070710_10000171 | Ga0070710_100001712 | 446 |
| 1072 | 3300005437 | Ga0070710_10033019 | Ga0070710_100330192 | 446 |
| 1073 | 3300005438 | Ga0070701_10064642 | Ga0070701_100646422 | 446 |
| 1074 | 3300005441 | Ga0070700_100022011 | Ga0070700_1000220115 | 446 |
| 1075 | 3300005458 | Ga0070681_10131380 | Ga0070681_101313802 | 446 |
| 1076 | 3300005459 | Ga0068867_100106614 | Ga0068867_1001066142 | 446 |
| 1077 | 3300005467 | Ga0070706_100001237 | Ga0070706_10000123721 | 446 |
| 1078 | 3300005467 | Ga0070706_100006955 | Ga0070706_1000069554 | 446 |
| 1079 | 3300005468 | Ga0070707_100005735 | Ga0070707_1000057352 | 446 |
| 1080 | 3300005468 | Ga0070707_100039318 | Ga0070707_1000393183 | 446 |
| 1081 | 3300005471 | Ga0070698_100000718 | Ga0070698_10000071834 | 446 |
| 1082 | 3300005471 | Ga0070698_100005554 | Ga0070698_1000055546 | 446 |
| 1083 | 3300005471 | Ga0070698_100012415 | Ga0070698_1000124155 | 446 |
| 1084 | 3300005530 | Ga0070679_100139525 | Ga0070679_1001395252 | 446 |
| 1085 | 3300005544 | Ga0070686_100015848 | Ga0070686_1000158483 | 446 |
| 1086 | 3300005614 | Ga0068856_100045686 | Ga0068856_1000456863 | 446 |
| 1087 | 3300005615 | Ga0070702_100036204 | Ga0070702_1000362042 | 446 |
| 1088 | 3300005617 | Ga0068859_100208887 | Ga0068859_1002088872 | 446 |
| 1089 | 3300005841 | Ga0068863_100041663 | Ga0068863_1000416634 | 446 |
| 1090 | 3300005844 | Ga0068862_100095958 | Ga0068862_1000959581 | 446 |
| 1091 | 3300005983 | Ga0081540_1000058 | Ga0081540_100005886 | 446 |
| 1092 | 3300005983 | Ga0081540_1000120 | Ga0081540_100012011 | 446 |
| 1093 | 3300005985 | Ga0081539_10000846 | Ga0081539_1000084619 | 446 |
| 1094 | 3300006028 | Ga0070717_10056734 | Ga0070717_100567343 | 446 |
| 1095 | 3300006173 | Ga0070716_100004282 | Ga0070716_1000042822 | 446 |
| 1096 | 3300006173 | Ga0070716_100098018 | Ga0070716_1000980182 | 446 |
| 1097 | 3300006175 | Ga0070712_100014200 | Ga0070712_1000142005 | 446 |
| 1098 | 3300006175 | Ga0070712_100023628 | Ga0070712_1000236283 | 446 |
| 1099 | 3300006852 | Ga0075433_10020156 | Ga0075433_100201566 | 446 |
| 1100 | 3300006871 | Ga0075434_100034046 | Ga0075434_1000340465 | 446 |
| 1101 | 3300006914 | Ga0075436_100011469 | Ga0075436_1000114692 | 446 |
| 1102 | 3300006914 | Ga0075436_100016125 | Ga0075436_1000161254 | 446 |
| 1103 | 3300006931 | Ga0097620_100208887 | Ga0097620_1002088872 | 446 |
| 1104 | 3300009094 | Ga0111539_10165209 | Ga0111539_101652092 | 446 |
| 1105 | 3300009174 | Ga0105241_10041881 | Ga0105241_100418812 | 446 |
| 1106 | 3300009174 | Ga0105241_10153317 | Ga0105241_101533172 | 446 |
| 1107 | 3300009553 | Ga0105249_10138850 | Ga0105249_101388501 | 446 |
| 1108 | 3300013102 | Ga0157371_10072602 | Ga0157371_100726022 | 446 |
| 1109 | 3300013105 | Ga0157369_10163930 | Ga0157369_101639302 | 446 |
| 1110 | 3300013297 | Ga0157378_10115653 | Ga0157378_101156532 | 446 |
| 1111 | 3300013308 | Ga0157375_10144658 | Ga0157375_101446582 | 446 |
| 1112 | 3300014325 | Ga0163163_10105894 | Ga0163163_101058942 | 446 |
| 1113 | 3300014497 | Ga0182008_10089599 | Ga0182008_100895992 | 446 |
| 1114 | 3300014969 | Ga0157376_10074672 | Ga0157376_100746723 | 446 |
| 1115 | 3300017792 | Ga0163161_10077287 | Ga0163161_100772872 | 446 |
| 1116 | 3300020081 | Ga0206354_10860617 | Ga0206354_108606172 | 446 |
| 1117 | 3300020082 | Ga0206353_11102129 | Ga0206353_111021293 | 446 |
| 1118 | 3300022467 | Ga0224712_10001022 | Ga0224712_100010225 | 446 |
| 1119 | 3300025898 | Ga0207692_10009178 | Ga0207692_100091783 | 446 |
| 1120 | 3300025898 | Ga0207692_10012558 | Ga0207692_100125583 | 446 |
| 1121 | 3300025898 | Ga0207692_10034204 | Ga0207692_100342042 | 446 |
| 1122 | 3300025899 | Ga0207642_10077937 | Ga0207642_100779372 | 446 |
| 1123 | 3300025901 | Ga0207688_10012847 | Ga0207688_100128473 | 446 |
| 1124 | 3300025904 | Ga0207647_10026494 | Ga0207647_100264942 | 446 |
| 1125 | 3300025906 | Ga0207699_10000393 | Ga0207699_100003932 | 446 |
| 1126 | 3300025906 | Ga0207699_10028655 | Ga0207699_100286552 | 446 |
| 1127 | 3300025908 | Ga0207643_10028173 | Ga0207643_100281733 | 446 |
| 1128 | 3300025910 | Ga0207684_10002760 | Ga0207684_100027609 | 446 |
| 1129 | 3300025910 | Ga0207684_10006264 | Ga0207684_1000626410 | 446 |
| 1130 | 3300025910 | Ga0207684_10047506 | Ga0207684_100475062 | 446 |
| 1131 | 3300025914 | Ga0207671_10057228 | Ga0207671_100572282 | 446 |
| 1132 | 3300025915 | Ga0207693_10004329 | Ga0207693_1000432910 | 446 |
| 1133 | 3300025915 | Ga0207693_10033132 | Ga0207693_100331322 | 446 |
| 1134 | 3300025916 | Ga0207663_10002048 | Ga0207663_100020483 | 446 |
