F494567

General Info

Members Datasets Scaffolds Average Seq Length
1526 528 1443 446

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000817|Ga0213875_1000081714
Length 490
Sequence VQAFKGSPCAASGATRPGARRVPSAAGQKTGLFSRYIVLIMTEFAVGGPGLPQQRRLVTEIPGPVSRELMARRSQAVARGVSSTMPVFATAAGGGVIVDADGNSLIDFGSGIAVVSVGNAAPRVVARAAEQAARFTHTCFMVTPYEGYVAVCEELARRTPGDHEKRSALFNSGAEAVENAVKIARYATGRQAVVAFDHAYHGRTNLTMALTAKNMPYKQGFGPFAGEIYRVPMAYPLRWPGGPDACRSDALRVVTELIHTQAGEENVAAVIIEPVQGEGGFIVPPPGFLPGLAEFCARHGIVLIADEIQSGFCRTGDWFACDHEGVVPDMVTTAKGIAGGLPLAAVTGRAEIMDAVHPGGLGGTYGGNPVACAAALGAIETMASEDLAGRARRIGEIMLPRLRKLAEKHPEIADVRGRGAMVAVELTVPGTLEPSPDVAARVARACHRAGLVVLTCGTFYNVLRFLPPLVIGEDLLEEGLSILEDAFSTL

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2527291629 Frankia sp. BMG5.23 Isolate Nodule
3 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
4 2558860280 Kutzneria sp. 744 Isolate Unclassified
5 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
6 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
7 2619618881 Frankia sp. ACN1ag Isolate Unclassified
8 2619619003 Frankia sp. CpI1-P Isolate Nodule
9 2626541554 Frankia sp. AvcI.1 Isolate Nodule
10 2643221546 Microbacterium sp. Root53 Isolate Unclassified
11 2643221576 Nocardioides sp. Root614 Isolate Unclassified
12 2643221590 Nocardioides sp. Root682 Isolate Unclassified
13 2643221615 Nocardioides sp. Root224 Isolate Unclassified
14 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
15 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
16 2643221679 Angustibacter sp. Root456 Isolate Unclassified
17 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
18 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
19 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
20 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
21 2684623036 Frankia sp. CgIM4 Isolate Nodule
22 2687453737 Frankia sp. BMG5.36 Isolate Nodule
23 2710264753 Frankia sp. KB5 Isolate Nodule
24 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
25 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
26 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
27 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
28 2739367653 Kocuria sp. OV113 Isolate Unclassified
29 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
30 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
31 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
32 2773857924 Frankia sp. CgIS1 Isolate Nodule
33 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
34 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
35 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
36 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
37 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
38 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
39 2855683550 Micromonospora sp. RP3T Isolate Unclassified
40 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
41 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
42 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
43 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
44 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
45 2857727296 Kocuria sp. R-72562 Isolate Unclassified
46 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
47 2858868258 Micromonospora sp. MH33 Isolate Unclassified
48 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
49 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
50 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
51 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
52 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
53 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
54 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
55 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
56 2902582711 Micromonospora sp. AP08 Isolate Unclassified
57 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
58 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
59 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
60 2919069694 Microbacterium sp. 1154 Isolate Unclassified
61 2920879853 Kocuria salina CV6 Isolate Unclassified
62 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
63 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
64 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
65 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
66 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
67 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
68 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
69 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
70 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
71 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
72 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
73 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
74 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
75 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
76 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
81 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
84 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
85 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
86 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
87 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
88 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
89 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
90 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
91 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
92 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
93 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
94 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
95 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
100 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
101 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
107 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
108 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
110 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
111 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
112 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
113 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
114 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
115 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
116 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
117 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
118 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
119 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
120 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
121 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
122 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
123 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
124 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
125 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
126 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
127 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
128 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
129 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
130 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
131 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
132 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
133 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
134 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
135 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
136 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
137 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
138 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
139 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
140 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
141 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
142 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
143 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
144 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
145 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
146 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
147 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
148 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
155 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
156 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
157 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
158 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
159 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
160 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
161 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
162 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
163 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
164 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
165 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
166 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
167 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
168 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
169 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
170 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
171 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
172 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
173 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
174 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
175 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
176 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
177 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
178 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
179 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
180 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
181 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
182 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
183 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
184 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
185 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
186 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
187 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
188 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
189 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
190 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
191 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
192 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
193 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
195 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
196 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
197 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
198 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
199 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
200 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
201 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
202 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
203 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
204 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
205 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
206 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
207 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
212 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
213 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
214 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
215 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
278 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
279 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
283 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
284 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
285 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
286 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
287 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
288 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
289 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
290 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
291 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
292 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
293 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
294 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
295 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
296 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
297 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
298 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
299 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
300 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
301 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
302 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
303 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
304 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
305 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
306 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
307 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
308 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
309 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
310 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
311 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
312 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
313 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
314 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
315 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
316 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
317 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
318 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
320 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
321 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
322 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
323 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
324 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
325 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
327 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
328 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
329 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
330 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
331 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
332 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
333 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
334 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
335 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
336 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
337 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
338 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
339 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
340 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
341 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
342 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
343 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
344 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
345 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
346 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
347 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
348 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
349 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
350 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
351 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
352 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
353 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
354 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
355 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
356 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
357 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
358 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
359 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
360 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
361 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
362 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
363 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
364 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
365 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
366 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
367 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
368 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
369 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
370 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
371 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
372 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
373 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
374 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
375 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
376 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
377 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
378 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
379 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
380 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
381 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
382 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
383 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
384 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
385 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
386 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
387 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
388 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
389 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
392 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
393 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
394 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
395 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
396 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
397 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
398 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
399 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
400 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
401 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
407 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
408 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
411 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
412 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
413 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
414 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
415 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
416 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
417 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
418 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
419 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
420 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
421 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
422 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
426 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
427 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
428 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
429 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
430 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
431 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
432 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
433 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
434 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
435 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
436 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
437 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
438 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
439 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
470 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
471 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
472 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
473 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
474 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
475 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
476 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
477 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
478 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
479 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
480 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
481 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
482 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
485 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
486 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
487 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
488 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
489 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
490 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
491 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
492 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
493 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
494 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
495 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
496 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
497 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
498 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
499 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
500 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
501 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
502 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
503 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
504 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
505 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
506 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
507 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
508 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
509 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
510 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
511 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
512 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
513 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
514 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
515 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
516 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
517 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
518 637000116 Frankia casuarinae CcI3 Isolate Nodule
519 649633069 Micromonospora sp. L5 Isolate Unclassified
520 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
521 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
522 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
523 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
524 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
525 8054920844 Frankia tisae Agncl-8 Isolate Nodule
526 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
527 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
528 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.77
Metatranscriptomes 0.79
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 2.88
Nodule 0.79
Rhizoplane 4.91
Rhizosphere 83.09
Stem 0
Stem Tuber 0
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002891 3300000549 Bacteria 2338
2 JGI24735J21928_10017543 3300002067 Bacteria 2213
3 JGI24742J22300_10000738 3300002244 Bacteria 4950
4 JGI24751J29686_10002307 3300002459 Bacteria 3862
5 JGI25406J46586_10011869 3300003203 Bacteria 3803
6 JGI25404J52841_10004701 3300003659 Bacteria 2786
7 Ga0055540_1000151 3300003792 Bacteria 68564
8 Ga0065714_10005169 3300005288 Bacteria 13494
9 Ga0065714_10089059 3300005288 Bacteria 1994
10 Ga0065712_10102081 3300005290 Unclassified 2018
11 Ga0065707_10115361 3300005295 Bacteria 2269
12 Ga0070658_10002566 3300005327 Bacteria 15138
13 Ga0070658_10008436 3300005327 Bacteria 8287
14 Ga0070658_10013145 3300005327 Bacteria 6643
15 Ga0070658_10055535 3300005327 Bacteria 3217
16 Ga0070658_10056797 3300005327 Bacteria 3182
17 Ga0070676_10007535 3300005328 Bacteria 5846
18 Ga0070676_10009094 3300005328 Bacteria 5373
19 Ga0070676_10013240 3300005328 Bacteria 4518
20 Ga0070683_100008479 3300005329 Bacteria 8731
21 Ga0070683_100040518 3300005329 Bacteria 4283
22 Ga0070683_100098967 3300005329 Bacteria 2745
23 Ga0070690_100019006 3300005330 Bacteria 4162
24 Ga0070690_100082287 3300005330 Bacteria 2108
25 Ga0070670_100023299 3300005331 Bacteria 5329
26 Ga0070670_100038542 3300005331 Bacteria 4110
27 Ga0068869_100004828 3300005334 Bacteria 8417
28 Ga0068869_100031873 3300005334 Bacteria 3711
29 Ga0068869_100032174 3300005334 Bacteria 3695
30 Ga0070666_10069723 3300005335 Bacteria 2391
31 Ga0070680_100012295 3300005336 Bacteria 6647
32 Ga0070680_100013556 3300005336 Bacteria 6353
33 Ga0070682_100002099 3300005337 Bacteria 11076
34 Ga0070682_100004601 3300005337 Bacteria 7673
35 Ga0068868_100004201 3300005338 Bacteria 10070
36 Ga0068868_100004550 3300005338 Bacteria 9736
37 Ga0068868_100080677 3300005338 Bacteria 2607
38 Ga0068868_100198584 3300005338 Bacteria 1671
39 Ga0070660_100010741 3300005339 Bacteria 6482
40 Ga0070660_100079459 3300005339 Bacteria 2573
41 Ga0070660_100101530 3300005339 Bacteria 2280
42 Ga0070660_100101912 3300005339 Bacteria 2275
43 Ga0070660_100133600 3300005339 Bacteria 1987
44 Ga0070689_100056212 3300005340 Bacteria 3051
45 Ga0070691_10019439 3300005341 Bacteria 3134
46 Ga0070691_10026776 3300005341 Bacteria 2689
47 Ga0070687_100073648 3300005343 Bacteria 1841
48 Ga0070661_100034296 3300005344 Bacteria 3680
49 Ga0070661_100099719 3300005344 Bacteria 2159
50 Ga0070661_100106607 3300005344 Bacteria 2089
51 Ga0070692_10007890 3300005345 Bacteria 4719
52 Ga0070692_10051972 3300005345 Bacteria 2133
53 Ga0070668_100020218 3300005347 Bacteria 5022
54 Ga0070668_100040980 3300005347 Bacteria 3546
55 Ga0070675_100003751 3300005354 Bacteria 11544
56 Ga0070675_100030129 3300005354 Bacteria 4378
57 Ga0070675_100120429 3300005354 Bacteria 2229
58 Ga0070675_100155834 3300005354 Bacteria 1961
59 Ga0070671_100046235 3300005355 Bacteria 3620
60 Ga0070671_100056340 3300005355 Bacteria 3270
61 Ga0070674_100084710 3300005356 Bacteria 2273
62 Ga0070673_100056609 3300005364 Bacteria 3094
63 Ga0070673_100117278 3300005364 Bacteria 2215
64 Ga0070688_100028259 3300005365 Bacteria 3346
65 Ga0070688_100064023 3300005365 Bacteria 2332
66 Ga0070659_100005597 3300005366 Bacteria 9029
67 Ga0070659_100017222 3300005366 Bacteria 5433
68 Ga0070659_100020191 3300005366 Bacteria 5058
69 Ga0070659_100041213 3300005366 Bacteria 3608
70 Ga0070659_100064120 3300005366 Bacteria 2907
71 Ga0070659_100116379 3300005366 Bacteria 2161
72 Ga0070659_100144114 3300005366 Bacteria 1940
73 Ga0070667_100000274 3300005367 Bacteria 58415
74 Ga0070667_100001524 3300005367 Bacteria 20730
75 Ga0070667_100009171 3300005367 Bacteria 8192
76 Ga0070667_100022147 3300005367 Bacteria 5272
77 Ga0070667_100103299 3300005367 Bacteria 2463
78 Ga0070709_10000165 3300005434 Bacteria 41860
79 Ga0070709_10002330 3300005434 Bacteria 10293
80 Ga0070709_10018668 3300005434 Bacteria 3999
81 Ga0070709_10042489 3300005434 Bacteria 2808
82 Ga0070709_10053489 3300005434 Bacteria 2542
83 Ga0070714_100000011 3300005435 Bacteria 231268
84 Ga0070714_100000434 3300005435 Bacteria 30291
85 Ga0070714_100002703 3300005435 Bacteria 13066
86 Ga0070714_100008744 3300005435 Bacteria 7916
87 Ga0070714_100022873 3300005435 Bacteria 5129
88 Ga0070714_100051017 3300005435 Bacteria 3527
89 Ga0070714_100275073 3300005435 Bacteria 1563
90 Ga0070713_100002252 3300005436 Bacteria 12524
91 Ga0070713_100003155 3300005436 Bacteria 10854
92 Ga0070713_100017302 3300005436 Bacteria 5448
93 Ga0070713_100019979 3300005436 Bacteria 5127
94 Ga0070713_100026414 3300005436 Bacteria 4558
95 Ga0070713_100258183 3300005436 Bacteria 1592
96 Ga0070710_10000171 3300005437 Bacteria 29726
97 Ga0070710_10000463 3300005437 Bacteria 19074
98 Ga0070710_10002152 3300005437 Bacteria 9322
99 Ga0070710_10006810 3300005437 Bacteria 5512
100 Ga0070710_10033019 3300005437 Bacteria 2808
101 Ga0070710_10151189 3300005437 Bacteria 1432
102 Ga0070701_10016314 3300005438 Bacteria 3450
103 Ga0070701_10033478 3300005438 Bacteria 2568
104 Ga0070701_10064642 3300005438 Bacteria 1940
105 Ga0070711_100025824 3300005439 Bacteria 3845
106 Ga0070711_100029945 3300005439 Bacteria 3598
107 Ga0070705_100014840 3300005440 Bacteria 4017
108 Ga0070705_100057691 3300005440 Bacteria 2291
109 Ga0070700_100003624 3300005441 Bacteria 7989
110 Ga0070700_100022011 3300005441 Bacteria 3711
111 Ga0070694_100005751 3300005444 Bacteria 7525
112 Ga0070708_100226332 3300005445 Bacteria 1755
113 Ga0070663_100068386 3300005455 Bacteria 2579
114 Ga0070678_100032623 3300005456 Bacteria 3606
115 Ga0070678_100035992 3300005456 Bacteria 3462
116 Ga0070662_100014295 3300005457 Bacteria 5300
117 Ga0070662_100194584 3300005457 Bacteria 1606
118 Ga0070681_10103138 3300005458 Bacteria 2797
119 Ga0070681_10131380 3300005458 Bacteria 2436
120 Ga0068867_100106614 3300005459 Bacteria 2147
121 Ga0070685_10002766 3300005466 Bacteria 8969
122 Ga0070685_10021688 3300005466 Unclassified 3494
123 Ga0070685_10044787 3300005466 Unclassified 2534
124 Ga0070685_10140487 3300005466 Bacteria 1520
125 Ga0070706_100001237 3300005467 Bacteria 27336
126 Ga0070706_100004718 3300005467 Bacteria 13070
127 Ga0070706_100006955 3300005467 Bacteria 10670
128 Ga0070706_100009075 3300005467 Bacteria 9259
129 Ga0070706_100033151 3300005467 Bacteria 4766
130 Ga0070706_100053432 3300005467 Bacteria 3729
131 Ga0070707_100000043 3300005468 Bacteria 108893
132 Ga0070707_100001600 3300005468 Bacteria 21940
133 Ga0070707_100005735 3300005468 Bacteria 11584
134 Ga0070707_100031950 3300005468 Bacteria 5015
135 Ga0070707_100039318 3300005468 Bacteria 4520
136 Ga0070707_100185944 3300005468 Bacteria 2026
137 Ga0070698_100000072 3300005471 Bacteria 75715
138 Ga0070698_100000718 3300005471 Bacteria 35574
139 Ga0070698_100001150 3300005471 Bacteria 29264
140 Ga0070698_100004671 3300005471 Bacteria 15059
141 Ga0070698_100005554 3300005471 Bacteria 13783
142 Ga0070698_100012415 3300005471 Bacteria 9020
143 Ga0070698_100073119 3300005471 Bacteria 3435
144 Ga0070679_100029150 3300005530 Bacteria 5444
145 Ga0070679_100046281 3300005530 Bacteria 4336
146 Ga0070679_100047220 3300005530 Bacteria 4292
147 Ga0070679_100139525 3300005530 Bacteria 2404
148 Ga0070679_100205955 3300005530 Bacteria 1932
149 Ga0070684_100002011 3300005535 Bacteria 14959
150 Ga0070684_100023514 3300005535 Bacteria 5157
151 Ga0070684_100024465 3300005535 Bacteria 5066
152 Ga0070684_100034101 3300005535 Bacteria 4350
153 Ga0070684_100126666 3300005535 Bacteria 2301
154 Ga0070684_100136438 3300005535 Bacteria 2216
155 Ga0070684_100193870 3300005535 Bacteria 1849
156 Ga0070697_100092625 3300005536 Bacteria 2501
157 Ga0068853_100005343 3300005539 Bacteria 10057
158 Ga0068853_100008349 3300005539 Bacteria 8313
159 Ga0068853_100165585 3300005539 Bacteria 1997
160 Ga0070672_100052179 3300005543 Bacteria 3192
161 Ga0070686_100015848 3300005544 Bacteria 4376
162 Ga0070686_100042436 3300005544 Bacteria 2849
163 Ga0070686_100044871 3300005544 Bacteria 2781
164 Ga0070695_100015011 3300005545 Bacteria 4673
165 Ga0070696_100012182 3300005546 Bacteria 5763
166 Ga0070693_100004316 3300005547 Bacteria 6711
167 Ga0070693_100124834 3300005547 Bacteria 1601
168 Ga0070665_100006685 3300005548 Bacteria 11724
169 Ga0070665_100031508 3300005548 Bacteria 5337
170 Ga0070665_100032143 3300005548 Bacteria 5281
171 Ga0070665_100062684 3300005548 Bacteria 3727
172 Ga0070665_100155578 3300005548 Bacteria 2288
173 Ga0070704_100002347 3300005549 Bacteria 10618
174 Ga0070704_100003385 3300005549 Bacteria 9138
175 Ga0068855_100003043 3300005563 Bacteria 20537
176 Ga0068855_100004547 3300005563 Bacteria 16940
177 Ga0068855_100006713 3300005563 Bacteria 13966
178 Ga0068855_100016017 3300005563 Bacteria 9018
179 Ga0068855_100054597 3300005563 Bacteria 4696
180 Ga0068855_100062487 3300005563 Bacteria 4347
181 Ga0068855_100086849 3300005563 Bacteria 3616
182 Ga0068855_100116992 3300005563 Bacteria 3055
183 Ga0068855_100133514 3300005563 Bacteria 2833
184 Ga0068855_100144212 3300005563 Bacteria 2712
185 Ga0068855_100148108 3300005563 Bacteria 2671
186 Ga0068855_100209765 3300005563 Bacteria 2189
187 Ga0068855_100280728 3300005563 Bacteria 1849
188 Ga0068855_100295895 3300005563 Bacteria 1793
189 Ga0070664_100001657 3300005564 Bacteria 17808
190 Ga0070664_100013266 3300005564 Bacteria 6711
191 Ga0070664_100095244 3300005564 Bacteria 2582
192 Ga0068857_100003425 3300005577 Bacteria 13229
193 Ga0068857_100006889 3300005577 Bacteria 9784
194 Ga0068857_100015539 3300005577 Bacteria 6651
195 Ga0068857_100142969 3300005577 Bacteria 2163
196 Ga0068857_100165186 3300005577 Bacteria 2010
197 Ga0068854_100007727 3300005578 Bacteria 6873
198 Ga0068854_100036762 3300005578 Bacteria 3434
199 Ga0068854_100051958 3300005578 Bacteria 2937
200 Ga0068856_100005605 3300005614 Bacteria 12355
201 Ga0068856_100013115 3300005614 Bacteria 8029
202 Ga0068856_100022233 3300005614 Bacteria 6165
203 Ga0068856_100045686 3300005614 Bacteria 4313
204 Ga0068856_100054151 3300005614 Bacteria 3957
205 Ga0070702_100003327 3300005615 Bacteria 7172
206 Ga0070702_100033771 3300005615 Bacteria 2815
207 Ga0070702_100036204 3300005615 Bacteria 2732
208 Ga0070702_100039852 3300005615 Bacteria 2624
209 Ga0068852_100005871 3300005616 Bacteria 8822
210 Ga0068852_100008555 3300005616 Bacteria 7547
211 Ga0068852_100015780 3300005616 Bacteria 5873
212 Ga0068852_100027507 3300005616 Bacteria 4636
213 Ga0068852_100031952 3300005616 Bacteria 4353
214 Ga0068852_100040501 3300005616 Bacteria 3931
215 Ga0068852_100139191 3300005616 Bacteria 2244
216 Ga0068852_100203944 3300005616 Bacteria 1872
217 Ga0068859_100012755 3300005617 Bacteria 8446
218 Ga0068859_100015246 3300005617 Bacteria 7718
219 Ga0068859_100020598 3300005617 Bacteria 6617
220 Ga0068859_100208887 3300005617 Bacteria 2038
221 Ga0068864_100012916 3300005618 Bacteria 6910
222 Ga0068864_100190358 3300005618 Bacteria 1880
223 Ga0068866_10005193 3300005718 Bacteria 5363
224 Ga0068861_100017127 3300005719 Bacteria 5137
225 Ga0068861_100057183 3300005719 Bacteria 2979
226 Ga0068851_10000005 3300005834 Bacteria 262808
227 Ga0068851_10062942 3300005834 Bacteria 1904
228 Ga0068870_10000471 3300005840 Bacteria 15325
229 Ga0068870_10020159 3300005840 Bacteria 3243
230 Ga0068863_100004781 3300005841 Bacteria 13343
231 Ga0068863_100014598 3300005841 Bacteria 7562
232 Ga0068863_100027875 3300005841 Bacteria 5391
233 Ga0068863_100041663 3300005841 Bacteria 4366
234 Ga0068858_100000058 3300005842 Bacteria 117238
235 Ga0068858_100031487 3300005842 Bacteria 4927
236 Ga0068858_100080479 3300005842 Bacteria 3027
237 Ga0068858_100202669 3300005842 Bacteria 1876
238 Ga0068860_100000451 3300005843 Bacteria 51981
239 Ga0068860_100020377 3300005843 Bacteria 6423
240 Ga0068860_100031992 3300005843 Bacteria 5058
241 Ga0068860_100048640 3300005843 Bacteria 4041
242 Ga0068862_100013889 3300005844 Bacteria 6676
243 Ga0068862_100095958 3300005844 Bacteria 2587
244 Ga0081455_10003611 3300005937 Bacteria 17731
245 Ga0081455_10015161 3300005937 Bacteria 7500
246 Ga0081455_10104478 3300005937 Bacteria 2266
247 Ga0081540_1000058 3300005983 Bacteria 120635
248 Ga0081540_1000120 3300005983 Bacteria 83032
249 Ga0081540_1001571 3300005983 Bacteria 19515
250 Ga0081540_1013835 3300005983 Bacteria 5218
251 Ga0081540_1017505 3300005983 Bacteria 4434
252 Ga0081540_1044975 3300005983 Bacteria 2247
253 Ga0081539_10000846 3300005985 Bacteria 58555
254 Ga0081539_10001386 3300005985 Bacteria 41825
255 Ga0081539_10004997 3300005985 Bacteria 14019
256 Ga0081539_10018904 3300005985 Bacteria 4747
257 Ga0081539_10050241 3300005985 Bacteria 2360
258 Ga0070717_10016290 3300006028 Bacteria 5761
259 Ga0070717_10056734 3300006028 Bacteria 3237
260 Ga0070717_10130606 3300006028 Bacteria 2160
261 Ga0075365_10004303 3300006038 Bacteria 7516
262 Ga0075365_10028765 3300006038 Bacteria 3546
263 Ga0075365_10054164 3300006038 Bacteria 2659
264 Ga0075368_10002325 3300006042 Bacteria 6175
265 Ga0075363_100010515 3300006048 Bacteria 4400
266 Ga0075363_100030288 3300006048 Bacteria 2800
267 Ga0075363_100060382 3300006048 Bacteria 2041
268 Ga0075364_10002585 3300006051 Bacteria 10145
269 Ga0075364_10013755 3300006051 Bacteria 4984
270 Ga0075364_10014100 3300006051 Bacteria 4932
271 Ga0070715_10003185 3300006163 Bacteria 5163
272 Ga0070715_10003914 3300006163 Bacteria 4817
273 Ga0070716_100003680 3300006173 Bacteria 7255
274 Ga0070716_100004282 3300006173 Bacteria 6799
275 Ga0070716_100098018 3300006173 Bacteria 1790
276 Ga0070712_100011158 3300006175 Bacteria 5686
277 Ga0070712_100014200 3300006175 Bacteria 5112
278 Ga0070712_100019304 3300006175 Bacteria 4444
279 Ga0070712_100023628 3300006175 Bacteria 4063
280 Ga0075367_10001320 3300006178 Bacteria 10513
281 Ga0097621_100008180 3300006237 Bacteria 7522
282 Ga0097621_100027509 3300006237 Bacteria 4473
283 Ga0097621_100052359 3300006237 Bacteria 3326
284 Ga0075370_10001552 3300006353 Bacteria 10058
285 Ga0068871_100073400 3300006358 Bacteria 2821
286 Ga0075428_100002554 3300006844 Bacteria 19788
287 Ga0075428_100080788 3300006844 Bacteria 3548
288 Ga0075430_100003453 3300006846 Bacteria 13222
289 Ga0075430_100047619 3300006846 Bacteria 3621
290 Ga0075431_100000676 3300006847 Bacteria 29173
291 Ga0075431_100010144 3300006847 Bacteria 9468
292 Ga0075431_100037448 3300006847 Bacteria 4996
293 Ga0075431_100055387 3300006847 Bacteria 4090
294 Ga0075431_100094076 3300006847 Bacteria 3093
295 Ga0075433_10003602 3300006852 Bacteria 11968
296 Ga0075433_10020156 3300006852 Bacteria 5569
297 Ga0075434_100001339 3300006871 Bacteria 20648
298 Ga0075434_100034046 3300006871 Bacteria 5029
299 Ga0075434_100065272 3300006871 Bacteria 3625
300 Ga0075429_100001358 3300006880 Bacteria 20005
301 Ga0075429_100002730 3300006880 Bacteria 14898
302 Ga0075436_100011469 3300006914 Bacteria 6083
303 Ga0075436_100016125 3300006914 Bacteria 5115
304 Ga0075436_100031803 3300006914 Bacteria 3636
305 Ga0097620_100012754 3300006931 Bacteria 8446
306 Ga0097620_100015246 3300006931 Bacteria 7718
307 Ga0097620_100020599 3300006931 Bacteria 6617
308 Ga0097620_100208887 3300006931 Bacteria 2038
309 Ga0075435_100048134 3300007076 Bacteria 3424
310 Ga0105240_10009128 3300009093 Bacteria 14078
311 Ga0105240_10021145 3300009093 Bacteria 8662
312 Ga0105240_10064152 3300009093 Bacteria 4565
313 Ga0105240_10122631 3300009093 Bacteria 3128
314 Ga0105240_10196807 3300009093 Bacteria 2365
315 Ga0111539_10007834 3300009094 Bacteria 13642
316 Ga0111539_10016741 3300009094 Bacteria 9086
317 Ga0111539_10165209 3300009094 Bacteria 2588
318 Ga0105245_10002916 3300009098 Bacteria 15349
319 Ga0105245_10026061 3300009098 Bacteria 5144
320 Ga0105245_10066101 3300009098 Bacteria 3272
321 Ga0105245_10195087 3300009098 Bacteria 1942
322 Ga0105245_10255111 3300009098 Bacteria 1705
323 Ga0105247_10016500 3300009101 Bacteria 4427
324 Ga0114129_10000459 3300009147 Bacteria 48751
325 Ga0114129_10003492 3300009147 Bacteria 22098
326 Ga0114129_10011584 3300009147 Bacteria 12556
327 Ga0114129_10220626 3300009147 Bacteria 2558
328 Ga0105243_10006996 3300009148 Bacteria 8685
329 Ga0105243_10013454 3300009148 Bacteria 6187
330 Ga0105243_10063408 3300009148 Bacteria 2961
331 Ga0105243_10129134 3300009148 Bacteria 2142
332 Ga0105243_10181781 3300009148 Bacteria 1829
333 Ga0105241_10000772 3300009174 Bacteria 24349
334 Ga0105241_10003418 3300009174 Bacteria 11818
335 Ga0105241_10041881 3300009174 Bacteria 3462
336 Ga0105241_10153317 3300009174 Bacteria 1887
337 Ga0105242_10009563 3300009176 Bacteria 7429
338 Ga0105242_10017039 3300009176 Bacteria 5657
339 Ga0105242_10035350 3300009176 Bacteria 4008
340 Ga0105248_10000784 3300009177 Bacteria 35696
341 Ga0105248_10046208 3300009177 Bacteria 4880
342 Ga0105248_10056078 3300009177 Bacteria 4420
343 Ga0105248_10100427 3300009177 Bacteria 3261
344 Ga0105237_10002853 3300009545 Bacteria 21014
345 Ga0105237_10025822 3300009545 Bacteria 6006
346 Ga0105237_10035761 3300009545 Bacteria 5025
347 Ga0105237_10051012 3300009545 Bacteria 4157
348 Ga0105237_10062059 3300009545 Bacteria 3736
349 Ga0105237_10098934 3300009545 Bacteria 2908
350 Ga0105238_10011164 3300009551 Bacteria 9034
351 Ga0105238_10132824 3300009551 Bacteria 2467
352 Ga0105238_10210488 3300009551 Bacteria 1920
353 Ga0105249_10011505 3300009553 Bacteria 7773
354 Ga0105249_10020772 3300009553 Bacteria 5872
355 Ga0105249_10077841 3300009553 Bacteria 3076
356 Ga0105249_10138850 3300009553 Bacteria 2328
357 Ga0105239_10002033 3300010375 Bacteria 26242
358 Ga0105239_10005653 3300010375 Bacteria 14609
359 Ga0105239_10009408 3300010375 Bacteria 11019
360 Ga0105239_10028033 3300010375 Bacteria 6197
361 Ga0105239_10063730 3300010375 Bacteria 4047
362 Ga0105239_10393219 3300010375 Bacteria 1568
363 Ga0105246_10015649 3300011119 Bacteria 4792
364 Ga0105246_10072017 3300011119 Bacteria 2435
365 Ga0105246_10120991 3300011119 Bacteria 1940
366 Ga0157373_10032874 3300013100 Bacteria 3733
367 Ga0157371_10043457 3300013102 Bacteria 3201
368 Ga0157371_10072602 3300013102 Bacteria 2437
369 Ga0157370_10004680 3300013104 Bacteria 15608
370 Ga0157370_10030047 3300013104 Bacteria 5326
371 Ga0157370_10033203 3300013104 Bacteria 5031
372 Ga0157370_10138642 3300013104 Bacteria 2266
373 Ga0157370_10224709 3300013104 Bacteria 1738
374 Ga0157369_10000631 3300013105 Bacteria 45670
375 Ga0157369_10039681 3300013105 Bacteria 5144
376 Ga0157369_10040006 3300013105 Bacteria 5121
377 Ga0157369_10092850 3300013105 Bacteria 3222
378 Ga0157369_10163930 3300013105 Bacteria 2345
379 Ga0157374_10004456 3300013296 Bacteria 11758
380 Ga0157374_10024129 3300013296 Bacteria 5449
381 Ga0157374_10101872 3300013296 Bacteria 2753
382 Ga0157374_10111570 3300013296 Bacteria 2631
383 Ga0157378_10016267 3300013297 Bacteria 6514
384 Ga0157378_10115653 3300013297 Bacteria 2465
385 Ga0157378_10288786 3300013297 Bacteria 1583
386 Ga0163162_10009743 3300013306 Bacteria 9352
387 Ga0163162_10010744 3300013306 Bacteria 8907
388 Ga0163162_10305408 3300013306 Bacteria 1723
389 Ga0157372_10000006 3300013307 Bacteria 354669
390 Ga0157372_10014423 3300013307 Bacteria 8453
391 Ga0157372_10025730 3300013307 Bacteria 6402
392 Ga0157372_10104477 3300013307 Bacteria 3238
393 Ga0157375_10063593 3300013308 Bacteria 3672
394 Ga0157375_10065285 3300013308 Bacteria 3628
395 Ga0157375_10144658 3300013308 Bacteria 2507
396 Ga0157375_10187845 3300013308 Bacteria 2220
397 Ga0163163_10001963 3300014325 Bacteria 17382
398 Ga0163163_10008595 3300014325 Bacteria 9079
399 Ga0163163_10105894 3300014325 Bacteria 2838
400 Ga0157380_10091050 3300014326 Bacteria 2517
401 Ga0157380_10128422 3300014326 Bacteria 2159
402 Ga0182008_10027165 3300014497 Bacteria 2901
403 Ga0182008_10084003 3300014497 Bacteria 1568
404 Ga0182008_10089599 3300014497 Bacteria 1516
405 Ga0157377_10003806 3300014745 Bacteria 6855
406 Ga0157377_10004860 3300014745 Bacteria 6248
407 Ga0157377_10028980 3300014745 Bacteria 2985
408 Ga0157377_10082550 3300014745 Bacteria 1882
409 Ga0157379_10004864 3300014968 Bacteria 11538
410 Ga0157379_10006071 3300014968 Bacteria 10405
411 Ga0157379_10017719 3300014968 Bacteria 6275
412 Ga0157379_10067044 3300014968 Bacteria 3209
413 Ga0157376_10074672 3300014969 Bacteria 2891
414 Ga0157376_10099772 3300014969 Unclassified 2534
415 Ga0157376_10222520 3300014969 Bacteria 1749
416 Ga0163161_10007930 3300017792 Bacteria 7350
417 Ga0163161_10020533 3300017792 Bacteria 4636
418 Ga0163161_10038949 3300017792 Bacteria 3411
419 Ga0163161_10077287 3300017792 Bacteria 2445
420 Ga0197907_10116683 3300020069 Bacteria 2334
421 Ga0206351_10892666 3300020077 Bacteria 5622
422 Ga0206354_10860617 3300020081 Bacteria 3538
423 Ga0206353_10474610 3300020082 Bacteria 1859
424 Ga0206353_10717049 3300020082 Bacteria 3676
425 Ga0206353_11102129 3300020082 Bacteria 3327
426 Ga0213873_10000163 3300021358 Bacteria 12443
427 Ga0213876_10019674 3300021384 Bacteria 3566
428 Ga0213875_10000817 3300021388 Bacteria 23214
429 Ga0213875_10002928 3300021388 Bacteria 9960
430 Ga0213875_10003242 3300021388 Bacteria 9334
431 Ga0213875_10005790 3300021388 Bacteria 6578
432 Ga0224712_10001022 3300022467 Bacteria 6122
433 Ga0224712_10051737 3300022467 Bacteria 1601
434 Ga0209148_1000907 3300025254 Bacteria 20039
435 Ga0209051_1000075 3300025303 Bacteria 205011
436 Ga0207656_10000001 3300025321 Bacteria 1323684
437 Ga0207656_10000003 3300025321 Bacteria 771644
438 Ga0207656_10000004 3300025321 Bacteria 632320
439 Ga0207655_1004585 3300025728 Bacteria 9731
440 Ga0207692_10000523 3300025898 Bacteria 13619
441 Ga0207692_10003276 3300025898 Bacteria 6308
442 Ga0207692_10009178 3300025898 Bacteria 4120
443 Ga0207692_10012558 3300025898 Bacteria 3641
444 Ga0207692_10034204 3300025898 Bacteria 2459
445 Ga0207642_10006583 3300025899 Bacteria 3874
446 Ga0207642_10077937 3300025899 Bacteria 1600
447 Ga0207710_10014744 3300025900 Bacteria 3299
448 Ga0207688_10001124 3300025901 Bacteria 13757
449 Ga0207688_10001953 3300025901 Bacteria 11045
450 Ga0207688_10002486 3300025901 Bacteria 9918
451 Ga0207688_10012847 3300025901 Bacteria 4552
452 Ga0207688_10035841 3300025901 Bacteria 2749
453 Ga0207688_10036234 3300025901 Bacteria 2735
454 Ga0207688_10041401 3300025901 Bacteria 2562
455 Ga0207680_10004471 3300025903 Bacteria 6631
456 Ga0207680_10031683 3300025903 Bacteria 2997
457 Ga0207680_10051419 3300025903 Bacteria 2464
458 Ga0207680_10110254 3300025903 Bacteria 1784
459 Ga0207647_10026494 3300025904 Bacteria 3793
460 Ga0207647_10040660 3300025904 Bacteria 2927
461 Ga0207699_10000393 3300025906 Bacteria 22711
462 Ga0207699_10016294 3300025906 Bacteria 3885
463 Ga0207699_10028655 3300025906 Bacteria 3097
464 Ga0207699_10040045 3300025906 Bacteria 2697
465 Ga0207643_10001695 3300025908 Bacteria 12362
466 Ga0207643_10028173 3300025908 Bacteria 3118
467 Ga0207705_10004458 3300025909 Bacteria 10575
468 Ga0207705_10030066 3300025909 Bacteria 3874
469 Ga0207705_10091463 3300025909 Bacteria 2228
470 Ga0207705_10140811 3300025909 Bacteria 1801
471 Ga0207684_10002760 3300025910 Bacteria 17486
472 Ga0207684_10006264 3300025910 Bacteria 10862
473 Ga0207684_10034871 3300025910 Bacteria 4274
474 Ga0207684_10047506 3300025910 Bacteria 3640
475 Ga0207684_10054822 3300025910 Bacteria 3383
476 Ga0207684_10059824 3300025910 Bacteria 3235
477 Ga0207654_10000003 3300025911 Bacteria 1030378
478 Ga0207654_10059581 3300025911 Bacteria 2227
479 Ga0207707_10129896 3300025912 Bacteria 2204
480 Ga0207707_10236968 3300025912 Bacteria 1587
481 Ga0207695_10001477 3300025913 Bacteria 39315
482 Ga0207695_10013965 3300025913 Bacteria 9543
483 Ga0207695_10014175 3300025913 Bacteria 9458
484 Ga0207695_10025708 3300025913 Bacteria 6585
485 Ga0207695_10050781 3300025913 Bacteria 4360
486 Ga0207695_10083572 3300025913 Bacteria 3225
487 Ga0207671_10000001 3300025914 Bacteria 1318881
488 Ga0207671_10000445 3300025914 Bacteria 57046
489 Ga0207671_10034894 3300025914 Bacteria 3736
490 Ga0207671_10057228 3300025914 Bacteria 2890