| 1135 | 3300025918 | Ga0207662_10066563 | Ga0207662_100665632 | 446 |
| 1136 | 3300025919 | Ga0207657_10019911 | Ga0207657_100199113 | 446 |
| 1137 | 3300025922 | Ga0207646_10000455 | Ga0207646_1000045536 | 446 |
| 1138 | 3300025922 | Ga0207646_10200697 | Ga0207646_102006972 | 446 |
| 1139 | 3300025928 | Ga0207700_10000029 | Ga0207700_1000002920 | 446 |
| 1140 | 3300025928 | Ga0207700_10023791 | Ga0207700_100237912 | 446 |
| 1141 | 3300025928 | Ga0207700_10026278 | Ga0207700_100262783 | 446 |
| 1142 | 3300025928 | Ga0207700_10064913 | Ga0207700_100649132 | 446 |
| 1143 | 3300025929 | Ga0207664_10000110 | Ga0207664_1000011052 | 446 |
| 1144 | 3300025929 | Ga0207664_10009269 | Ga0207664_100092693 | 446 |
| 1145 | 3300025929 | Ga0207664_10018463 | Ga0207664_100184633 | 446 |
| 1146 | 3300025929 | Ga0207664_10136096 | Ga0207664_101360961 | 446 |
| 1147 | 3300025933 | Ga0207706_10043648 | Ga0207706_100436482 | 446 |
| 1148 | 3300025939 | Ga0207665_10004600 | Ga0207665_100046005 | 446 |
| 1149 | 3300025939 | Ga0207665_10008216 | Ga0207665_100082162 | 446 |
| 1150 | 3300025940 | Ga0207691_10078880 | Ga0207691_100788802 | 446 |
| 1151 | 3300025942 | Ga0207689_10102201 | Ga0207689_101022012 | 446 |
| 1152 | 3300026023 | Ga0207677_10124562 | Ga0207677_101245622 | 446 |
| 1153 | 3300026035 | Ga0207703_10193937 | Ga0207703_101939372 | 446 |
| 1154 | 3300026041 | Ga0207639_10075785 | Ga0207639_100757852 | 446 |
| 1155 | 3300026067 | Ga0207678_10023107 | Ga0207678_100231074 | 446 |
| 1156 | 3300026078 | Ga0207702_10013428 | Ga0207702_100134288 | 446 |
| 1157 | 3300026089 | Ga0207648_10042554 | Ga0207648_100425542 | 446 |
| 1158 | 3300026118 | Ga0207675_100007636 | Ga0207675_1000076363 | 446 |
| 1159 | 3300026121 | Ga0207683_10032299 | Ga0207683_100322992 | 446 |
| 1160 | 3300028379 | Ga0268266_10251610 | Ga0268266_102516101 | 446 |
| 1161 | 3300028794 | Ga0307515_10129340 | Ga0307515_101293402 | 446 |
| 1162 | 3300031247 | Ga0265340_10001983 | Ga0265340_100019835 | 446 |
| 1163 | 3300034818 | Ga0373950_0001388 | Ga0373950_0001388_216_1574 | 446 |
| 1164 | 3300034957 | Ga0373938_0016100 | Ga0373938_0016100_86_1444 | 446 |
| 1165 | 3300035083 | Ga0373926_0000182 | Ga0373926_0000182_1796_3163 | 446 |
| 1166 | 3300035083 | Ga0373926_0003441 | Ga0373926_0003441_2231_3604 | 446 |
| 1167 | 3300035083 | Ga0373926_0031073 | Ga0373926_0031073_12_1370 | 446 |
| 1168 | 3300035086 | Ga0373934_0000109 | Ga0373934_0000109_10059_11417 | 446 |
| 1169 | 3300035086 | Ga0373934_0001845 | Ga0373934_0001845_1197_2555 | 446 |
| 1170 | 3300035086 | Ga0373934_0002127 | Ga0373934_0002127_5708_7081 | 446 |
| 1171 | 3300035086 | Ga0373934_0064473 | Ga0373934_0064473_85_1443 | 446 |
| 1172 | 3300035092 | Ga0373952_0006560 | Ga0373952_0006560_487_1860 | 446 |
| 1173 | 3300035111 | Ga0373923_0000129 | Ga0373923_0000129_1830_3203 | 446 |
| 1174 | 3300035112 | Ga0373932_0019184 | Ga0373932_0019184_395_1753 | 446 |
| 1175 | 3300035114 | Ga0373939_0016970 | Ga0373939_0016970_173_1546 | 446 |
| 1176 | 3300035116 | Ga0373945_0000108 | Ga0373945_0000108_10748_12115 | 446 |
| 1177 | 3300035116 | Ga0373945_0002663 | Ga0373945_0002663_4064_5437 | 446 |
| 1178 | 3300035116 | Ga0373945_0006241 | Ga0373945_0006241_1160_2518 | 446 |
| 1179 | 3300035117 | Ga0373953_0000026 | Ga0373953_0000026_16287_17645 | 446 |
| 1180 | 3300035117 | Ga0373953_0024094 | Ga0373953_0024094_644_2017 | 446 |
| 1181 | 3300035118 | Ga0373954_0006046 | Ga0373954_0006046_3468_4826 | 446 |
| 1182 | 3300035118 | Ga0373954_0006922 | Ga0373954_0006922_342_1715 | 446 |
| 1183 | 3300035119 | Ga0373956_0001484 | Ga0373956_0001484_3767_5125 | 446 |
| 1184 | 3300035120 | Ga0373957_0000038 | Ga0373957_0000038_17423_18781 | 446 |
| 1185 | 3300035170 | Ga0373943_0001545 | Ga0373943_0001545_1764_3137 | 446 |
| 1186 | 3300035170 | Ga0373943_0003488 | Ga0373943_0003488_5490_6857 | 446 |
| 1187 | 3300035170 | Ga0373943_0105497 | Ga0373943_0105497_55_1413 | 446 |
| 1188 | 3300035171 | Ga0373946_0028410 | Ga0373946_0028410_163_1536 | 446 |
| 1189 | 3300035172 | Ga0373955_0000841 | Ga0373955_0000841_697_2055 | 446 |
| 1190 | 3300035172 | Ga0373955_0015149 | Ga0373955_0015149_1998_3356 | 446 |
| 1191 | 3300035172 | Ga0373955_0064649 | Ga0373955_0064649_467_1840 | 446 |
| 1192 | 3300035207 | Ga0373942_0015698 | Ga0373942_0015698_102_1460 | 446 |
| 1193 | 3300035242 | Ga0373962_0011166 | Ga0373962_0011166_344_1717 | 446 |
| 1194 | 3300035410 | Ga0373924_0002452 | Ga0373924_0002452_1651_3009 | 446 |
| 1195 | 3300035410 | Ga0373924_0048402 | Ga0373924_0048402_46_1419 | 446 |
| 1196 | 3300035691 | Ga0373931_0037655 | Ga0373931_0037655_250_1623 | 446 |
| 1197 | 3300035692 | Ga0373935_0001486 | Ga0373935_0001486_10123_11490 | 446 |
| 1198 | 3300035692 | Ga0373935_0036971 | Ga0373935_0036971_872_2230 | 446 |
| 1199 | 3300035695 | Ga0373927_0000680 | Ga0373927_0000680_23492_24859 | 446 |
| 1200 | 3300035724 | Ga0373933_0000188 | Ga0373933_0000188_4850_6208 | 446 |
| 1201 | 3300035724 | Ga0373933_0000604 | Ga0373933_0000604_6328_7686 | 446 |
| 1202 | 3300035724 | Ga0373933_0042571 | Ga0373933_0042571_648_2021 | 446 |
| 1203 | 3300035725 | Ga0373947_0002803 | Ga0373947_0002803_8190_9557 | 446 |
| 1204 | 3300036401 | Ga0373937_0000138 | Ga0373937_0000138_33971_35329 | 446 |
| 1205 | 3300036401 | Ga0373937_0001588 | Ga0373937_0001588_5115_6473 | 446 |
| 1206 | 3300036401 | Ga0373937_0059365 | Ga0373937_0059365_55_1413 | 446 |
| 1207 | 3300036401 | Ga0373937_0062370 | Ga0373937_0062370_1146_2519 | 446 |
| 1208 | 3300037068 | Ga0373925_0000699 | Ga0373925_0000699_20755_22122 | 446 |
| 1209 | 3300037853 | Ga0436364_0232843 | Ga0436364_0232843_28833_30215 | 446 |
| 1210 | 3300037853 | Ga0436364_1306745 | Ga0436364_1306745_2191_3564 | 446 |
| 1211 | 3300039450 | Ga0436363_0778823 | Ga0436363_0778823_287_1660 | 446 |
| 1212 | 3300041491 | Ga0451833_1422046 | Ga0451833_1422046_441_1871 | 446 |
| 1213 | 3300044694 | Ga0466963_0106439 | Ga0466963_0106439_105_1472 | 446 |
| 1214 | 3300045976 | Ga0466967_0049038 | Ga0466967_0049038_2236_3618 | 446 |
| 1215 | 3300045976 | Ga0466967_0068868 | Ga0466967_0068868_1164_2531 | 446 |
| 1216 | 3300046454 | Ga0495592_0000041 | Ga0495592_0000041_87334_88692 | 446 |
| 1217 | 3300046454 | Ga0495592_0049321 | Ga0495592_0049321_932_2290 | 446 |
| 1218 | 3300046455 | Ga0495603_0010135 | Ga0495603_0010135_1168_2541 | 446 |
| 1219 | 3300046459 | Ga0495629_0007344 | Ga0495629_0007344_585_1943 | 446 |
| 1220 | 3300046459 | Ga0495629_0056443 | Ga0495629_0056443_1342_2715 | 446 |
| 1221 | 3300046461 | Ga0495641_0028361 | Ga0495641_0028361_220_1593 | 446 |
| 1222 | 3300046462 | Ga0495651_0000018 | Ga0495651_0000018_34740_36098 | 446 |
| 1223 | 3300046462 | Ga0495651_0031225 | Ga0495651_0031225_1230_2597 | 446 |
| 1224 | 3300046462 | Ga0495651_0035162 | Ga0495651_0035162_2117_3490 | 446 |
| 1225 | 3300046463 | Ga0495653_0003023 | Ga0495653_0003023_1582_2940 | 446 |
| 1226 | 3300046463 | Ga0495653_0017016 | Ga0495653_0017016_2388_3755 | 446 |
| 1227 | 3300046463 | Ga0495653_0059305 | Ga0495653_0059305_1480_2853 | 446 |
| 1228 | 3300046473 | Ga0495582_0011706 | Ga0495582_0011706_149_1507 | 446 |
| 1229 | 3300046473 | Ga0495582_0032044 | Ga0495582_0032044_1360_2733 | 446 |
| 1230 | 3300046476 | Ga0495662_0002680 | Ga0495662_0002680_1115_2488 | 446 |
| 1231 | 3300046477 | Ga0495664_0001298 | Ga0495664_0001298_6064_7431 | 446 |
| 1232 | 3300046477 | Ga0495664_0027977 | Ga0495664_0027977_109_1467 | 446 |
| 1233 | 3300046499 | Ga0495594_0021375 | Ga0495594_0021375_2076_3434 | 446 |
| 1234 | 3300046499 | Ga0495594_0027716 | Ga0495594_0027716_1402_2775 | 446 |
| 1235 | 3300046511 | Ga0495608_0000039 | Ga0495608_0000039_34740_36098 | 446 |
| 1236 | 3300046511 | Ga0495608_0007120 | Ga0495608_0007120_170_1528 | 446 |
| 1237 | 3300046511 | Ga0495608_0078393 | Ga0495608_0078393_94_1467 | 446 |
| 1238 | 3300046514 | Ga0495618_0001552 | Ga0495618_0001552_13450_14817 | 446 |
| 1239 | 3300046514 | Ga0495618_0054617 | Ga0495618_0054617_450_1808 | 446 |
| 1240 | 3300046516 | Ga0495628_0000219 | Ga0495628_0000219_16311_17669 | 446 |
| 1241 | 3300046516 | Ga0495628_0003347 | Ga0495628_0003347_11557_12930 | 446 |
| 1242 | 3300046517 | Ga0495630_0064011 | Ga0495630_0064011_1359_2732 | 446 |
| 1243 | 3300046517 | Ga0495630_0082178 | Ga0495630_0082178_849_2207 | 446 |
| 1244 | 3300046529 | Ga0495652_0000092 | Ga0495652_0000092_87098_88456 | 446 |
| 1245 | 3300046529 | Ga0495652_0024482 | Ga0495652_0024482_3812_5170 | 446 |
| 1246 | 3300046531 | Ga0495665_0000931 | Ga0495665_0000931_9342_10715 | 446 |
| 1247 | 3300046531 | Ga0495665_0006900 | Ga0495665_0006900_4429_5796 | 446 |
| 1248 | 3300046533 | Ga0495640_0009819 | Ga0495640_0009819_347_1720 | 446 |
| 1249 | 3300046535 | Ga0495586_0008834 | Ga0495586_0008834_1432_2805 | 446 |
| 1250 | 3300046536 | Ga0495587_0000034 | Ga0495587_0000034_87335_88693 | 446 |
| 1251 | 3300046536 | Ga0495587_0012295 | Ga0495587_0012295_1106_2479 | 446 |
| 1252 | 3300046536 | Ga0495587_0045833 | Ga0495587_0045833_459_1832 | 446 |
| 1253 | 3300046543 | Ga0495645_0018528 | Ga0495645_0018528_1154_2527 | 446 |