491 Ga0207671_10083588 3300025914 Bacteria 2397
492 Ga0207671_10085080 3300025914 Bacteria 2376
493 Ga0207693_10004329 3300025915 Bacteria 12016
494 Ga0207693_10008492 3300025915 Bacteria 8408
495 Ga0207693_10018010 3300025915 Bacteria 5629
496 Ga0207693_10033132 3300025915 Bacteria 4078
497 Ga0207663_10002048 3300025916 Bacteria 9599
498 Ga0207663_10122342 3300025916 Bacteria 1784
499 Ga0207660_10053263 3300025917 Bacteria 2883
500 Ga0207660_10078396 3300025917 Bacteria 2421
501 Ga0207660_10167495 3300025917 Bacteria 1699
502 Ga0207662_10066563 3300025918 Bacteria 2171
503 Ga0207657_10003219 3300025919 Bacteria 17487
504 Ga0207657_10008017 3300025919 Bacteria 10770
505 Ga0207657_10019911 3300025919 Bacteria 6359
506 Ga0207657_10022980 3300025919 Bacteria 5818
507 Ga0207657_10083944 3300025919 Bacteria 2671
508 Ga0207657_10099648 3300025919 Bacteria 2413
509 Ga0207657_10172647 3300025919 Bacteria 1751
510 Ga0207649_10019926 3300025920 Bacteria 3840
511 Ga0207652_10062722 3300025921 Bacteria 3212
512 Ga0207652_10078970 3300025921 Bacteria 2874
513 Ga0207652_10159508 3300025921 Bacteria 2022
514 Ga0207646_10000455 3300025922 Bacteria 54634
515 Ga0207646_10009604 3300025922 Bacteria 9543
516 Ga0207646_10012030 3300025922 Bacteria 8337
517 Ga0207646_10058309 3300025922 Bacteria 3448
518 Ga0207646_10200697 3300025922 Bacteria 1801
519 Ga0207681_10112658 3300025923 Bacteria 1982
520 Ga0207694_10000039 3300025924 Bacteria 186164
521 Ga0207694_10012986 3300025924 Bacteria 6271
522 Ga0207650_10046281 3300025925 Bacteria 3204
523 Ga0207659_10002929 3300025926 Bacteria 10167
524 Ga0207659_10036838 3300025926 Bacteria 3392
525 Ga0207687_10018558 3300025927 Bacteria 4595
526 Ga0207687_10020145 3300025927 Bacteria 4424
527 Ga0207687_10020433 3300025927 Bacteria 4392
528 Ga0207687_10040450 3300025927 Bacteria 3195
529 Ga0207700_10000029 3300025928 Bacteria 132615
530 Ga0207700_10001933 3300025928 Bacteria 11790
531 Ga0207700_10002047 3300025928 Bacteria 11530
532 Ga0207700_10010489 3300025928 Bacteria 5851
533 Ga0207700_10023791 3300025928 Bacteria 4232
534 Ga0207700_10026278 3300025928 Bacteria 4058
535 Ga0207700_10052281 3300025928 Bacteria 3054
536 Ga0207700_10064913 3300025928 Bacteria 2783
537 Ga0207700_10078908 3300025928 Bacteria 2562
538 Ga0207700_10079066 3300025928 Bacteria 2560
539 Ga0207664_10000001 3300025929 Bacteria 724213
540 Ga0207664_10000110 3300025929 Bacteria 72637
541 Ga0207664_10000648 3300025929 Bacteria 24123
542 Ga0207664_10001639 3300025929 Bacteria 14743
543 Ga0207664_10009269 3300025929 Bacteria 6898
544 Ga0207664_10018463 3300025929 Bacteria 5136
545 Ga0207664_10019628 3300025929 Bacteria 4999
546 Ga0207664_10050041 3300025929 Bacteria 3293
547 Ga0207664_10066907 3300025929 Bacteria 2881
548 Ga0207664_10069855 3300025929 Bacteria 2825
549 Ga0207664_10095245 3300025929 Bacteria 2449
550 Ga0207664_10136096 3300025929 Bacteria 2073
551 Ga0207690_10001473 3300025932 Bacteria 14697
552 Ga0207690_10057859 3300025932 Bacteria 2620
553 Ga0207690_10082994 3300025932 Bacteria 2242
554 Ga0207706_10019341 3300025933 Bacteria 6125
555 Ga0207706_10028367 3300025933 Bacteria 4999
556 Ga0207706_10043648 3300025933 Bacteria 3973
557 Ga0207686_10001569 3300025934 Bacteria 12891
558 Ga0207686_10067540 3300025934 Bacteria 2288
559 Ga0207709_10003866 3300025935 Bacteria 8771
560 Ga0207709_10009207 3300025935 Bacteria 5439
561 Ga0207709_10014342 3300025935 Bacteria 4375
562 Ga0207665_10000995 3300025939 Bacteria 19125
563 Ga0207665_10002740 3300025939 Bacteria 11815
564 Ga0207665_10004600 3300025939 Bacteria 9162
565 Ga0207665_10005087 3300025939 Bacteria 8775
566 Ga0207665_10008216 3300025939 Bacteria 6891
567 Ga0207665_10012993 3300025939 Bacteria 5472
568 Ga0207665_10061089 3300025939 Bacteria 2553
569 Ga0207691_10069059 3300025940 Bacteria 3192
570 Ga0207691_10078880 3300025940 Bacteria 2964
571 Ga0207691_10207000 3300025940 Bacteria 1706
572 Ga0207711_10000881 3300025941 Bacteria 29003
573 Ga0207711_10015199 3300025941 Bacteria 6392
574 Ga0207711_10021967 3300025941 Bacteria 5332
575 Ga0207689_10000812 3300025942 Bacteria 30156
576 Ga0207689_10002842 3300025942 Bacteria 15975
577 Ga0207689_10021795 3300025942 Bacteria 5387
578 Ga0207689_10042117 3300025942 Bacteria 3779
579 Ga0207689_10102201 3300025942 Bacteria 2354
580 Ga0207661_10017684 3300025944 Bacteria 5283
581 Ga0207661_10054690 3300025944 Bacteria 3199
582 Ga0207661_10056544 3300025944 Bacteria 3150
583 Ga0207661_10095635 3300025944 Bacteria 2484
584 Ga0207679_10004464 3300025945 Bacteria 8720
585 Ga0207679_10009676 3300025945 Bacteria 6179
586 Ga0207667_10002609 3300025949 Bacteria 22348
587 Ga0207667_10016601 3300025949 Bacteria 8310
588 Ga0207667_10018589 3300025949 Bacteria 7789
589 Ga0207667_10026581 3300025949 Bacteria 6318
590 Ga0207667_10081943 3300025949 Bacteria 3342
591 Ga0207667_10104838 3300025949 Bacteria 2917
592 Ga0207667_10109884 3300025949 Bacteria 2844
593 Ga0207667_10229988 3300025949 Bacteria 1899
594 Ga0207667_10236499 3300025949 Bacteria 1870
595 Ga0207651_10163247 3300025960 Bacteria 1749
596 Ga0207712_10000976 3300025961 Bacteria 20527
597 Ga0207712_10017414 3300025961 Bacteria 4666
598 Ga0207712_10056219 3300025961 Bacteria 2772
599 Ga0207668_10028789 3300025972 Bacteria 3636
600 Ga0207640_10057688 3300025981 Bacteria 2555
601 Ga0207658_10000423 3300025986 Bacteria 40097
602 Ga0207658_10013608 3300025986 Bacteria 5565
603 Ga0207658_10044590 3300025986 Bacteria 3229
604 Ga0207677_10010033 3300026023 Bacteria 5344
605 Ga0207677_10043878 3300026023 Bacteria 2975
606 Ga0207677_10124562 3300026023 Bacteria 1945
607 Ga0207703_10000026 3300026035 Bacteria 211591
608 Ga0207703_10071745 3300026035 Bacteria 2861
609 Ga0207703_10154816 3300026035 Bacteria 2002
610 Ga0207703_10193937 3300026035 Bacteria 1801
611 Ga0207639_10021897 3300026041 Bacteria 4596
612 Ga0207639_10075785 3300026041 Bacteria 2646
613 Ga0207639_10223339 3300026041 Bacteria 1628
614 Ga0207678_10001903 3300026067 Bacteria 19059
615 Ga0207678_10005054 3300026067 Bacteria 11834
616 Ga0207678_10006493 3300026067 Bacteria 10380
617 Ga0207678_10023040 3300026067 Bacteria 5449
618 Ga0207678_10023107 3300026067 Bacteria 5441
619 Ga0207678_10025591 3300026067 Bacteria 5151
620 Ga0207678_10039000 3300026067 Bacteria 4124
621 Ga0207678_10077611 3300026067 Bacteria 2845
622 Ga0207678_10127003 3300026067 Bacteria 2175
623 Ga0207708_10000002 3300026075 Bacteria 411071
624 Ga0207708_10009740 3300026075 Bacteria 7129
625 Ga0207708_10013892 3300026075 Bacteria 6019
626 Ga0207708_10028771 3300026075 Bacteria 4208
627 Ga0207702_10001341 3300026078 Bacteria 24610
628 Ga0207702_10006747 3300026078 Bacteria 9855
629 Ga0207702_10013428 3300026078 Bacteria 6808
630 Ga0207702_10026441 3300026078 Bacteria 4817
631 Ga0207702_10028954 3300026078 Bacteria 4606
632 Ga0207702_10034660 3300026078 Bacteria 4221
633 Ga0207702_10103335 3300026078 Bacteria 2520
634 Ga0207702_10132370 3300026078 Bacteria 2245
635 Ga0207641_10000947 3300026088 Bacteria 29805
636 Ga0207641_10089947 3300026088 Bacteria 2683
637 Ga0207648_10004840 3300026089 Bacteria 13732
638 Ga0207648_10042554 3300026089 Bacteria 3986
639 Ga0207648_10210766 3300026089 Bacteria 1725
640 Ga0207676_10001905 3300026095 Bacteria 15233
641 Ga0207676_10009539 3300026095 Bacteria 6910
642 Ga0207676_10183316 3300026095 Bacteria 1835
643 Ga0207674_10001048 3300026116 Bacteria 35994
644 Ga0207674_10006493 3300026116 Bacteria 13753
645 Ga0207674_10015449 3300026116 Bacteria 8388
646 Ga0207674_10025821 3300026116 Bacteria 6254
647 Ga0207674_10059551 3300026116 Bacteria 3864
648 Ga0207674_10062578 3300026116 Bacteria 3759
649 Ga0207674_10080496 3300026116 Bacteria 3261
650 Ga0207674_10198274 3300026116 Bacteria 1957
651 Ga0207674_10351489 3300026116 Bacteria 1425
652 Ga0207675_100007636 3300026118 Bacteria 10214
653 Ga0207675_100009536 3300026118 Bacteria 9078
654 Ga0207675_100013715 3300026118 Bacteria 7563
655 Ga0207675_100080852 3300026118 Bacteria 3047
656 Ga0207675_100097026 3300026118 Bacteria 2775
657 Ga0207683_10000772 3300026121 Bacteria 29159
658 Ga0207683_10003905 3300026121 Bacteria 12920
659 Ga0207683_10008837 3300026121 Bacteria 8593
660 Ga0207683_10032299 3300026121 Bacteria 4548
661 Ga0207683_10122255 3300026121 Bacteria 2338
662 Ga0207698_10001479 3300026142 Bacteria 13677
663 Ga0207698_10001813 3300026142 Bacteria 12478
664 Ga0207698_10005852 3300026142 Bacteria 7639
665 Ga0207698_10070822 3300026142 Bacteria 2764
666 Ga0207698_10196066 3300026142 Bacteria 1804
667 Ga0209813_10002341 3300027866 Bacteria 4345
668 Ga0207428_10000976 3300027907 Bacteria 31618
669 Ga0207428_10061848 3300027907 Bacteria 2963
670 Ga0207428_10181296 3300027907 Bacteria 1591
671 Ga0268266_10006262 3300028379 Bacteria 10918
672 Ga0268266_10022863 3300028379 Bacteria 5321
673 Ga0268266_10056335 3300028379 Bacteria 3382
674 Ga0268266_10251610 3300028379 Bacteria 1634
675 Ga0268265_10010662 3300028380 Bacteria 6207
676 Ga0268265_10021583 3300028380 Bacteria 4514
677 Ga0268264_10003254 3300028381 Bacteria 14049
678 Ga0268264_10018989 3300028381 Bacteria 5620
679 Ga0268264_10059778 3300028381 Bacteria 3194
680 Ga0268264_10121427 3300028381 Bacteria 2303
681 Ga0265337_1001378 3300028556 Bacteria 11957
682 Ga0265326_10012682 3300028558 Bacteria 2472
683 Ga0265319_1001043 3300028563 Bacteria 17329
684 Ga0265334_10001867 3300028573 Bacteria 10016
685 Ga0265334_10030060 3300028573 Bacteria 2175
686 Ga0265318_10019527 3300028577 Bacteria 2747
687 Ga0307515_10000027 3300028794 Bacteria 371624
688 Ga0307515_10066071 3300028794 Bacteria 5018
689 Ga0307515_10129340 3300028794 Bacteria 2793
690 Ga0307515_10227977 3300028794 Bacteria 1663
691 Ga0265338_10001035 3300028800 Bacteria 46510
692 Ga0265338_10006264 3300028800 Bacteria 15225
693 Ga0265338_10054763 3300028800 Bacteria 3553
694 Ga0307511_10001301 3300030521 Bacteria 26468
695 Ga0314311_1212962 3300030733 Bacteria 2018
696 Ga0265325_10006702 3300031241 Bacteria 6968
697 Ga0265340_10001983 3300031247 Bacteria 11708
698 Ga0265340_10013753 3300031247 Bacteria 4244
699 Ga0265340_10017009 3300031247 Bacteria 3761
700 Ga0265340_10017262 3300031247 Bacteria 3731
701 Ga0265339_10023224 3300031249 Bacteria 3587
702 Ga0265327_10000303 3300031251 Bacteria 95597
703 Ga0265327_10001438 3300031251 Bacteria 30041
704 Ga0265316_10041947 3300031344 Bacteria 3659
705 Ga0307513_10231673 3300031456 Bacteria 1659
706 Ga0307509_10054677 3300031507 Bacteria 4248
707 Ga0307508_10004026 3300031616 Bacteria 14548
708 Ga0307514_10092337 3300031649 Bacteria 2202
709 Ga0316575_10005460 3300031665 Bacteria 4533
710 Ga0265314_10016524 3300031711 Bacteria 5822
711 Ga0265342_10070307 3300031712 Bacteria 2042
712 Ga0316576_10000208 3300031727 Bacteria 24680
713 Ga0316576_10000264 3300031727 Bacteria 22816
714 Ga0316576_10015164 3300031727 Bacteria 5165
715 Ga0316576_10021294 3300031727 Bacteria 4482
716 Ga0307516_10005562 3300031730 Bacteria 15026
717 Ga0307405_10038551 3300031731 Bacteria 2882
718 Ga0316577_10002961 3300031733 Bacteria 8500
719 Ga0307413_10020698 3300031824 Bacteria 3506
720 Ga0307413_10073600 3300031824 Bacteria 2160
721 Ga0307410_10082099 3300031852 Bacteria 2267
722 Ga0326468_10000319 3300031889 Bacteria 5101
723 Ga0307406_10056841 3300031901 Bacteria 2508
724 Ga0307406_10065433 3300031901 Bacteria 2363
725 Ga0307407_10002637 3300031903 Bacteria 7092
726 Ga0307407_10021731 3300031903 Bacteria 3316
727 Ga0307409_100003188 3300031995 Bacteria 8819
728 Ga0307409_100015666 3300031995 Bacteria 4984
729 Ga0307409_100018133 3300031995 Bacteria 4718
730 Ga0307409_100046231 3300031995 Bacteria 3294
731 Ga0307409_100065113 3300031995 Bacteria 2866
732 Ga0307409_100066141 3300031995 Bacteria 2848
733 Ga0307409_100131339 3300031995 Bacteria 2141
734 Ga0307409_100240190 3300031995 Bacteria 1648
735 Ga0307416_100003741 3300032002 Bacteria 9028
736 Ga0307416_100009098 3300032002 Bacteria 6472
737 Ga0307416_100010065 3300032002 Bacteria 6227
738 Ga0307416_100051807 3300032002 Bacteria 3282
739 Ga0307416_100087560 3300032002 Bacteria 2659
740 Ga0307416_100107698 3300032002 Bacteria 2447
741 Ga0307416_100114950 3300032002 Bacteria 2382
742 Ga0307416_100193370 3300032002 Bacteria 1922
743 Ga0307416_100301960 3300032002 Bacteria 1592
744 Ga0307414_10132602 3300032004 Bacteria 1937
745 Ga0307411_10006601 3300032005 Bacteria 5822
746 Ga0307415_100000071 3300032126 Bacteria 42220
747 Ga0307415_100005737 3300032126 Bacteria 6619
748 Ga0307415_100032960 3300032126 Bacteria 3357
749 Ga0307415_100044564 3300032126 Bacteria 2967
750 Ga0307415_100059026 3300032126 Bacteria 2644
751 Ga0307415_100072424 3300032126 Bacteria 2427
752 Ga0307415_100085540 3300032126 Bacteria 2266
753 Ga0307415_100095214 3300032126 Bacteria 2167
754 Ga0307415_100122703 3300032126 Bacteria 1951
755 Ga0307507_10000001 3300033179 Bacteria 417520
756 Ga0316587_1003395 3300033529 Bacteria 2228
757 Ga0316587_1005033 3300033529 Bacteria 1957
758 Ga0316587_1010829 3300033529 Bacteria 1463
759 Ga0373950_0001388 3300034818 Bacteria 3153
760 Ga0373938_0016100 3300034957 Bacteria 1457
761 Ga0373926_0000182 3300035083 Bacteria 14126
762 Ga0373926_0001667 3300035083 Bacteria 6864
763 Ga0373926_0003441 3300035083 Bacteria 5100
764 Ga0373926_0031073 3300035083 Bacteria 1882
765 Ga0373934_0000109 3300035086 Bacteria 29409
766 Ga0373934_0001845 3300035086 Bacteria 7778
767 Ga0373934_0002127 3300035086 Bacteria 7268
768 Ga0373934_0021094 3300035086 Bacteria 2509
769 Ga0373934_0030713 3300035086 Bacteria 2101
770 Ga0373934_0038057 3300035086 Bacteria 1894
771 Ga0373934_0064473 3300035086 Bacteria 1462
772 Ga0373951_0000180 3300035091 Bacteria 22725
773 Ga0373952_0006560 3300035092 Bacteria 2154
774 Ga0373923_0000129 3300035111 Bacteria 13969
775 Ga0373923_0015564 3300035111 Bacteria 2874
776 Ga0373923_0025003 3300035111 Bacteria 2362
777 Ga0373923_0034811 3300035111 Bacteria 2046
778 Ga0373923_0100727 3300035111 Bacteria 1273
779 Ga0373932_0008770 3300035112 Bacteria 2420
780 Ga0373932_0019184 3300035112 Bacteria 1779
781 Ga0373936_0012109 3300035113 Bacteria 3275
782 Ga0373936_0030205 3300035113 Bacteria 2137
783 Ga0373939_0016970 3300035114 Bacteria 1927
784 Ga0373945_0000108 3300035116 Bacteria 19713
785 Ga0373945_0002663 3300035116 Bacteria 5597
786 Ga0373945_0006241 3300035116 Bacteria 3838
787 Ga0373953_0000026 3300035117 Bacteria 40030
788 Ga0373953_0011211 3300035117 Bacteria 3140
789 Ga0373953_0018750 3300035117 Bacteria 2565
790 Ga0373953_0024094 3300035117 Bacteria 2310
791 Ga0373954_0006046 3300035118 Bacteria 5264
792 Ga0373954_0006922 3300035118 Bacteria 4949
793 Ga0373954_0011406 3300035118 Bacteria 3938
794 Ga0373954_0011949 3300035118 Bacteria 3857
795 Ga0373954_0027261 3300035118 Bacteria 2621
796 Ga0373954_0031152 3300035118 Bacteria 2461
797 Ga0373956_0001484 3300035119 Bacteria 9701
798 Ga0373956_0029611 3300035119 Bacteria 2388
799 Ga0373956_0061514 3300035119 Bacteria 1701
800 Ga0373957_0000038 3300035120 Bacteria 34200
801 Ga0373957_0000972 3300035120 Bacteria 7524
802 Ga0373943_0001545 3300035170 Bacteria 10430
803 Ga0373943_0003488 3300035170 Bacteria 7161
804 Ga0373943_0105497 3300035170 Bacteria 1479
805 Ga0373946_0028410 3300035171 Bacteria 2218
806 Ga0373955_0000841 3300035172 Bacteria 13157
807 Ga0373955_0012628 3300035172 Bacteria 4062
808 Ga0373955_0015149 3300035172 Bacteria 3769
809 Ga0373955_0064649 3300035172 Bacteria 2028
810 Ga0373955_0070526 3300035172 Bacteria 1952
811 Ga0373942_0015698 3300035207 Bacteria 1849
812 Ga0373962_0011166 3300035242 Bacteria 2247
813 Ga0316574_0010285 3300035398 Bacteria 5280
814 Ga0316574_0015276 3300035398 Bacteria 4453
815 Ga0316574_0023786 3300035398 Bacteria 3661
816 Ga0316574_0068299 3300035398 Bacteria 2241
817 Ga0373924_0002452 3300035410 Bacteria 6241
818 Ga0373924_0004584 3300035410 Bacteria 4834
819 Ga0373924_0008148 3300035410 Bacteria 3797
820 Ga0373924_0048402 3300035410 Bacteria 1756
821 Ga0373931_0037655 3300035691 Bacteria 2525
822 Ga0373931_0058559 3300035691 Bacteria 2069
823 Ga0373935_0000541 3300035692 Bacteria 19633
824 Ga0373935_0001486 3300035692 Bacteria 13024
825 Ga0373935_0007408 3300035692 Bacteria 6567
826 Ga0373935_0036971 3300035692 Bacteria 3054
827 Ga0373935_0055524 3300035692 Bacteria 2523
828 Ga0373927_0000680 3300035695 Bacteria 25895
829 Ga0373927_0205419 3300035695 Bacteria 1293
830 Ga0373933_0000188 3300035724 Bacteria 40947
831 Ga0373933_0000604 3300035724 Bacteria 22424
832 Ga0373933_0007701 3300035724 Bacteria 5881
833 Ga0373933_0036485 3300035724 Bacteria 2878
834 Ga0373933_0036606 3300035724 Bacteria 2873
835 Ga0373933_0042571 3300035724 Bacteria 2684
836 Ga0373933_0083526 3300035724 Bacteria 1961
837 Ga0373947_0000003 3300035725 Bacteria 345338
838 Ga0373947_0002803 3300035725 Bacteria 10417
839 Ga0373947_0112580 3300035725 Bacteria 1721
840 Ga0373947_0155331 3300035725 Bacteria 1476
841 Ga0373937_0000138 3300036401 Bacteria 70068
842 Ga0373937_0001588 3300036401 Bacteria 19105
843 Ga0373937_0059365 3300036401 Bacteria 3515
844 Ga0373937_0062370 3300036401 Bacteria 3427
845 Ga0373937_0107679 3300036401 Bacteria 2591
846 Ga0373937_0290635 3300036401 Bacteria 1544
847 Ga0316582_0030200 3300036647 Bacteria 3299
848 Ga0316584_0005941 3300036712 Bacteria 8239
849 Ga0316584_0015706 3300036712 Bacteria 5419
850 Ga0373925_0000400 3300037068 Bacteria 44261
851 Ga0373925_0000699 3300037068 Bacteria 31424
852 Ga0373925_0036510 3300037068 Bacteria 3627
853 Ga0395899_0003096 3300037312 Bacteria 13237
854 Ga0395899_0098042 3300037312 Bacteria 2118
855 Ga0395900_0007778 3300037418 Bacteria 11058
856 Ga0395900_0034891 3300037418 Bacteria 5182
857 Ga0395900_0121921 3300037418 Bacteria 2675
858 Ga0395898_0058456 3300037466 Bacteria 3753
859 Ga0395898_0065076 3300037466 Bacteria 3535
860 Ga0395898_0169526 3300037466 Bacteria 2087
861 Ga0395905_0034235 3300037471 Bacteria 4769
862 Ga0436364_0050345 3300037853 Bacteria 1318
863 Ga0436364_0151261 3300037853 Bacteria 9936
864 Ga0436364_0206485 3300037853 Bacteria 20706
865 Ga0436364_0207639 3300037853 Bacteria 28695
866 Ga0436364_0232843 3300037853 Bacteria 50861
867 Ga0436364_0343519 3300037853 Bacteria 7214
868 Ga0436364_0540807 3300037853 Bacteria 3855
869 Ga0436364_1306745 3300037853 Bacteria 3959
870 Ga0436364_1391037 3300037853 Bacteria 2099
871 Ga0436364_1522620 3300037853 Bacteria 6371
872 Ga0395901_0020378 3300038443 Bacteria 6788
873 Ga0395901_0128065 3300038443 Bacteria 2668
874 Ga0395901_0239284 3300038443 Bacteria 1893
875 Ga0400488_46678 3300038741 Bacteria 2393
876 Ga0400488_55885 3300038741 Bacteria 27888
877 Ga0400483_037289 3300039062 Bacteria 5955
878 Ga0400483_246361 3300039062 Bacteria 6457
879 Ga0400489_90291 3300039093 Bacteria 9492
880 Ga0400489_92236 3300039093 Bacteria 51082
881 Ga0400487_46379 3300039110 Bacteria 4510
882 Ga0400487_56871 3300039110 Bacteria 7932
883 Ga0436365_0575809 3300039437 Bacteria 3680
884 Ga0436365_1505452 3300039437 Bacteria 4297
885 Ga0436363_0714317 3300039450 Bacteria 2203
886 Ga0436363_0778823 3300039450 Bacteria 2097
887 Ga0451833_1422046 3300041491 Bacteria 1998
888 Ga0466969_0006927 3300044656 Bacteria 6031
889 Ga0466969_0030015 3300044656 Bacteria 2772
890 Ga0466972_0000561 3300044658 Bacteria 18133
891 Ga0466972_0016381 3300044658 Bacteria 3707
892 Ga0466972_0024084 3300044658 Bacteria 3022
893 Ga0466972_0026321 3300044658 Bacteria 2883
894 Ga0466965_0000033 3300044683 Bacteria 52298
895 Ga0466965_0003444 3300044683 Bacteria 6939
896 Ga0466965_0007762 3300044683 Bacteria 4939
897 Ga0466965_0016329 3300044683 Bacteria 3531
898 Ga0466965_0021631 3300044683 Bacteria 3098
899 Ga0466965_0029880 3300044683 Bacteria 2653
900 Ga0466966_0004604 3300044684 Bacteria 9083
901 Ga0466966_0013174 3300044684 Bacteria 5476
902 Ga0466966_0028566 3300044684 Bacteria 3631
903 Ga0466966_0047307 3300044684 Bacteria 2743
904 Ga0466966_0075640 3300044684 Bacteria 2104
905 Ga0466961_0001757 3300044693 Bacteria 13456
906 Ga0466961_0002160 3300044693 Bacteria 12237
907 Ga0466961_0005395 3300044693 Bacteria 8050
908 Ga0466961_0032277 3300044693 Bacteria 3364
909 Ga0466961_0053842 3300044693 Bacteria 2567
910 Ga0466961_0118351 3300044693 Bacteria 1664
911 Ga0466963_0001901 3300044694 Bacteria 11416
912 Ga0466963_0003409 3300044694 Bacteria 9096
913 Ga0466963_0005394 3300044694 Bacteria 7485
914 Ga0466963_0016029 3300044694 Bacteria 4653
915 Ga0466963_0056721 3300044694 Bacteria 2607
916 Ga0466963_0098471 3300044694 Bacteria 1999
917 Ga0466963_0106439 3300044694 Bacteria 1923
918 Ga0466964_0004578 3300044706 Bacteria 5114
919 Ga0453684_0009878 3300044712 Bacteria 16506
920 Ga0453684_0029978 3300044712 Bacteria 7701
921 Ga0466971_0040714 3300044719 Bacteria 2087
922 Ga0466968_0013176 3300044735 Bacteria 3248
923 Ga0466970_0002336 3300044765 Bacteria 9173
924 Ga0466970_0011058 3300044765 Bacteria 4594
925 Ga0466970_0023147 3300044765 Bacteria 3243
926 Ga0466970_0057098 3300044765 Bacteria 2087
927 Ga0466957_0002955 3300044842 Bacteria 9218
928 Ga0466957_0020263 3300044842 Bacteria 3913
929 Ga0466957_0030002 3300044842 Bacteria 3246
930 Ga0466957_0046861 3300044842 Bacteria 2626
931 Ga0466957_0138971 3300044842 Bacteria 1564
932 Ga0466960_0000745 3300044901 Bacteria 11417
933 Ga0466960_0009176 3300044901 Bacteria 4070
934 Ga0466960_0018156 3300044901 Bacteria 3078
935 Ga0466960_0021518 3300044901 Bacteria 2872
936 Ga0466960_0040212 3300044901 Bacteria 2210
937 Ga0466960_0069360 3300044901 Bacteria 1751
938 Ga0466960_0082756 3300044901 Bacteria 1621
939 Ga0466959_0017177 3300045049 Bacteria 5298
940 Ga0466959_0038424 3300045049 Bacteria 3537
941 Ga0466959_0097432 3300045049 Bacteria 2108
942 Ga0466959_0147916 3300045049 Bacteria 1657
943 Ga0466958_0002571 3300045836 Bacteria 9161
944 Ga0466958_0028022 3300045836 Bacteria 3337
945 Ga0466958_0029484 3300045836 Bacteria 3256
946 Ga0466958_0039593 3300045836 Bacteria 2833
947 Ga0466958_0112114 3300045836 Bacteria 1703
948 Ga0466958_0122299 3300045836 Bacteria 1630
949 Ga0466967_0002082 3300045976 Bacteria 12246
950 Ga0466967_0005091 3300045976 Bacteria 9024
951 Ga0466967_0016571 3300045976 Bacteria 5817
952 Ga0466967_0033243 3300045976 Bacteria 4364
953 Ga0466967_0036222 3300045976 Bacteria 4210
954 Ga0466967_0049038 3300045976 Bacteria 3691
955 Ga0466967_0053897 3300045976 Bacteria 3537
956 Ga0466967_0068868 3300045976 Bacteria 3161
957 Ga0466967_0071041 3300045976 Bacteria 3116
958 Ga0466967_0082103 3300045976 Bacteria 2912
959 Ga0466967_0108688 3300045976 Bacteria 2545
960 Ga0466967_0132620 3300045976 Bacteria 2314
961 Ga0466967_0136992 3300045976 Bacteria 2277
962 Ga0466967_0155512 3300045976 Bacteria 2141
963 Ga0466967_0225251 3300045976 Bacteria 1783
964 Ga0495592_0000041 3300046454 Bacteria 123431
965 Ga0495592_0002850 3300046454 Bacteria 12278
966 Ga0495592_0025383 3300046454 Bacteria 4499
967 Ga0495592_0033870 3300046454 Bacteria 3852
968 Ga0495592_0047303 3300046454 Bacteria 3203
969 Ga0495592_0049321 3300046454 Bacteria 3129
970 Ga0495603_0010135 3300046455 Bacteria 5703
971 Ga0495629_0005572 3300046459 Bacteria 9400
972 Ga0495629_0007344 3300046459 Bacteria 8123
973 Ga0495629_0043776 3300046459 Bacteria 3143
974 Ga0495629_0047902 3300046459 Bacteria 2997
975 Ga0495629_0056443 3300046459 Bacteria 2745
976 Ga0495641_0021199 3300046461 Bacteria 3274
977 Ga0495641_0028361 3300046461 Bacteria 2710
978 Ga0495641_0043813 3300046461 Bacteria 2068
979 Ga0495641_0070729 3300046461 Bacteria 1567
980 Ga0495651_0000018 3300046462 Bacteria 123195
981 Ga0495651_0009202 3300046462 Bacteria 7584
982 Ga0495651_0011383 3300046462 Bacteria 6835
983 Ga0495651_0031225 3300046462 Bacteria 4155