| 1254 | 3300046543 | Ga0495645_0143473 | Ga0495645_0143473_67_1425 | 446 |
| 1255 | 3300046559 | Ga0495667_0000150 | Ga0495667_0000150_34740_36098 | 446 |
| 1256 | 3300046559 | Ga0495667_0000669 | Ga0495667_0000669_10091_11449 | 446 |
| 1257 | 3300046559 | Ga0495667_0001777 | Ga0495667_0001777_12054_13421 | 446 |
| 1258 | 3300046559 | Ga0495667_0138833 | Ga0495667_0138833_163_1536 | 446 |
| 1259 | 3300046642 | Ga0495634_0082621 | Ga0495634_0082621_664_2022 | 446 |
| 1260 | 3300046663 | Ga0495635_0000138 | Ga0495635_0000138_31231_32598 | 446 |
| 1261 | 3300046675 | Ga0495657_0000247 | Ga0495657_0000247_34740_36098 | 446 |
| 1262 | 3300046675 | Ga0495657_0038707 | Ga0495657_0038707_1871_3238 | 446 |
| 1263 | 3300046675 | Ga0495657_0045690 | Ga0495657_0045690_1082_2440 | 446 |
| 1264 | 3300046675 | Ga0495657_0060132 | Ga0495657_0060132_1115_2488 | 446 |
| 1265 | 3300046678 | Ga0495599_0000108 | Ga0495599_0000108_20052_21410 | 446 |
| 1266 | 3300046678 | Ga0495599_0029060 | Ga0495599_0029060_1286_2644 | 446 |
| 1267 | 3300046678 | Ga0495599_0082042 | Ga0495599_0082042_556_1914 | 446 |
| 1268 | 3300046679 | Ga0495623_0000287 | Ga0495623_0000287_29057_30415 | 446 |
| 1269 | 3300046679 | Ga0495623_0024688 | Ga0495623_0024688_1253_2626 | 446 |
| 1270 | 3300046679 | Ga0495623_0030914 | Ga0495623_0030914_2050_3408 | 446 |
| 1271 | 3300046680 | Ga0495646_0008529 | Ga0495646_0008529_3520_4878 | 446 |
| 1272 | 3300046680 | Ga0495646_0048843 | Ga0495646_0048843_1005_2363 | 446 |
| 1273 | 3300046681 | Ga0495647_0008900 | Ga0495647_0008900_446_1819 | 446 |
| 1274 | 3300046683 | Ga0495658_0004732 | Ga0495658_0004732_1239_2612 | 446 |
| 1275 | 3300046690 | Ga0495624_0038049 | Ga0495624_0038049_1399_2772 | 446 |
| 1276 | 3300046809 | Ga0495600_0003753 | Ga0495600_0003753_625_1983 | 446 |
| 1277 | 3300047315 | Ga0495581_0038183 | Ga0495581_0038183_390_1757 | 446 |
| 1278 | 3300047315 | Ga0495581_0080488 | Ga0495581_0080488_282_1655 | 446 |
| 1279 | 3300047317 | Ga0495604_0000039 | Ga0495604_0000039_87334_88692 | 446 |
| 1280 | 3300047317 | Ga0495604_0004961 | Ga0495604_0004961_527_1885 | 446 |
| 1281 | 3300047317 | Ga0495604_0068694 | Ga0495604_0068694_784_2142 | 446 |
| 1282 | 3300047319 | Ga0495674_0000235 | Ga0495674_0000235_10271_11638 | 446 |
| 1283 | 3300047319 | Ga0495674_0022562 | Ga0495674_0022562_3045_4418 | 446 |
| 1284 | 3300047319 | Ga0495674_0094410 | Ga0495674_0094410_736_2109 | 446 |
| 1285 | 3300047319 | Ga0495674_0110789 | Ga0495674_0110789_898_2256 | 446 |
| 1286 | 3300047321 | Ga0495676_0011200 | Ga0495676_0011200_4054_5421 | 446 |
| 1287 | 3300047322 | Ga0495680_0000028 | Ga0495680_0000028_24174_25532 | 446 |
| 1288 | 3300047322 | Ga0495680_0001355 | Ga0495680_0001355_10562_11920 | 446 |
| 1289 | 3300047322 | Ga0495680_0001817 | Ga0495680_0001817_18347_19714 | 446 |
| 1290 | 3300047322 | Ga0495680_0072835 | Ga0495680_0072835_33_1406 | 446 |
| 1291 | 3300047322 | Ga0495680_0084807 | Ga0495680_0084807_570_1943 | 446 |
| 1292 | 3300047322 | Ga0495680_0129163 | Ga0495680_0129163_149_1507 | 446 |
| 1293 | 3300047444 | Ga0495675_0000355 | Ga0495675_0000355_2232_3590 | 446 |
| 1294 | 3300047444 | Ga0495675_0008588 | Ga0495675_0008588_1725_3098 | 446 |
| 1295 | 3300047444 | Ga0495675_0027151 | Ga0495675_0027151_1307_2665 | 446 |
| 1296 | 3300047471 | Ga0495684_0000154 | Ga0495684_0000154_23102_24469 | 446 |
| 1297 | 3300047471 | Ga0495684_0043852 | Ga0495684_0043852_1794_3152 | 446 |
| 1298 | 3300047673 | Ga0495593_0012728 | Ga0495593_0012728_814_2172 | 446 |
| 1299 | 3300047673 | Ga0495593_0026923 | Ga0495593_0026923_1765_3138 | 446 |
| 1300 | 3300048088 | Ga0495602_0000043 | Ga0495602_0000043_87334_88692 | 446 |
| 1301 | 3300048088 | Ga0495602_0055088 | Ga0495602_0055088_1061_2434 | 446 |
| 1302 | 3300048088 | Ga0495602_0057893 | Ga0495602_0057893_79_1437 | 446 |
| 1303 | 3300048089 | Ga0495614_0014275 | Ga0495614_0014275_1431_2804 | 446 |
| 1304 | 3300048903 | Ga0496100_0084442 | Ga0496100_0084442_351_1709 | 446 |
| 1305 | 3300048908 | Ga0496105_0088810 | Ga0496105_0088810_151_1509 | 446 |
| 1306 | 3300048908 | Ga0496105_0092545 | Ga0496105_0092545_957_2330 | 446 |
| 1307 | 3300048910 | Ga0496107_0062574 | Ga0496107_0062574_31_1389 | 446 |
| 1308 | 3300048910 | Ga0496107_0131628 | Ga0496107_0131628_43_1416 | 446 |
| 1309 | 3300048911 | Ga0496108_0074019 | Ga0496108_0074019_856_2229 | 446 |
| 1310 | 3300048917 | Ga0496114_0048238 | Ga0496114_0048238_169_1542 | 446 |
| 1311 | 3300048918 | Ga0496115_0012391 | Ga0496115_0012391_3067_4440 | 446 |
| 1312 | 3300048925 | Ga0496122_0005660 | Ga0496122_0005660_10569_11930 | 446 |
| 1313 | 3300049568 | Ga0501031_0026500 | Ga0501031_0026500_1066_2406 | 446 |
| 1314 | 3300049574 | Ga0501038_0029892 | Ga0501038_0029892_2120_3460 | 446 |
| 1315 | 3300049575 | Ga0501039_0047074 | Ga0501039_0047074_1060_2400 | 446 |
| 1316 | 3300049577 | Ga0501041_0064103 | Ga0501041_0064103_702_2042 | 446 |
| 1317 | 3300049580 | Ga0501046_0168778 | Ga0501046_0168778_23_1363 | 446 |
| 1318 | 3300049588 | Ga0501072_0016427 | Ga0501072_0016427_4095_5459 | 446 |
| 1319 | 3300049741 | Ga0501079_0025288 | Ga0501079_0025288_1072_2412 | 446 |
| 1320 | 3300049742 | Ga0501080_0119003 | Ga0501080_0119003_592_1992 | 446 |
| 1321 | 3300049742 | Ga0501080_0184613 | Ga0501080_0184613_308_1648 | 446 |
| 1322 | 3300049744 | Ga0501083_0126874 | Ga0501083_0126874_166_1506 | 446 |
| 1323 | 3300049823 | Ga0501044_0212884 | Ga0501044_0212884_295_1695 | 446 |
| 1324 | 3300049824 | Ga0501045_0054980 | Ga0501045_0054980_408_1748 | 446 |
| 1325 | 3300050511 | nmdc:mga08y16_52421_c1 | nmdc:mga08y16_52421_c1_1216_2574 | 446 |
| 1326 | 3300050512 | nmdc:mga0n895_303769_c1 | nmdc:mga0n895_303769_c1_223_1581 | 446 |
| 1327 | 3300050513 | nmdc:mga0rr50_9814_c1 | nmdc:mga0rr50_9814_c1_3273_4631 | 446 |
| 1328 | 3300050515 | nmdc:mga0a205_99676_c1 | nmdc:mga0a205_99676_c1_39_1397 | 446 |
| 1329 | 3300053077 | Ga0495601_0026034 | Ga0495601_0026034_1122_2495 | 446 |
| 1330 | 3300053078 | Ga0495612_0016357 | Ga0495612_0016357_1570_2943 | 446 |
| 1331 | 3300053084 | Ga0495595_0004992 | Ga0495595_0004992_286_1644 | 446 |
| 1332 | 3300053084 | Ga0495595_0009778 | Ga0495595_0009778_1843_3201 | 446 |
| 1333 | 3300053084 | Ga0495595_0010465 | Ga0495595_0010465_894_2267 | 446 |
| 1334 | 3300053085 | Ga0495619_0003503 | Ga0495619_0003503_1115_2488 | 446 |
| 1335 | 3300061734 | Ga0530510_0095460 | Ga0530510_0095460_667_2082 | 446 |
| 1336 | iso_pu_bacteria | 2527291629 | 2528215625 | 446 |
| 1337 | iso_pu_bacteria | 2546825537 | 2546950832 | 446 |
| 1338 | iso_pu_bacteria | 2684623036 | 2686543997 | 446 |
| 1339 | iso_pu_bacteria | 2710264753 | 2710604753 | 446 |
| 1340 | iso_pu_bacteria | 2773857924 | 2774866894 | 446 |
| 1341 | iso_pu_bacteria | 637000116 | 637881150 | 446 |
| 1342 | iso_pu_bacteria | 8054920844 | 8054924366 | 446 |
| 1343 | 3300000549 | LJQas_1002891 | LJQas_10028912 | 447 |
| 1344 | 3300005337 | Ga0070682_100004601 | Ga0070682_1000046017 | 447 |
| 1345 | 3300005339 | Ga0070660_100010741 | Ga0070660_1000107412 | 447 |
| 1346 | 3300005435 | Ga0070714_100022873 | Ga0070714_1000228732 | 447 |
| 1347 | 3300005458 | Ga0070681_10103138 | Ga0070681_101031382 | 447 |
| 1348 | 3300005467 | Ga0070706_100009075 | Ga0070706_1000090757 | 447 |
| 1349 | 3300005468 | Ga0070707_100000043 | Ga0070707_10000004317 | 447 |
| 1350 | 3300005471 | Ga0070698_100000072 | Ga0070698_10000007266 | 447 |
| 1351 | 3300005535 | Ga0070684_100002011 | Ga0070684_10000201110 | 447 |
| 1352 | 3300005548 | Ga0070665_100006685 | Ga0070665_1000066855 | 447 |
| 1353 | 3300005563 | Ga0068855_100003043 | Ga0068855_10000304311 | 447 |
| 1354 | 3300005563 | Ga0068855_100144212 | Ga0068855_1001442122 | 447 |
| 1355 | 3300005563 | Ga0068855_100148108 | Ga0068855_1001481082 | 447 |
| 1356 | 3300005577 | Ga0068857_100015539 | Ga0068857_1000155393 | 447 |
| 1357 | 3300005841 | Ga0068863_100027875 | Ga0068863_1000278753 | 447 |
| 1358 | 3300005842 | Ga0068858_100031487 | Ga0068858_1000314873 | 447 |
| 1359 | 3300005843 | Ga0068860_100031992 | Ga0068860_1000319924 | 447 |
| 1360 | 3300006038 | Ga0075365_10004303 | Ga0075365_100043033 | 447 |
| 1361 | 3300006038 | Ga0075365_10028765 | Ga0075365_100287652 | 447 |
| 1362 | 3300006042 | Ga0075368_10002325 | Ga0075368_100023253 | 447 |
| 1363 | 3300006048 | Ga0075363_100030288 | Ga0075363_1000302882 | 447 |
| 1364 | 3300006048 | Ga0075363_100060382 | Ga0075363_1000603822 | 447 |
| 1365 | 3300006051 | Ga0075364_10013755 | Ga0075364_100137551 | 447 |
| 1366 | 3300006051 | Ga0075364_10014100 | Ga0075364_100141003 | 447 |
| 1367 | 3300006175 | Ga0070712_100019304 | Ga0070712_1000193042 | 447 |
| 1368 | 3300006237 | Ga0097621_100008180 | Ga0097621_1000081805 | 447 |
| 1369 | 3300006353 | Ga0075370_10001552 | Ga0075370_100015528 | 447 |
| 1370 | 3300009093 | Ga0105240_10122631 | Ga0105240_101226312 | 447 |
| 1371 | 3300009098 | Ga0105245_10002916 | Ga0105245_100029167 | 447 |
| 1372 | 3300009148 | Ga0105243_10129134 | Ga0105243_101291342 | 447 |
| 1373 | 3300009545 | Ga0105237_10098934 | Ga0105237_100989342 | 447 |