984 Ga0495651_0035162 3300046462 Bacteria 3902
985 Ga0495651_0037714 3300046462 Bacteria 3763
986 Ga0495651_0053368 3300046462 Bacteria 3112
987 Ga0495651_0069311 3300046462 Bacteria 2686
988 Ga0495651_0142234 3300046462 Bacteria 1738
989 Ga0495653_0003023 3300046463 Bacteria 13488
990 Ga0495653_0017016 3300046463 Bacteria 5914
991 Ga0495653_0018739 3300046463 Bacteria 5619
992 Ga0495653_0059305 3300046463 Bacteria 2905
993 Ga0495653_0072340 3300046463 Bacteria 2574
994 Ga0495582_0009586 3300046473 Bacteria 5332
995 Ga0495582_0011706 3300046473 Bacteria 4834
996 Ga0495582_0032044 3300046473 Bacteria 2891
997 Ga0495582_0097833 3300046473 Bacteria 1641
998 Ga0495662_0002680 3300046476 Bacteria 8992
999 Ga0495662_0005429 3300046476 Bacteria 6382
1000 Ga0495664_0001298 3300046477 Bacteria 13086
1001 Ga0495664_0016579 3300046477 Bacteria 4199
1002 Ga0495664_0027977 3300046477 Bacteria 3289
1003 Ga0495664_0037228 3300046477 Bacteria 2871
1004 Ga0495594_0021375 3300046499 Bacteria 3454
1005 Ga0495594_0021541 3300046499 Bacteria 3440
1006 Ga0495594_0027716 3300046499 Bacteria 3053
1007 Ga0495596_0067415 3300046500 Bacteria 1391
1008 Ga0495606_0013094 3300046507 Bacteria 6588
1009 Ga0495608_0000039 3300046511 Bacteria 123195
1010 Ga0495608_0007120 3300046511 Bacteria 7912
1011 Ga0495608_0017964 3300046511 Bacteria 4887
1012 Ga0495608_0030826 3300046511 Bacteria 3627
1013 Ga0495608_0078393 3300046511 Bacteria 2149
1014 Ga0495618_0001552 3300046514 Bacteria 15406
1015 Ga0495618_0020662 3300046514 Bacteria 4053
1016 Ga0495618_0054617 3300046514 Bacteria 2528
1017 Ga0495618_0130751 3300046514 Bacteria 1606
1018 Ga0495628_0000219 3300046516 Bacteria 50121
1019 Ga0495628_0003347 3300046516 Bacteria 14334
1020 Ga0495628_0011141 3300046516 Bacteria 7612
1021 Ga0495628_0030202 3300046516 Bacteria 4389
1022 Ga0495628_0124610 3300046516 Bacteria 1974
1023 Ga0495630_0031062 3300046517 Bacteria 3975
1024 Ga0495630_0064011 3300046517 Bacteria 2762
1025 Ga0495630_0082178 3300046517 Bacteria 2431
1026 Ga0495630_0110066 3300046517 Bacteria 2086
1027 Ga0495652_0000092 3300046529 Bacteria 96258
1028 Ga0495652_0024482 3300046529 Bacteria 5343
1029 Ga0495652_0050293 3300046529 Bacteria 3563
1030 Ga0495652_0074837 3300046529 Bacteria 2815
1031 Ga0495652_0114558 3300046529 Bacteria 2162
1032 Ga0495665_0000931 3300046531 Bacteria 15431
1033 Ga0495665_0004607 3300046531 Bacteria 7439
1034 Ga0495665_0006900 3300046531 Bacteria 6130
1035 Ga0495665_0070809 3300046531 Bacteria 1837
1036 Ga0495640_0009819 3300046533 Bacteria 7428
1037 Ga0495640_0032645 3300046533 Bacteria 3707
1038 Ga0495640_0034686 3300046533 Bacteria 3574
1039 Ga0495640_0079305 3300046533 Bacteria 2186
1040 Ga0495640_0112828 3300046533 Bacteria 1774
1041 Ga0495586_0004920 3300046535 Bacteria 7146
1042 Ga0495586_0008834 3300046535 Bacteria 5366
1043 Ga0495586_0039928 3300046535 Bacteria 2524
1044 Ga0495586_0057677 3300046535 Bacteria 2107
1045 Ga0495587_0000034 3300046536 Bacteria 123432
1046 Ga0495587_0000538 3300046536 Bacteria 26274
1047 Ga0495587_0012295 3300046536 Bacteria 5395
1048 Ga0495587_0012821 3300046536 Bacteria 5271
1049 Ga0495587_0017071 3300046536 Bacteria 4512
1050 Ga0495587_0045833 3300046536 Bacteria 2597
1051 Ga0495645_0018528 3300046543 Bacteria 5002
1052 Ga0495645_0034852 3300046543 Bacteria 3670
1053 Ga0495645_0062902 3300046543 Bacteria 2687
1054 Ga0495645_0143473 3300046543 Bacteria 1664
1055 Ga0495667_0000150 3300046559 Bacteria 47612
1056 Ga0495667_0000669 3300046559 Bacteria 21922
1057 Ga0495667_0001777 3300046559 Bacteria 14303
1058 Ga0495667_0013704 3300046559 Bacteria 5478
1059 Ga0495667_0018638 3300046559 Bacteria 4686
1060 Ga0495667_0036999 3300046559 Bacteria 3254
1061 Ga0495667_0062859 3300046559 Bacteria 2432
1062 Ga0495667_0138833 3300046559 Bacteria 1566
1063 Ga0495668_0000182 3300046616 Bacteria 93763
1064 Ga0495634_0003876 3300046642 Bacteria 11882
1065 Ga0495634_0017558 3300046642 Bacteria 5103
1066 Ga0495634_0028083 3300046642 Bacteria 3909
1067 Ga0495634_0069487 3300046642 Bacteria 2323
1068 Ga0495634_0082621 3300046642 Bacteria 2098
1069 Ga0495625_0000464 3300046660 Bacteria 60878
1070 Ga0495635_0000138 3300046663 Bacteria 44247
1071 Ga0495635_0007591 3300046663 Bacteria 7567
1072 Ga0495635_0046808 3300046663 Bacteria 2983
1073 Ga0495657_0000247 3300046675 Bacteria 49117
1074 Ga0495657_0016894 3300046675 Bacteria 5305
1075 Ga0495657_0038707 3300046675 Bacteria 3280
1076 Ga0495657_0045690 3300046675 Bacteria 2970
1077 Ga0495657_0051156 3300046675 Bacteria 2774
1078 Ga0495657_0059797 3300046675 Bacteria 2526
1079 Ga0495657_0060132 3300046675 Bacteria 2518
1080 Ga0495657_0170129 3300046675 Bacteria 1342
1081 Ga0495599_0000108 3300046678 Bacteria 56078
1082 Ga0495599_0001098 3300046678 Bacteria 15229
1083 Ga0495599_0029060 3300046678 Bacteria 3464
1084 Ga0495599_0082042 3300046678 Bacteria 2014
1085 Ga0495599_0085122 3300046678 Bacteria 1974
1086 Ga0495623_0000287 3300046679 Bacteria 32946
1087 Ga0495623_0011210 3300046679 Bacteria 5798
1088 Ga0495623_0016471 3300046679 Bacteria 4775
1089 Ga0495623_0024688 3300046679 Bacteria 3870
1090 Ga0495623_0030914 3300046679 Bacteria 3445
1091 Ga0495623_0070403 3300046679 Bacteria 2179
1092 Ga0495646_0008529 3300046680 Bacteria 6511
1093 Ga0495646_0011228 3300046680 Bacteria 5687
1094 Ga0495646_0029846 3300046680 Bacteria 3405
1095 Ga0495646_0039786 3300046680 Bacteria 2897
1096 Ga0495646_0048843 3300046680 Bacteria 2569
1097 Ga0495647_0008900 3300046681 Bacteria 3384
1098 Ga0495658_0004732 3300046683 Bacteria 6682
1099 Ga0495658_0018605 3300046683 Bacteria 3614
1100 Ga0495613_0003455 3300046689 Bacteria 11809
1101 Ga0495613_0088523 3300046689 Bacteria 2243
1102 Ga0495624_0038049 3300046690 Bacteria 3092
1103 Ga0495624_0057818 3300046690 Bacteria 2438
1104 Ga0495624_0097768 3300046690 Bacteria 1808
1105 Ga0495600_0003753 3300046809 Bacteria 8988
1106 Ga0495600_0024182 3300046809 Bacteria 3909
1107 Ga0495600_0068710 3300046809 Bacteria 2315
1108 Ga0495581_0028214 3300047315 Bacteria 3254
1109 Ga0495581_0035097 3300047315 Bacteria 2902
1110 Ga0495581_0038183 3300047315 Bacteria 2779
1111 Ga0495581_0041912 3300047315 Bacteria 2649
1112 Ga0495581_0080488 3300047315 Bacteria 1885
1113 Ga0495604_0000039 3300047317 Bacteria 123431
1114 Ga0495604_0004961 3300047317 Bacteria 10551
1115 Ga0495604_0018417 3300047317 Bacteria 5592
1116 Ga0495604_0031876 3300047317 Bacteria 4178
1117 Ga0495604_0068694 3300047317 Bacteria 2688
1118 Ga0495604_0094448 3300047317 Bacteria 2210
1119 Ga0495674_0000235 3300047319 Bacteria 46762
1120 Ga0495674_0012639 3300047319 Bacteria 7955
1121 Ga0495674_0022562 3300047319 Bacteria 5804
1122 Ga0495674_0061194 3300047319 Bacteria 3282
1123 Ga0495674_0091225 3300047319 Bacteria 2602
1124 Ga0495674_0094410 3300047319 Bacteria 2551
1125 Ga0495674_0110789 3300047319 Bacteria 2327
1126 Ga0495676_0003177 3300047321 Bacteria 14843
1127 Ga0495676_0011200 3300047321 Bacteria 8106
1128 Ga0495676_0045136 3300047321 Bacteria 3590
1129 Ga0495680_0000028 3300047322 Bacteria 112865
1130 Ga0495680_0001355 3300047322 Bacteria 26607
1131 Ga0495680_0001817 3300047322 Bacteria 22541
1132 Ga0495680_0003332 3300047322 Bacteria 15879
1133 Ga0495680_0072835 3300047322 Bacteria 2612
1134 Ga0495680_0084807 3300047322 Bacteria 2387
1135 Ga0495680_0090669 3300047322 Bacteria 2292
1136 Ga0495680_0100253 3300047322 Bacteria 2158
1137 Ga0495680_0129163 3300047322 Bacteria 1858
1138 Ga0495683_0016323 3300047323 Bacteria 3857
1139 Ga0495675_0000355 3300047444 Bacteria 32066
1140 Ga0495675_0007520 3300047444 Bacteria 6714
1141 Ga0495675_0008588 3300047444 Bacteria 6332
1142 Ga0495675_0027151 3300047444 Bacteria 3648
1143 Ga0495684_0000154 3300047471 Bacteria 50763
1144 Ga0495684_0010849 3300047471 Bacteria 7045
1145 Ga0495684_0014031 3300047471 Bacteria 6163
1146 Ga0495684_0043852 3300047471 Bacteria 3424
1147 Ga0495684_0053559 3300047471 Bacteria 3078
1148 Ga0495684_0064876 3300047471 Bacteria 2775
1149 Ga0495593_0012122 3300047673 Bacteria 4933
1150 Ga0495593_0012728 3300047673 Bacteria 4802
1151 Ga0495593_0026923 3300047673 Bacteria 3168
1152 Ga0495593_0080233 3300047673 Bacteria 1688
1153 Ga0495602_0000043 3300048088 Bacteria 123431
1154 Ga0495602_0008296 3300048088 Bacteria 10856
1155 Ga0495602_0024111 3300048088 Bacteria 5906
1156 Ga0495602_0035651 3300048088 Bacteria 4637
1157 Ga0495602_0035718 3300048088 Bacteria 4632
1158 Ga0495602_0055088 3300048088 Bacteria 3504
1159 Ga0495602_0057893 3300048088 Bacteria 3396
1160 Ga0495602_0061044 3300048088 Bacteria 3281
1161 Ga0495602_0089421 3300048088 Bacteria 2560
1162 Ga0495614_0014275 3300048089 Bacteria 3480
1163 Ga0495626_0001774 3300048091 Bacteria 16389
1164 Ga0496100_0000092 3300048903 Bacteria 50831
1165 Ga0496100_0038256 3300048903 Bacteria 3039
1166 Ga0496100_0050919 3300048903 Bacteria 2686
1167 Ga0496100_0084442 3300048903 Bacteria 2152
1168 Ga0496101_0000018 3300048904 Bacteria 236102
1169 Ga0496101_0016361 3300048904 Bacteria 5009
1170 Ga0496101_0028268 3300048904 Bacteria 3914
1171 Ga0496102_0000013 3300048905 Bacteria 311668
1172 Ga0496102_0000596 3300048905 Bacteria 37908
1173 Ga0496102_0007973 3300048905 Bacteria 9049
1174 Ga0496102_0086146 3300048905 Bacteria 2901
1175 Ga0496102_0093133 3300048905 Bacteria 2791
1176 Ga0496102_0129917 3300048905 Bacteria 2357
1177 Ga0496103_0000039 3300048906 Bacteria 174284
1178 Ga0496103_0000727 3300048906 Bacteria 24310
1179 Ga0496103_0004802 3300048906 Bacteria 8171
1180 Ga0496103_0054242 3300048906 Bacteria 2485
1181 Ga0496103_0133693 3300048906 Bacteria 1585
1182 Ga0496104_0009738 3300048907 Bacteria 8566
1183 Ga0496104_0047128 3300048907 Bacteria 4061
1184 Ga0496104_0093953 3300048907 Bacteria 2869
1185 Ga0496104_0169183 3300048907 Bacteria 2096
1186 Ga0496104_0350867 3300048907 Bacteria 1388
1187 Ga0496105_0015802 3300048908 Bacteria 6022
1188 Ga0496105_0075183 3300048908 Bacteria 2790
1189 Ga0496105_0088810 3300048908 Bacteria 2554
1190 Ga0496105_0092545 3300048908 Bacteria 2496
1191 Ga0496106_0002072 3300048909 Bacteria 15020
1192 Ga0496106_0009107 3300048909 Bacteria 7334
1193 Ga0496106_0012275 3300048909 Bacteria 6323
1194 Ga0496107_0000935 3300048910 Bacteria 17262
1195 Ga0496107_0006564 3300048910 Bacteria 8004
1196 Ga0496107_0048100 3300048910 Bacteria 3072
1197 Ga0496107_0062574 3300048910 Bacteria 2696
1198 Ga0496107_0118127 3300048910 Bacteria 1953
1199 Ga0496107_0131628 3300048910 Bacteria 1846
1200 Ga0496108_0000102 3300048911 Bacteria 88979
1201 Ga0496108_0006454 3300048911 Bacteria 9507
1202 Ga0496108_0008211 3300048911 Bacteria 8474
1203 Ga0496108_0023924 3300048911 Bacteria 5028
1204 Ga0496108_0039627 3300048911 Bacteria 3926
1205 Ga0496108_0074019 3300048911 Bacteria 2875
1206 Ga0496108_0075343 3300048911 Bacteria 2851
1207 Ga0496108_0150524 3300048911 Bacteria 2008
1208 Ga0496109_0000688 3300048912 Bacteria 28149
1209 Ga0496109_0004908 3300048912 Bacteria 11164
1210 Ga0496109_0019911 3300048912 Bacteria 5922
1211 Ga0496109_0070694 3300048912 Bacteria 3203
1212 Ga0496109_0251993 3300048912 Bacteria 1663
1213 Ga0496110_0009673 3300048913 Bacteria 7808
1214 Ga0496110_0011608 3300048913 Bacteria 7222
1215 Ga0496110_0020138 3300048913 Bacteria 5627
1216 Ga0496110_0029903 3300048913 Bacteria 4694
1217 Ga0496110_0340763 3300048913 Bacteria 1366
1218 Ga0496111_0002416 3300048914 Bacteria 11266
1219 Ga0496111_0011805 3300048914 Bacteria 5898
1220 Ga0496111_0013543 3300048914 Bacteria 5554
1221 Ga0496111_0028665 3300048914 Bacteria 3947
1222 Ga0496111_0054085 3300048914 Bacteria 2901
1223 Ga0496111_0099368 3300048914 Bacteria 2137
1224 Ga0496112_0005115 3300048915 Bacteria 11270
1225 Ga0496112_0014288 3300048915 Bacteria 7356
1226 Ga0496112_0014487 3300048915 Bacteria 7320
1227 Ga0496114_0001339 3300048917 Bacteria 18667
1228 Ga0496114_0021886 3300048917 Bacteria 5204
1229 Ga0496114_0029190 3300048917 Bacteria 4531
1230 Ga0496114_0048238 3300048917 Bacteria 3542
1231 Ga0496114_0048817 3300048917 Bacteria 3521
1232 Ga0496114_0187082 3300048917 Bacteria 1810
1233 Ga0496114_0218840 3300048917 Bacteria 1671
1234 Ga0496115_0012391 3300048918 Bacteria 6415
1235 Ga0496115_0037599 3300048918 Bacteria 3837
1236 Ga0496115_0074859 3300048918 Bacteria 2750
1237 Ga0496115_0264022 3300048918 Bacteria 1415
1238 Ga0496116_0005632 3300048919 Bacteria 11534
1239 Ga0496117_0011653 3300048920 Bacteria 7853
1240 Ga0496117_0065167 3300048920 Bacteria 2478
1241 Ga0496118_0015918 3300048921 Bacteria 6929
1242 Ga0496118_0036390 3300048921 Bacteria 3981
1243 Ga0496118_0039440 3300048921 Bacteria 3768
1244 Ga0496118_0090072 3300048921 Bacteria 2115
1245 Ga0496119_0000022 3300048922 Bacteria 269878
1246 Ga0496119_0002150 3300048922 Bacteria 22146
1247 Ga0496119_0008239 3300048922 Bacteria 9212
1248 Ga0496119_0009414 3300048922 Bacteria 8389
1249 Ga0496119_0009570 3300048922 Bacteria 8286
1250 Ga0496120_0000856 3300048923 Bacteria 43060
1251 Ga0496120_0001757 3300048923 Bacteria 24522
1252 Ga0496120_0002970 3300048923 Bacteria 16139
1253 Ga0496120_0033465 3300048923 Bacteria 3089
1254 Ga0496121_0000023 3300048924 Bacteria 463448
1255 Ga0496121_0000040 3300048924 Bacteria 348494
1256 Ga0496121_0081195 3300048924 Bacteria 2567
1257 Ga0496122_0000022 3300048925 Bacteria 388704
1258 Ga0496122_0000164 3300048925 Bacteria 158055
1259 Ga0496122_0005660 3300048925 Bacteria 14751
1260 Ga0496123_0000016 3300048926 Bacteria 424330
1261 Ga0496124_0000014 3300048927 Bacteria 463448
1262 Ga0496124_0024555 3300048927 Bacteria 5476
1263 Ga0496125_0000020 3300048928 Bacteria 463448
1264 Ga0496125_0004443 3300048928 Bacteria 16177
1265 Ga0496125_0020299 3300048928 Bacteria 6237
1266 Ga0496126_0000023 3300048929 Bacteria 463448
1267 Ga0496126_0000055 3300048929 Bacteria 297958
1268 Ga0496126_0000090 3300048929 Bacteria 210538
1269 Ga0496126_0017091 3300048929 Bacteria 7234
1270 Ga0496126_0029368 3300048929 Bacteria 5223
1271 Ga0496126_0065298 3300048929 Bacteria 3257
1272 Ga0496126_0098756 3300048929 Bacteria 2558
1273 Ga0501318_003400 3300049534 Bacteria 1456
1274 Ga0501031_0005397 3300049568 Bacteria 8322
1275 Ga0501031_0026500 3300049568 Bacteria 3779
1276 Ga0501032_0006594 3300049569 Bacteria 8524
1277 Ga0501032_0046696 3300049569 Bacteria 2926
1278 Ga0501032_0054738 3300049569 Bacteria 2685
1279 Ga0501032_0086591 3300049569 Bacteria 2082
1280 Ga0501032_0104282 3300049569 Bacteria 1878
1281 Ga0501033_0000494 3300049570 Bacteria 37191
1282 Ga0501033_0028033 3300049570 Bacteria 4232
1283 Ga0501033_0036462 3300049570 Bacteria 3685
1284 Ga0501034_0000419 3300049571 Bacteria 71157
1285 Ga0501034_0006558 3300049571 Bacteria 12501
1286 Ga0501034_0019166 3300049571 Bacteria 7005
1287 Ga0501034_0026165 3300049571 Bacteria 5941
1288 Ga0501034_0059905 3300049571 Bacteria 3824
1289 Ga0501034_0078355 3300049571 Bacteria 3309
1290 Ga0501034_0107146 3300049571 Bacteria 2787
1291 Ga0501034_0131140 3300049571 Bacteria 2489
1292 Ga0501036_0004897 3300049572 Bacteria 10817
1293 Ga0501036_0005514 3300049572 Bacteria 10261
1294 Ga0501036_0042038 3300049572 Bacteria 3869
1295 Ga0501037_0051933 3300049573 Bacteria 2998
1296 Ga0501037_0125969 3300049573 Bacteria 1839
1297 Ga0501038_0000874 3300049574 Bacteria 26668
1298 Ga0501038_0005310 3300049574 Bacteria 11969
1299 Ga0501038_0029892 3300049574 Bacteria 4827
1300 Ga0501038_0054638 3300049574 Bacteria 3434
1301 Ga0501039_0003402 3300049575 Bacteria 11891
1302 Ga0501039_0037459 3300049575 Bacteria 3743
1303 Ga0501039_0047074 3300049575 Bacteria 3333
1304 Ga0501040_0008855 3300049576 Bacteria 6540
1305 Ga0501040_0054321 3300049576 Bacteria 2746
1306 Ga0501040_0085641 3300049576 Bacteria 2187
1307 Ga0501041_0064103 3300049577 Bacteria 2250
1308 Ga0501042_0004599 3300049578 Bacteria 8810
1309 Ga0501042_0021978 3300049578 Bacteria 4453
1310 Ga0501042_0035811 3300049578 Bacteria 3521
1311 Ga0501042_0041130 3300049578 Bacteria 3286
1312 Ga0501043_0240324 3300049579 Bacteria 1397
1313 Ga0501046_0007799 3300049580 Bacteria 9391
1314 Ga0501046_0035397 3300049580 Bacteria 4024
1315 Ga0501046_0168778 3300049580 Bacteria 1643
1316 Ga0501047_0001249 3300049581 Bacteria 25187
1317 Ga0501047_0001409 3300049581 Bacteria 23584
1318 Ga0501047_0040928 3300049581 Bacteria 4480
1319 Ga0501047_0068887 3300049581 Bacteria 3408
1320 Ga0501047_0073300 3300049581 Bacteria 3296
1321 Ga0501047_0284257 3300049581 Bacteria 1498
1322 Ga0501048_0000373 3300049582 Bacteria 31068
1323 Ga0501048_0001597 3300049582 Bacteria 17210
1324 Ga0501048_0010469 3300049582 Bacteria 6925
1325 Ga0501067_0041410 3300049583 Bacteria 2558
1326 Ga0501070_0030864 3300049586 Bacteria 4489
1327 Ga0501070_0076909 3300049586 Bacteria 2763
1328 Ga0501070_0166188 3300049586 Bacteria 1818
1329 Ga0501071_0011093 3300049587 Bacteria 6057
1330 Ga0501072_0011323 3300049588 Bacteria 6814
1331 Ga0501072_0016427 3300049588 Bacteria 5683
1332 Ga0501073_0000222 3300049589 Bacteria 37299
1333 Ga0501073_0026792 3300049589 Bacteria 4127
1334 Ga0501074_0007071 3300049590 Bacteria 8108
1335 Ga0501075_0013707 3300049591 Bacteria 5793
1336 Ga0501075_0077991 3300049591 Bacteria 2507
1337 Ga0501076_0007625 3300049592 Bacteria 7881
1338 Ga0501076_0029351 3300049592 Bacteria 4277
1339 Ga0501076_0155067 3300049592 Bacteria 1864
1340 Ga0501077_0007115 3300049593 Bacteria 6899
1341 Ga0501079_0025288 3300049741 Bacteria 4555
1342 Ga0501079_0026643 3300049741 Bacteria 4432
1343 Ga0501080_0035655 3300049742 Bacteria 4643
1344 Ga0501080_0059984 3300049742 Bacteria 3540
1345 Ga0501080_0119003 3300049742 Bacteria 2449
1346 Ga0501080_0184613 3300049742 Bacteria 1918
1347 Ga0501081_0042748 3300049743 Bacteria 3106
1348 Ga0501083_0126874 3300049744 Bacteria 1673
1349 Ga0501035_0001462 3300049822 Bacteria 24206
1350 Ga0501035_0009678 3300049822 Bacteria 8964
1351 Ga0501035_0076257 3300049822 Bacteria 2965
1352 Ga0501035_0101828 3300049822 Bacteria 2520
1353 Ga0501044_0000898 3300049823 Bacteria 35963
1354 Ga0501044_0015179 3300049823 Bacteria 8298
1355 Ga0501044_0212884 3300049823 Bacteria 1886
1356 Ga0501045_0015883 3300049824 Bacteria 5340
1357 Ga0501045_0034276 3300049824 Bacteria 3685
1358 Ga0501045_0054980 3300049824 Bacteria 2911
1359 Ga0501045_0080160 3300049824 Bacteria 2407
1360 Ga0501045_0121296 3300049824 Bacteria 1941
1361 nmdc:mga00v17_2173_c1 3300050491 Bacteria 10081
1362 nmdc:mga00v17_31322_c1 3300050491 Bacteria 3136
1363 nmdc:mga00v17_65464_c1 3300050491 Bacteria 2242
1364 nmdc:mga0yw44_3567_c1 3300050492 Bacteria 6937
1365 nmdc:mga0yw44_37400_c1 3300050492 Bacteria 2865
1366 nmdc:mga0yw44_44144_c1 3300050492 Bacteria 2665
1367 nmdc:mga06z11_2278_c1 3300050494 Bacteria 7302
1368 nmdc:mga06z11_49292_c1 3300050494 Bacteria 2148
1369 nmdc:mga04h51_7778_c1 3300050495 Bacteria 2843
1370 nmdc:mga05p37_182605_c1 3300050507 Bacteria 2552
1371 nmdc:mga05p37_52804_c1 3300050507 Bacteria 4998
1372 nmdc:mga09592_41508_c1 3300050508 Bacteria 3869
1373 nmdc:mga09592_45588_c1 3300050508 Bacteria 3694
1374 nmdc:mga09592_5723_c1 3300050508 Bacteria 10135
1375 nmdc:mga0qj67_10513_c1 3300050509 Bacteria 6912
1376 nmdc:mga0qj67_112058_c1 3300050509 Bacteria 2203
1377 nmdc:mga0qj67_27993_c1 3300050509 Bacteria 4373
1378 nmdc:mga0qj67_39034_c1 3300050509 Bacteria 3727
1379 nmdc:mga06r32_214624_c1 3300050510 Unclassified 1912
1380 nmdc:mga06r32_78017_c1 3300050510 Bacteria 3219
1381 nmdc:mga06r32_7811_c1 3300050510 Bacteria 9616
1382 nmdc:mga06r32_907_c1 3300050510 Bacteria 26417
1383 nmdc:mga08y16_144330_c1 3300050511 Bacteria 2474
1384 nmdc:mga08y16_16524_c1 3300050511 Bacteria 7764
1385 nmdc:mga08y16_296204_c1 3300050511 Bacteria 1668
1386 nmdc:mga08y16_3908_c1 3300050511 Bacteria 15520
1387 nmdc:mga08y16_52421_c1 3300050511 Bacteria 4268
1388 nmdc:mga0n895_19316_c1 3300050512 Bacteria 6332
1389 nmdc:mga0n895_303769_c1 3300050512 Bacteria 1618
1390 nmdc:mga0n895_3126_c1 3300050512 Bacteria 13199
1391 nmdc:mga0n895_5628_c1 3300050512 Bacteria 10500
1392 nmdc:mga0rr50_23628_c1 3300050513 Bacteria 4243
1393 nmdc:mga0rr50_5853_c1 3300050513 Bacteria 7393
1394 nmdc:mga0rr50_9814_c1 3300050513 Bacteria 6045
1395 nmdc:mga08x19_4958_c1 3300050514 Bacteria 7862
1396 nmdc:mga08x19_60972_c1 3300050514 Bacteria 2444
1397 nmdc:mga0a205_99676_c1 3300050515 Bacteria 2804
1398 nmdc:mga0sz30_39630_c1 3300050516 Bacteria 1977
1399 nmdc:mga0sz30_57802_c1 3300050516 Bacteria 1653
1400 Ga0495601_0026034 3300053077 Bacteria 3609
1401 Ga0495601_0059509 3300053077 Bacteria 2423
1402 Ga0495601_0081449 3300053077 Bacteria 2077
1403 Ga0495612_0012517 3300053078 Bacteria 3420
1404 Ga0495612_0016357 3300053078 Bacteria 2973
1405 Ga0495612_0035606 3300053078 Bacteria 2018
1406 Ga0495612_0057063 3300053078 Bacteria 1612
1407 Ga0495595_0004992 3300053084 Bacteria 5357
1408 Ga0495595_0007305 3300053084 Bacteria 4520
1409 Ga0495595_0009778 3300053084 Bacteria 3975
1410 Ga0495595_0010465 3300053084 Bacteria 3855
1411 Ga0495619_0003503 3300053085 Bacteria 10118
1412 Ga0495619_0008758 3300053085 Bacteria 6397
1413 Ga0495619_0022642 3300053085 Bacteria 4023
1414 Ga0500644_0000090 3300053088 Bacteria 56710
1415 Ga0500556_0000421 3300053104 Bacteria 30523
1416 Ga0500556_0000698 3300053104 Bacteria 20621
1417 Ga0500562_002205 3300053108 Bacteria 4872
1418 Ga0500593_000189 3300053117 Bacteria 25029
1419 Ga0500593_011246 3300053117 Bacteria 3775
1420 Ga0500559_0000561 3300053136 Bacteria 25730
1421 Ga0500568_0000098 3300053139 Bacteria 80393
1422 Ga0500568_0000970 3300053139 Bacteria 19744
1423 Ga0500573_0024571 3300053140 Bacteria 3464
1424 Ga0500573_0037001 3300053140 Bacteria 2819
1425 Ga0500577_0025316 3300053142 Bacteria 2006
1426 Ga0500590_004738 3300053148 Bacteria 6461
1427 Ga0500616_0000740 3300053153 Bacteria 37626
1428 Ga0500616_0001673 3300053153 Bacteria 20432
1429 Ga0500616_0005443 3300053153 Bacteria 8638
1430 Ga0500620_001941 3300053155 Bacteria 4009
1431 Ga0501084_0006238 3300054114 Bacteria 9804
1432 Ga0501084_0146062 3300054114 Bacteria 1992
1433 Ga0501082_0009270 3300060353 Bacteria 8484
1434 Ga0501082_0106390 3300060353 Bacteria 2427
1435 Ga0501082_0173233 3300060353 Bacteria 1876
1436 Ga0501082_0335787 3300060353 Bacteria 1317
1437 Ga0466962_0007440 3300061719 Bacteria 5256
1438 Ga0466962_0010186 3300061719 Bacteria 4515
1439 Ga0466962_0030612 3300061719 Bacteria 2578
1440 Ga0466962_0064430 3300061719 Bacteria 1750
1441 Ga0530510_0004246 3300061734 Bacteria 9906
1442 Ga0530510_0073077 3300061734 Bacteria 2489
1443 Ga0530510_0095460 3300061734 Bacteria 2172

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0251993 Ga0496109_0251993_570_1631 347
2 3300026116 Ga0207674_10351489 Ga0207674_103514892 357
3 3300037853 Ga0436364_0343519 Ga0436364_0343519_6100_7200 363
4 3300049573 Ga0501037_0125969 Ga0501037_0125969_728_1825 364
5 3300049581 Ga0501047_0284257 Ga0501047_0284257_17_1114 364
6 3300005983 Ga0081540_1044975 Ga0081540_10449751 377
7 3300005288 Ga0065714_10005169 Ga0065714_100051696 378
8 3300035398 Ga0316574_0068299 Ga0316574_0068299_520_1872 391
9 3300036712 Ga0316584_0015706 Ga0316584_0015706_2587_3939 391
10 3300048918 Ga0496115_0264022 Ga0496115_0264022_206_1402 392
11 3300046675 Ga0495657_0170129 Ga0495657_0170129_32_1300 395
12 3300035119 Ga0373956_0061514 Ga0373956_0061514_38_1306 397
13 3300036401 Ga0373937_0290635 Ga0373937_0290635_287_1534 399
14 3300049571 Ga0501034_0059905 Ga0501034_0059905_667_1872 399
15 3300049572 Ga0501036_0004897 Ga0501036_0004897_8983_10185 399
16 3300049580 Ga0501046_0007799 Ga0501046_0007799_4401_5603 399
17 3300049583 Ga0501067_0041410 Ga0501067_0041410_26_1228 399
18 3300049589 Ga0501073_0026792 Ga0501073_0026792_450_1652 399
19 3300049822 Ga0501035_0076257 Ga0501035_0076257_1712_2917 399
20 3300049824 Ga0501045_0121296 Ga0501045_0121296_449_1651 399
21 3300054114 Ga0501084_0146062 Ga0501084_0146062_642_1844 399
22 3300035111 Ga0373923_0100727 Ga0373923_0100727_15_1229 400
23 3300048928 Ga0496125_0020299 Ga0496125_0020299_100_1470 402
24 3300005435 Ga0070714_100008744 Ga0070714_1000087441 403
25 3300021388 Ga0213875_10002928 Ga0213875_100029287 404
26 3300025944 Ga0207661_10054690 Ga0207661_100546902 404
27 3300035695 Ga0373927_0205419 Ga0373927_0205419_48_1277 404
28 3300037418 Ga0395900_0034891 Ga0395900_0034891_657_1940 404
29 3300037466 Ga0395898_0065076 Ga0395898_0065076_1810_3093 404
30 3300038443 Ga0395901_0239284 Ga0395901_0239284_160_1443 404
31 3300046500 Ga0495596_0067415 Ga0495596_0067415_73_1287 404
32 3300049579 Ga0501043_0240324 Ga0501043_0240324_12_1226 404
33 3300049571 Ga0501034_0019166 Ga0501034_0019166_2726_4099 406
34 3300005290 Ga0065712_10102081 Ga0065712_101020812 407
35 3300005354 Ga0070675_100120429 Ga0070675_1001204291 407
36 3300005435 Ga0070714_100051017 Ga0070714_1000510172 407
37 3300005466 Ga0070685_10021688 Ga0070685_100216883 407
38 3300005466 Ga0070685_10044787 Ga0070685_100447873 407
39 3300013308 Ga0157375_10065285 Ga0157375_100652852 407
40 3300014969 Ga0157376_10099772 Ga0157376_100997723 407
41 3300025961 Ga0207712_10000976 Ga0207712_1000097618 407
42 3300049576 Ga0501040_0054321 Ga0501040_0054321_1085_2392 407
43 3300002459 JGI24751J29686_10002307 JGI24751J29686_100023073 408
44 3300005295 Ga0065707_10115361 Ga0065707_101153612 408
45 3300005331 Ga0070670_100023299 Ga0070670_1000232992 408
46 3300005471 Ga0070698_100001150 Ga0070698_1000011503 408
47 3300005471 Ga0070698_100004671 Ga0070698_1000046716 408
48 3300005618 Ga0068864_100012916 Ga0068864_1000129164 408
49 3300006358 Ga0068871_100073400 Ga0068871_1000734003 408
50 3300006844 Ga0075428_100080788 Ga0075428_1000807882 408
51 3300006846 Ga0075430_100047619 Ga0075430_1000476193 408
52 3300006847 Ga0075431_100037448 Ga0075431_1000374484 408
53 3300006847 Ga0075431_100094076 Ga0075431_1000940763 408
54 3300009176 Ga0105242_10009563 Ga0105242_100095632 408
55 3300009553 Ga0105249_10011505 Ga0105249_100115052 408
56 3300025923 Ga0207681_10112658 Ga0207681_101126582 408
57 3300025934 Ga0207686_10001569 Ga0207686_100015695 408
58 3300025961 Ga0207712_10017414 Ga0207712_100174142 408
59 3300026088 Ga0207641_10000947 Ga0207641_1000094710 408
60 3300026095 Ga0207676_10009539 Ga0207676_100095394 408
61 3300044684 Ga0466966_0075640 Ga0466966_0075640_635_1996 408
62 3300050508 nmdc:mga09592_45588_c1 nmdc:mga09592_45588_c1_1425_2771 408
63 3300050509 nmdc:mga0qj67_112058_c1 nmdc:mga0qj67_112058_c1_65_1411 408
64 3300050509 nmdc:mga0qj67_39034_c1 nmdc:mga0qj67_39034_c1_1511_2857 408
65 3300050510 nmdc:mga06r32_214624_c1 nmdc:mga06r32_214624_c1_304_1650 408
66 3300044656 Ga0466969_0030015 Ga0466969_0030015_1238_2569 409
67 3300031456 Ga0307513_10231673 Ga0307513_102316732 410
68 3300037312 Ga0395899_0098042 Ga0395899_0098042_95_1390 410
69 3300037418 Ga0395900_0007778 Ga0395900_0007778_2374_3669 410
70 3300037471 Ga0395905_0034235 Ga0395905_0034235_2403_3698 410
71 3300005577 Ga0068857_100165186 Ga0068857_1001651862 411
72 3300026116 Ga0207674_10198274 Ga0207674_101982743 411
73 3300037853 Ga0436364_0050345 Ga0436364_0050345_37_1287 411
74 3300044656 Ga0466969_0006927 Ga0466969_0006927_4769_6013 411
75 3300044693 Ga0466961_0032277 Ga0466961_0032277_1708_3039 411
76 3300039062 Ga0400483_037289 Ga0400483_037289_1565_2806 412
77 3300039062 Ga0400483_246361 Ga0400483_246361_1252_2493 412
78 3300044735 Ga0466968_0013176 Ga0466968_0013176_826_2184 412
79 3300048910 Ga0496107_0048100 Ga0496107_0048100_1182_2525 412
80 3300049571 Ga0501034_0006558 Ga0501034_0006558_9293_10666 413
81 3300010375 Ga0105239_10002033 Ga0105239_1000203321 414
82 3300014745 Ga0157377_10004860 Ga0157377_100048602 414
83 3300028573 Ga0265334_10001867 Ga0265334_100018675 414
84 3300031852 Ga0307410_10082099 Ga0307410_100820992 415
85 3300032126 Ga0307415_100085540 Ga0307415_1000855402 415
86 3300049581 Ga0501047_0001409 Ga0501047_0001409_587_1909 415
87 3300049822 Ga0501035_0001462 Ga0501035_0001462_5843_7165 415
88 3300049823 Ga0501044_0000898 Ga0501044_0000898_19733_21055 415
89 3300053104 Ga0500556_0000698 Ga0500556_0000698_6566_7909 415
90 iso_pu_bacteria 2740891818 2740990748 415
91 3300031649 Ga0307514_10092337 Ga0307514_100923372 416
92 3300031889 Ga0326468_10000319 Ga0326468_100003193 416
93 3300053117 Ga0500593_000189 Ga0500593_000189_16426_17769 416
94 3300005336 Ga0070680_100012295 Ga0070680_1000122952 417
95 3300005530 Ga0070679_100029150 Ga0070679_1000291502 417
96 3300005530 Ga0070679_100047220 Ga0070679_1000472203 417
97 3300005535 Ga0070684_100034101 Ga0070684_1000341013 417
98 3300020082 Ga0206353_10474610 Ga0206353_104746101 417
99 3300026067 Ga0207678_10025591 Ga0207678_100255912 417
100 3300028556 Ga0265337_1001378 Ga0265337_100137811 417
101 3300028558 Ga0265326_10012682 Ga0265326_100126822 417
102 3300028563 Ga0265319_1001043 Ga0265319_10010433 417
103 3300028573 Ga0265334_10030060 Ga0265334_100300602 417
104 3300028577 Ga0265318_10019527 Ga0265318_100195272 417
105 3300028800 Ga0265338_10001035 Ga0265338_1000103531 417
106 3300031241 Ga0265325_10006702 Ga0265325_100067021 417
107 3300031247 Ga0265340_10013753 Ga0265340_100137535 417
108 3300031249 Ga0265339_10023224 Ga0265339_100232243 417
109 3300031344 Ga0265316_10041947 Ga0265316_100419473 417
110 3300031711 Ga0265314_10016524 Ga0265314_100165243 417
111 3300031995 Ga0307409_100065113 Ga0307409_1000651132 417
112 3300032002 Ga0307416_100010065 Ga0307416_1000100654 417
113 3300032126 Ga0307415_100032960 Ga0307415_1000329602 417
114 3300048913 Ga0496110_0340763 Ga0496110_0340763_22_1284 417
115 3300049570 Ga0501033_0000494 Ga0501033_0000494_32953_34215 417
116 iso_pu_bacteria 2858868258 2858873870 417
117 3300028380 Ga0268265_10021583 Ga0268265_100215833 418
118 3300035398 Ga0316574_0023786 Ga0316574_0023786_2025_3293 418
119 3300045976 Ga0466967_0053897 Ga0466967_0053897_1010_2284 418
120 3300048929 Ga0496126_0000055 Ga0496126_0000055_186450_187724 418
121 3300049569 Ga0501032_0086591 Ga0501032_0086591_714_1991 418
122 iso_pu_bacteria 2501939600 2501943259 418
123 iso_pu_bacteria 2831935698 2831938686 418
124 iso_pu_bacteria 2855683550 2855684854 418
125 iso_pu_bacteria 2856858025 2856860657 418
126 iso_pu_bacteria 2867302475 2867306586 418
127 iso_pu_bacteria 2902582711 2902585597 418
128 iso_pu_bacteria 649633069 649811392 418
129 3300005435 Ga0070714_100000434 Ga0070714_1000004346 419
130 3300014745 Ga0157377_10082550 Ga0157377_100825502 419
131 3300005329 Ga0070683_100008479 Ga0070683_1000084794 420
132 3300005535 Ga0070684_100023514 Ga0070684_1000235142 420
133 3300005985 Ga0081539_10018904 Ga0081539_100189043 420
134 3300025944 Ga0207661_10017684 Ga0207661_100176842 420
135 3300031995 Ga0307409_100240190 Ga0307409_1002401902 420
136 3300033179 Ga0307507_10000001 Ga0307507_10000001190 420
137 3300035091 Ga0373951_0000180 Ga0373951_0000180_15801_17093 420
138 iso_pu_bacteria 2675903059 2676480395 420
139 3300005445 Ga0070708_100226332 Ga0070708_1002263322 421
140 3300032126 Ga0307415_100044564 Ga0307415_1000445642 421
141 3300038741 Ga0400488_55885 Ga0400488_55885_25956_27227 421
142 3300044683 Ga0466965_0029880 Ga0466965_0029880_933_2294 421
143 3300046461 Ga0495641_0043813 Ga0495641_0043813_20_1297 421
144 3300046499 Ga0495594_0021541 Ga0495594_0021541_1793_3115 421
145 3300049569 Ga0501032_0054738 Ga0501032_0054738_765_2033 421
146 3300049572 Ga0501036_0042038 Ga0501036_0042038_941_2302 421
147 3300049574 Ga0501038_0054638 Ga0501038_0054638_128_1396 421
148 3300049575 Ga0501039_0003402 Ga0501039_0003402_140_1408 421
149 3300049576 Ga0501040_0085641 Ga0501040_0085641_254_1615 421
150 3300049578 Ga0501042_0035811 Ga0501042_0035811_2127_3395 421
151 3300049578 Ga0501042_0041130 Ga0501042_0041130_663_2024 421
152 3300049581 Ga0501047_0073300 Ga0501047_0073300_824_2092 421
153 3300049582 Ga0501048_0001597 Ga0501048_0001597_14228_15496 421
154 3300049591 Ga0501075_0077991 Ga0501075_0077991_263_1624 421
155 3300049592 Ga0501076_0029351 Ga0501076_0029351_2483_3844 421
156 3300049742 Ga0501080_0059984 Ga0501080_0059984_309_1577 421
157 3300060353 Ga0501082_0106390 Ga0501082_0106390_263_1624 421
158 3300061734 Ga0530510_0073077 Ga0530510_0073077_321_1682 421
159 iso_pu_bacteria 2751185782 2753270470 421
160 iso_pu_bacteria 2887478801 2887483970 421
161 3300005437 Ga0070710_10151189 Ga0070710_101511891 422
162 3300005468 Ga0070707_100185944 Ga0070707_1001859442 422
163 3300005564 Ga0070664_100095244 Ga0070664_1000952442 422
164 3300009147 Ga0114129_10000459 Ga0114129_100004599 422
165 3300025922 Ga0207646_10058309 Ga0207646_100583092 422
166 3300028794 Ga0307515_10000027 Ga0307515_10000027291 422
167 3300028794 Ga0307515_10066071 Ga0307515_100660714 422
168 3300031730 Ga0307516_10005562 Ga0307516_100055626 422
169 3300032002 Ga0307416_100107698 Ga0307416_1001076982 422
170 3300032126 Ga0307415_100005737 Ga0307415_1000057372 422
171 3300048911 Ga0496108_0000102 Ga0496108_0000102_25734_27011 422
172 3300050507 nmdc:mga05p37_182605_c1 nmdc:mga05p37_182605_c1_559_1830 422
173 3300005618 Ga0068864_100190358 Ga0068864_1001903582 423
174 3300005841 Ga0068863_100014598 Ga0068863_1000145983 423
175 3300005985 Ga0081539_10001386 Ga0081539_1000138627 423
176 3300026088 Ga0207641_10089947 Ga0207641_100899472 423
177 3300026116 Ga0207674_10025821 Ga0207674_100258213 423
178 3300032002 Ga0307416_100051807 Ga0307416_1000518072 423
179 3300035086 Ga0373934_0038057 Ga0373934_0038057_108_1466 423
180 3300047322 Ga0495680_0100253 Ga0495680_0100253_639_1997 423
181 3300048088 Ga0495602_0024111 Ga0495602_0024111_4011_5369 423
182 3300048907 Ga0496104_0350867 Ga0496104_0350867_11_1282 423
183 3300048915 Ga0496112_0005115 Ga0496112_0005115_8564_9835 423
184 3300048915 Ga0496112_0014288 Ga0496112_0014288_232_1503 423
185 3300060353 Ga0501082_0335787 Ga0501082_0335787_15_1289 423
186 3300005548 Ga0070665_100031508 Ga0070665_1000315082 424
187 3300005983 Ga0081540_1017505 Ga0081540_10175053 424
188 3300028379 Ga0268266_10056335 Ga0268266_100563352 424
189 3300031616 Ga0307508_10004026 Ga0307508_100040269 424
190 3300032126 Ga0307415_100072424 Ga0307415_1000724242 424
191 3300009177 Ga0105248_10056078 Ga0105248_100560782 425
192 3300013306 Ga0163162_10305408 Ga0163162_103054082 425
193 3300025941 Ga0207711_10021967 Ga0207711_100219672 425
194 3300028381 Ga0268264_10018989 Ga0268264_100189894 425
195 3300031507 Ga0307509_10054677 Ga0307509_100546773 425
196 3300031731 Ga0307405_10038551 Ga0307405_100385512 425
197 3300031733 Ga0316577_10002961 Ga0316577_100029611 425
198 3300031903 Ga0307407_10021731 Ga0307407_100217314 425
199 3300031995 Ga0307409_100003188 Ga0307409_1000031884 425
200 3300031995 Ga0307409_100018133 Ga0307409_1000181333 425
201 3300032002 Ga0307416_100003741 Ga0307416_1000037412 425
202 3300032126 Ga0307415_100000071 Ga0307415_1000000716 425
203 3300032126 Ga0307415_100059026 Ga0307415_1000590262 425
204 3300033529 Ga0316587_1003395 Ga0316587_10033951 425
205 3300033529 Ga0316587_1005033 Ga0316587_10050331 425
206 3300033529 Ga0316587_1010829 Ga0316587_10108291 425
207 3300035117 Ga0373953_0018750 Ga0373953_0018750_204_1529 425
208 3300035398 Ga0316574_0015276 Ga0316574_0015276_1875_3185 425
209 3300035692 Ga0373935_0007408 Ga0373935_0007408_3329_4633 425
210 3300035724 Ga0373933_0036485 Ga0373933_0036485_198_1556 425
211 3300038741 Ga0400488_46678 Ga0400488_46678_341_1651 425
212 3300039093 Ga0400489_90291 Ga0400489_90291_1157_2479 425
213 3300039093 Ga0400489_92236 Ga0400489_92236_15463_16773 425
214 3300039110 Ga0400487_46379 Ga0400487_46379_23_1333 425
215 3300039110 Ga0400487_56871 Ga0400487_56871_6048_7358 425
216 3300044712 Ga0453684_0009878 Ga0453684_0009878_5192_6502 425
217 3300044712 Ga0453684_0029978 Ga0453684_0029978_1741_3051 425
218 3300046462 Ga0495651_0053368 Ga0495651_0053368_820_2178 425
219 3300048088 Ga0495602_0035651 Ga0495602_0035651_1673_3031 425
220 3300048905 Ga0496102_0129917 Ga0496102_0129917_721_2058 425
221 3300048921 Ga0496118_0090072 Ga0496118_0090072_324_1661 425
222 3300049571 Ga0501034_0000419 Ga0501034_0000419_24800_26173 425
223 3300005437 Ga0070710_10000463 Ga0070710_100004633 426
224 3300025898 Ga0207692_10000523 Ga0207692_100005237 426
225 3300030733 Ga0314311_1212962 Ga0314311_12129622 426
226 3300044683 Ga0466965_0003444 Ga0466965_0003444_4731_6026 426
227 3300044683 Ga0466965_0007762 Ga0466965_0007762_559_1842 426
228 3300044683 Ga0466965_0021631 Ga0466965_0021631_1138_2421 426
229 3300045976 Ga0466967_0225251 Ga0466967_0225251_216_1547 426
230 3300046559 Ga0495667_0013704 Ga0495667_0013704_3737_5050 426
231 3300026067 Ga0207678_10039000 Ga0207678_100390002 427
232 3300046507 Ga0495606_0013094 Ga0495606_0013094_2866_4149 427
233 3300046616 Ga0495668_0000182 Ga0495668_0000182_80215_81498 427
234 3300046660 Ga0495625_0000464 Ga0495625_0000464_42775_44058 427
235 3300047323 Ga0495683_0016323 Ga0495683_0016323_2381_3664 427
236 3300048091 Ga0495626_0001774 Ga0495626_0001774_12272_13555 427
237 3300002244 JGI24742J22300_10000738 JGI24742J22300_100007383 428
238 3300005288 Ga0065714_10089059 Ga0065714_100890592 428
239 3300005328 Ga0070676_10013240 Ga0070676_100132404 428
240 3300005330 Ga0070690_100082287 Ga0070690_1000822872 428
241 3300005334 Ga0068869_100032174 Ga0068869_1000321742 428
242 3300005338 Ga0068868_100080677 Ga0068868_1000806771 428
243 3300005340 Ga0070689_100056212 Ga0070689_1000562122 428
244 3300005341 Ga0070691_10026776 Ga0070691_100267762 428
245 3300005355 Ga0070671_100046235 Ga0070671_1000462352 428
246 3300005365 Ga0070688_100028259 Ga0070688_1000282593 428
247 3300005366 Ga0070659_100017222 Ga0070659_1000172223 428
248 3300005434 Ga0070709_10042489 Ga0070709_100424892 428
249 3300005438 Ga0070701_10016314 Ga0070701_100163142 428
250 3300005439 Ga0070711_100029945 Ga0070711_1000299452 428
251 3300005440 Ga0070705_100014840 Ga0070705_1000148402 428
252 3300005441 Ga0070700_100003624 Ga0070700_1000036248 428
253 3300005456 Ga0070678_100032623 Ga0070678_1000326232 428
254 3300005457 Ga0070662_100194584 Ga0070662_1001945842 428
255 3300005539 Ga0068853_100008349 Ga0068853_1000083493 428
256 3300005544 Ga0070686_100042436 Ga0070686_1000424362 428
257 3300005546 Ga0070696_100012182 Ga0070696_1000121823 428
258 3300005548 Ga0070665_100062684 Ga0070665_1000626841 428
259 3300005549 Ga0070704_100003385 Ga0070704_1000033854 428
260 3300005563 Ga0068855_100054597 Ga0068855_1000545972 428
261 3300005578 Ga0068854_100036762 Ga0068854_1000367622 428
262 3300005616 Ga0068852_100027507 Ga0068852_1000275073 428
263 3300005617 Ga0068859_100012755 Ga0068859_1000127556 428
264 3300005719 Ga0068861_100017127 Ga0068861_1000171273 428
265 3300005843 Ga0068860_100048640 Ga0068860_1000486402 428
266 3300005985 Ga0081539_10004997 Ga0081539_100049973 428
267 3300006163 Ga0070715_10003185 Ga0070715_100031853 428
268 3300006173 Ga0070716_100003680 Ga0070716_1000036803 428
269 3300006175 Ga0070712_100011158 Ga0070712_1000111583 428
270 3300006931 Ga0097620_100012754 Ga0097620_1000127546 428
271 3300009098 Ga0105245_10026061 Ga0105245_100260613 428
272 3300009101 Ga0105247_10016500 Ga0105247_100165003 428
273 3300009148 Ga0105243_10013454 Ga0105243_100134543 428
274 3300009176 Ga0105242_10017039 Ga0105242_100170393 428
275 3300009545 Ga0105237_10035761 Ga0105237_100357612 428
276 3300010375 Ga0105239_10028033 Ga0105239_100280333 428
277 3300013297 Ga0157378_10288786 Ga0157378_102887861 428
278 3300014326 Ga0157380_10091050 Ga0157380_100910502 428
279 3300014745 Ga0157377_10028980 Ga0157377_100289803 428
280 3300017792 Ga0163161_10007930 Ga0163161_100079305 428
281 3300025898 Ga0207692_10003276 Ga0207692_100032765 428
282 3300025899 Ga0207642_10006583 Ga0207642_100065833 428
283 3300025901 Ga0207688_10001124 Ga0207688_100011244 428
284 3300025903 Ga0207680_10051419 Ga0207680_100514192 428
285 3300025915 Ga0207693_10008492 Ga0207693_100084926 428
286 3300025932 Ga0207690_10082994 Ga0207690_100829942 428
287 3300025933 Ga0207706_10028367 Ga0207706_100283676 428
288 3300025934 Ga0207686_10067540 Ga0207686_100675401 428
289 3300025935 Ga0207709_10009207 Ga0207709_100092073 428
290 3300025939 Ga0207665_10002740 Ga0207665_100027408 428
291 3300025940 Ga0207691_10207000 Ga0207691_102070001 428
292 3300025942 Ga0207689_10042117 Ga0207689_100421172 428
293 3300025986 Ga0207658_10044590 Ga0207658_100445902 428
294 3300026035 Ga0207703_10071745 Ga0207703_100717452 428
295 3300026041 Ga0207639_10021897 Ga0207639_100218975 428
296 3300026067 Ga0207678_10023040 Ga0207678_100230403 428
297 3300026075 Ga0207708_10009740 Ga0207708_100097404 428
298 3300026089 Ga0207648_10004840 Ga0207648_100048404 428
299 3300026118 Ga0207675_100009536 Ga0207675_1000095364 428
300 3300026121 Ga0207683_10003905 Ga0207683_100039053 428
301 3300035691 Ga0373931_0058559 Ga0373931_0058559_704_2035 428
302 3300048903 Ga0496100_0038256 Ga0496100_0038256_1516_2847 428
303 3300048904 Ga0496101_0016361 Ga0496101_0016361_2285_3616 428
304 3300048906 Ga0496103_0004802 Ga0496103_0004802_2775_4106 428
305 3300048909 Ga0496106_0012275 Ga0496106_0012275_1296_2627 428
306 3300048910 Ga0496107_0006564 Ga0496107_0006564_3312_4643 428
307 3300048917 Ga0496114_0021886 Ga0496114_0021886_3658_4989 428
308 3300053078 Ga0495612_0035606 Ga0495612_0035606_46_1377 428
309 3300045049 Ga0466959_0147916 Ga0466959_0147916_295_1626 429
310 3300003792 Ga0055540_1000151 Ga0055540_100015127 430
311 3300005367 Ga0070667_100000274 Ga0070667_10000027422 430
312 3300005434 Ga0070709_10053489 Ga0070709_100534892 430
313 3300005535 Ga0070684_100136438 Ga0070684_1001364382 430
314 3300005535 Ga0070684_100193870 Ga0070684_1001938701 430
315 3300009545 Ga0105237_10025822 Ga0105237_100258222 430
316 3300010375 Ga0105239_10009408 Ga0105239_100094083 430
317 3300020069 Ga0197907_10116683 Ga0197907_101166832 430
318 3300025303 Ga0209051_1000075 Ga0209051_1000075165 430
319 3300025903 Ga0207680_10004471 Ga0207680_100044715 430
320 3300025914 Ga0207671_10083588 Ga0207671_100835882 430
321 3300025944 Ga0207661_10056544 Ga0207661_100565443 430
322 3300025986 Ga0207658_10000423 Ga0207658_1000042322 430
323 3300028800 Ga0265338_10006264 Ga0265338_100062648 430
324 3300031251 Ga0265327_10001438 Ga0265327_1000143816 430
325 3300044842 Ga0466957_0030002 Ga0466957_0030002_750_2054 430
326 3300048903 Ga0496100_0000092 Ga0496100_0000092_29806_31146 430
327 3300048904 Ga0496101_0000018 Ga0496101_0000018_29680_31020 430
328 3300048905 Ga0496102_0007973 Ga0496102_0007973_3868_5208 430
329 3300048906 Ga0496103_0000727 Ga0496103_0000727_17626_18966 430
330 3300048909 Ga0496106_0002072 Ga0496106_0002072_285_1625 430
331 3300048910 Ga0496107_0000935 Ga0496107_0000935_10015_11355 430
332 3300048911 Ga0496108_0008211 Ga0496108_0008211_6910_8250 430
333 3300048912 Ga0496109_0000688 Ga0496109_0000688_7021_8361 430
334 3300048913 Ga0496110_0020138 Ga0496110_0020138_3968_5308 430
335 3300048914 Ga0496111_0028665 Ga0496111_0028665_1911_3251 430
336 3300048917 Ga0496114_0001339 Ga0496114_0001339_9022_10362 430
337 3300048919 Ga0496116_0005632 Ga0496116_0005632_2846_4186 430
338 3300048921 Ga0496118_0015918 Ga0496118_0015918_2847_4187 430
339 3300048923 Ga0496120_0033465 Ga0496120_0033465_242_1582 430
340 3300048924 Ga0496121_0000023 Ga0496121_0000023_422485_423825 430
341 3300048925 Ga0496122_0000164 Ga0496122_0000164_126822_128162 430
342 3300048927 Ga0496124_0000014 Ga0496124_0000014_422485_423825 430
343 3300048928 Ga0496125_0000020 Ga0496125_0000020_39624_40964 430
344 3300048929 Ga0496126_0000023 Ga0496126_0000023_422485_423825 430
345 iso_pu_bacteria 2791354901 2791915920 430
346 3300014497 Ga0182008_10084003 Ga0182008_100840031 431
347 3300044901 Ga0466960_0000745 Ga0466960_0000745_7907_9220 431
348 3300048912 Ga0496109_0019911 Ga0496109_0019911_920_2251 431
349 3300048924 Ga0496121_0000040 Ga0496121_0000040_341087_342409 431
350 3300049568 Ga0501031_0005397 Ga0501031_0005397_1119_2468 431
351 3300049572 Ga0501036_0005514 Ga0501036_0005514_8551_9900 431
352 3300049576 Ga0501040_0008855 Ga0501040_0008855_4652_6001 431
353 3300049578 Ga0501042_0004599 Ga0501042_0004599_1595_2944 431
354 3300049582 Ga0501048_0010469 Ga0501048_0010469_2472_3821 431
355 3300049587 Ga0501071_0011093 Ga0501071_0011093_4422_5771 431
356 3300049588 Ga0501072_0011323 Ga0501072_0011323_3084_4433 431
357 3300049590 Ga0501074_0007071 Ga0501074_0007071_3684_5033 431
358 3300049591 Ga0501075_0013707 Ga0501075_0013707_2884_4233 431
359 3300049592 Ga0501076_0007625 Ga0501076_0007625_5743_7092 431
360 3300049593 Ga0501077_0007115 Ga0501077_0007115_2423_3772 431
361 3300049741 Ga0501079_0026643 Ga0501079_0026643_1957_3306 431
362 3300049743 Ga0501081_0042748 Ga0501081_0042748_1574_2923 431
363 3300049822 Ga0501035_0101828 Ga0501035_0101828_835_2184 431
364 3300049824 Ga0501045_0015883 Ga0501045_0015883_2126_3475 431
365 3300050492 nmdc:mga0yw44_3567_c1 nmdc:mga0yw44_3567_c1_1533_2864 431
366 3300054114 Ga0501084_0006238 Ga0501084_0006238_2362_3711 431
367 3300060353 Ga0501082_0173233 Ga0501082_0173233_216_1565 431
368 3300061734 Ga0530510_0004246 Ga0530510_0004246_4424_5773 431
369 3300005466 Ga0070685_10140487 Ga0070685_101404871 432
370 3300009545 Ga0105237_10062059 Ga0105237_100620593 432
371 3300013105 Ga0157369_10040006 Ga0157369_100400064 432
372 3300025913 Ga0207695_10014175 Ga0207695_100141754 432
373 3300025914 Ga0207671_10034894 Ga0207671_100348943 432
374 3300026078 Ga0207702_10028954 Ga0207702_100289544 432
375 3300044658 Ga0466972_0016381 Ga0466972_0016381_432_1733 432
376 3300045976 Ga0466967_0033243 Ga0466967_0033243_17_1327 432
377 3300048907 Ga0496104_0093953 Ga0496104_0093953_43_1422 432
378 3300048917 Ga0496114_0029190 Ga0496114_0029190_1063_2442 432
379 3300048918 Ga0496115_0074859 Ga0496115_0074859_1113_2492 432
380 3300049824 Ga0501045_0034276 Ga0501045_0034276_1886_3217 432
381 3300050492 nmdc:mga0yw44_44144_c1 nmdc:mga0yw44_44144_c1_977_2296 432
382 iso_pu_bacteria 2857479173 2857479889 433
383 iso_pu_bacteria 2857632687 2857633258 433
384 iso_pu_bacteria 2870801768 2870802621 433
385 iso_pu_bacteria 2870804320 2870804702 433
386 iso_pu_bacteria 8056207758 8056212039 433
387 iso_pu_bacteria 2582581312 2585299721 434
388 iso_pu_bacteria 2558860280 2559431129 435
389 iso_pu_bacteria 2643221615 2644089766 435
390 iso_pu_bacteria 2643221657 2644319611 435
391 iso_pu_bacteria 2893684298 2893686605 435
392 iso_pu_bacteria 8054704163 8054710913 435
393 iso_pu_bacteria 8056060235 8056063949 435
394 3300005343 Ga0070687_100073648 Ga0070687_1000736481 436
395 3300005347 Ga0070668_100040980 Ga0070668_1000409802 436
396 3300005365 Ga0070688_100064023 Ga0070688_1000640232 436
397 3300005366 Ga0070659_100064120 Ga0070659_1000641202 436
398 3300005436 Ga0070713_100258183 Ga0070713_1002581832 436
399 3300005539 Ga0068853_100005343 Ga0068853_1000053434 436
400 3300005544 Ga0070686_100044871 Ga0070686_1000448713 436
401 3300005563 Ga0068855_100280728 Ga0068855_1002807282 436
402 3300005577 Ga0068857_100142969 Ga0068857_1001429692 436
403 3300005615 Ga0070702_100033771 Ga0070702_1000337712 436
404 3300005616 Ga0068852_100031952 Ga0068852_1000319522 436
405 3300005718 Ga0068866_10005193 Ga0068866_100051935 436
406 3300006844 Ga0075428_100002554 Ga0075428_10000255411 436
407 3300006846 Ga0075430_100003453 Ga0075430_1000034532 436
408 3300006847 Ga0075431_100010144 Ga0075431_1000101443 436
409 3300006880 Ga0075429_100001358 Ga0075429_10000135818 436
410 3300009147 Ga0114129_10003492 Ga0114129_1000349219 436
411 3300009551 Ga0105238_10210488 Ga0105238_102104882 436
412 3300009553 Ga0105249_10077841 Ga0105249_100778415 436
413 3300011119 Ga0105246_10120991 Ga0105246_101209912 436
414 3300014968 Ga0157379_10067044 Ga0157379_100670444 436
415 3300021388 Ga0213875_10005790 Ga0213875_100057903 436
416 3300025901 Ga0207688_10041401 Ga0207688_100414012 436
417 3300025914 Ga0207671_10085080 Ga0207671_100850802 436
418 3300025917 Ga0207660_10078396 Ga0207660_100783962 436
419 3300025919 Ga0207657_10099648 Ga0207657_100996482 436
420 3300025927 Ga0207687_10020433 Ga0207687_100204335 436
421 3300025942 Ga0207689_10021795 Ga0207689_100217955 436
422 3300025960 Ga0207651_10163247 Ga0207651_101632471 436
423 3300025972 Ga0207668_10028789 Ga0207668_100287893 436
424 3300026067 Ga0207678_10006493 Ga0207678_1000649310 436
425 3300026116 Ga0207674_10059551 Ga0207674_100595513 436
426 3300026118 Ga0207675_100080852 Ga0207675_1000808522 436
427 3300026142 Ga0207698_10196066 Ga0207698_101960661 436
428 3300028379 Ga0268266_10022863 Ga0268266_100228634 436
429 3300030521 Ga0307511_10001301 Ga0307511_1000130110 436
430 3300031727 Ga0316576_10000208 Ga0316576_100002085 436
431 3300044684 Ga0466966_0004604 Ga0466966_0004604_2776_4107 436
432 3300044693 Ga0466961_0002160 Ga0466961_0002160_8952_10283 436
433 3300045049 Ga0466959_0017177 Ga0466959_0017177_2314_3645 436
434 3300050508 nmdc:mga09592_41508_c1 nmdc:mga09592_41508_c1_1660_3018 436
435 3300050509 nmdc:mga0qj67_27993_c1 nmdc:mga0qj67_27993_c1_1226_2584 436
436 3300050510 nmdc:mga06r32_78017_c1 nmdc:mga06r32_78017_c1_1367_2725 436
437 3300050511 nmdc:mga08y16_144330_c1 nmdc:mga08y16_144330_c1_794_2143 436
438 iso_pu_bacteria 2687453737 2689955885 436
439 iso_pu_bacteria 2738541264 2738667586 436
440 iso_pu_bacteria 2738541356 2739146656 436
441 iso_pu_bacteria 2784132109 2784473296 436
442 iso_pu_bacteria 2939582691 2939584442 436
443 3300013296 Ga0157374_10101872 Ga0157374_101018722 437
444 3300017792 Ga0163161_10038949 Ga0163161_100389493 437
445 3300025901 Ga0207688_10035841 Ga0207688_100358413 437
446 3300026089 Ga0207648_10210766 Ga0207648_102107662 437
447 3300037853 Ga0436364_0206485 Ga0436364_0206485_4535_5881 437
448 3300044765 Ga0466970_0002336 Ga0466970_0002336_7089_8414 437
449 3300048905 Ga0496102_0000596 Ga0496102_0000596_21936_23264 437
450 3300048906 Ga0496103_0054242 Ga0496103_0054242_122_1450 437
451 3300048927 Ga0496124_0024555 Ga0496124_0024555_100_1422 437
452 3300049571 Ga0501034_0026165 Ga0501034_0026165_2467_3807 437
453 3300053077 Ga0495601_0059509 Ga0495601_0059509_103_1452 437
454 iso_pu_bacteria 2643221632 2644184016 437
455 iso_pu_bacteria 2738543005 2739203666 437
456 iso_pu_bacteria 2739367653 2739604111 437
457 iso_pu_bacteria 2816332305 2817509876 437
458 iso_pu_bacteria 2857727296 2857727535 437
459 iso_pu_bacteria 2857729791 2857732304 437
460 iso_pu_bacteria 2870622029 2870622359 437
461 iso_pu_bacteria 2902810491 2902812340 437
462 iso_pu_bacteria 2920879853 2920883143 437
463 iso_pu_bacteria 2928121344 2928124804 437
464 iso_pu_bacteria 8046352972 8046355678 437
465 3300002067 JGI24735J21928_10017543 JGI24735J21928_100175432 438
466 3300005327 Ga0070658_10013145 Ga0070658_100131453 438
467 3300005327 Ga0070658_10055535 Ga0070658_100555352 438
468 3300005338 Ga0068868_100004201 Ga0068868_10000420111 438
469 3300005339 Ga0070660_100101530 Ga0070660_1001015301 438
470 3300005344 Ga0070661_100099719 Ga0070661_1000997193 438
471 3300005344 Ga0070661_100106607 Ga0070661_1001066071 438
472 3300005347 Ga0070668_100020218 Ga0070668_1000202185 438
473 3300005354 Ga0070675_100155834 Ga0070675_1001558341 438
474 3300005356 Ga0070674_100084710 Ga0070674_1000847101 438
475 3300005366 Ga0070659_100005597 Ga0070659_1000055973 438
476 3300005366 Ga0070659_100020191 Ga0070659_1000201911 438
477 3300005367 Ga0070667_100001524 Ga0070667_10000152417 438
478 3300005436 Ga0070713_100017302 Ga0070713_1000173023 438
479 3300005438 Ga0070701_10033478 Ga0070701_100334784 438
480 3300005440 Ga0070705_100057691 Ga0070705_1000576913 438
481 3300005444 Ga0070694_100005751 Ga0070694_1000057515 438
482 3300005466 Ga0070685_10002766 Ga0070685_100027664 438
483 3300005535 Ga0070684_100126666 Ga0070684_1001266662 438
484 3300005539 Ga0068853_100165585 Ga0068853_1001655852 438
485 3300005545 Ga0070695_100015011 Ga0070695_1000150111 438
486 3300005549 Ga0070704_100002347 Ga0070704_10000234711 438
487 3300005563 Ga0068855_100004547 Ga0068855_1000045475 438
488 3300005563 Ga0068855_100006713 Ga0068855_1000067133 438
489 3300005563 Ga0068855_100086849 Ga0068855_1000868492 438
490 3300005563 Ga0068855_100209765 Ga0068855_1002097653 438
491 3300005577 Ga0068857_100003425 Ga0068857_1000034259 438
492 3300005614 Ga0068856_100005605 Ga0068856_1000056059 438
493 3300005614 Ga0068856_100022233 Ga0068856_1000222333 438
494 3300005615 Ga0070702_100003327 Ga0070702_1000033275 438
495 3300005616 Ga0068852_100005871 Ga0068852_1000058712 438
496 3300005616 Ga0068852_100040501 Ga0068852_1000405013 438
497 3300005616 Ga0068852_100139191 Ga0068852_1001391914 438
498 3300005719 Ga0068861_100057183 Ga0068861_1000571833 438
499 3300005834 Ga0068851_10000005 Ga0068851_10000005120 438
500 3300005840 Ga0068870_10020159 Ga0068870_100201592 438
501 3300005842 Ga0068858_100000058 Ga0068858_10000005883 438
502 3300005842 Ga0068858_100202669 Ga0068858_1002026691 438
503 3300005843 Ga0068860_100020377 Ga0068860_1000203772 438
504 3300005983 Ga0081540_1001571 Ga0081540_100157117 438
505 3300006028 Ga0070717_10016290 Ga0070717_100162904 438
506 3300006237 Ga0097621_100027509 Ga0097621_1000275093 438
507 3300009093 Ga0105240_10009128 Ga0105240_100091289 438
508 3300009093 Ga0105240_10064152 Ga0105240_100641524 438
509 3300009093 Ga0105240_10196807 Ga0105240_101968073 438
510 3300009148 Ga0105243_10181781 Ga0105243_101817812 438
511 3300009174 Ga0105241_10000772 Ga0105241_100007727 438
512 3300009176 Ga0105242_10035350 Ga0105242_100353502 438
513 3300009177 Ga0105248_10046208 Ga0105248_100462083 438
514 3300009177 Ga0105248_10100427 Ga0105248_101004273 438
515 3300009545 Ga0105237_10002853 Ga0105237_1000285312 438
516 3300009545 Ga0105237_10051012 Ga0105237_100510121 438
517 3300010375 Ga0105239_10393219 Ga0105239_103932192 438
518 3300011119 Ga0105246_10072017 Ga0105246_100720173 438
519 3300013102 Ga0157371_10043457 Ga0157371_100434571 438
520 3300013104 Ga0157370_10033203 Ga0157370_100332032 438
521 3300013296 Ga0157374_10111570 Ga0157374_101115702 438
522 3300013297 Ga0157378_10016267 Ga0157378_100162675 438
523 3300013306 Ga0163162_10010744 Ga0163162_100107444 438
524 3300013307 Ga0157372_10014423 Ga0157372_100144234 438
525 3300014326 Ga0157380_10128422 Ga0157380_101284223 438
526 3300014968 Ga0157379_10017719 Ga0157379_100177193 438
527 3300014969 Ga0157376_10222520 Ga0157376_102225202 438
528 3300017792 Ga0163161_10020533 Ga0163161_100205334 438
529 3300020082 Ga0206353_10717049 Ga0206353_107170492 438
530 3300025254 Ga0209148_1000907 Ga0209148_100090713 438
531 3300025321 Ga0207656_10000001 Ga0207656_10000001181 438
532 3300025321 Ga0207656_10000003 Ga0207656_10000003287 438
533 3300025321 Ga0207656_10000004 Ga0207656_10000004144 438
534 3300025901 Ga0207688_10001953 Ga0207688_100019531 438
535 3300025903 Ga0207680_10031683 Ga0207680_100316833 438
536 3300025909 Ga0207705_10004458 Ga0207705_1000445811 438
537 3300025909 Ga0207705_10140811 Ga0207705_101408112 438
538 3300025911 Ga0207654_10000003 Ga0207654_10000003501 438
539 3300025913 Ga0207695_10013965 Ga0207695_100139653 438
540 3300025913 Ga0207695_10050781 Ga0207695_100507814 438
541 3300025914 Ga0207671_10000001 Ga0207671_10000001179 438
542 3300025915 Ga0207693_10018010 Ga0207693_100180102 438
543 3300025919 Ga0207657_10003219 Ga0207657_100032198 438
544 3300025919 Ga0207657_10172647 Ga0207657_101726472 438
545 3300025920 Ga0207649_10019926 Ga0207649_100199262 438
546 3300025924 Ga0207694_10000039 Ga0207694_10000039167 438
547 3300025927 Ga0207687_10020145 Ga0207687_100201454 438
548 3300025932 Ga0207690_10001473 Ga0207690_100014737 438
549 3300025932 Ga0207690_10057859 Ga0207690_100578593 438
550 3300025935 Ga0207709_10014342 Ga0207709_100143422 438
551 3300025939 Ga0207665_10000995 Ga0207665_1000099520 438
552 3300025941 Ga0207711_10015199 Ga0207711_100151994 438
553 3300025949 Ga0207667_10002609 Ga0207667_1000260911 438
554 3300025949 Ga0207667_10018589 Ga0207667_100185893 438
555 3300025949 Ga0207667_10104838 Ga0207667_101048382 438
556 3300025949 Ga0207667_10236499 Ga0207667_102364992 438
557 3300025981 Ga0207640_10057688 Ga0207640_100576881 438
558 3300026035 Ga0207703_10000026 Ga0207703_100000267 438
559 3300026067 Ga0207678_10001903 Ga0207678_1000190317 438
560 3300026078 Ga0207702_10026441 Ga0207702_100264412 438
561 3300026078 Ga0207702_10103335 Ga0207702_101033352 438
562 3300026078 Ga0207702_10132370 Ga0207702_101323701 438
563 3300026116 Ga0207674_10006493 Ga0207674_100064938 438
564 3300026116 Ga0207674_10080496 Ga0207674_100804963 438
565 3300026118 Ga0207675_100013715 Ga0207675_1000137152 438
566 3300026121 Ga0207683_10008837 Ga0207683_100088375 438
567 3300026142 Ga0207698_10001479 Ga0207698_100014798 438
568 3300028381 Ga0268264_10121427 Ga0268264_101214273 438
569 3300031247 Ga0265340_10017009 Ga0265340_100170093 438
570 3300035112 Ga0373932_0008770 Ga0373932_0008770_915_2324 438
571 3300037466 Ga0395898_0169526 Ga0395898_0169526_190_1515 438
572 3300037853 Ga0436364_0540807 Ga0436364_0540807_1065_2402 438
573 3300044683 Ga0466965_0000033 Ga0466965_0000033_27937_29259 438
574 3300044693 Ga0466961_0053842 Ga0466961_0053842_405_1736 438
575 3300044842 Ga0466957_0138971 Ga0466957_0138971_153_1484 438
576 3300048907 Ga0496104_0047128 Ga0496104_0047128_762_2171 438
577 3300048911 Ga0496108_0023924 Ga0496108_0023924_2326_3735 438
578 3300048917 Ga0496114_0218840 Ga0496114_0218840_231_1640 438
579 3300048929 Ga0496126_0000090 Ga0496126_0000090_180429_181760 438
580 3300049569 Ga0501032_0006594 Ga0501032_0006594_3742_5064 438
581 3300049570 Ga0501033_0028033 Ga0501033_0028033_810_2132 438
582 3300049570 Ga0501033_0036462 Ga0501033_0036462_1364_2686 438
583 3300049571 Ga0501034_0078355 Ga0501034_0078355_1657_2979 438
584 3300049571 Ga0501034_0107146 Ga0501034_0107146_366_1688 438
585 3300049573 Ga0501037_0051933 Ga0501037_0051933_1190_2512 438
586 3300049574 Ga0501038_0005310 Ga0501038_0005310_2139_3461 438
587 3300049581 Ga0501047_0040928 Ga0501047_0040928_2929_4251 438
588 3300050512 nmdc:mga0n895_19316_c1 nmdc:mga0n895_19316_c1_603_2012 438
589 3300050513 nmdc:mga0rr50_23628_c1 nmdc:mga0rr50_23628_c1_2819_4228 438
590 3300053139 Ga0500568_0000970 Ga0500568_0000970_1134_2456 438
591 3300053140 Ga0500573_0024571 Ga0500573_0024571_1835_3157 438
592 3300053140 Ga0500573_0037001 Ga0500573_0037001_71_1393 438
593 3300053148 Ga0500590_004738 Ga0500590_004738_3507_4829 438
594 3300053155 Ga0500620_001941 Ga0500620_001941_2472_3794 438
595 3300005366 Ga0070659_100116379 Ga0070659_1001163792 439
596 3300005435 Ga0070714_100000011 Ga0070714_100000011194 439
597 3300005435 Ga0070714_100275073 Ga0070714_1002750731 439
598 3300005543 Ga0070672_100052179 Ga0070672_1000521792 439
599 3300005548 Ga0070665_100032143 Ga0070665_1000321433 439
600 3300005563 Ga0068855_100016017 Ga0068855_1000160178 439
601 3300005563 Ga0068855_100062487 Ga0068855_1000624873 439
602 3300005563 Ga0068855_100116992 Ga0068855_1001169922 439
603 3300005578 Ga0068854_100007727 Ga0068854_1000077274 439
604 3300005614 Ga0068856_100054151 Ga0068856_1000541513 439
605 3300005616 Ga0068852_100008555 Ga0068852_1000085553 439
606 3300005616 Ga0068852_100015780 Ga0068852_1000157802 439
607 3300005616 Ga0068852_100203944 Ga0068852_1002039442 439
608 3300005617 Ga0068859_100015246 Ga0068859_1000152463 439
609 3300006051 Ga0075364_10002585 Ga0075364_100025853 439
610 3300006931 Ga0097620_100015246 Ga0097620_1000152466 439
611 3300009093 Ga0105240_10021145 Ga0105240_100211454 439
612 3300009098 Ga0105245_10066101 Ga0105245_100661012 439
613 3300009098 Ga0105245_10195087 Ga0105245_101950872 439
614 3300009174 Ga0105241_10003418 Ga0105241_100034182 439
615 3300009177 Ga0105248_10000784 Ga0105248_1000078415 439
616 3300009551 Ga0105238_10011164 Ga0105238_100111646 439
617 3300013296 Ga0157374_10024129 Ga0157374_100241292 439
618 3300013307 Ga0157372_10000006 Ga0157372_10000006166 439
619 3300014325 Ga0163163_10001963 Ga0163163_100019632 439
620 3300020077 Ga0206351_10892666 Ga0206351_108926663 439
621 3300025911 Ga0207654_10059581 Ga0207654_100595813 439
622 3300025913 Ga0207695_10001477 Ga0207695_1000147733 439
623 3300025913 Ga0207695_10025708 Ga0207695_100257084 439
624 3300025914 Ga0207671_10000445 Ga0207671_1000044533 439
625 3300025916 Ga0207663_10122342 Ga0207663_101223421 439
626 3300025924 Ga0207694_10012986 Ga0207694_100129864 439
627 3300025927 Ga0207687_10040450 Ga0207687_100404503 439
628 3300025928 Ga0207700_10052281 Ga0207700_100522812 439
629 3300025929 Ga0207664_10000001 Ga0207664_10000001317 439
630 3300025929 Ga0207664_10001639 Ga0207664_100016399 439
631 3300025940 Ga0207691_10069059 Ga0207691_100690592 439
632 3300025941 Ga0207711_10000881 Ga0207711_100008819 439
633 3300025949 Ga0207667_10016601 Ga0207667_100166012 439
634 3300025949 Ga0207667_10081943 Ga0207667_100819433 439
635 3300026041 Ga0207639_10223339 Ga0207639_102233391 439
636 3300026067 Ga0207678_10127003 Ga0207678_101270031 439
637 3300026075 Ga0207708_10000002 Ga0207708_10000002229 439
638 3300026078 Ga0207702_10034660 Ga0207702_100346602 439
639 3300026142 Ga0207698_10001813 Ga0207698_1000181311 439
640 3300026142 Ga0207698_10005852 Ga0207698_100058522 439
641 3300026142 Ga0207698_10070822 Ga0207698_100708221 439
642 3300028794 Ga0307515_10227977 Ga0307515_102279771 439
643 3300031665 Ga0316575_10005460 Ga0316575_100054602 439
644 3300031727 Ga0316576_10000264 Ga0316576_100002645 439
645 3300032002 Ga0307416_100087560 Ga0307416_1000875602 439
646 3300032002 Ga0307416_100301960 Ga0307416_1003019601 439
647 3300035118 Ga0373954_0031152 Ga0373954_0031152_514_1881 439
648 3300035724 Ga0373933_0007701 Ga0373933_0007701_1925_3292 439
649 3300036647 Ga0316582_0030200 Ga0316582_0030200_1001_2362 439
650 3300036712 Ga0316584_0005941 Ga0316584_0005941_4660_6021 439
651 3300037853 Ga0436364_0151261 Ga0436364_0151261_3987_5339 439
652 3300044658 Ga0466972_0000561 Ga0466972_0000561_11205_12539 439
653 3300044658 Ga0466972_0024084 Ga0466972_0024084_1123_2454 439
654 3300044683 Ga0466965_0016329 Ga0466965_0016329_1621_2952 439
655 3300044684 Ga0466966_0013174 Ga0466966_0013174_435_1766 439
656 3300044684 Ga0466966_0047307 Ga0466966_0047307_676_2007 439
657 3300044693 Ga0466961_0001757 Ga0466961_0001757_6797_8128 439
658 3300044693 Ga0466961_0005395 Ga0466961_0005395_2001_3332 439
659 3300044693 Ga0466961_0118351 Ga0466961_0118351_16_1347 439
660 3300044694 Ga0466963_0001901 Ga0466963_0001901_9089_10423 439
661 3300044694 Ga0466963_0003409 Ga0466963_0003409_4287_5621 439
662 3300044694 Ga0466963_0005394 Ga0466963_0005394_1634_2968 439
663 3300044694 Ga0466963_0016029 Ga0466963_0016029_1847_3178 439
664 3300044694 Ga0466963_0056721 Ga0466963_0056721_761_2092 439
665 3300044694 Ga0466963_0098471 Ga0466963_0098471_116_1447 439
666 3300044719 Ga0466971_0040714 Ga0466971_0040714_614_1957 439
667 3300044842 Ga0466957_0020263 Ga0466957_0020263_1317_2648 439
668 3300044901 Ga0466960_0009176 Ga0466960_0009176_329_1684 439
669 3300044901 Ga0466960_0021518 Ga0466960_0021518_693_2024 439
670 3300044901 Ga0466960_0069360 Ga0466960_0069360_381_1700 439
671 3300044901 Ga0466960_0082756 Ga0466960_0082756_153_1484 439
672 3300045049 Ga0466959_0038424 Ga0466959_0038424_2076_3407 439
673 3300045836 Ga0466958_0002571 Ga0466958_0002571_3370_4701 439
674 3300045836 Ga0466958_0029484 Ga0466958_0029484_69_1400 439
675 3300045836 Ga0466958_0039593 Ga0466958_0039593_504_1838 439
676 3300045836 Ga0466958_0112114 Ga0466958_0112114_191_1525 439
677 3300045836 Ga0466958_0122299 Ga0466958_0122299_44_1378 439
678 3300045976 Ga0466967_0002082 Ga0466967_0002082_7928_9259 439
679 3300045976 Ga0466967_0005091 Ga0466967_0005091_1020_2354 439
680 3300045976 Ga0466967_0082103 Ga0466967_0082103_426_1757 439
681 3300045976 Ga0466967_0108688 Ga0466967_0108688_673_2013 439
682 3300045976 Ga0466967_0132620 Ga0466967_0132620_390_1730 439
683 3300045976 Ga0466967_0136992 Ga0466967_0136992_476_1807 439
684 3300046454 Ga0495592_0002850 Ga0495592_0002850_4424_5755 439
685 3300046459 Ga0495629_0005572 Ga0495629_0005572_1546_2877 439
686 3300046462 Ga0495651_0011383 Ga0495651_0011383_53_1384 439
687 3300046462 Ga0495651_0142234 Ga0495651_0142234_317_1648 439
688 3300046463 Ga0495653_0018739 Ga0495653_0018739_414_1781 439
689 3300046477 Ga0495664_0037228 Ga0495664_0037228_965_2296 439
690 3300046511 Ga0495608_0017964 Ga0495608_0017964_3074_4441 439
691 3300046514 Ga0495618_0130751 Ga0495618_0130751_34_1365 439
692 3300046516 Ga0495628_0011141 Ga0495628_0011141_6241_7572 439
693 3300046516 Ga0495628_0030202 Ga0495628_0030202_2144_3475 439
694 3300046529 Ga0495652_0050293 Ga0495652_0050293_2149_3480 439
695 3300046529 Ga0495652_0074837 Ga0495652_0074837_1085_2416 439
696 3300046533 Ga0495640_0079305 Ga0495640_0079305_741_2108 439
697 3300046543 Ga0495645_0034852 Ga0495645_0034852_2209_3540 439
698 3300046559 Ga0495667_0018638 Ga0495667_0018638_2449_3816 439
699 3300046559 Ga0495667_0062859 Ga0495667_0062859_499_1830 439
700 3300046642 Ga0495634_0003876 Ga0495634_0003876_4247_5578 439
701 3300046675 Ga0495657_0016894 Ga0495657_0016894_294_1661 439
702 3300046679 Ga0495623_0070403 Ga0495623_0070403_462_1793 439
703 3300046689 Ga0495613_0003455 Ga0495613_0003455_4434_5765 439
704 3300046690 Ga0495624_0097768 Ga0495624_0097768_351_1682 439
705 3300046809 Ga0495600_0024182 Ga0495600_0024182_1485_2816 439
706 3300047315 Ga0495581_0028214 Ga0495581_0028214_948_2279 439
707 3300047317 Ga0495604_0031876 Ga0495604_0031876_1807_3138 439
708 3300047321 Ga0495676_0003177 Ga0495676_0003177_8718_10049 439
709 3300047471 Ga0495684_0014031 Ga0495684_0014031_4464_5831 439
710 3300048088 Ga0495602_0061044 Ga0495602_0061044_1467_2834 439
711 3300048904 Ga0496101_0028268 Ga0496101_0028268_1238_2569 439
712 3300048905 Ga0496102_0000013 Ga0496102_0000013_73802_75133 439
713 3300048906 Ga0496103_0000039 Ga0496103_0000039_20234_21565 439
714 3300048917 Ga0496114_0187082 Ga0496114_0187082_328_1659 439
715 3300048920 Ga0496117_0011653 Ga0496117_0011653_3896_5221 439
716 3300048921 Ga0496118_0036390 Ga0496118_0036390_2361_3692 439
717 3300048921 Ga0496118_0039440 Ga0496118_0039440_692_2017 439
718 3300048922 Ga0496119_0000022 Ga0496119_0000022_196674_198008 439
719 3300048922 Ga0496119_0008239 Ga0496119_0008239_4243_5568 439
720 3300048922 Ga0496119_0009570 Ga0496119_0009570_5614_6945 439
721 3300048923 Ga0496120_0000856 Ga0496120_0000856_30519_31844 439
722 3300048923 Ga0496120_0002970 Ga0496120_0002970_1862_3196 439
723 3300048924 Ga0496121_0081195 Ga0496121_0081195_739_2070 439
724 3300049569 Ga0501032_0046696 Ga0501032_0046696_1207_2541 439
725 3300049574 Ga0501038_0000874 Ga0501038_0000874_11710_13044 439
726 3300049581 Ga0501047_0001249 Ga0501047_0001249_10463_11797 439
727 3300049582 Ga0501048_0000373 Ga0501048_0000373_8813_10147 439
728 3300049586 Ga0501070_0166188 Ga0501070_0166188_350_1684 439
729 3300049589 Ga0501073_0000222 Ga0501073_0000222_24661_25986 439
730 3300049742 Ga0501080_0035655 Ga0501080_0035655_3230_4555 439
731 3300050491 nmdc:mga00v17_2173_c1 nmdc:mga00v17_2173_c1_1840_3165 439
732 3300050491 nmdc:mga00v17_65464_c1 nmdc:mga00v17_65464_c1_65_1390 439
733 3300050516 nmdc:mga0sz30_39630_c1 nmdc:mga0sz30_39630_c1_339_1664 439
734 3300050516 nmdc:mga0sz30_57802_c1 nmdc:mga0sz30_57802_c1_263_1588 439
735 3300053085 Ga0495619_0008758 Ga0495619_0008758_3174_4505 439
736 3300053104 Ga0500556_0000421 Ga0500556_0000421_17210_18535 439
737 3300053108 Ga0500562_002205 Ga0500562_002205_3406_4731 439
738 3300053117 Ga0500593_011246 Ga0500593_011246_2282_3607 439
739 3300053136 Ga0500559_0000561 Ga0500559_0000561_3148_4473 439
740 3300053139 Ga0500568_0000098 Ga0500568_0000098_51897_53225 439
741 3300053142 Ga0500577_0025316 Ga0500577_0025316_294_1628 439
742 3300053153 Ga0500616_0001673 Ga0500616_0001673_1756_3207 439
743 3300061719 Ga0466962_0010186 Ga0466962_0010186_2379_3710 439
744 3300061719 Ga0466962_0064430 Ga0466962_0064430_135_1475 439
745 iso_pu_bacteria 2643221576 2643889583 439
746 iso_pu_bacteria 2643221590 2643958639 439
747 iso_pu_bacteria 2643221679 2644446523 439
748 iso_pu_bacteria 2808606365 2808872930 439
749 3300005328 Ga0070676_10007535 Ga0070676_100075354 440
750 3300005331 Ga0070670_100038542 Ga0070670_1000385423 440
751 3300005334 Ga0068869_100004828 Ga0068869_1000048286 440
752 3300005338 Ga0068868_100004550 Ga0068868_1000045502 440
753 3300005339 Ga0070660_100133600 Ga0070660_1001336002 440
754 3300005354 Ga0070675_100003751 Ga0070675_1000037514 440
755 3300005455 Ga0070663_100068386 Ga0070663_1000683862 440
756 3300005457 Ga0070662_100014295 Ga0070662_1000142953 440
757 3300005530 Ga0070679_100205955 Ga0070679_1002059552 440
758 3300005535 Ga0070684_100024465 Ga0070684_1000244653 440
759 3300005547 Ga0070693_100124834 Ga0070693_1001248341 440
760 3300005564 Ga0070664_100001657 Ga0070664_1000016574 440
761 3300005564 Ga0070664_100013266 Ga0070664_1000132662 440
762 3300005577 Ga0068857_100006889 Ga0068857_1000068894 440
763 3300005615 Ga0070702_100039852 Ga0070702_1000398522 440
764 3300005844 Ga0068862_100013889 Ga0068862_1000138895 440
765 3300009094 Ga0111539_10016741 Ga0111539_100167412 440
766 3300009098 Ga0105245_10255111 Ga0105245_102551112 440
767 3300021358 Ga0213873_10000163 Ga0213873_100001633 440
768 3300021388 Ga0213875_10003242 Ga0213875_100032424 440
769 3300025910 Ga0207684_10059824 Ga0207684_100598242 440
770 3300025919 Ga0207657_10083944 Ga0207657_100839443 440
771 3300025925 Ga0207650_10046281 Ga0207650_100462812 440
772 3300025926 Ga0207659_10002929 Ga0207659_100029299 440
773 3300025933 Ga0207706_10019341 Ga0207706_100193413 440
774 3300025942 Ga0207689_10002842 Ga0207689_1000284215 440
775 3300025945 Ga0207679_10004464 Ga0207679_100044644 440
776 3300026023 Ga0207677_10010033 Ga0207677_100100332 440
777 3300026067 Ga0207678_10077611 Ga0207678_100776112 440
778 3300026075 Ga0207708_10028771 Ga0207708_100287713 440
779 3300026116 Ga0207674_10015449 Ga0207674_100154494 440
780 3300026121 Ga0207683_10122255 Ga0207683_101222552 440
781 3300027907 Ga0207428_10181296 Ga0207428_101812962 440
782 3300028380 Ga0268265_10010662 Ga0268265_100106624 440
783 3300031901 Ga0307406_10065433 Ga0307406_100654332 440
784 3300031995 Ga0307409_100046231 Ga0307409_1000462312 440
785 3300032126 Ga0307415_100095214 Ga0307415_1000952142 440
786 3300037853 Ga0436364_1391037 Ga0436364_1391037_71_1447 440
787 3300037853 Ga0436364_1522620 Ga0436364_1522620_2287_3636 440
788 3300039437 Ga0436365_1505452 Ga0436365_1505452_603_1952 440
789 3300048914 Ga0496111_0013543 Ga0496111_0013543_2660_3994 440
790 3300050511 nmdc:mga08y16_296204_c1 nmdc:mga08y16_296204_c1_186_1520 440
791 3300053153 Ga0500616_0005443 Ga0500616_0005443_64_1395 440
792 iso_pu_bacteria 2643221690 2644506582 440
793 iso_pu_bacteria 2643221694 2644526504 440
794 iso_pu_bacteria 2643221722 2644671170 440
795 iso_pu_bacteria 2857481737 2857482011 440
796 3300005327 Ga0070658_10008436 Ga0070658_100084368 441
797 3300005367 Ga0070667_100009171 Ga0070667_1000091712 441
798 3300013105 Ga0157369_10000631 Ga0157369_1000063116 441
799 3300013105 Ga0157369_10092850 Ga0157369_100928504 441
800 3300025909 Ga0207705_10091463 Ga0207705_100914632 441
801 3300031251 Ga0265327_10000303 Ga0265327_1000030341 441
802 3300045976 Ga0466967_0155512 Ga0466967_0155512_471_1907 441
803 3300048929 Ga0496126_0065298 Ga0496126_0065298_1734_3068 441
804 3300048929 Ga0496126_0098756 Ga0496126_0098756_618_1952 441
805 3300049569 Ga0501032_0104282 Ga0501032_0104282_249_1586 441
806 3300049580 Ga0501046_0035397 Ga0501046_0035397_2606_3952 441
807 3300061719 Ga0466962_0030612 Ga0466962_0030612_340_1710 441
808 iso_pu_bacteria 8053945823 8053950053 441
809 3300005328 Ga0070676_10009094 Ga0070676_100090943 442
810 3300005336 Ga0070680_100013556 Ga0070680_1000135564 442
811 3300005337 Ga0070682_100002099 Ga0070682_1000020992 442
812 3300005339 Ga0070660_100101912 Ga0070660_1001019122 442
813 3300005345 Ga0070692_10007890 Ga0070692_100078903 442
814 3300005354 Ga0070675_100030129 Ga0070675_1000301292 442
815 3300005355 Ga0070671_100056340 Ga0070671_1000563402 442
816 3300005364 Ga0070673_100056609 Ga0070673_1000566092 442
817 3300005366 Ga0070659_100144114 Ga0070659_1001441142 442
818 3300005436 Ga0070713_100026414 Ga0070713_1000264143 442
819 3300005456 Ga0070678_100035992 Ga0070678_1000359922 442
820 3300005530 Ga0070679_100046281 Ga0070679_1000462812 442
821 3300005547 Ga0070693_100004316 Ga0070693_1000043165 442
822 3300005563 Ga0068855_100295895 Ga0068855_1002958952 442
823 3300005578 Ga0068854_100051958 Ga0068854_1000519582 442
824 3300005614 Ga0068856_100013115 Ga0068856_1000131153 442
825 3300005617 Ga0068859_100020598 Ga0068859_1000205984 442
826 3300005834 Ga0068851_10062942 Ga0068851_100629422 442
827 3300005840 Ga0068870_10000471 Ga0068870_100004712 442
828 3300005841 Ga0068863_100004781 Ga0068863_1000047817 442
829 3300005842 Ga0068858_100080479 Ga0068858_1000804792 442
830 3300006028 Ga0070717_10130606 Ga0070717_101306062 442
831 3300006048 Ga0075363_100010515 Ga0075363_1000105153 442
832 3300006237 Ga0097621_100052359 Ga0097621_1000523592 442
833 3300006852 Ga0075433_10003602 Ga0075433_100036022 442
834 3300006871 Ga0075434_100001339 Ga0075434_10000133911 442
835 3300006931 Ga0097620_100020599 Ga0097620_1000205994 442
836 3300007076 Ga0075435_100048134 Ga0075435_1000481343 442
837 3300009148 Ga0105243_10063408 Ga0105243_100634082 442
838 3300009551 Ga0105238_10132824 Ga0105238_101328242 442
839 3300013100 Ga0157373_10032874 Ga0157373_100328742 442
840 3300013104 Ga0157370_10030047 Ga0157370_100300473 442
841 3300013307 Ga0157372_10104477 Ga0157372_101044772 442
842 3300013308 Ga0157375_10063593 Ga0157375_100635932 442
843 3300014497 Ga0182008_10027165 Ga0182008_100271653 442
844 3300014745 Ga0157377_10003806 Ga0157377_100038064 442
845 3300025900 Ga0207710_10014744 Ga0207710_100147442 442
846 3300025901 Ga0207688_10002486 Ga0207688_100024862 442
847 3300025903 Ga0207680_10110254 Ga0207680_101102542 442
848 3300025908 Ga0207643_10001695 Ga0207643_1000169510 442
849 3300025912 Ga0207707_10129896 Ga0207707_101298962 442
850 3300025917 Ga0207660_10053263 Ga0207660_100532632 442
851 3300025919 Ga0207657_10008017 Ga0207657_100080176 442
852 3300025921 Ga0207652_10078970 Ga0207652_100789702 442
853 3300025926 Ga0207659_10036838 Ga0207659_100368382 442
854 3300025929 Ga0207664_10000648 Ga0207664_1000064810 442
855 3300025929 Ga0207664_10066907 Ga0207664_100669071 442
856 3300025942 Ga0207689_10000812 Ga0207689_100008125 442
857 3300025945 Ga0207679_10009676 Ga0207679_100096764 442
858 3300026023 Ga0207677_10043878 Ga0207677_100438782 442
859 3300026067 Ga0207678_10005054 Ga0207678_100050543 442
860 3300026078 Ga0207702_10001341 Ga0207702_100013418 442
861 3300026078 Ga0207702_10006747 Ga0207702_100067472 442
862 3300026095 Ga0207676_10001905 Ga0207676_100019052 442
863 3300026121 Ga0207683_10000772 Ga0207683_1000077212 442
864 3300027866 Ga0209813_10002341 Ga0209813_100023413 442
865 3300027907 Ga0207428_10061848 Ga0207428_100618482 442
866 3300031824 Ga0307413_10073600 Ga0307413_100736001 442
867 3300044765 Ga0466970_0057098 Ga0466970_0057098_239_1612 442
868 3300045049 Ga0466959_0097432 Ga0466959_0097432_547_1920 442
869 3300045976 Ga0466967_0071041 Ga0466967_0071041_1043_2416 442
870 3300048905 Ga0496102_0086146 Ga0496102_0086146_595_1938 442
871 3300048905 Ga0496102_0093133 Ga0496102_0093133_69_1439 442
872 3300048906 Ga0496103_0133693 Ga0496103_0133693_192_1562 442
873 3300048908 Ga0496105_0015802 Ga0496105_0015802_3944_5314 442
874 3300048908 Ga0496105_0075183 Ga0496105_0075183_1394_2737 442
875 3300048909 Ga0496106_0009107 Ga0496106_0009107_1442_2812 442
876 3300048911 Ga0496108_0039627 Ga0496108_0039627_1000_2343 442
877 3300048912 Ga0496109_0004908 Ga0496109_0004908_2103_3446 442
878 3300048912 Ga0496109_0070694 Ga0496109_0070694_1130_2500 442
879 3300048913 Ga0496110_0029903 Ga0496110_0029903_3338_4681 442
880 3300048914 Ga0496111_0002416 Ga0496111_0002416_5974_7317 442
881 3300048915 Ga0496112_0014487 Ga0496112_0014487_3555_4898 442
882 3300048917 Ga0496114_0048817 Ga0496114_0048817_1168_2511 442
883 3300048918 Ga0496115_0037599 Ga0496115_0037599_1924_3294 442
884 3300050494 nmdc:mga06z11_2278_c1 nmdc:mga06z11_2278_c1_410_1762 442
885 3300050511 nmdc:mga08y16_16524_c1 nmdc:mga08y16_16524_c1_1927_3297 442
886 3300050512 nmdc:mga0n895_5628_c1 nmdc:mga0n895_5628_c1_4969_6339 442
887 3300050513 nmdc:mga0rr50_5853_c1 nmdc:mga0rr50_5853_c1_1522_2892 442
888 3300050514 nmdc:mga08x19_4958_c1 nmdc:mga08x19_4958_c1_4923_6293 442
889 iso_pu_bacteria 2579778521 2579852800 442
890 iso_pu_bacteria 2619618881 2619856613 442
891 iso_pu_bacteria 2619619003 2620348820 442
892 iso_pu_bacteria 2626541554 2626636116 442
893 iso_pu_bacteria 2626541554 2626640275 442
894 iso_pu_bacteria 2728369276 2729905574 442
895 iso_pu_bacteria 2773857758 2774381069 442
896 iso_pu_bacteria 2862705112 2862706851 442
897 iso_pu_bacteria 2867346516 2867350915 442
898 iso_pu_bacteria 2904509784 2904511047 442
899 iso_pu_bacteria 2908678064 2908680203 442
900 iso_pu_bacteria 2919069694 2919072404 442
901 iso_pu_bacteria 2974294766 2974296360 442
902 iso_pu_bacteria 2974324384 2974327405 442
903 iso_pu_bacteria 2977228692 2977229027 442
904 iso_pu_bacteria 2984542743 2984544404 442
905 iso_pu_bacteria 2990044586 2990045954 442
906 iso_pu_bacteria 8008485437 8008487276 442
907 iso_pu_bacteria 8025524527 8025526291 442
908 3300005327 Ga0070658_10002566 Ga0070658_1000256614 443
909 3300005329 Ga0070683_100098967 Ga0070683_1000989673 443
910 3300005367 Ga0070667_100022147 Ga0070667_1000221474 443
911 3300005548 Ga0070665_100155578 Ga0070665_1001555782 443
912 3300005563 Ga0068855_100133514 Ga0068855_1001335142 443
913 3300005843 Ga0068860_100000451 Ga0068860_10000045135 443
914 3300005937 Ga0081455_10003611 Ga0081455_100036117 443
915 3300005937 Ga0081455_10104478 Ga0081455_101044782 443
916 3300005983 Ga0081540_1013835 Ga0081540_10138355 443
917 3300005985 Ga0081539_10050241 Ga0081539_100502411 443
918 3300006038 Ga0075365_10054164 Ga0075365_100541643 443
919 3300006178 Ga0075367_10001320 Ga0075367_100013209 443
920 3300006847 Ga0075431_100055387 Ga0075431_1000553871 443
921 3300006880 Ga0075429_100002730 Ga0075429_10000273012 443
922 3300009094 Ga0111539_10007834 Ga0111539_100078345 443
923 3300009147 Ga0114129_10220626 Ga0114129_102206262 443
924 3300010375 Ga0105239_10063730 Ga0105239_100637303 443
925 3300013104 Ga0157370_10138642 Ga0157370_101386421 443
926 3300013308 Ga0157375_10187845 Ga0157375_101878452 443
927 3300025909 Ga0207705_10030066 Ga0207705_100300663 443
928 3300025944 Ga0207661_10095635 Ga0207661_100956351 443
929 3300025949 Ga0207667_10109884 Ga0207667_101098843 443
930 3300025986 Ga0207658_10013608 Ga0207658_100136082 443
931 3300027907 Ga0207428_10000976 Ga0207428_1000097627 443
932 3300028381 Ga0268264_10003254 Ga0268264_1000325413 443
933 3300032002 Ga0307416_100193370 Ga0307416_1001933702 443
934 3300037312 Ga0395899_0003096 Ga0395899_0003096_10967_12325 443
935 3300048907 Ga0496104_0169183 Ga0496104_0169183_625_1956 443
936 3300048920 Ga0496117_0065167 Ga0496117_0065167_544_1899 443
937 3300048922 Ga0496119_0002150 Ga0496119_0002150_5543_6904 443
938 3300048922 Ga0496119_0009414 Ga0496119_0009414_5591_6946 443
939 3300048923 Ga0496120_0001757 Ga0496120_0001757_14595_15950 443
940 3300048925 Ga0496122_0000022 Ga0496122_0000022_22223_23578 443
941 3300048926 Ga0496123_0000016 Ga0496123_0000016_69170_70525 443
942 3300048928 Ga0496125_0004443 Ga0496125_0004443_13778_15133 443
943 3300048929 Ga0496126_0017091 Ga0496126_0017091_4384_5739 443
944 3300049571 Ga0501034_0131140 Ga0501034_0131140_644_1984 443
945 3300050491 nmdc:mga00v17_31322_c1 nmdc:mga00v17_31322_c1_640_1971 443
946 3300050507 nmdc:mga05p37_52804_c1 nmdc:mga05p37_52804_c1_1208_2554 443
947 3300050508 nmdc:mga09592_5723_c1 nmdc:mga09592_5723_c1_2346_3692 443
948 3300050509 nmdc:mga0qj67_10513_c1 nmdc:mga0qj67_10513_c1_181_1527 443
949 3300050510 nmdc:mga06r32_907_c1 nmdc:mga06r32_907_c1_12475_13821 443
950 3300050511 nmdc:mga08y16_3908_c1 nmdc:mga08y16_3908_c1_10088_11434 443
951 3300060353 Ga0501082_0009270 Ga0501082_0009270_2156_3496 443
952 iso_pu_bacteria 2855386786 2855387662 443
953 iso_pu_bacteria 2857720070 2857722450 443
954 iso_pu_bacteria 2928090899 2928092673 443
955 iso_pu_bacteria 2984580707 2984583790 443
956 iso_pu_bacteria 8055157932 8055162478 443
957 3300005434 Ga0070709_10018668 Ga0070709_100186682 444
958 3300005437 Ga0070710_10006810 Ga0070710_100068102 444
959 3300005439 Ga0070711_100025824 Ga0070711_1000258242 444
960 3300005467 Ga0070706_100053432 Ga0070706_1000534323 444
961 3300005468 Ga0070707_100031950 Ga0070707_1000319503 444
962 3300005471 Ga0070698_100073119 Ga0070698_1000731194 444
963 3300005536 Ga0070697_100092625 Ga0070697_1000926252 444
964 3300005937 Ga0081455_10015161 Ga0081455_100151616 444
965 3300006163 Ga0070715_10003914 Ga0070715_100039145 444
966 3300006847 Ga0075431_100000676 Ga0075431_1000006767 444
967 3300006871 Ga0075434_100065272 Ga0075434_1000652723 444
968 3300009147 Ga0114129_10011584 Ga0114129_100115847 444
969 3300009148 Ga0105243_10006996 Ga0105243_100069967 444
970 3300013104 Ga0157370_10224709 Ga0157370_102247092 444
971 3300021388 Ga0213875_10000817 Ga0213875_1000081714 444
972 3300025728 Ga0207655_1004585 Ga0207655_10045855 444
973 3300025901 Ga0207688_10036234 Ga0207688_100362342 444
974 3300025906 Ga0207699_10016294 Ga0207699_100162942 444
975 3300025912 Ga0207707_10236968 Ga0207707_102369681 444
976 3300025921 Ga0207652_10062722 Ga0207652_100627222 444
977 3300025928 Ga0207700_10010489 Ga0207700_100104894 444
978 3300025928 Ga0207700_10078908 Ga0207700_100789082 444
979 3300025928 Ga0207700_10079066 Ga0207700_100790663 444
980 3300025929 Ga0207664_10095245 Ga0207664_100952452 444
981 3300025935 Ga0207709_10003866 Ga0207709_100038662 444
982 3300025939 Ga0207665_10005087 Ga0207665_100050877 444
983 3300025939 Ga0207665_10061089 Ga0207665_100610892 444
984 3300028800 Ga0265338_10054763 Ga0265338_100547633 444
985 3300031712 Ga0265342_10070307 Ga0265342_100703072 444
986 3300031727 Ga0316576_10021294 Ga0316576_100212942 444
987 3300031824 Ga0307413_10020698 Ga0307413_100206983 444
988 3300031995 Ga0307409_100015666 Ga0307409_1000156663 444
989 3300032002 Ga0307416_100114950 Ga0307416_1001149502 444
990 3300032126 Ga0307415_100122703 Ga0307415_1001227032 444
991 3300035111 Ga0373923_0015564 Ga0373923_0015564_90_1535 444
992 3300035113 Ga0373936_0030205 Ga0373936_0030205_698_2050 444
993 3300035118 Ga0373954_0011949 Ga0373954_0011949_897_2342 444
994 3300035398 Ga0316574_0010285 Ga0316574_0010285_1493_2854 444
995 3300035410 Ga0373924_0008148 Ga0373924_0008148_1545_2990 444
996 3300035724 Ga0373933_0036606 Ga0373933_0036606_900_2345 444
997 3300036401 Ga0373937_0107679 Ga0373937_0107679_1101_2546 444
998 3300037068 Ga0373925_0000400 Ga0373925_0000400_2406_3758 444
999 3300037068 Ga0373925_0036510 Ga0373925_0036510_412_1857 444
1000 3300037418 Ga0395900_0121921 Ga0395900_0121921_1242_2591 444
1001 3300037853 Ga0436364_0207639 Ga0436364_0207639_17253_18725 444
1002 3300038443 Ga0395901_0128065 Ga0395901_0128065_931_2280 444
1003 3300044842 Ga0466957_0046861 Ga0466957_0046861_103_1488 444
1004 3300045976 Ga0466967_0036222 Ga0466967_0036222_126_1526 444
1005 3300046454 Ga0495592_0025383 Ga0495592_0025383_219_1664 444
1006 3300046462 Ga0495651_0037714 Ga0495651_0037714_2114_3559 444
1007 3300046533 Ga0495640_0032645 Ga0495640_0032645_623_2068 444
1008 3300046535 Ga0495586_0039928 Ga0495586_0039928_352_1797 444
1009 3300046536 Ga0495587_0012821 Ga0495587_0012821_541_1986 444
1010 3300046559 Ga0495667_0036999 Ga0495667_0036999_178_1623 444
1011 3300046642 Ga0495634_0017558 Ga0495634_0017558_3263_4708 444
1012 3300046663 Ga0495635_0046808 Ga0495635_0046808_770_2215 444
1013 3300046680 Ga0495646_0039786 Ga0495646_0039786_1392_2837 444
1014 3300047319 Ga0495674_0091225 Ga0495674_0091225_398_1843 444
1015 3300047471 Ga0495684_0053559 Ga0495684_0053559_1160_2605 444
1016 3300048088 Ga0495602_0035718 Ga0495602_0035718_318_1763 444
1017 3300048929 Ga0496126_0029368 Ga0496126_0029368_676_2028 444
1018 3300049534 Ga0501318_003400 Ga0501318_003400_30_1385 444
1019 3300049581 Ga0501047_0068887 Ga0501047_0068887_1992_3344 444
1020 3300049822 Ga0501035_0009678 Ga0501035_0009678_6036_7388 444
1021 3300049823 Ga0501044_0015179 Ga0501044_0015179_5956_7308 444
1022 3300050510 nmdc:mga06r32_7811_c1 nmdc:mga06r32_7811_c1_792_2141 444
1023 3300050512 nmdc:mga0n895_3126_c1 nmdc:mga0n895_3126_c1_1046_2398 444
1024 3300053077 Ga0495601_0081449 Ga0495601_0081449_280_1752 444
1025 iso_pu_bacteria 2643221546 2643753920 444
1026 3300005434 Ga0070709_10002330 Ga0070709_100023304 445
1027 3300005436 Ga0070713_100003155 Ga0070713_1000031557 445
1028 3300005437 Ga0070710_10002152 Ga0070710_100021525 445
1029 3300005467 Ga0070706_100004718 Ga0070706_1000047185 445
1030 3300005467 Ga0070706_100033151 Ga0070706_1000331512 445
1031 3300005468 Ga0070707_100001600 Ga0070707_1000016008 445
1032 3300006914 Ga0075436_100031803 Ga0075436_1000318032 445
1033 3300025910 Ga0207684_10034871 Ga0207684_100348712 445
1034 3300025921 Ga0207652_10159508 Ga0207652_101595081 445
1035 3300025922 Ga0207646_10012030 Ga0207646_100120306 445
1036 3300025929 Ga0207664_10069855 Ga0207664_100698552 445
1037 3300026035 Ga0207703_10154816 Ga0207703_101548162 445
1038 3300031247 Ga0265340_10017262 Ga0265340_100172624 445
1039 3300031727 Ga0316576_10015164 Ga0316576_100151642 445
1040 3300032004 Ga0307414_10132602 Ga0307414_101326022 445
1041 3300035083 Ga0373926_0001667 Ga0373926_0001667_4545_5900 445
1042 3300035692 Ga0373935_0000541 Ga0373935_0000541_16960_18315 445
1043 3300035725 Ga0373947_0000003 Ga0373947_0000003_31515_32870 445
1044 3300044765 Ga0466970_0011058 Ga0466970_0011058_2140_3477 445
1045 3300044901 Ga0466960_0040212 Ga0466960_0040212_251_1588 445
1046 3300048914 Ga0496111_0054085 Ga0496111_0054085_1464_2819 445
1047 3300049578 Ga0501042_0021978 Ga0501042_0021978_1871_3226 445
1048 3300049586 Ga0501070_0030864 Ga0501070_0030864_1534_2946 445
1049 3300050514 nmdc:mga08x19_60972_c1 nmdc:mga08x19_60972_c1_19_1374 445
1050 3300053153 Ga0500616_0000740 Ga0500616_0000740_16125_17507 445
1051 iso_pu_bacteria 3002998708 3002998973 445
1052 3300003203 JGI25406J46586_10011869 JGI25406J46586_100118692 446
1053 3300003659 JGI25404J52841_10004701 JGI25404J52841_100047012 446
1054 3300005327 Ga0070658_10056797 Ga0070658_100567972 446
1055 3300005329 Ga0070683_100040518 Ga0070683_1000405182 446
1056 3300005330 Ga0070690_100019006 Ga0070690_1000190062 446
1057 3300005334 Ga0068869_100031873 Ga0068869_1000318735 446
1058 3300005335 Ga0070666_10069723 Ga0070666_100697232 446
1059 3300005338 Ga0068868_100198584 Ga0068868_1001985841 446
1060 3300005339 Ga0070660_100079459 Ga0070660_1000794592 446
1061 3300005341 Ga0070691_10019439 Ga0070691_100194392 446
1062 3300005344 Ga0070661_100034296 Ga0070661_1000342961 446
1063 3300005345 Ga0070692_10051972 Ga0070692_100519722 446
1064 3300005364 Ga0070673_100117278 Ga0070673_1001172781 446
1065 3300005366 Ga0070659_100041213 Ga0070659_1000412132 446
1066 3300005367 Ga0070667_100103299 Ga0070667_1001032992 446
1067 3300005434 Ga0070709_10000165 Ga0070709_100001658 446
1068 3300005435 Ga0070714_100002703 Ga0070714_1000027037 446
1069 3300005436 Ga0070713_100002252 Ga0070713_1000022527 446
1070 3300005436 Ga0070713_100019979 Ga0070713_1000199793 446
1071 3300005437 Ga0070710_10000171 Ga0070710_100001712 446
1072 3300005437 Ga0070710_10033019 Ga0070710_100330192 446
1073 3300005438 Ga0070701_10064642 Ga0070701_100646422 446
1074 3300005441 Ga0070700_100022011 Ga0070700_1000220115 446
1075 3300005458 Ga0070681_10131380 Ga0070681_101313802 446
1076 3300005459 Ga0068867_100106614 Ga0068867_1001066142 446
1077 3300005467 Ga0070706_100001237 Ga0070706_10000123721 446
1078 3300005467 Ga0070706_100006955 Ga0070706_1000069554 446
1079 3300005468 Ga0070707_100005735 Ga0070707_1000057352 446
1080 3300005468 Ga0070707_100039318 Ga0070707_1000393183 446
1081 3300005471 Ga0070698_100000718 Ga0070698_10000071834 446
1082 3300005471 Ga0070698_100005554 Ga0070698_1000055546 446
1083 3300005471 Ga0070698_100012415 Ga0070698_1000124155 446
1084 3300005530 Ga0070679_100139525 Ga0070679_1001395252 446
1085 3300005544 Ga0070686_100015848 Ga0070686_1000158483 446
1086 3300005614 Ga0068856_100045686 Ga0068856_1000456863 446
1087 3300005615 Ga0070702_100036204 Ga0070702_1000362042 446
1088 3300005617 Ga0068859_100208887 Ga0068859_1002088872 446
1089 3300005841 Ga0068863_100041663 Ga0068863_1000416634 446
1090 3300005844 Ga0068862_100095958 Ga0068862_1000959581 446
1091 3300005983 Ga0081540_1000058 Ga0081540_100005886 446
1092 3300005983 Ga0081540_1000120 Ga0081540_100012011 446
1093 3300005985 Ga0081539_10000846 Ga0081539_1000084619 446
1094 3300006028 Ga0070717_10056734 Ga0070717_100567343 446
1095 3300006173 Ga0070716_100004282 Ga0070716_1000042822 446
1096 3300006173 Ga0070716_100098018 Ga0070716_1000980182 446
1097 3300006175 Ga0070712_100014200 Ga0070712_1000142005 446
1098 3300006175 Ga0070712_100023628 Ga0070712_1000236283 446
1099 3300006852 Ga0075433_10020156 Ga0075433_100201566 446
1100 3300006871 Ga0075434_100034046 Ga0075434_1000340465 446
1101 3300006914 Ga0075436_100011469 Ga0075436_1000114692 446
1102 3300006914 Ga0075436_100016125 Ga0075436_1000161254 446
1103 3300006931 Ga0097620_100208887 Ga0097620_1002088872 446
1104 3300009094 Ga0111539_10165209 Ga0111539_101652092 446
1105 3300009174 Ga0105241_10041881 Ga0105241_100418812 446
1106 3300009174 Ga0105241_10153317 Ga0105241_101533172 446
1107 3300009553 Ga0105249_10138850 Ga0105249_101388501 446
1108 3300013102 Ga0157371_10072602 Ga0157371_100726022 446
1109 3300013105 Ga0157369_10163930 Ga0157369_101639302 446
1110 3300013297 Ga0157378_10115653 Ga0157378_101156532 446
1111 3300013308 Ga0157375_10144658 Ga0157375_101446582 446
1112 3300014325 Ga0163163_10105894 Ga0163163_101058942 446
1113 3300014497 Ga0182008_10089599 Ga0182008_100895992 446
1114 3300014969 Ga0157376_10074672 Ga0157376_100746723 446
1115 3300017792 Ga0163161_10077287 Ga0163161_100772872 446
1116 3300020081 Ga0206354_10860617 Ga0206354_108606172 446
1117 3300020082 Ga0206353_11102129 Ga0206353_111021293 446
1118 3300022467 Ga0224712_10001022 Ga0224712_100010225 446
1119 3300025898 Ga0207692_10009178 Ga0207692_100091783 446
1120 3300025898 Ga0207692_10012558 Ga0207692_100125583 446
1121 3300025898 Ga0207692_10034204 Ga0207692_100342042 446
1122 3300025899 Ga0207642_10077937 Ga0207642_100779372 446
1123 3300025901 Ga0207688_10012847 Ga0207688_100128473 446
1124 3300025904 Ga0207647_10026494 Ga0207647_100264942 446
1125 3300025906 Ga0207699_10000393 Ga0207699_100003932 446
1126 3300025906 Ga0207699_10028655 Ga0207699_100286552 446
1127 3300025908 Ga0207643_10028173 Ga0207643_100281733 446
1128 3300025910 Ga0207684_10002760 Ga0207684_100027609 446
1129 3300025910 Ga0207684_10006264 Ga0207684_1000626410 446
1130 3300025910 Ga0207684_10047506 Ga0207684_100475062 446
1131 3300025914 Ga0207671_10057228 Ga0207671_100572282 446
1132 3300025915 Ga0207693_10004329 Ga0207693_1000432910 446
1133 3300025915 Ga0207693_10033132 Ga0207693_100331322 446
1134 3300025916 Ga0207663_10002048 Ga0207663_100020483 446
1135 3300025918 Ga0207662_10066563 Ga0207662_100665632 446
1136 3300025919 Ga0207657_10019911 Ga0207657_100199113 446
1137 3300025922 Ga0207646_10000455 Ga0207646_1000045536 446
1138 3300025922 Ga0207646_10200697 Ga0207646_102006972 446
1139 3300025928 Ga0207700_10000029 Ga0207700_1000002920 446
1140 3300025928 Ga0207700_10023791 Ga0207700_100237912 446
1141 3300025928 Ga0207700_10026278 Ga0207700_100262783 446
1142 3300025928 Ga0207700_10064913 Ga0207700_100649132 446
1143 3300025929 Ga0207664_10000110 Ga0207664_1000011052 446
1144 3300025929 Ga0207664_10009269 Ga0207664_100092693 446
1145 3300025929 Ga0207664_10018463 Ga0207664_100184633 446
1146 3300025929 Ga0207664_10136096 Ga0207664_101360961 446
1147 3300025933 Ga0207706_10043648 Ga0207706_100436482 446
1148 3300025939 Ga0207665_10004600 Ga0207665_100046005 446
1149 3300025939 Ga0207665_10008216 Ga0207665_100082162 446
1150 3300025940 Ga0207691_10078880 Ga0207691_100788802 446
1151 3300025942 Ga0207689_10102201 Ga0207689_101022012 446
1152 3300026023 Ga0207677_10124562 Ga0207677_101245622 446
1153 3300026035 Ga0207703_10193937 Ga0207703_101939372 446
1154 3300026041 Ga0207639_10075785 Ga0207639_100757852 446
1155 3300026067 Ga0207678_10023107 Ga0207678_100231074 446
1156 3300026078 Ga0207702_10013428 Ga0207702_100134288 446
1157 3300026089 Ga0207648_10042554 Ga0207648_100425542 446
1158 3300026118 Ga0207675_100007636 Ga0207675_1000076363 446
1159 3300026121 Ga0207683_10032299 Ga0207683_100322992 446
1160 3300028379 Ga0268266_10251610 Ga0268266_102516101 446
1161 3300028794 Ga0307515_10129340 Ga0307515_101293402 446
1162 3300031247 Ga0265340_10001983 Ga0265340_100019835 446
1163 3300034818 Ga0373950_0001388 Ga0373950_0001388_216_1574 446
1164 3300034957 Ga0373938_0016100 Ga0373938_0016100_86_1444 446
1165 3300035083 Ga0373926_0000182 Ga0373926_0000182_1796_3163 446
1166 3300035083 Ga0373926_0003441 Ga0373926_0003441_2231_3604 446
1167 3300035083 Ga0373926_0031073 Ga0373926_0031073_12_1370 446
1168 3300035086 Ga0373934_0000109 Ga0373934_0000109_10059_11417 446
1169 3300035086 Ga0373934_0001845 Ga0373934_0001845_1197_2555 446
1170 3300035086 Ga0373934_0002127 Ga0373934_0002127_5708_7081 446
1171 3300035086 Ga0373934_0064473 Ga0373934_0064473_85_1443 446
1172 3300035092 Ga0373952_0006560 Ga0373952_0006560_487_1860 446
1173 3300035111 Ga0373923_0000129 Ga0373923_0000129_1830_3203 446
1174 3300035112 Ga0373932_0019184 Ga0373932_0019184_395_1753 446
1175 3300035114 Ga0373939_0016970 Ga0373939_0016970_173_1546 446
1176 3300035116 Ga0373945_0000108 Ga0373945_0000108_10748_12115 446
1177 3300035116 Ga0373945_0002663 Ga0373945_0002663_4064_5437 446
1178 3300035116 Ga0373945_0006241 Ga0373945_0006241_1160_2518 446
1179 3300035117 Ga0373953_0000026 Ga0373953_0000026_16287_17645 446
1180 3300035117 Ga0373953_0024094 Ga0373953_0024094_644_2017 446
1181 3300035118 Ga0373954_0006046 Ga0373954_0006046_3468_4826 446
1182 3300035118 Ga0373954_0006922 Ga0373954_0006922_342_1715 446
1183 3300035119 Ga0373956_0001484 Ga0373956_0001484_3767_5125 446
1184 3300035120 Ga0373957_0000038 Ga0373957_0000038_17423_18781 446
1185 3300035170 Ga0373943_0001545 Ga0373943_0001545_1764_3137 446
1186 3300035170 Ga0373943_0003488 Ga0373943_0003488_5490_6857 446
1187 3300035170 Ga0373943_0105497 Ga0373943_0105497_55_1413 446
1188 3300035171 Ga0373946_0028410 Ga0373946_0028410_163_1536 446
1189 3300035172 Ga0373955_0000841 Ga0373955_0000841_697_2055 446
1190 3300035172 Ga0373955_0015149 Ga0373955_0015149_1998_3356 446
1191 3300035172 Ga0373955_0064649 Ga0373955_0064649_467_1840 446
1192 3300035207 Ga0373942_0015698 Ga0373942_0015698_102_1460 446
1193 3300035242 Ga0373962_0011166 Ga0373962_0011166_344_1717 446
1194 3300035410 Ga0373924_0002452 Ga0373924_0002452_1651_3009 446
1195 3300035410 Ga0373924_0048402 Ga0373924_0048402_46_1419 446
1196 3300035691 Ga0373931_0037655 Ga0373931_0037655_250_1623 446
1197 3300035692 Ga0373935_0001486 Ga0373935_0001486_10123_11490 446
1198 3300035692 Ga0373935_0036971 Ga0373935_0036971_872_2230 446
1199 3300035695 Ga0373927_0000680 Ga0373927_0000680_23492_24859 446
1200 3300035724 Ga0373933_0000188 Ga0373933_0000188_4850_6208 446
1201 3300035724 Ga0373933_0000604 Ga0373933_0000604_6328_7686 446
1202 3300035724 Ga0373933_0042571 Ga0373933_0042571_648_2021 446
1203 3300035725 Ga0373947_0002803 Ga0373947_0002803_8190_9557 446
1204 3300036401 Ga0373937_0000138 Ga0373937_0000138_33971_35329 446
1205 3300036401 Ga0373937_0001588 Ga0373937_0001588_5115_6473 446
1206 3300036401 Ga0373937_0059365 Ga0373937_0059365_55_1413 446
1207 3300036401 Ga0373937_0062370 Ga0373937_0062370_1146_2519 446
1208 3300037068 Ga0373925_0000699 Ga0373925_0000699_20755_22122 446
1209 3300037853 Ga0436364_0232843 Ga0436364_0232843_28833_30215 446
1210 3300037853 Ga0436364_1306745 Ga0436364_1306745_2191_3564 446
1211 3300039450 Ga0436363_0778823 Ga0436363_0778823_287_1660 446
1212 3300041491 Ga0451833_1422046 Ga0451833_1422046_441_1871 446
1213 3300044694 Ga0466963_0106439 Ga0466963_0106439_105_1472 446
1214 3300045976 Ga0466967_0049038 Ga0466967_0049038_2236_3618 446
1215 3300045976 Ga0466967_0068868 Ga0466967_0068868_1164_2531 446
1216 3300046454 Ga0495592_0000041 Ga0495592_0000041_87334_88692 446
1217 3300046454 Ga0495592_0049321 Ga0495592_0049321_932_2290 446
1218 3300046455 Ga0495603_0010135 Ga0495603_0010135_1168_2541 446
1219 3300046459 Ga0495629_0007344 Ga0495629_0007344_585_1943 446
1220 3300046459 Ga0495629_0056443 Ga0495629_0056443_1342_2715 446
1221 3300046461 Ga0495641_0028361 Ga0495641_0028361_220_1593 446
1222 3300046462 Ga0495651_0000018 Ga0495651_0000018_34740_36098 446
1223 3300046462 Ga0495651_0031225 Ga0495651_0031225_1230_2597 446
1224 3300046462 Ga0495651_0035162 Ga0495651_0035162_2117_3490 446
1225 3300046463 Ga0495653_0003023 Ga0495653_0003023_1582_2940 446
1226 3300046463 Ga0495653_0017016 Ga0495653_0017016_2388_3755 446
1227 3300046463 Ga0495653_0059305 Ga0495653_0059305_1480_2853 446
1228 3300046473 Ga0495582_0011706 Ga0495582_0011706_149_1507 446
1229 3300046473 Ga0495582_0032044 Ga0495582_0032044_1360_2733 446
1230 3300046476 Ga0495662_0002680 Ga0495662_0002680_1115_2488 446
1231 3300046477 Ga0495664_0001298 Ga0495664_0001298_6064_7431 446
1232 3300046477 Ga0495664_0027977 Ga0495664_0027977_109_1467 446
1233 3300046499 Ga0495594_0021375 Ga0495594_0021375_2076_3434 446
1234 3300046499 Ga0495594_0027716 Ga0495594_0027716_1402_2775 446
1235 3300046511 Ga0495608_0000039 Ga0495608_0000039_34740_36098 446
1236 3300046511 Ga0495608_0007120 Ga0495608_0007120_170_1528 446
1237 3300046511 Ga0495608_0078393 Ga0495608_0078393_94_1467 446
1238 3300046514 Ga0495618_0001552 Ga0495618_0001552_13450_14817 446
1239 3300046514 Ga0495618_0054617 Ga0495618_0054617_450_1808 446
1240 3300046516 Ga0495628_0000219 Ga0495628_0000219_16311_17669 446
1241 3300046516 Ga0495628_0003347 Ga0495628_0003347_11557_12930 446
1242 3300046517 Ga0495630_0064011 Ga0495630_0064011_1359_2732 446
1243 3300046517 Ga0495630_0082178 Ga0495630_0082178_849_2207 446
1244 3300046529 Ga0495652_0000092 Ga0495652_0000092_87098_88456 446
1245 3300046529 Ga0495652_0024482 Ga0495652_0024482_3812_5170 446
1246 3300046531 Ga0495665_0000931 Ga0495665_0000931_9342_10715 446
1247 3300046531 Ga0495665_0006900 Ga0495665_0006900_4429_5796 446
1248 3300046533 Ga0495640_0009819 Ga0495640_0009819_347_1720 446
1249 3300046535 Ga0495586_0008834 Ga0495586_0008834_1432_2805 446
1250 3300046536 Ga0495587_0000034 Ga0495587_0000034_87335_88693 446
1251 3300046536 Ga0495587_0012295 Ga0495587_0012295_1106_2479 446
1252 3300046536 Ga0495587_0045833 Ga0495587_0045833_459_1832 446
1253 3300046543 Ga0495645_0018528 Ga0495645_0018528_1154_2527 446
1254 3300046543 Ga0495645_0143473 Ga0495645_0143473_67_1425 446
1255 3300046559 Ga0495667_0000150 Ga0495667_0000150_34740_36098 446
1256 3300046559 Ga0495667_0000669 Ga0495667_0000669_10091_11449 446
1257 3300046559 Ga0495667_0001777 Ga0495667_0001777_12054_13421 446
1258 3300046559 Ga0495667_0138833 Ga0495667_0138833_163_1536 446
1259 3300046642 Ga0495634_0082621 Ga0495634_0082621_664_2022 446
1260 3300046663 Ga0495635_0000138 Ga0495635_0000138_31231_32598 446
1261 3300046675 Ga0495657_0000247 Ga0495657_0000247_34740_36098 446
1262 3300046675 Ga0495657_0038707 Ga0495657_0038707_1871_3238 446
1263 3300046675 Ga0495657_0045690 Ga0495657_0045690_1082_2440 446
1264 3300046675 Ga0495657_0060132 Ga0495657_0060132_1115_2488 446
1265 3300046678 Ga0495599_0000108 Ga0495599_0000108_20052_21410 446
1266 3300046678 Ga0495599_0029060 Ga0495599_0029060_1286_2644 446
1267 3300046678 Ga0495599_0082042 Ga0495599_0082042_556_1914 446
1268 3300046679 Ga0495623_0000287 Ga0495623_0000287_29057_30415 446
1269 3300046679 Ga0495623_0024688 Ga0495623_0024688_1253_2626 446
1270 3300046679 Ga0495623_0030914 Ga0495623_0030914_2050_3408 446
1271 3300046680 Ga0495646_0008529 Ga0495646_0008529_3520_4878 446
1272 3300046680 Ga0495646_0048843 Ga0495646_0048843_1005_2363 446
1273 3300046681 Ga0495647_0008900 Ga0495647_0008900_446_1819 446
1274 3300046683 Ga0495658_0004732 Ga0495658_0004732_1239_2612 446
1275 3300046690 Ga0495624_0038049 Ga0495624_0038049_1399_2772 446
1276 3300046809 Ga0495600_0003753 Ga0495600_0003753_625_1983 446
1277 3300047315 Ga0495581_0038183 Ga0495581_0038183_390_1757 446
1278 3300047315 Ga0495581_0080488 Ga0495581_0080488_282_1655 446
1279 3300047317 Ga0495604_0000039 Ga0495604_0000039_87334_88692 446
1280 3300047317 Ga0495604_0004961 Ga0495604_0004961_527_1885 446
1281 3300047317 Ga0495604_0068694 Ga0495604_0068694_784_2142 446
1282 3300047319 Ga0495674_0000235 Ga0495674_0000235_10271_11638 446
1283 3300047319 Ga0495674_0022562 Ga0495674_0022562_3045_4418 446
1284 3300047319 Ga0495674_0094410 Ga0495674_0094410_736_2109 446
1285 3300047319 Ga0495674_0110789 Ga0495674_0110789_898_2256 446
1286 3300047321 Ga0495676_0011200 Ga0495676_0011200_4054_5421 446
1287 3300047322 Ga0495680_0000028 Ga0495680_0000028_24174_25532 446
1288 3300047322 Ga0495680_0001355 Ga0495680_0001355_10562_11920 446
1289 3300047322 Ga0495680_0001817 Ga0495680_0001817_18347_19714 446
1290 3300047322 Ga0495680_0072835 Ga0495680_0072835_33_1406 446
1291 3300047322 Ga0495680_0084807 Ga0495680_0084807_570_1943 446
1292 3300047322 Ga0495680_0129163 Ga0495680_0129163_149_1507 446
1293 3300047444 Ga0495675_0000355 Ga0495675_0000355_2232_3590 446
1294 3300047444 Ga0495675_0008588 Ga0495675_0008588_1725_3098 446
1295 3300047444 Ga0495675_0027151 Ga0495675_0027151_1307_2665 446
1296 3300047471 Ga0495684_0000154 Ga0495684_0000154_23102_24469 446
1297 3300047471 Ga0495684_0043852 Ga0495684_0043852_1794_3152 446
1298 3300047673 Ga0495593_0012728 Ga0495593_0012728_814_2172 446
1299 3300047673 Ga0495593_0026923 Ga0495593_0026923_1765_3138 446
1300 3300048088 Ga0495602_0000043 Ga0495602_0000043_87334_88692 446
1301 3300048088 Ga0495602_0055088 Ga0495602_0055088_1061_2434 446
1302 3300048088 Ga0495602_0057893 Ga0495602_0057893_79_1437 446
1303 3300048089 Ga0495614_0014275 Ga0495614_0014275_1431_2804 446
1304 3300048903 Ga0496100_0084442 Ga0496100_0084442_351_1709 446
1305 3300048908 Ga0496105_0088810 Ga0496105_0088810_151_1509 446
1306 3300048908 Ga0496105_0092545 Ga0496105_0092545_957_2330 446
1307 3300048910 Ga0496107_0062574 Ga0496107_0062574_31_1389 446
1308 3300048910 Ga0496107_0131628 Ga0496107_0131628_43_1416 446
1309 3300048911 Ga0496108_0074019 Ga0496108_0074019_856_2229 446
1310 3300048917 Ga0496114_0048238 Ga0496114_0048238_169_1542 446
1311 3300048918 Ga0496115_0012391 Ga0496115_0012391_3067_4440 446
1312 3300048925 Ga0496122_0005660 Ga0496122_0005660_10569_11930 446
1313 3300049568 Ga0501031_0026500 Ga0501031_0026500_1066_2406 446
1314 3300049574 Ga0501038_0029892 Ga0501038_0029892_2120_3460 446
1315 3300049575 Ga0501039_0047074 Ga0501039_0047074_1060_2400 446
1316 3300049577 Ga0501041_0064103 Ga0501041_0064103_702_2042 446
1317 3300049580 Ga0501046_0168778 Ga0501046_0168778_23_1363 446
1318 3300049588 Ga0501072_0016427 Ga0501072_0016427_4095_5459 446
1319 3300049741 Ga0501079_0025288 Ga0501079_0025288_1072_2412 446
1320 3300049742 Ga0501080_0119003 Ga0501080_0119003_592_1992 446
1321 3300049742 Ga0501080_0184613 Ga0501080_0184613_308_1648 446
1322 3300049744 Ga0501083_0126874 Ga0501083_0126874_166_1506 446
1323 3300049823 Ga0501044_0212884 Ga0501044_0212884_295_1695 446
1324 3300049824 Ga0501045_0054980 Ga0501045_0054980_408_1748 446
1325 3300050511 nmdc:mga08y16_52421_c1 nmdc:mga08y16_52421_c1_1216_2574 446
1326 3300050512 nmdc:mga0n895_303769_c1 nmdc:mga0n895_303769_c1_223_1581 446
1327 3300050513 nmdc:mga0rr50_9814_c1 nmdc:mga0rr50_9814_c1_3273_4631 446
1328 3300050515 nmdc:mga0a205_99676_c1 nmdc:mga0a205_99676_c1_39_1397 446
1329 3300053077 Ga0495601_0026034 Ga0495601_0026034_1122_2495 446
1330 3300053078 Ga0495612_0016357 Ga0495612_0016357_1570_2943 446
1331 3300053084 Ga0495595_0004992 Ga0495595_0004992_286_1644 446
1332 3300053084 Ga0495595_0009778 Ga0495595_0009778_1843_3201 446
1333 3300053084 Ga0495595_0010465 Ga0495595_0010465_894_2267 446
1334 3300053085 Ga0495619_0003503 Ga0495619_0003503_1115_2488 446
1335 3300061734 Ga0530510_0095460 Ga0530510_0095460_667_2082 446
1336 iso_pu_bacteria 2527291629 2528215625 446
1337 iso_pu_bacteria 2546825537 2546950832 446
1338 iso_pu_bacteria 2684623036 2686543997 446
1339 iso_pu_bacteria 2710264753 2710604753 446
1340 iso_pu_bacteria 2773857924 2774866894 446
1341 iso_pu_bacteria 637000116 637881150 446
1342 iso_pu_bacteria 8054920844 8054924366 446
1343 3300000549 LJQas_1002891 LJQas_10028912 447
1344 3300005337 Ga0070682_100004601 Ga0070682_1000046017 447
1345 3300005339 Ga0070660_100010741 Ga0070660_1000107412 447
1346 3300005435 Ga0070714_100022873 Ga0070714_1000228732 447
1347 3300005458 Ga0070681_10103138 Ga0070681_101031382 447
1348 3300005467 Ga0070706_100009075 Ga0070706_1000090757 447
1349 3300005468 Ga0070707_100000043 Ga0070707_10000004317 447
1350 3300005471 Ga0070698_100000072 Ga0070698_10000007266 447
1351 3300005535 Ga0070684_100002011 Ga0070684_10000201110 447
1352 3300005548 Ga0070665_100006685 Ga0070665_1000066855 447
1353 3300005563 Ga0068855_100003043 Ga0068855_10000304311 447
1354 3300005563 Ga0068855_100144212 Ga0068855_1001442122 447
1355 3300005563 Ga0068855_100148108 Ga0068855_1001481082 447
1356 3300005577 Ga0068857_100015539 Ga0068857_1000155393 447
1357 3300005841 Ga0068863_100027875 Ga0068863_1000278753 447
1358 3300005842 Ga0068858_100031487 Ga0068858_1000314873 447
1359 3300005843 Ga0068860_100031992 Ga0068860_1000319924 447
1360 3300006038 Ga0075365_10004303 Ga0075365_100043033 447
1361 3300006038 Ga0075365_10028765 Ga0075365_100287652 447
1362 3300006042 Ga0075368_10002325 Ga0075368_100023253 447
1363 3300006048 Ga0075363_100030288 Ga0075363_1000302882 447
1364 3300006048 Ga0075363_100060382 Ga0075363_1000603822 447
1365 3300006051 Ga0075364_10013755 Ga0075364_100137551 447
1366 3300006051 Ga0075364_10014100 Ga0075364_100141003 447
1367 3300006175 Ga0070712_100019304 Ga0070712_1000193042 447
1368 3300006237 Ga0097621_100008180 Ga0097621_1000081805 447
1369 3300006353 Ga0075370_10001552 Ga0075370_100015528 447
1370 3300009093 Ga0105240_10122631 Ga0105240_101226312 447
1371 3300009098 Ga0105245_10002916 Ga0105245_100029167 447
1372 3300009148 Ga0105243_10129134 Ga0105243_101291342 447
1373 3300009545 Ga0105237_10098934 Ga0105237_100989342 447
1374 3300009553 Ga0105249_10020772 Ga0105249_100207724 447
1375 3300010375 Ga0105239_10005653 Ga0105239_100056535 447
1376 3300011119 Ga0105246_10015649 Ga0105246_100156492 447
1377 3300013104 Ga0157370_10004680 Ga0157370_1000468010 447
1378 3300013105 Ga0157369_10039681 Ga0157369_100396814 447
1379 3300013296 Ga0157374_10004456 Ga0157374_100044565 447
1380 3300013306 Ga0163162_10009743 Ga0163162_100097432 447
1381 3300013307 Ga0157372_10025730 Ga0157372_100257303 447
1382 3300014325 Ga0163163_10008595 Ga0163163_100085954 447
1383 3300014968 Ga0157379_10004864 Ga0157379_100048645 447
1384 3300014968 Ga0157379_10006071 Ga0157379_100060719 447
1385 3300021384 Ga0213876_10019674 Ga0213876_100196742 447
1386 3300022467 Ga0224712_10051737 Ga0224712_100517372 447
1387 3300025904 Ga0207647_10040660 Ga0207647_100406602 447
1388 3300025906 Ga0207699_10040045 Ga0207699_100400452 447
1389 3300025910 Ga0207684_10054822 Ga0207684_100548223 447
1390 3300025913 Ga0207695_10083572 Ga0207695_100835723 447
1391 3300025917 Ga0207660_10167495 Ga0207660_101674951 447
1392 3300025919 Ga0207657_10022980 Ga0207657_100229802 447
1393 3300025922 Ga0207646_10009604 Ga0207646_100096047 447
1394 3300025927 Ga0207687_10018558 Ga0207687_100185582 447
1395 3300025928 Ga0207700_10001933 Ga0207700_1000193311 447
1396 3300025928 Ga0207700_10002047 Ga0207700_100020477 447
1397 3300025929 Ga0207664_10019628 Ga0207664_100196285 447
1398 3300025929 Ga0207664_10050041 Ga0207664_100500413 447
1399 3300025939 Ga0207665_10012993 Ga0207665_100129934 447
1400 3300025949 Ga0207667_10026581 Ga0207667_100265815 447
1401 3300025949 Ga0207667_10229988 Ga0207667_102299881 447
1402 3300025961 Ga0207712_10056219 Ga0207712_100562192 447
1403 3300026075 Ga0207708_10013892 Ga0207708_100138923 447
1404 3300026095 Ga0207676_10183316 Ga0207676_101833162 447
1405 3300026116 Ga0207674_10001048 Ga0207674_1000104832 447
1406 3300026116 Ga0207674_10062578 Ga0207674_100625782 447
1407 3300026118 Ga0207675_100097026 Ga0207675_1000970262 447
1408 3300028379 Ga0268266_10006262 Ga0268266_100062625 447
1409 3300028381 Ga0268264_10059778 Ga0268264_100597781 447
1410 3300031901 Ga0307406_10056841 Ga0307406_100568412 447
1411 3300031903 Ga0307407_10002637 Ga0307407_100026375 447
1412 3300031995 Ga0307409_100066141 Ga0307409_1000661413 447
1413 3300031995 Ga0307409_100131339 Ga0307409_1001313392 447
1414 3300032002 Ga0307416_100009098 Ga0307416_1000090983 447
1415 3300032005 Ga0307411_10006601 Ga0307411_100066014 447
1416 3300035086 Ga0373934_0021094 Ga0373934_0021094_89_1453 447
1417 3300035086 Ga0373934_0030713 Ga0373934_0030713_30_1394 447
1418 3300035111 Ga0373923_0025003 Ga0373923_0025003_886_2250 447
1419 3300035111 Ga0373923_0034811 Ga0373923_0034811_122_1486 447
1420 3300035113 Ga0373936_0012109 Ga0373936_0012109_822_2186 447
1421 3300035117 Ga0373953_0011211 Ga0373953_0011211_750_2114 447
1422 3300035118 Ga0373954_0011406 Ga0373954_0011406_938_2302 447
1423 3300035118 Ga0373954_0027261 Ga0373954_0027261_959_2323 447
1424 3300035119 Ga0373956_0029611 Ga0373956_0029611_995_2359 447
1425 3300035120 Ga0373957_0000972 Ga0373957_0000972_874_2238 447
1426 3300035172 Ga0373955_0012628 Ga0373955_0012628_1845_3209 447
1427 3300035172 Ga0373955_0070526 Ga0373955_0070526_189_1553 447
1428 3300035410 Ga0373924_0004584 Ga0373924_0004584_1338_2702 447
1429 3300035692 Ga0373935_0055524 Ga0373935_0055524_385_1749 447
1430 3300035724 Ga0373933_0083526 Ga0373933_0083526_330_1694 447
1431 3300035725 Ga0373947_0112580 Ga0373947_0112580_101_1465 447
1432 3300035725 Ga0373947_0155331 Ga0373947_0155331_60_1424 447
1433 3300037466 Ga0395898_0058456 Ga0395898_0058456_2120_3490 447
1434 3300038443 Ga0395901_0020378 Ga0395901_0020378_3335_4684 447
1435 3300039437 Ga0436365_0575809 Ga0436365_0575809_318_1694 447
1436 3300039450 Ga0436363_0714317 Ga0436363_0714317_97_1461 447
1437 3300044658 Ga0466972_0026321 Ga0466972_0026321_552_1895 447
1438 3300044684 Ga0466966_0028566 Ga0466966_0028566_2246_3589 447
1439 3300044706 Ga0466964_0004578 Ga0466964_0004578_3698_5041 447
1440 3300044765 Ga0466970_0023147 Ga0466970_0023147_481_1824 447
1441 3300044842 Ga0466957_0002955 Ga0466957_0002955_3163_4506 447
1442 3300044901 Ga0466960_0018156 Ga0466960_0018156_1674_3017 447
1443 3300045836 Ga0466958_0028022 Ga0466958_0028022_783_2126 447
1444 3300045976 Ga0466967_0016571 Ga0466967_0016571_93_1436 447
1445 3300046454 Ga0495592_0033870 Ga0495592_0033870_523_1887 447
1446 3300046454 Ga0495592_0047303 Ga0495592_0047303_1312_2676 447
1447 3300046459 Ga0495629_0043776 Ga0495629_0043776_604_1968 447
1448 3300046459 Ga0495629_0047902 Ga0495629_0047902_634_1998 447
1449 3300046461 Ga0495641_0021199 Ga0495641_0021199_873_2237 447
1450 3300046461 Ga0495641_0070729 Ga0495641_0070729_92_1441 447
1451 3300046462 Ga0495651_0009202 Ga0495651_0009202_746_2110 447
1452 3300046462 Ga0495651_0069311 Ga0495651_0069311_1263_2627 447
1453 3300046463 Ga0495653_0072340 Ga0495653_0072340_888_2252 447
1454 3300046473 Ga0495582_0009586 Ga0495582_0009586_3357_4721 447
1455 3300046473 Ga0495582_0097833 Ga0495582_0097833_19_1383 447
1456 3300046476 Ga0495662_0005429 Ga0495662_0005429_3377_4741 447
1457 3300046477 Ga0495664_0016579 Ga0495664_0016579_581_1945 447
1458 3300046511 Ga0495608_0030826 Ga0495608_0030826_323_1687 447
1459 3300046514 Ga0495618_0020662 Ga0495618_0020662_2660_4024 447
1460 3300046516 Ga0495628_0124610 Ga0495628_0124610_30_1394 447
1461 3300046517 Ga0495630_0031062 Ga0495630_0031062_708_2072 447
1462 3300046517 Ga0495630_0110066 Ga0495630_0110066_423_1787 447
1463 3300046529 Ga0495652_0114558 Ga0495652_0114558_769_2133 447
1464 3300046531 Ga0495665_0004607 Ga0495665_0004607_4443_5807 447
1465 3300046531 Ga0495665_0070809 Ga0495665_0070809_449_1813 447
1466 3300046533 Ga0495640_0034686 Ga0495640_0034686_1185_2549 447
1467 3300046533 Ga0495640_0112828 Ga0495640_0112828_195_1559 447
1468 3300046535 Ga0495586_0004920 Ga0495586_0004920_873_2237 447
1469 3300046535 Ga0495586_0057677 Ga0495586_0057677_528_1892 447
1470 3300046536 Ga0495587_0000538 Ga0495587_0000538_16829_18193 447
1471 3300046536 Ga0495587_0017071 Ga0495587_0017071_2122_3486 447
1472 3300046543 Ga0495645_0062902 Ga0495645_0062902_1122_2486 447
1473 3300046642 Ga0495634_0028083 Ga0495634_0028083_2262_3626 447
1474 3300046642 Ga0495634_0069487 Ga0495634_0069487_231_1595 447
1475 3300046663 Ga0495635_0007591 Ga0495635_0007591_1227_2591 447
1476 3300046675 Ga0495657_0051156 Ga0495657_0051156_102_1466 447
1477 3300046675 Ga0495657_0059797 Ga0495657_0059797_961_2325 447
1478 3300046678 Ga0495599_0001098 Ga0495599_0001098_2407_3771 447
1479 3300046678 Ga0495599_0085122 Ga0495599_0085122_581_1945 447
1480 3300046679 Ga0495623_0011210 Ga0495623_0011210_3826_5190 447
1481 3300046679 Ga0495623_0016471 Ga0495623_0016471_2526_3890 447
1482 3300046680 Ga0495646_0011228 Ga0495646_0011228_2507_3871 447
1483 3300046680 Ga0495646_0029846 Ga0495646_0029846_1185_2549 447
1484 3300046683 Ga0495658_0018605 Ga0495658_0018605_1238_2602 447
1485 3300046689 Ga0495613_0088523 Ga0495613_0088523_708_2072 447
1486 3300046690 Ga0495624_0057818 Ga0495624_0057818_490_1854 447
1487 3300046809 Ga0495600_0068710 Ga0495600_0068710_750_2114 447
1488 3300047315 Ga0495581_0035097 Ga0495581_0035097_1140_2504 447
1489 3300047315 Ga0495581_0041912 Ga0495581_0041912_343_1707 447
1490 3300047317 Ga0495604_0018417 Ga0495604_0018417_1206_2570 447
1491 3300047317 Ga0495604_0094448 Ga0495604_0094448_517_1881 447
1492 3300047319 Ga0495674_0012639 Ga0495674_0012639_2504_3868 447
1493 3300047319 Ga0495674_0061194 Ga0495674_0061194_709_2073 447
1494 3300047321 Ga0495676_0045136 Ga0495676_0045136_1172_2548 447
1495 3300047322 Ga0495680_0003332 Ga0495680_0003332_2776_4140 447
1496 3300047322 Ga0495680_0090669 Ga0495680_0090669_330_1694 447
1497 3300047444 Ga0495675_0007520 Ga0495675_0007520_166_1530 447
1498 3300047471 Ga0495684_0010849 Ga0495684_0010849_1915_3279 447
1499 3300047471 Ga0495684_0064876 Ga0495684_0064876_202_1566 447
1500 3300047673 Ga0495593_0012122 Ga0495593_0012122_3021_4385 447
1501 3300047673 Ga0495593_0080233 Ga0495593_0080233_60_1424 447
1502 3300048088 Ga0495602_0008296 Ga0495602_0008296_7434_8798 447
1503 3300048088 Ga0495602_0089421 Ga0495602_0089421_874_2238 447
1504 3300048903 Ga0496100_0050919 Ga0496100_0050919_836_2191 447
1505 3300048907 Ga0496104_0009738 Ga0496104_0009738_6972_8336 447
1506 3300048910 Ga0496107_0118127 Ga0496107_0118127_538_1893 447
1507 3300048911 Ga0496108_0006454 Ga0496108_0006454_829_2178 447
1508 3300048911 Ga0496108_0075343 Ga0496108_0075343_928_2274 447
1509 3300048911 Ga0496108_0150524 Ga0496108_0150524_58_1407 447
1510 3300048913 Ga0496110_0009673 Ga0496110_0009673_2701_4065 447
1511 3300048913 Ga0496110_0011608 Ga0496110_0011608_63_1412 447
1512 3300048914 Ga0496111_0011805 Ga0496111_0011805_513_1862 447
1513 3300048914 Ga0496111_0099368 Ga0496111_0099368_453_1817 447
1514 3300049575 Ga0501039_0037459 Ga0501039_0037459_834_2192 447
1515 3300049586 Ga0501070_0076909 Ga0501070_0076909_453_1796 447
1516 3300049592 Ga0501076_0155067 Ga0501076_0155067_472_1830 447
1517 3300049824 Ga0501045_0080160 Ga0501045_0080160_726_2084 447
1518 3300050492 nmdc:mga0yw44_37400_c1 nmdc:mga0yw44_37400_c1_356_1705 447
1519 3300050494 nmdc:mga06z11_49292_c1 nmdc:mga06z11_49292_c1_302_1666 447
1520 3300050495 nmdc:mga04h51_7778_c1 nmdc:mga04h51_7778_c1_796_2160 447
1521 3300053078 Ga0495612_0012517 Ga0495612_0012517_873_2237 447
1522 3300053078 Ga0495612_0057063 Ga0495612_0057063_18_1382 447
1523 3300053084 Ga0495595_0007305 Ga0495595_0007305_2131_3495 447
1524 3300053085 Ga0495619_0022642 Ga0495619_0022642_2079_3443 447
1525 3300053088 Ga0500644_0000090 Ga0500644_0000090_23817_25190 447
1526 3300061719 Ga0466962_0007440 Ga0466962_0007440_412_1755 447

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

76

487

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oks-assembly1.cif.gz_A crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis 0.9958 14 443
3q8n-assembly2.cif.gz_B crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis 0.9955 10 444
3r4t-assembly1.cif.gz_A crystal structure of 4-aminobutyrate aminotransferase gabt from mycobacterium marinum covalently bound to pyridoxal phosphate 0.9942 10 443
4ffc-assembly1.cif.gz_D crystal structure of a 4-aminobutyrate aminotransferase (gabt) from mycobacterium abscessus 0.9919 13 446
4atp-assembly1.cif.gz_A structure of gaba-transaminase a1r958 from arthrobacter aurescens in complex with plp 0.9916 11 444
ID Description Score Start End Superfamily
af_P9WQ79_74_338_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9915 82 334 3.40.640.10
af_P9WQ79_346_447_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9898 345 442 3.90.1150.10
1sf2B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9891 341 444 3.90.1150.10
3oksC01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9838 14 443 3.90.1150.10
1sf2C02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9689 82 339 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A6J6XHC8-F1-model_v4 Unannotated protein 0.9989 57 446 GO:0009448
GO:0030170
GO:0034386
GO:0042802
AF-A0A3C1DT72-F1-model_v4 4-aminobutyrate--2-oxoglutarate transaminase (EC 2.6.1.19) 0.9983 138 389 GO:0030170
GO:0034386
GO:0042802
AF-A0A6B3FPI1-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9962 209 312 GO:0008483
GO:0030170
GO:0042802
AF-A0A6J6XHC8-F1-model_v4 Unannotated protein 0.9938 57 446 GO:0009448
GO:0030170
GO:0034386
GO:0042802
AF-A0A6G9CLW6-F1-model_v4 Aspartate aminotransferase family protein 0.9937 192 446 GO:0008483
GO:0030170
GO:0042802

Feature Viewer

pLDDT pTM Quality
96.57 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map