| 1374 | 3300009553 | Ga0105249_10020772 | Ga0105249_100207724 | 447 |
| 1375 | 3300010375 | Ga0105239_10005653 | Ga0105239_100056535 | 447 |
| 1376 | 3300011119 | Ga0105246_10015649 | Ga0105246_100156492 | 447 |
| 1377 | 3300013104 | Ga0157370_10004680 | Ga0157370_1000468010 | 447 |
| 1378 | 3300013105 | Ga0157369_10039681 | Ga0157369_100396814 | 447 |
| 1379 | 3300013296 | Ga0157374_10004456 | Ga0157374_100044565 | 447 |
| 1380 | 3300013306 | Ga0163162_10009743 | Ga0163162_100097432 | 447 |
| 1381 | 3300013307 | Ga0157372_10025730 | Ga0157372_100257303 | 447 |
| 1382 | 3300014325 | Ga0163163_10008595 | Ga0163163_100085954 | 447 |
| 1383 | 3300014968 | Ga0157379_10004864 | Ga0157379_100048645 | 447 |
| 1384 | 3300014968 | Ga0157379_10006071 | Ga0157379_100060719 | 447 |
| 1385 | 3300021384 | Ga0213876_10019674 | Ga0213876_100196742 | 447 |
| 1386 | 3300022467 | Ga0224712_10051737 | Ga0224712_100517372 | 447 |
| 1387 | 3300025904 | Ga0207647_10040660 | Ga0207647_100406602 | 447 |
| 1388 | 3300025906 | Ga0207699_10040045 | Ga0207699_100400452 | 447 |
| 1389 | 3300025910 | Ga0207684_10054822 | Ga0207684_100548223 | 447 |
| 1390 | 3300025913 | Ga0207695_10083572 | Ga0207695_100835723 | 447 |
| 1391 | 3300025917 | Ga0207660_10167495 | Ga0207660_101674951 | 447 |
| 1392 | 3300025919 | Ga0207657_10022980 | Ga0207657_100229802 | 447 |
| 1393 | 3300025922 | Ga0207646_10009604 | Ga0207646_100096047 | 447 |
| 1394 | 3300025927 | Ga0207687_10018558 | Ga0207687_100185582 | 447 |
| 1395 | 3300025928 | Ga0207700_10001933 | Ga0207700_1000193311 | 447 |
| 1396 | 3300025928 | Ga0207700_10002047 | Ga0207700_100020477 | 447 |
| 1397 | 3300025929 | Ga0207664_10019628 | Ga0207664_100196285 | 447 |
| 1398 | 3300025929 | Ga0207664_10050041 | Ga0207664_100500413 | 447 |
| 1399 | 3300025939 | Ga0207665_10012993 | Ga0207665_100129934 | 447 |
| 1400 | 3300025949 | Ga0207667_10026581 | Ga0207667_100265815 | 447 |
| 1401 | 3300025949 | Ga0207667_10229988 | Ga0207667_102299881 | 447 |
| 1402 | 3300025961 | Ga0207712_10056219 | Ga0207712_100562192 | 447 |
| 1403 | 3300026075 | Ga0207708_10013892 | Ga0207708_100138923 | 447 |
| 1404 | 3300026095 | Ga0207676_10183316 | Ga0207676_101833162 | 447 |
| 1405 | 3300026116 | Ga0207674_10001048 | Ga0207674_1000104832 | 447 |
| 1406 | 3300026116 | Ga0207674_10062578 | Ga0207674_100625782 | 447 |
| 1407 | 3300026118 | Ga0207675_100097026 | Ga0207675_1000970262 | 447 |
| 1408 | 3300028379 | Ga0268266_10006262 | Ga0268266_100062625 | 447 |
| 1409 | 3300028381 | Ga0268264_10059778 | Ga0268264_100597781 | 447 |
| 1410 | 3300031901 | Ga0307406_10056841 | Ga0307406_100568412 | 447 |
| 1411 | 3300031903 | Ga0307407_10002637 | Ga0307407_100026375 | 447 |
| 1412 | 3300031995 | Ga0307409_100066141 | Ga0307409_1000661413 | 447 |
| 1413 | 3300031995 | Ga0307409_100131339 | Ga0307409_1001313392 | 447 |
| 1414 | 3300032002 | Ga0307416_100009098 | Ga0307416_1000090983 | 447 |
| 1415 | 3300032005 | Ga0307411_10006601 | Ga0307411_100066014 | 447 |
| 1416 | 3300035086 | Ga0373934_0021094 | Ga0373934_0021094_89_1453 | 447 |
| 1417 | 3300035086 | Ga0373934_0030713 | Ga0373934_0030713_30_1394 | 447 |
| 1418 | 3300035111 | Ga0373923_0025003 | Ga0373923_0025003_886_2250 | 447 |
| 1419 | 3300035111 | Ga0373923_0034811 | Ga0373923_0034811_122_1486 | 447 |
| 1420 | 3300035113 | Ga0373936_0012109 | Ga0373936_0012109_822_2186 | 447 |
| 1421 | 3300035117 | Ga0373953_0011211 | Ga0373953_0011211_750_2114 | 447 |
| 1422 | 3300035118 | Ga0373954_0011406 | Ga0373954_0011406_938_2302 | 447 |
| 1423 | 3300035118 | Ga0373954_0027261 | Ga0373954_0027261_959_2323 | 447 |
| 1424 | 3300035119 | Ga0373956_0029611 | Ga0373956_0029611_995_2359 | 447 |
| 1425 | 3300035120 | Ga0373957_0000972 | Ga0373957_0000972_874_2238 | 447 |
| 1426 | 3300035172 | Ga0373955_0012628 | Ga0373955_0012628_1845_3209 | 447 |
| 1427 | 3300035172 | Ga0373955_0070526 | Ga0373955_0070526_189_1553 | 447 |
| 1428 | 3300035410 | Ga0373924_0004584 | Ga0373924_0004584_1338_2702 | 447 |
| 1429 | 3300035692 | Ga0373935_0055524 | Ga0373935_0055524_385_1749 | 447 |
| 1430 | 3300035724 | Ga0373933_0083526 | Ga0373933_0083526_330_1694 | 447 |
| 1431 | 3300035725 | Ga0373947_0112580 | Ga0373947_0112580_101_1465 | 447 |
| 1432 | 3300035725 | Ga0373947_0155331 | Ga0373947_0155331_60_1424 | 447 |
| 1433 | 3300037466 | Ga0395898_0058456 | Ga0395898_0058456_2120_3490 | 447 |
| 1434 | 3300038443 | Ga0395901_0020378 | Ga0395901_0020378_3335_4684 | 447 |
| 1435 | 3300039437 | Ga0436365_0575809 | Ga0436365_0575809_318_1694 | 447 |
| 1436 | 3300039450 | Ga0436363_0714317 | Ga0436363_0714317_97_1461 | 447 |
| 1437 | 3300044658 | Ga0466972_0026321 | Ga0466972_0026321_552_1895 | 447 |
| 1438 | 3300044684 | Ga0466966_0028566 | Ga0466966_0028566_2246_3589 | 447 |
| 1439 | 3300044706 | Ga0466964_0004578 | Ga0466964_0004578_3698_5041 | 447 |
| 1440 | 3300044765 | Ga0466970_0023147 | Ga0466970_0023147_481_1824 | 447 |
| 1441 | 3300044842 | Ga0466957_0002955 | Ga0466957_0002955_3163_4506 | 447 |
| 1442 | 3300044901 | Ga0466960_0018156 | Ga0466960_0018156_1674_3017 | 447 |
| 1443 | 3300045836 | Ga0466958_0028022 | Ga0466958_0028022_783_2126 | 447 |
| 1444 | 3300045976 | Ga0466967_0016571 | Ga0466967_0016571_93_1436 | 447 |
| 1445 | 3300046454 | Ga0495592_0033870 | Ga0495592_0033870_523_1887 | 447 |
| 1446 | 3300046454 | Ga0495592_0047303 | Ga0495592_0047303_1312_2676 | 447 |
| 1447 | 3300046459 | Ga0495629_0043776 | Ga0495629_0043776_604_1968 | 447 |
| 1448 | 3300046459 | Ga0495629_0047902 | Ga0495629_0047902_634_1998 | 447 |
| 1449 | 3300046461 | Ga0495641_0021199 | Ga0495641_0021199_873_2237 | 447 |
| 1450 | 3300046461 | Ga0495641_0070729 | Ga0495641_0070729_92_1441 | 447 |
| 1451 | 3300046462 | Ga0495651_0009202 | Ga0495651_0009202_746_2110 | 447 |
| 1452 | 3300046462 | Ga0495651_0069311 | Ga0495651_0069311_1263_2627 | 447 |
| 1453 | 3300046463 | Ga0495653_0072340 | Ga0495653_0072340_888_2252 | 447 |
| 1454 | 3300046473 | Ga0495582_0009586 | Ga0495582_0009586_3357_4721 | 447 |
| 1455 | 3300046473 | Ga0495582_0097833 | Ga0495582_0097833_19_1383 | 447 |
| 1456 | 3300046476 | Ga0495662_0005429 | Ga0495662_0005429_3377_4741 | 447 |
| 1457 | 3300046477 | Ga0495664_0016579 | Ga0495664_0016579_581_1945 | 447 |
| 1458 | 3300046511 | Ga0495608_0030826 | Ga0495608_0030826_323_1687 | 447 |
| 1459 | 3300046514 | Ga0495618_0020662 | Ga0495618_0020662_2660_4024 | 447 |
| 1460 | 3300046516 | Ga0495628_0124610 | Ga0495628_0124610_30_1394 | 447 |
| 1461 | 3300046517 | Ga0495630_0031062 | Ga0495630_0031062_708_2072 | 447 |
| 1462 | 3300046517 | Ga0495630_0110066 | Ga0495630_0110066_423_1787 | 447 |
| 1463 | 3300046529 | Ga0495652_0114558 | Ga0495652_0114558_769_2133 | 447 |
| 1464 | 3300046531 | Ga0495665_0004607 | Ga0495665_0004607_4443_5807 | 447 |
| 1465 | 3300046531 | Ga0495665_0070809 | Ga0495665_0070809_449_1813 | 447 |
| 1466 | 3300046533 | Ga0495640_0034686 | Ga0495640_0034686_1185_2549 | 447 |
| 1467 | 3300046533 | Ga0495640_0112828 | Ga0495640_0112828_195_1559 | 447 |
| 1468 | 3300046535 | Ga0495586_0004920 | Ga0495586_0004920_873_2237 | 447 |
| 1469 | 3300046535 | Ga0495586_0057677 | Ga0495586_0057677_528_1892 | 447 |
| 1470 | 3300046536 | Ga0495587_0000538 | Ga0495587_0000538_16829_18193 | 447 |
| 1471 | 3300046536 | Ga0495587_0017071 | Ga0495587_0017071_2122_3486 | 447 |
| 1472 | 3300046543 | Ga0495645_0062902 | Ga0495645_0062902_1122_2486 | 447 |
| 1473 | 3300046642 | Ga0495634_0028083 | Ga0495634_0028083_2262_3626 | 447 |
| 1474 | 3300046642 | Ga0495634_0069487 | Ga0495634_0069487_231_1595 | 447 |
| 1475 | 3300046663 | Ga0495635_0007591 | Ga0495635_0007591_1227_2591 | 447 |
| 1476 | 3300046675 | Ga0495657_0051156 | Ga0495657_0051156_102_1466 | 447 |
| 1477 | 3300046675 | Ga0495657_0059797 | Ga0495657_0059797_961_2325 | 447 |
| 1478 | 3300046678 | Ga0495599_0001098 | Ga0495599_0001098_2407_3771 | 447 |
| 1479 | 3300046678 | Ga0495599_0085122 | Ga0495599_0085122_581_1945 | 447 |
| 1480 | 3300046679 | Ga0495623_0011210 | Ga0495623_0011210_3826_5190 | 447 |
| 1481 | 3300046679 | Ga0495623_0016471 | Ga0495623_0016471_2526_3890 | 447 |
| 1482 | 3300046680 | Ga0495646_0011228 | Ga0495646_0011228_2507_3871 | 447 |
| 1483 | 3300046680 | Ga0495646_0029846 | Ga0495646_0029846_1185_2549 | 447 |
| 1484 | 3300046683 | Ga0495658_0018605 | Ga0495658_0018605_1238_2602 | 447 |
| 1485 | 3300046689 | Ga0495613_0088523 | Ga0495613_0088523_708_2072 | 447 |
| 1486 | 3300046690 | Ga0495624_0057818 | Ga0495624_0057818_490_1854 | 447 |
| 1487 | 3300046809 | Ga0495600_0068710 | Ga0495600_0068710_750_2114 | 447 |
| 1488 | 3300047315 | Ga0495581_0035097 | Ga0495581_0035097_1140_2504 | 447 |
| 1489 | 3300047315 | Ga0495581_0041912 | Ga0495581_0041912_343_1707 | 447 |
| 1490 | 3300047317 | Ga0495604_0018417 | Ga0495604_0018417_1206_2570 | 447 |
| 1491 | 3300047317 | Ga0495604_0094448 | Ga0495604_0094448_517_1881 | 447 |
| 1492 | 3300047319 | Ga0495674_0012639 | Ga0495674_0012639_2504_3868 | 447 |
| 1493 | 3300047319 | Ga0495674_0061194 | Ga0495674_0061194_709_2073 | 447 |
| 1494 | 3300047321 | Ga0495676_0045136 | Ga0495676_0045136_1172_2548 | 447 |
| 1495 | 3300047322 | Ga0495680_0003332 | Ga0495680_0003332_2776_4140 | 447 |
| 1496 | 3300047322 | Ga0495680_0090669 | Ga0495680_0090669_330_1694 | 447 |
| 1497 | 3300047444 | Ga0495675_0007520 | Ga0495675_0007520_166_1530 | 447 |
| 1498 | 3300047471 | Ga0495684_0010849 | Ga0495684_0010849_1915_3279 | 447 |
| 1499 | 3300047471 | Ga0495684_0064876 | Ga0495684_0064876_202_1566 | 447 |
| 1500 | 3300047673 | Ga0495593_0012122 | Ga0495593_0012122_3021_4385 | 447 |
| 1501 | 3300047673 | Ga0495593_0080233 | Ga0495593_0080233_60_1424 | 447 |
| 1502 | 3300048088 | Ga0495602_0008296 | Ga0495602_0008296_7434_8798 | 447 |
| 1503 | 3300048088 | Ga0495602_0089421 | Ga0495602_0089421_874_2238 | 447 |
| 1504 | 3300048903 | Ga0496100_0050919 | Ga0496100_0050919_836_2191 | 447 |
| 1505 | 3300048907 | Ga0496104_0009738 | Ga0496104_0009738_6972_8336 | 447 |
| 1506 | 3300048910 | Ga0496107_0118127 | Ga0496107_0118127_538_1893 | 447 |
| 1507 | 3300048911 | Ga0496108_0006454 | Ga0496108_0006454_829_2178 | 447 |
| 1508 | 3300048911 | Ga0496108_0075343 | Ga0496108_0075343_928_2274 | 447 |
| 1509 | 3300048911 | Ga0496108_0150524 | Ga0496108_0150524_58_1407 | 447 |
| 1510 | 3300048913 | Ga0496110_0009673 | Ga0496110_0009673_2701_4065 | 447 |
| 1511 | 3300048913 | Ga0496110_0011608 | Ga0496110_0011608_63_1412 | 447 |
| 1512 | 3300048914 | Ga0496111_0011805 | Ga0496111_0011805_513_1862 | 447 |
| 1513 | 3300048914 | Ga0496111_0099368 | Ga0496111_0099368_453_1817 | 447 |
| 1514 | 3300049575 | Ga0501039_0037459 | Ga0501039_0037459_834_2192 | 447 |
| 1515 | 3300049586 | Ga0501070_0076909 | Ga0501070_0076909_453_1796 | 447 |
| 1516 | 3300049592 | Ga0501076_0155067 | Ga0501076_0155067_472_1830 | 447 |
| 1517 | 3300049824 | Ga0501045_0080160 | Ga0501045_0080160_726_2084 | 447 |
| 1518 | 3300050492 | nmdc:mga0yw44_37400_c1 | nmdc:mga0yw44_37400_c1_356_1705 | 447 |
| 1519 | 3300050494 | nmdc:mga06z11_49292_c1 | nmdc:mga06z11_49292_c1_302_1666 | 447 |
| 1520 | 3300050495 | nmdc:mga04h51_7778_c1 | nmdc:mga04h51_7778_c1_796_2160 | 447 |
| 1521 | 3300053078 | Ga0495612_0012517 | Ga0495612_0012517_873_2237 | 447 |
| 1522 | 3300053078 | Ga0495612_0057063 | Ga0495612_0057063_18_1382 | 447 |
| 1523 | 3300053084 | Ga0495595_0007305 | Ga0495595_0007305_2131_3495 | 447 |
| 1524 | 3300053085 | Ga0495619_0022642 | Ga0495619_0022642_2079_3443 | 447 |
| 1525 | 3300053088 | Ga0500644_0000090 | Ga0500644_0000090_23817_25190 | 447 |
| 1526 | 3300061719 | Ga0466962_0007440 | Ga0466962_0007440_412_1755 | 447 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oks-assembly1.cif.gz_A | crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis | 0.9958 | 14 | 443 |
| 3q8n-assembly2.cif.gz_B | crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis | 0.9955 | 10 | 444 |
| 3r4t-assembly1.cif.gz_A | crystal structure of 4-aminobutyrate aminotransferase gabt from mycobacterium marinum covalently bound to pyridoxal phosphate | 0.9942 | 10 | 443 |
| 4ffc-assembly1.cif.gz_D | crystal structure of a 4-aminobutyrate aminotransferase (gabt) from mycobacterium abscessus | 0.9919 | 13 | 446 |
| 4atp-assembly1.cif.gz_A | structure of gaba-transaminase a1r958 from arthrobacter aurescens in complex with plp | 0.9916 | 11 | 444 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQ79_74_338_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9915 | 82 | 334 | 3.40.640.10 |
| af_P9WQ79_346_447_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9898 | 345 | 442 | 3.90.1150.10 |
| 1sf2B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9891 | 341 | 444 | 3.90.1150.10 |
| 3oksC01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9838 | 14 | 443 | 3.90.1150.10 |
| 1sf2C02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9689 | 82 | 339 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J6XHC8-F1-model_v4 | Unannotated protein | 0.9989 | 57 | 446 |
GO:0009448
GO:0030170 GO:0034386 GO:0042802 |
| AF-A0A3C1DT72-F1-model_v4 | 4-aminobutyrate--2-oxoglutarate transaminase (EC 2.6.1.19) | 0.9983 | 138 | 389 |
GO:0030170
GO:0034386 GO:0042802 |
| AF-A0A6B3FPI1-F1-model_v4 | Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | 0.9962 | 209 | 312 |
GO:0008483
GO:0030170 GO:0042802 |
| AF-A0A6J6XHC8-F1-model_v4 | Unannotated protein | 0.9938 | 57 | 446 |
GO:0009448
GO:0030170 GO:0034386 GO:0042802 |
| AF-A0A6G9CLW6-F1-model_v4 | Aspartate aminotransferase family protein | 0.9937 | 192 | 446 |
GO:0008483
GO:0030170 GO:0042802 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar