F494572
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1527 | 607 | 3054 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10085778|Ga0065707_100857781 |
| Length | 324 |
| Sequence | MDERLEHLIEHAERLLTRLEQALPHAPRAPDWSASIAFRYRRRGANAQLEPVRHVSAIRLSDLKEIDAQMERLRRNTEQFVSGRPANNVLLTGARGTGKSSLIKACLHQFCDRGLRLIEIDKADLIELPDLVELVAHRPERFVVFCDDLSFDEGEPGYKALKSVLDGSVAATSDNLLIYATSNRRHLLPEYMKENLTYTHTDDGEVHPGEVVEEKISLSERFGLWISFYPFSQQEYLAIVAQWLRTFGAAEATITQALKPSLVWALERGSRSGRVAYQFARDWAGRSAGAEGMQGVALQGTEPPGHAGPGVGADADHPDGLDHV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 110 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 149 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 247 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 248 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 249 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 250 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 251 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 254 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 258 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 259 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 260 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 261 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 262 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 263 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 264 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 265 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 266 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 267 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 268 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 272 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 273 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 274 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 275 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 276 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 277 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 278 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 279 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 280 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 284 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 285 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 286 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 288 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 294 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 300 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 302 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 307 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 308 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 309 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 310 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 312 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 313 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 314 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 315 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 316 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 317 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 319 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 320 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 321 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 322 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 323 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 324 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 325 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 326 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 327 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 328 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 329 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 331 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 332 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 333 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 334 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 335 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 336 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 337 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 338 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 339 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 340 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 341 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 342 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 343 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 344 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 345 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 346 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 347 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 348 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 349 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 350 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 351 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 352 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 353 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 354 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 355 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 356 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 357 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 358 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 359 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 360 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 361 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 362 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 363 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 364 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 365 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 366 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 367 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 368 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 369 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 370 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 371 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 372 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 373 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 374 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 375 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 376 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 377 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 440 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 441 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 442 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 444 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 445 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 446 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 447 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 448 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 449 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 450 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 451 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 452 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 453 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 454 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 455 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 456 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 457 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 483 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 484 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 485 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 486 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 487 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 488 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 489 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 490 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 495 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 496 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 500 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 501 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 502 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 503 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 504 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 505 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 514 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 519 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 520 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 521 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 523 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 524 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 525 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 526 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 527 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 528 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 529 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 530 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 531 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 533 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 534 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 535 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 536 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 537 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 539 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 540 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 542 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 543 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 544 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 545 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 546 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 547 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 548 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 549 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 550 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 551 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 552 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 553 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 554 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 555 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 556 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 557 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 558 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 559 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 560 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 561 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 562 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 563 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 564 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 565 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 566 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 567 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 568 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 569 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 570 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 571 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 572 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 573 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 574 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 575 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 576 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 577 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 578 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 579 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 580 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 581 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 582 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 583 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 584 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 585 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 586 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 587 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 588 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 589 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 590 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 591 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 592 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 593 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 594 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 595 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 596 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 597 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 598 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 599 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 600 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 601 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 602 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 603 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 604 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 605 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 606 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 607 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.28 |
| Metatranscriptomes | 0.39 |
| Isolates | 4.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.67 |
| Nodule | 0.65 |
| Rhizoplane | 1.51 |
| Rhizosphere | 80.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10085778 | 3300005295 | Bacteria | 5889 |
| 2 | JGI24740J21852_10010522 | 3300001979 | Bacteria | 3556 |
| 3 | JGI25155J39150_1000022 | 3300002704 | Bacteria | 142950 |
| 4 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 5 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 6 | JGI25158J39367_1005484 | 3300002739 | Bacteria | 1862 |
| 7 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 8 | JGI25152J39213_1011510 | 3300002773 | Bacteria | 1952 |
| 9 | JGI25159J45721_1015079 | 3300002987 | Bacteria | 1710 |
| 10 | JGI25151J46595_10007571 | 3300003187 | Bacteria | 5305 |
| 11 | JGI25153J46596_10003017 | 3300003215 | Bacteria | 9528 |
| 12 | Ga0006562J51391_1102770 | 3300003578 | Bacteria | 1746 |
| 13 | Ga0006562J51391_1102771 | 3300003578 | Bacteria | 1580 |
| 14 | Ga0055535_1000221 | 3300003761 | Bacteria | 60185 |
| 15 | Ga0055542_1000129 | 3300003762 | Bacteria | 99542 |
| 16 | Ga0055537_1000475 | 3300003773 | Bacteria | 25145 |
| 17 | Ga0055524_1000053 | 3300003775 | Bacteria | 144892 |
| 18 | Ga0055536_1001528 | 3300003781 | Bacteria | 13873 |
| 19 | Ga0055536_1008131 | 3300003781 | Bacteria | 4570 |
| 20 | Ga0055536_1033036 | 3300003781 | Bacteria | 1327 |
| 21 | Ga0055534_1000429 | 3300003784 | Bacteria | 25145 |
| 22 | Ga0055534_1003675 | 3300003784 | Bacteria | 4746 |
| 23 | Ga0055534_1004148 | 3300003784 | Bacteria | 4295 |
| 24 | Ga0055528_1002516 | 3300003790 | Bacteria | 9769 |
| 25 | Ga0055528_1007607 | 3300003790 | Bacteria | 4766 |
| 26 | Ga0055530_10001363 | 3300003791 | Bacteria | 18109 |
| 27 | Ga0055530_10005013 | 3300003791 | Bacteria | 6531 |
| 28 | Ga0055540_1002889 | 3300003792 | Bacteria | 8714 |
| 29 | Ga0055540_1003142 | 3300003792 | Bacteria | 8171 |
| 30 | Ga0055531_10000158 | 3300003794 | Bacteria | 77918 |
| 31 | Ga0055531_10000179 | 3300003794 | Bacteria | 72059 |
| 32 | Ga0055531_10000543 | 3300003794 | Bacteria | 33406 |
| 33 | Ga0065165_1000177 | 3300005262 | Bacteria | 113446 |
| 34 | Ga0065165_1001456 | 3300005262 | Bacteria | 25564 |
| 35 | Ga0065165_1026655 | 3300005262 | Bacteria | 1898 |
| 36 | Ga0065165_1051685 | 3300005262 | Bacteria | 1164 |
| 37 | Ga0065714_10088812 | 3300005288 | Bacteria | 2002 |
| 38 | Ga0065704_10134796 | 3300005289 | Bacteria | 1584 |
| 39 | Ga0065707_10004626 | 3300005295 | Bacteria | 3131 |
| 40 | Ga0070658_10058717 | 3300005327 | Bacteria | 3132 |
| 41 | Ga0070676_10064584 | 3300005328 | Bacteria | 2183 |
| 42 | Ga0070676_10165882 | 3300005328 | Bacteria | 1425 |
| 43 | Ga0070683_100079043 | 3300005329 | Bacteria | 3078 |
| 44 | Ga0070690_100000076 | 3300005330 | Bacteria | 48076 |
| 45 | Ga0070690_100011766 | 3300005330 | Bacteria | 5129 |
| 46 | Ga0070690_100076426 | 3300005330 | Bacteria | 2185 |
| 47 | Ga0070690_100097702 | 3300005330 | Bacteria | 1943 |
| 48 | Ga0070690_100237707 | 3300005330 | Bacteria | 1284 |
| 49 | Ga0070670_100006933 | 3300005331 | Bacteria | 9605 |
| 50 | Ga0070670_100098535 | 3300005331 | Bacteria | 2515 |
| 51 | Ga0070670_100203438 | 3300005331 | Bacteria | 1721 |
| 52 | Ga0068869_100001183 | 3300005334 | Bacteria | 15316 |
| 53 | Ga0068869_100056383 | 3300005334 | Bacteria | 2865 |
| 54 | Ga0068869_100153438 | 3300005334 | Bacteria | 1788 |
| 55 | Ga0068869_100215564 | 3300005334 | Bacteria | 1519 |
| 56 | Ga0070666_10006757 | 3300005335 | Bacteria | 7065 |
| 57 | Ga0070666_10064631 | 3300005335 | Bacteria | 2481 |
| 58 | Ga0070680_100000812 | 3300005336 | Bacteria | 22014 |
| 59 | Ga0070680_100006232 | 3300005336 | Bacteria | 9050 |
| 60 | Ga0070680_100078687 | 3300005336 | Bacteria | 2717 |
| 61 | Ga0068868_100000966 | 3300005338 | Bacteria | 19576 |
| 62 | Ga0068868_100118129 | 3300005338 | Bacteria | 2161 |
| 63 | Ga0068868_100471099 | 3300005338 | Bacteria | 1095 |
| 64 | Ga0070660_100064288 | 3300005339 | Bacteria | 2854 |
| 65 | Ga0070689_100005432 | 3300005340 | Bacteria | 8699 |
| 66 | Ga0070689_100009409 | 3300005340 | Bacteria | 6928 |
| 67 | Ga0070689_100012393 | 3300005340 | Bacteria | 6141 |
| 68 | Ga0070689_100013607 | 3300005340 | Bacteria | 5892 |
| 69 | Ga0070689_100253426 | 3300005340 | Bacteria | 1453 |
| 70 | Ga0070691_10003561 | 3300005341 | Bacteria | 7025 |
| 71 | Ga0070691_10003688 | 3300005341 | Bacteria | 6917 |
| 72 | Ga0070691_10121804 | 3300005341 | Bacteria | 1314 |
| 73 | Ga0070687_100000107 | 3300005343 | Bacteria | 28094 |
| 74 | Ga0070687_100083430 | 3300005343 | Bacteria | 1750 |
| 75 | Ga0070687_100083699 | 3300005343 | Bacteria | 1747 |
| 76 | Ga0070661_100110093 | 3300005344 | Bacteria | 2056 |
| 77 | Ga0070692_10005519 | 3300005345 | Bacteria | 5402 |
| 78 | Ga0070692_10019289 | 3300005345 | Bacteria | 3289 |
| 79 | Ga0070692_10043349 | 3300005345 | Bacteria | 2313 |
| 80 | Ga0070668_100014537 | 3300005347 | Bacteria | 5883 |
| 81 | Ga0070668_100056051 | 3300005347 | Bacteria | 3043 |
| 82 | Ga0070668_100079443 | 3300005347 | Bacteria | 2568 |
| 83 | Ga0070669_100005844 | 3300005353 | Bacteria | 8872 |
| 84 | Ga0070669_100024219 | 3300005353 | Bacteria | 4352 |
| 85 | Ga0070669_100056715 | 3300005353 | Bacteria | 2872 |
| 86 | Ga0070669_100080916 | 3300005353 | Bacteria | 2419 |
| 87 | Ga0070669_100169668 | 3300005353 | Bacteria | 1700 |
| 88 | Ga0070675_100008036 | 3300005354 | Bacteria | 8179 |
| 89 | Ga0070675_100027347 | 3300005354 | Bacteria | 4582 |
| 90 | Ga0070675_100042997 | 3300005354 | Bacteria | 3691 |
| 91 | Ga0070671_100002643 | 3300005355 | Bacteria | 13868 |
| 92 | Ga0070671_100011057 | 3300005355 | Bacteria | 7245 |
| 93 | Ga0070671_100126767 | 3300005355 | Bacteria | 2149 |
| 94 | Ga0070671_100142202 | 3300005355 | Bacteria | 2025 |
| 95 | Ga0070671_100354492 | 3300005355 | Bacteria | 1252 |
| 96 | Ga0070674_100004974 | 3300005356 | Bacteria | 7619 |
| 97 | Ga0070674_100060000 | 3300005356 | Bacteria | 2650 |
| 98 | Ga0070673_100046302 | 3300005364 | Bacteria | 3377 |
| 99 | Ga0070673_100146969 | 3300005364 | Bacteria | 1993 |
| 100 | Ga0070673_100243232 | 3300005364 | Bacteria | 1565 |
| 101 | Ga0070688_100049953 | 3300005365 | Bacteria | 2604 |
| 102 | Ga0070688_100201968 | 3300005365 | Bacteria | 1391 |
| 103 | Ga0070659_100187177 | 3300005366 | Bacteria | 1701 |
| 104 | Ga0070659_100208652 | 3300005366 | Bacteria | 1609 |
| 105 | Ga0070659_100351996 | 3300005366 | Bacteria | 1236 |
| 106 | Ga0070667_100016643 | 3300005367 | Bacteria | 6086 |
| 107 | Ga0070667_100023158 | 3300005367 | Bacteria | 5151 |
| 108 | Ga0070667_100212242 | 3300005367 | Bacteria | 1721 |
| 109 | Ga0070667_100327871 | 3300005367 | Bacteria | 1382 |
| 110 | Ga0070701_10000399 | 3300005438 | Bacteria | 14648 |
| 111 | Ga0070705_100029021 | 3300005440 | Bacteria | 3036 |
| 112 | Ga0070705_100071961 | 3300005440 | Bacteria | 2093 |
| 113 | Ga0070700_100000695 | 3300005441 | Bacteria | 16626 |
| 114 | Ga0070700_100003268 | 3300005441 | Bacteria | 8350 |
| 115 | Ga0070700_100075600 | 3300005441 | Bacteria | 2161 |
| 116 | Ga0070694_100091408 | 3300005444 | Bacteria | 2136 |
| 117 | Ga0070694_100096346 | 3300005444 | Bacteria | 2085 |
| 118 | Ga0070694_100110515 | 3300005444 | Bacteria | 1957 |
| 119 | Ga0070694_100190004 | 3300005444 | Bacteria | 1524 |
| 120 | Ga0070678_100006239 | 3300005456 | Bacteria | 6975 |
| 121 | Ga0070678_100068048 | 3300005456 | Bacteria | 2653 |
| 122 | Ga0070678_100189130 | 3300005456 | Bacteria | 1691 |
| 123 | Ga0070662_100017313 | 3300005457 | Bacteria | 4857 |
| 124 | Ga0070662_100048475 | 3300005457 | Bacteria | 3060 |
| 125 | Ga0070662_100081313 | 3300005457 | Bacteria | 2413 |
| 126 | Ga0070681_10000131 | 3300005458 | Bacteria | 56441 |
| 127 | Ga0070681_10001310 | 3300005458 | Bacteria | 21725 |
| 128 | Ga0070681_10011104 | 3300005458 | Bacteria | 8913 |
| 129 | Ga0070681_10479521 | 3300005458 | Bacteria | 1156 |
| 130 | Ga0068867_100001930 | 3300005459 | Bacteria | 14446 |
| 131 | Ga0068867_100002071 | 3300005459 | Bacteria | 14068 |
| 132 | Ga0068867_100002251 | 3300005459 | Bacteria | 13569 |
| 133 | Ga0068867_100005640 | 3300005459 | Bacteria | 8872 |
| 134 | Ga0068867_100049124 | 3300005459 | Bacteria | 3105 |
| 135 | Ga0068867_100107037 | 3300005459 | Bacteria | 2143 |
| 136 | Ga0068867_100184517 | 3300005459 | Bacteria | 1661 |
| 137 | Ga0068867_100362023 | 3300005459 | Bacteria | 1213 |
| 138 | Ga0070685_10062721 | 3300005466 | Bacteria | 2180 |
| 139 | Ga0070706_100000463 | 3300005467 | Bacteria | 48079 |
| 140 | Ga0070706_100328109 | 3300005467 | Bacteria | 1427 |
| 141 | Ga0070706_100544038 | 3300005467 | Bacteria | 1080 |
| 142 | Ga0070707_100084821 | 3300005468 | Bacteria | 3061 |
| 143 | Ga0070707_100232052 | 3300005468 | Bacteria | 1796 |
| 144 | Ga0070707_100670418 | 3300005468 | Bacteria | 1000 |
| 145 | Ga0070699_100007582 | 3300005518 | Bacteria | 9436 |
| 146 | Ga0070699_100477240 | 3300005518 | Bacteria | 1132 |
| 147 | Ga0070699_100621188 | 3300005518 | Bacteria | 986 |
| 148 | Ga0070679_100008624 | 3300005530 | Bacteria | 9608 |
| 149 | Ga0070679_100025341 | 3300005530 | Bacteria | 5820 |
| 150 | Ga0070679_100048778 | 3300005530 | Bacteria | 4218 |
| 151 | Ga0070679_100051692 | 3300005530 | Bacteria | 4093 |
| 152 | Ga0070679_100148794 | 3300005530 | Bacteria | 2319 |
| 153 | Ga0070679_100623511 | 3300005530 | Bacteria | 1022 |
| 154 | Ga0070684_100074042 | 3300005535 | Bacteria | 3002 |
| 155 | Ga0070684_100100602 | 3300005535 | Bacteria | 2582 |
| 156 | Ga0070697_100000561 | 3300005536 | Bacteria | 27986 |
| 157 | Ga0068853_100019963 | 3300005539 | Bacteria | 5566 |
| 158 | Ga0068853_100029057 | 3300005539 | Bacteria | 4656 |
| 159 | Ga0068853_100037525 | 3300005539 | Bacteria | 4123 |
| 160 | Ga0068853_100216257 | 3300005539 | Bacteria | 1748 |
| 161 | Ga0070672_100007718 | 3300005543 | Bacteria | 7327 |
| 162 | Ga0070672_100016975 | 3300005543 | Bacteria | 5226 |
| 163 | Ga0070672_100102772 | 3300005543 | Bacteria | 2320 |
| 164 | Ga0070686_100000265 | 3300005544 | Bacteria | 35750 |
| 165 | Ga0070686_100049881 | 3300005544 | Bacteria | 2657 |
| 166 | Ga0070686_100064529 | 3300005544 | Bacteria | 2376 |
| 167 | Ga0070686_100302585 | 3300005544 | Bacteria | 1186 |
| 168 | Ga0070686_100320429 | 3300005544 | Bacteria | 1156 |
| 169 | Ga0070695_100010977 | 3300005545 | Bacteria | 5415 |
| 170 | Ga0070695_100232474 | 3300005545 | Bacteria | 1333 |
| 171 | Ga0070696_100000037 | 3300005546 | Bacteria | 62186 |
| 172 | Ga0070696_100000395 | 3300005546 | Bacteria | 26958 |
| 173 | Ga0070696_100009221 | 3300005546 | Bacteria | 6605 |
| 174 | Ga0070696_100090356 | 3300005546 | Bacteria | 2179 |
| 175 | Ga0070696_100255838 | 3300005546 | Bacteria | 1326 |
| 176 | Ga0070696_100268856 | 3300005546 | Bacteria | 1296 |
| 177 | Ga0070693_100009214 | 3300005547 | Bacteria | 4904 |
| 178 | Ga0070693_100012997 | 3300005547 | Bacteria | 4228 |
| 179 | Ga0070704_100019475 | 3300005549 | Bacteria | 4360 |
| 180 | Ga0070704_100092483 | 3300005549 | Bacteria | 2258 |
| 181 | Ga0068855_100004649 | 3300005563 | Bacteria | 16756 |
| 182 | Ga0068855_100004857 | 3300005563 | Bacteria | 16412 |
| 183 | Ga0068855_100010307 | 3300005563 | Bacteria | 11273 |
| 184 | Ga0068855_100040261 | 3300005563 | Bacteria | 5547 |
| 185 | Ga0068855_100052158 | 3300005563 | Bacteria | 4816 |
| 186 | Ga0068855_100071465 | 3300005563 | Bacteria | 4035 |
| 187 | Ga0068855_100126648 | 3300005563 | Bacteria | 2920 |
| 188 | Ga0068855_100271508 | 3300005563 | Bacteria | 1886 |
| 189 | Ga0068857_100050189 | 3300005577 | Bacteria | 3702 |
| 190 | Ga0068857_100146465 | 3300005577 | Bacteria | 2137 |
| 191 | Ga0068857_100197346 | 3300005577 | Bacteria | 1834 |
| 192 | Ga0068854_100232915 | 3300005578 | Bacteria | 1463 |
| 193 | Ga0068856_100014722 | 3300005614 | Bacteria | 7549 |
| 194 | Ga0068856_100030042 | 3300005614 | Bacteria | 5312 |
| 195 | Ga0068856_100062381 | 3300005614 | Bacteria | 3682 |
| 196 | Ga0068856_100084723 | 3300005614 | Bacteria | 3149 |
| 197 | Ga0068856_100091182 | 3300005614 | Bacteria | 3032 |
| 198 | Ga0068856_100282997 | 3300005614 | Bacteria | 1675 |
| 199 | Ga0070702_100000223 | 3300005615 | Bacteria | 19138 |
| 200 | Ga0070702_100089046 | 3300005615 | Bacteria | 1867 |
| 201 | Ga0068852_100028336 | 3300005616 | Bacteria | 4582 |
| 202 | Ga0068852_100037752 | 3300005616 | Bacteria | 4053 |
| 203 | Ga0068852_100090940 | 3300005616 | Bacteria | 2730 |
| 204 | Ga0068852_100118933 | 3300005616 | Bacteria | 2415 |
| 205 | Ga0068852_100403561 | 3300005616 | Bacteria | 1345 |
| 206 | Ga0068859_100000813 | 3300005617 | Bacteria | 31757 |
| 207 | Ga0068859_100003358 | 3300005617 | Bacteria | 16282 |
| 208 | Ga0068859_100019167 | 3300005617 | Bacteria | 6872 |
| 209 | Ga0068859_100022929 | 3300005617 | Bacteria | 6260 |
| 210 | Ga0068859_100095785 | 3300005617 | Bacteria | 3021 |
| 211 | Ga0068859_100141218 | 3300005617 | Bacteria | 2482 |
| 212 | Ga0068859_100169103 | 3300005617 | Bacteria | 2267 |
| 213 | Ga0068864_100002065 | 3300005618 | Bacteria | 16597 |
| 214 | Ga0068864_100031868 | 3300005618 | Bacteria | 4475 |
| 215 | Ga0068864_100066296 | 3300005618 | Bacteria | 3133 |
| 216 | Ga0068864_100093008 | 3300005618 | Bacteria | 2663 |
| 217 | Ga0068864_100094644 | 3300005618 | Bacteria | 2640 |
| 218 | Ga0068866_10000107 | 3300005718 | Bacteria | 35562 |
| 219 | Ga0068866_10003257 | 3300005718 | Bacteria | 6683 |
| 220 | Ga0068866_10007229 | 3300005718 | Bacteria | 4645 |
| 221 | Ga0068866_10085870 | 3300005718 | Bacteria | 1701 |
| 222 | Ga0068861_100001908 | 3300005719 | Bacteria | 13422 |
| 223 | Ga0068861_100003286 | 3300005719 | Bacteria | 10701 |
| 224 | Ga0068861_100005730 | 3300005719 | Bacteria | 8421 |
| 225 | Ga0068861_100016185 | 3300005719 | Bacteria | 5271 |
| 226 | Ga0068851_10000590 | 3300005834 | Bacteria | 15755 |
| 227 | Ga0068851_10006836 | 3300005834 | Bacteria | 5222 |
| 228 | Ga0068851_10025366 | 3300005834 | Bacteria | 2908 |
| 229 | Ga0068870_10005307 | 3300005840 | Bacteria | 5615 |
| 230 | Ga0068863_100020937 | 3300005841 | Bacteria | 6246 |
| 231 | Ga0068863_100031484 | 3300005841 | Bacteria | 5060 |
| 232 | Ga0068863_100059870 | 3300005841 | Bacteria | 3603 |
| 233 | Ga0068863_100126062 | 3300005841 | Bacteria | 2443 |
| 234 | Ga0068863_100227676 | 3300005841 | Bacteria | 1798 |
| 235 | Ga0068863_100263155 | 3300005841 | Bacteria | 1668 |
| 236 | Ga0068858_100002059 | 3300005842 | Bacteria | 20475 |
| 237 | Ga0068858_100002634 | 3300005842 | Bacteria | 18080 |
| 238 | Ga0068858_100009260 | 3300005842 | Bacteria | 9405 |
| 239 | Ga0068858_100015823 | 3300005842 | Bacteria | 7091 |
| 240 | Ga0068858_100720873 | 3300005842 | Bacteria | 971 |
| 241 | Ga0068860_100000823 | 3300005843 | Bacteria | 34706 |
| 242 | Ga0068860_100002377 | 3300005843 | Bacteria | 19765 |
| 243 | Ga0068860_100010005 | 3300005843 | Bacteria | 9401 |
| 244 | Ga0068860_100013908 | 3300005843 | Bacteria | 7890 |
| 245 | Ga0068860_100077614 | 3300005843 | Bacteria | 3159 |
| 246 | Ga0068862_100000524 | 3300005844 | Bacteria | 40510 |
| 247 | Ga0068862_100004134 | 3300005844 | Bacteria | 12303 |
| 248 | Ga0068862_100053550 | 3300005844 | Bacteria | 3455 |
| 249 | Ga0068862_100069467 | 3300005844 | Bacteria | 3041 |
| 250 | Ga0068862_100074012 | 3300005844 | Bacteria | 2944 |
| 251 | Ga0068862_100617182 | 3300005844 | Bacteria | 1043 |
| 252 | Ga0081539_10000770 | 3300005985 | Bacteria | 62993 |
| 253 | Ga0075365_10006791 | 3300006038 | Bacteria | 6337 |
| 254 | Ga0075365_10060700 | 3300006038 | Bacteria | 2523 |
| 255 | Ga0075368_10000729 | 3300006042 | Bacteria | 10069 |
| 256 | Ga0075363_100006078 | 3300006048 | Bacteria | 5447 |
| 257 | Ga0075363_100013051 | 3300006048 | Bacteria | 4016 |
| 258 | Ga0075363_100017008 | 3300006048 | Bacteria | 3600 |
| 259 | Ga0075363_100021733 | 3300006048 | Bacteria | 3237 |
| 260 | Ga0075363_100023200 | 3300006048 | Bacteria | 3142 |
| 261 | Ga0075432_10036342 | 3300006058 | Bacteria | 1712 |
| 262 | Ga0070715_10052184 | 3300006163 | Bacteria | 1763 |
| 263 | Ga0070715_10075341 | 3300006163 | Bacteria | 1518 |
| 264 | Ga0075362_10006328 | 3300006177 | Bacteria | 4409 |
| 265 | Ga0075362_10009223 | 3300006177 | Bacteria | 3806 |
| 266 | Ga0075362_10140226 | 3300006177 | Bacteria | 1155 |
| 267 | Ga0075369_10006559 | 3300006186 | Bacteria | 4403 |
| 268 | Ga0075369_10065462 | 3300006186 | Bacteria | 1593 |
| 269 | Ga0075366_10001345 | 3300006195 | Bacteria | 12278 |
| 270 | Ga0075366_10003111 | 3300006195 | Bacteria | 8677 |
| 271 | Ga0075366_10004891 | 3300006195 | Bacteria | 7226 |
| 272 | Ga0075366_10005480 | 3300006195 | Bacteria | 6878 |
| 273 | Ga0075366_10007403 | 3300006195 | Bacteria | 6062 |
| 274 | Ga0075366_10070270 | 3300006195 | Bacteria | 2085 |
| 275 | Ga0075366_10081257 | 3300006195 | Bacteria | 1936 |
| 276 | Ga0075366_10082938 | 3300006195 | Bacteria | 1916 |
| 277 | Ga0075366_10085706 | 3300006195 | Bacteria | 1884 |
| 278 | Ga0075366_10119078 | 3300006195 | Bacteria | 1590 |
| 279 | Ga0075366_10256797 | 3300006195 | Bacteria | 1066 |
| 280 | Ga0097621_100001105 | 3300006237 | Bacteria | 18836 |
| 281 | Ga0097621_100004475 | 3300006237 | Bacteria | 9740 |
| 282 | Ga0097621_100004893 | 3300006237 | Bacteria | 9390 |
| 283 | Ga0097621_100011516 | 3300006237 | Bacteria | 6517 |
| 284 | Ga0097621_100015018 | 3300006237 | Bacteria | 5814 |
| 285 | Ga0097621_100028244 | 3300006237 | Bacteria | 4421 |
| 286 | Ga0097621_100041619 | 3300006237 | Bacteria | 3699 |
| 287 | Ga0097621_100093501 | 3300006237 | Bacteria | 2520 |
| 288 | Ga0097621_100271698 | 3300006237 | Bacteria | 1490 |
| 289 | Ga0075370_10001747 | 3300006353 | Bacteria | 9677 |
| 290 | Ga0075370_10002909 | 3300006353 | Bacteria | 8042 |
| 291 | Ga0075370_10008912 | 3300006353 | Bacteria | 5184 |
| 292 | Ga0075370_10018941 | 3300006353 | Bacteria | 3739 |
| 293 | Ga0075370_10029361 | 3300006353 | Bacteria | 3063 |
| 294 | Ga0075370_10035374 | 3300006353 | Bacteria | 2803 |
| 295 | Ga0068871_100001255 | 3300006358 | Bacteria | 16960 |
| 296 | Ga0068871_100005726 | 3300006358 | Bacteria | 8725 |
| 297 | Ga0068871_100005895 | 3300006358 | Bacteria | 8616 |
| 298 | Ga0068871_100007755 | 3300006358 | Bacteria | 7686 |
| 299 | Ga0068871_100041620 | 3300006358 | Bacteria | 3684 |
| 300 | Ga0068871_100102463 | 3300006358 | Bacteria | 2399 |
| 301 | Ga0068871_100148527 | 3300006358 | Bacteria | 1998 |
| 302 | Ga0075428_100046009 | 3300006844 | Bacteria | 4794 |
| 303 | Ga0075428_100156306 | 3300006844 | Bacteria | 2477 |
| 304 | Ga0075428_100161138 | 3300006844 | Bacteria | 2435 |
| 305 | Ga0075430_100004390 | 3300006846 | Bacteria | 11907 |
| 306 | Ga0075430_100023926 | 3300006846 | Bacteria | 5201 |
| 307 | Ga0075430_100125945 | 3300006846 | Bacteria | 2135 |
| 308 | Ga0075430_100232229 | 3300006846 | Bacteria | 1529 |
| 309 | Ga0075430_100294579 | 3300006846 | Bacteria | 1342 |
| 310 | Ga0075431_100055531 | 3300006847 | Bacteria | 4085 |
| 311 | Ga0075431_100130231 | 3300006847 | Bacteria | 2595 |
| 312 | Ga0075431_100216257 | 3300006847 | Bacteria | 1956 |
| 313 | Ga0075431_100370035 | 3300006847 | Bacteria | 1438 |
| 314 | Ga0075433_10015306 | 3300006852 | Bacteria | 6287 |
| 315 | Ga0075433_10025822 | 3300006852 | Bacteria | 4967 |
| 316 | Ga0075433_10161312 | 3300006852 | Bacteria | 1996 |
| 317 | Ga0075433_10282682 | 3300006852 | Bacteria | 1470 |
| 318 | Ga0075434_100000169 | 3300006871 | Bacteria | 41864 |
| 319 | Ga0075434_100002533 | 3300006871 | Bacteria | 16119 |
| 320 | Ga0075434_100044170 | 3300006871 | Bacteria | 4421 |
| 321 | Ga0075434_100420951 | 3300006871 | Bacteria | 1357 |
| 322 | Ga0075429_100000043 | 3300006880 | Bacteria | 57531 |
| 323 | Ga0075429_100000297 | 3300006880 | Bacteria | 35129 |
| 324 | Ga0075429_100031540 | 3300006880 | Bacteria | 4607 |
| 325 | Ga0068865_100000281 | 3300006881 | Bacteria | 28119 |
| 326 | Ga0068865_100000467 | 3300006881 | Bacteria | 22595 |
| 327 | Ga0068865_100022066 | 3300006881 | Bacteria | 4146 |
| 328 | Ga0068865_100047195 | 3300006881 | Bacteria | 2958 |
| 329 | Ga0068865_100369920 | 3300006881 | Bacteria | 1166 |
| 330 | Ga0075436_100000735 | 3300006914 | Bacteria | 21703 |
| 331 | Ga0075436_100000989 | 3300006914 | Bacteria | 19059 |
| 332 | Ga0075436_100002087 | 3300006914 | Bacteria | 13796 |
| 333 | Ga0075436_100037921 | 3300006914 | Bacteria | 3327 |
| 334 | Ga0097620_100000813 | 3300006931 | Bacteria | 31757 |
| 335 | Ga0097620_100003358 | 3300006931 | Bacteria | 16282 |
| 336 | Ga0097620_100019167 | 3300006931 | Bacteria | 6872 |
| 337 | Ga0097620_100022929 | 3300006931 | Bacteria | 6260 |
| 338 | Ga0097620_100095785 | 3300006931 | Bacteria | 3021 |
| 339 | Ga0097620_100141215 | 3300006931 | Bacteria | 2482 |
| 340 | Ga0097620_100154088 | 3300006931 | Bacteria | 2374 |
| 341 | Ga0097620_100169112 | 3300006931 | Bacteria | 2267 |
| 342 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 343 | Ga0079104_1024414 | 3300006946 | Bacteria | 1592 |
| 344 | Ga0099826_10000006 | 3300006948 | Bacteria | 432260 |
| 345 | Ga0099826_10001433 | 3300006948 | Bacteria | 14295 |
| 346 | Ga0099826_10047540 | 3300006948 | Bacteria | 2914 |
| 347 | Ga0075435_100000193 | 3300007076 | Bacteria | 36806 |
| 348 | Ga0075435_100003462 | 3300007076 | Bacteria | 10703 |
| 349 | Ga0075435_100067670 | 3300007076 | Bacteria | 2908 |
| 350 | Ga0075435_100158163 | 3300007076 | Bacteria | 1908 |
| 351 | Ga0075435_100273683 | 3300007076 | Bacteria | 1441 |
| 352 | Ga0075435_100327130 | 3300007076 | Bacteria | 1312 |
| 353 | Ga0099794_10009590 | 3300007265 | Bacteria | 4080 |
| 354 | Ga0099794_10040107 | 3300007265 | Bacteria | 2225 |
| 355 | Ga0099794_10151403 | 3300007265 | Bacteria | 1178 |
| 356 | Ga0099795_10004388 | 3300007788 | Bacteria | 3633 |
| 357 | Ga0099795_10047104 | 3300007788 | Bacteria | 1556 |
| 358 | Ga0105244_10011385 | 3300009036 | Bacteria | 5338 |
| 359 | Ga0105250_10005158 | 3300009092 | Bacteria | 5895 |
| 360 | Ga0105250_10098696 | 3300009092 | Bacteria | 1191 |
| 361 | Ga0105240_10025383 | 3300009093 | Bacteria | 7788 |
| 362 | Ga0105240_10083354 | 3300009093 | Bacteria | 3924 |
| 363 | Ga0105240_10168408 | 3300009093 | Bacteria | 2597 |
| 364 | Ga0105240_10196995 | 3300009093 | Bacteria | 2364 |
| 365 | Ga0105240_10221311 | 3300009093 | Bacteria | 2205 |
| 366 | Ga0111539_10157611 | 3300009094 | Bacteria | 2656 |
| 367 | Ga0111539_10169618 | 3300009094 | Bacteria | 2550 |
| 368 | Ga0105245_10000511 | 3300009098 | Bacteria | 35566 |
| 369 | Ga0105245_10002551 | 3300009098 | Bacteria | 16405 |
| 370 | Ga0105245_10037219 | 3300009098 | Bacteria | 4326 |
| 371 | Ga0105245_10299143 | 3300009098 | Bacteria | 1578 |
| 372 | Ga0105245_10307068 | 3300009098 | Bacteria | 1559 |
| 373 | Ga0105245_10453394 | 3300009098 | Bacteria | 1291 |
| 374 | Ga0105247_10375689 | 3300009101 | Bacteria | 1006 |
| 375 | Ga0114129_10012381 | 3300009147 | Bacteria | 12143 |
| 376 | Ga0105243_10000784 | 3300009148 | Bacteria | 30492 |
| 377 | Ga0105243_10001212 | 3300009148 | Bacteria | 23228 |
| 378 | Ga0105243_10002490 | 3300009148 | Bacteria | 15370 |
| 379 | Ga0105243_10006331 | 3300009148 | Bacteria | 9144 |
| 380 | Ga0105243_10011373 | 3300009148 | Bacteria | 6735 |
| 381 | Ga0105243_10012444 | 3300009148 | Bacteria | 6432 |
| 382 | Ga0105243_10012837 | 3300009148 | Bacteria | 6330 |
| 383 | Ga0105243_10075673 | 3300009148 | Bacteria | 2733 |
| 384 | Ga0105243_10091340 | 3300009148 | Bacteria | 2507 |
| 385 | Ga0105243_10258984 | 3300009148 | Bacteria | 1557 |
| 386 | Ga0105241_10261988 | 3300009174 | Bacteria | 1469 |
| 387 | Ga0105241_10454797 | 3300009174 | Bacteria | 1133 |
| 388 | Ga0105242_10002499 | 3300009176 | Bacteria | 14416 |
| 389 | Ga0105242_10002648 | 3300009176 | Bacteria | 14033 |
| 390 | Ga0105242_10025474 | 3300009176 | Bacteria | 4682 |
| 391 | Ga0105242_10304536 | 3300009176 | Bacteria | 1456 |
| 392 | Ga0105242_10619299 | 3300009176 | Bacteria | 1048 |
| 393 | Ga0105248_10000507 | 3300009177 | Bacteria | 44310 |
| 394 | Ga0105248_10005804 | 3300009177 | Bacteria | 13570 |
| 395 | Ga0105248_10074832 | 3300009177 | Bacteria | 3806 |
| 396 | Ga0105248_10220347 | 3300009177 | Bacteria | 2136 |
| 397 | Ga0105237_10098355 | 3300009545 | Bacteria | 2917 |
| 398 | Ga0105237_10328713 | 3300009545 | Bacteria | 1533 |
| 399 | Ga0105237_10757584 | 3300009545 | Bacteria | 977 |
| 400 | Ga0105238_10062981 | 3300009551 | Bacteria | 3709 |
| 401 | Ga0105238_10130674 | 3300009551 | Bacteria | 2489 |
| 402 | Ga0105249_10014809 | 3300009553 | Bacteria | 6894 |
| 403 | Ga0105249_10031885 | 3300009553 | Bacteria | 4768 |
| 404 | Ga0105249_10051098 | 3300009553 | Bacteria | 3770 |
| 405 | Ga0105249_10395340 | 3300009553 | Bacteria | 1411 |
| 406 | Ga0105239_10136528 | 3300010375 | Bacteria | 2730 |
| 407 | Ga0105239_10238061 | 3300010375 | Bacteria | 2043 |
| 408 | Ga0105246_10307291 | 3300011119 | Bacteria | 1283 |
| 409 | Ga0157370_10004427 | 3300013104 | Bacteria | 16097 |
| 410 | Ga0157370_10009369 | 3300013104 | Bacteria | 10474 |
| 411 | Ga0157370_10075515 | 3300013104 | Bacteria | 3177 |
| 412 | Ga0157370_10225610 | 3300013104 | Bacteria | 1734 |
| 413 | Ga0157370_10242427 | 3300013104 | Bacteria | 1668 |
| 414 | Ga0157369_10003852 | 3300013105 | Bacteria | 17828 |
| 415 | Ga0157369_10366954 | 3300013105 | Bacteria | 1495 |
| 416 | Ga0157369_10540983 | 3300013105 | Bacteria | 1204 |
| 417 | Ga0157374_10101114 | 3300013296 | Bacteria | 2764 |
| 418 | Ga0157378_10000797 | 3300013297 | Bacteria | 29325 |
| 419 | Ga0157378_10001703 | 3300013297 | Bacteria | 19776 |
| 420 | Ga0157378_10003052 | 3300013297 | Bacteria | 14881 |
| 421 | Ga0157378_10123159 | 3300013297 | Unclassified | 2392 |
| 422 | Ga0163162_10002252 | 3300013306 | Bacteria | 18114 |
| 423 | Ga0163162_10015531 | 3300013306 | Bacteria | 7442 |
| 424 | Ga0163162_10084437 | 3300013306 | Bacteria | 3251 |
| 425 | Ga0163162_10132115 | 3300013306 | Bacteria | 2605 |
| 426 | Ga0163162_10176828 | 3300013306 | Bacteria | 2260 |
| 427 | Ga0163162_10277668 | 3300013306 | Bacteria | 1807 |
| 428 | Ga0157372_10037717 | 3300013307 | Bacteria | 5332 |
| 429 | Ga0157372_10222146 | 3300013307 | Bacteria | 2189 |
| 430 | Ga0157372_10836713 | 3300013307 | Bacteria | 1069 |
| 431 | Ga0157375_10025703 | 3300013308 | Bacteria | 5478 |
| 432 | Ga0157375_10026436 | 3300013308 | Bacteria | 5409 |
| 433 | Ga0157375_10048298 | 3300013308 | Bacteria | 4162 |
| 434 | Ga0157375_10049801 | 3300013308 | Bacteria | 4106 |
| 435 | Ga0157375_10097080 | 3300013308 | Bacteria | 3020 |
| 436 | Ga0157375_10152670 | 3300013308 | Bacteria | 2446 |
| 437 | Ga0157375_10161194 | 3300013308 | Bacteria | 2385 |
| 438 | Ga0157375_10311946 | 3300013308 | Bacteria | 1737 |
| 439 | Ga0157375_10425325 | 3300013308 | Bacteria | 1494 |
| 440 | Ga0163163_10009458 | 3300014325 | Bacteria | 8703 |
| 441 | Ga0163163_10180537 | 3300014325 | Bacteria | 2158 |
| 442 | Ga0163163_10318039 | 3300014325 | Bacteria | 1610 |
| 443 | Ga0157380_10010570 | 3300014326 | Bacteria | 6638 |
| 444 | Ga0157380_10014505 | 3300014326 | Bacteria | 5766 |
| 445 | Ga0157380_10022401 | 3300014326 | Bacteria | 4755 |
| 446 | Ga0157380_10049076 | 3300014326 | Bacteria | 3327 |
| 447 | Ga0182008_10003127 | 3300014497 | Bacteria | 10128 |
| 448 | Ga0182008_10004233 | 3300014497 | Bacteria | 8415 |
| 449 | Ga0182008_10017487 | 3300014497 | Bacteria | 3720 |
| 450 | Ga0182008_10028571 | 3300014497 | Bacteria | 2820 |
| 451 | Ga0182008_10060779 | 3300014497 | Bacteria | 1862 |
| 452 | Ga0157377_10041231 | 3300014745 | Bacteria | 2560 |
| 453 | Ga0157377_10254452 | 3300014745 | Bacteria | 1140 |
| 454 | Ga0157377_10283613 | 3300014745 | Bacteria | 1087 |
| 455 | Ga0157377_10350801 | 3300014745 | Bacteria | 990 |
| 456 | Ga0157379_10021513 | 3300014968 | Bacteria | 5710 |
| 457 | Ga0157379_10070089 | 3300014968 | Bacteria | 3136 |
| 458 | Ga0157379_10136617 | 3300014968 | Bacteria | 2209 |
| 459 | Ga0157376_10004974 | 3300014969 | Bacteria | 9267 |
| 460 | Ga0157376_10007718 | 3300014969 | Bacteria | 7707 |
| 461 | Ga0182006_1000030 | 3300015261 | Bacteria | 242894 |
| 462 | Ga0182006_1001066 | 3300015261 | Bacteria | 17656 |
| 463 | Ga0182006_1008458 | 3300015261 | Bacteria | 4662 |
| 464 | Ga0182007_10002485 | 3300015262 | Bacteria | 9137 |
| 465 | Ga0182007_10021578 | 3300015262 | Bacteria | 2285 |
| 466 | Ga0182005_1036334 | 3300015265 | Bacteria | 1340 |
| 467 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 468 | Ga0163161_10000099 | 3300017792 | Bacteria | 83318 |
| 469 | Ga0163161_10011306 | 3300017792 | Bacteria | 6186 |
| 470 | Ga0163161_10020762 | 3300017792 | Bacteria | 4611 |
| 471 | Ga0163161_10028787 | 3300017792 | Bacteria | 3947 |
| 472 | Ga0163161_10067857 | 3300017792 | Bacteria | 2605 |
| 473 | Ga0163161_10183408 | 3300017792 | Bacteria | 1606 |
| 474 | Ga0163161_10334952 | 3300017792 | Bacteria | 1199 |
| 475 | Ga0213872_10000169 | 3300021361 | Bacteria | 58596 |
| 476 | Ga0213872_10000382 | 3300021361 | Bacteria | 37031 |
| 477 | Ga0213872_10003263 | 3300021361 | Bacteria | 9053 |
| 478 | Ga0213874_10021161 | 3300021377 | Bacteria | 1791 |
| 479 | Ga0213876_10030362 | 3300021384 | Bacteria | 2851 |
| 480 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 481 | Ga0209672_100660 | 3300025228 | Bacteria | 17534 |
| 482 | Ga0209147_101111 | 3300025229 | Bacteria | 11165 |
| 483 | Ga0209258_100240 | 3300025242 | Bacteria | 100990 |
| 484 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 485 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 486 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 487 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 488 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 489 | Ga0209565_1000224 | 3300025263 | Bacteria | 63468 |
| 490 | Ga0209565_1001443 | 3300025263 | Bacteria | 10500 |
| 491 | Ga0209673_1000097 | 3300025273 | Bacteria | 193482 |
| 492 | Ga0209673_1000172 | 3300025273 | Bacteria | 133472 |
| 493 | Ga0209673_1002773 | 3300025273 | Bacteria | 11415 |
| 494 | Ga0209673_1026389 | 3300025273 | Bacteria | 1909 |
| 495 | Ga0209673_1027409 | 3300025273 | Bacteria | 1853 |
| 496 | Ga0209130_1000832 | 3300025284 | Bacteria | 25922 |
| 497 | Ga0209130_1001095 | 3300025284 | Bacteria | 20107 |
| 498 | Ga0209130_1001276 | 3300025284 | Bacteria | 17456 |
| 499 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 500 | Ga0209675_1000431 | 3300025291 | Bacteria | 33567 |
| 501 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 502 | Ga0209676_1000739 | 3300025292 | Bacteria | 44487 |
| 503 | Ga0209676_1000836 | 3300025292 | Bacteria | 39908 |
| 504 | Ga0209676_1005062 | 3300025292 | Bacteria | 7045 |
| 505 | Ga0209676_1016772 | 3300025292 | Bacteria | 2627 |
| 506 | Ga0209025_1000174 | 3300025294 | Bacteria | 158915 |
| 507 | Ga0209025_1000906 | 3300025294 | Bacteria | 45842 |
| 508 | Ga0209025_1001066 | 3300025294 | Bacteria | 39849 |
| 509 | Ga0209025_1034199 | 3300025294 | Bacteria | 2328 |
| 510 | Ga0209025_1057319 | 3300025294 | Bacteria | 1490 |
| 511 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 512 | Ga0209758_1009180 | 3300025297 | Bacteria | 6217 |
| 513 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 514 | Ga0209050_1001075 | 3300025298 | Bacteria | 33506 |
| 515 | Ga0209050_1005184 | 3300025298 | Bacteria | 8337 |
| 516 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 517 | Ga0209256_1000103 | 3300025299 | Bacteria | 193900 |
| 518 | Ga0209256_1000165 | 3300025299 | Bacteria | 135104 |
| 519 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 520 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 521 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 522 | Ga0209051_1000099 | 3300025303 | Bacteria | 165161 |
| 523 | Ga0209051_1000221 | 3300025303 | Bacteria | 96174 |
| 524 | Ga0209051_1000315 | 3300025303 | Bacteria | 73579 |
| 525 | Ga0209051_1000452 | 3300025303 | Bacteria | 54387 |
| 526 | Ga0209051_1001491 | 3300025303 | Bacteria | 19599 |
| 527 | Ga0209051_1009063 | 3300025303 | Bacteria | 5176 |
| 528 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 529 | Ga0209257_1000047 | 3300025304 | Bacteria | 460507 |
| 530 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 531 | Ga0209257_1000309 | 3300025304 | Bacteria | 104166 |
| 532 | Ga0209257_1006026 | 3300025304 | Bacteria | 8101 |
| 533 | Ga0209257_1006654 | 3300025304 | Bacteria | 7336 |
| 534 | Ga0209257_1019426 | 3300025304 | Bacteria | 2559 |
| 535 | Ga0207697_10012918 | 3300025315 | Bacteria | 3491 |
| 536 | Ga0207656_10002493 | 3300025321 | Bacteria | 6219 |
| 537 | Ga0207656_10023459 | 3300025321 | Bacteria | 2486 |
| 538 | Ga0207656_10028846 | 3300025321 | Bacteria | 2281 |
| 539 | Ga0207696_1002665 | 3300025711 | Bacteria | 8578 |
| 540 | Ga0207655_1000639 | 3300025728 | Bacteria | 41880 |
| 541 | Ga0207642_10000059 | 3300025899 | Bacteria | 32214 |
| 542 | Ga0207642_10001537 | 3300025899 | Bacteria | 7094 |
| 543 | Ga0207642_10018424 | 3300025899 | Bacteria | 2679 |
| 544 | Ga0207642_10108463 | 3300025899 | Bacteria | 1409 |
| 545 | Ga0207642_10109080 | 3300025899 | Bacteria | 1406 |
| 546 | Ga0207688_10074185 | 3300025901 | Bacteria | 1934 |
| 547 | Ga0207688_10210137 | 3300025901 | Bacteria | 1169 |
| 548 | Ga0207680_10002140 | 3300025903 | Bacteria | 9255 |
| 549 | Ga0207680_10056159 | 3300025903 | Bacteria | 2377 |
| 550 | Ga0207685_10083974 | 3300025905 | Bacteria | 1325 |
| 551 | Ga0207645_10037643 | 3300025907 | Bacteria | 3104 |
| 552 | Ga0207645_10056575 | 3300025907 | Bacteria | 2504 |
| 553 | Ga0207643_10072392 | 3300025908 | Bacteria | 1985 |
| 554 | Ga0207705_10027726 | 3300025909 | Bacteria | 4040 |
| 555 | Ga0207705_10279860 | 3300025909 | Bacteria | 1277 |
| 556 | Ga0207654_10049621 | 3300025911 | Bacteria | 2408 |
| 557 | Ga0207654_10199505 | 3300025911 | Bacteria | 1316 |
| 558 | Ga0207654_10332635 | 3300025911 | Bacteria | 1041 |
| 559 | Ga0207707_10010652 | 3300025912 | Bacteria | 7988 |
| 560 | Ga0207707_10037440 | 3300025912 | Bacteria | 4240 |
| 561 | Ga0207707_10128622 | 3300025912 | Bacteria | 2215 |
| 562 | Ga0207707_10340259 | 3300025912 | Bacteria | 1294 |
| 563 | Ga0207695_10071845 | 3300025913 | Bacteria | 3533 |
| 564 | Ga0207695_10129241 | 3300025913 | Bacteria | 2485 |
| 565 | Ga0207660_10005092 | 3300025917 | Bacteria | 8559 |
| 566 | Ga0207660_10035234 | 3300025917 | Bacteria | 3473 |
| 567 | Ga0207660_10071742 | 3300025917 | Bacteria | 2520 |
| 568 | Ga0207660_10294245 | 3300025917 | Bacteria | 1291 |
| 569 | Ga0207662_10000258 | 3300025918 | Bacteria | 24573 |
| 570 | Ga0207662_10032494 | 3300025918 | Bacteria | 3039 |
| 571 | Ga0207662_10081302 | 3300025918 | Bacteria | 1977 |
| 572 | Ga0207657_10025234 | 3300025919 | Bacteria | 5485 |
| 573 | Ga0207649_10003399 | 3300025920 | Bacteria | 8699 |
| 574 | Ga0207652_10030048 | 3300025921 | Bacteria | 4548 |
| 575 | Ga0207652_10046373 | 3300025921 | Bacteria | 3708 |
| 576 | Ga0207652_10403426 | 3300025921 | Bacteria | 1233 |
| 577 | Ga0207652_10606648 | 3300025921 | Bacteria | 981 |
| 578 | Ga0207646_10134671 | 3300025922 | Bacteria | 2224 |
| 579 | Ga0207646_10166669 | 3300025922 | Bacteria | 1989 |
| 580 | Ga0207646_10355344 | 3300025922 | Bacteria | 1324 |
| 581 | Ga0207646_10474246 | 3300025922 | Bacteria | 1128 |
| 582 | Ga0207681_10000424 | 3300025923 | Bacteria | 29435 |
| 583 | Ga0207681_10019120 | 3300025923 | Bacteria | 4325 |
| 584 | Ga0207681_10041269 | 3300025923 | Bacteria | 3075 |
| 585 | Ga0207694_10083398 | 3300025924 | Bacteria | 2513 |
| 586 | Ga0207650_10006179 | 3300025925 | Bacteria | 8164 |
| 587 | Ga0207650_10284363 | 3300025925 | Bacteria | 1347 |
| 588 | Ga0207659_10020943 | 3300025926 | Bacteria | 4331 |
| 589 | Ga0207659_10042740 | 3300025926 | Bacteria | 3179 |
| 590 | Ga0207659_10114883 | 3300025926 | Bacteria | 2052 |
| 591 | Ga0207687_10000254 | 3300025927 | Bacteria | 36273 |
| 592 | Ga0207687_10002550 | 3300025927 | Bacteria | 12371 |
| 593 | Ga0207687_10083007 | 3300025927 | Bacteria | 2319 |
| 594 | Ga0207687_10101678 | 3300025927 | Bacteria | 2116 |
| 595 | Ga0207644_10000264 | 3300025931 | Bacteria | 35311 |
| 596 | Ga0207644_10002654 | 3300025931 | Bacteria | 11522 |
| 597 | Ga0207644_10014945 | 3300025931 | Bacteria | 5204 |
| 598 | Ga0207644_10523931 | 3300025931 | Bacteria | 979 |
| 599 | Ga0207690_10110969 | 3300025932 | Bacteria | 1975 |
| 600 | Ga0207706_10013512 | 3300025933 | Bacteria | 7420 |
| 601 | Ga0207706_10031863 | 3300025933 | Bacteria | 4696 |
| 602 | Ga0207706_10082110 | 3300025933 | Bacteria | 2833 |
| 603 | Ga0207706_10332277 | 3300025933 | Bacteria | 1322 |
| 604 | Ga0207686_10000084 | 3300025934 | Bacteria | 79402 |
| 605 | Ga0207686_10023994 | 3300025934 | Bacteria | 3528 |
| 606 | Ga0207686_10052906 | 3300025934 | Bacteria | 2536 |
| 607 | Ga0207686_10192202 | 3300025934 | Bacteria | 1456 |
| 608 | Ga0207709_10000111 | 3300025935 | Bacteria | 127580 |
| 609 | Ga0207709_10000608 | 3300025935 | Bacteria | 29634 |
| 610 | Ga0207709_10001030 | 3300025935 | Bacteria | 20608 |
| 611 | Ga0207709_10001599 | 3300025935 | Bacteria | 15434 |
| 612 | Ga0207709_10002253 | 3300025935 | Bacteria | 12260 |
| 613 | Ga0207709_10003776 | 3300025935 | Bacteria | 8901 |
| 614 | Ga0207709_10009256 | 3300025935 | Bacteria | 5425 |
| 615 | Ga0207709_10018818 | 3300025935 | Bacteria | 3873 |
| 616 | Ga0207709_10019289 | 3300025935 | Bacteria | 3832 |
| 617 | Ga0207709_10036017 | 3300025935 | Bacteria | 2930 |
| 618 | Ga0207709_10234187 | 3300025935 | Bacteria | 1332 |
| 619 | Ga0207670_10007649 | 3300025936 | Bacteria | 6048 |
| 620 | Ga0207670_10021569 | 3300025936 | Bacteria | 3977 |
| 621 | Ga0207670_10041074 | 3300025936 | Bacteria | 3040 |
| 622 | Ga0207669_10020526 | 3300025937 | Bacteria | 3467 |
| 623 | Ga0207669_10042801 | 3300025937 | Bacteria | 2647 |
| 624 | Ga0207704_10000722 | 3300025938 | Bacteria | 14494 |
| 625 | Ga0207704_10001711 | 3300025938 | Bacteria | 9812 |
| 626 | Ga0207704_10003689 | 3300025938 | Bacteria | 6966 |
| 627 | Ga0207704_10010623 | 3300025938 | Bacteria | 4498 |
| 628 | Ga0207704_10046802 | 3300025938 | Bacteria | 2581 |
| 629 | Ga0207704_10068335 | 3300025938 | Bacteria | 2239 |
| 630 | Ga0207691_10018804 | 3300025940 | Bacteria | 6544 |
| 631 | Ga0207691_10066785 | 3300025940 | Bacteria | 3253 |
| 632 | Ga0207691_10073889 | 3300025940 | Bacteria | 3075 |
| 633 | Ga0207691_10092293 | 3300025940 | Bacteria | 2711 |
| 634 | Ga0207691_10107652 | 3300025940 | Bacteria | 2481 |
| 635 | Ga0207691_10276318 | 3300025940 | Bacteria | 1446 |
| 636 | Ga0207711_10003550 | 3300025941 | Bacteria | 13509 |
| 637 | Ga0207711_10010810 | 3300025941 | Bacteria | 7587 |
| 638 | Ga0207711_10048589 | 3300025941 | Bacteria | 3630 |
| 639 | Ga0207689_10000872 | 3300025942 | Bacteria | 29094 |
| 640 | Ga0207689_10003506 | 3300025942 | Bacteria | 14336 |
| 641 | Ga0207689_10051064 | 3300025942 | Bacteria | 3409 |
| 642 | Ga0207689_10135887 | 3300025942 | Bacteria | 2025 |
| 643 | Ga0207689_10159270 | 3300025942 | Bacteria | 1860 |
| 644 | Ga0207689_10374332 | 3300025942 | Bacteria | 1185 |
| 645 | Ga0207661_10037982 | 3300025944 | Bacteria | 3771 |
| 646 | Ga0207679_10201745 | 3300025945 | Bacteria | 1662 |
| 647 | Ga0207679_10211630 | 3300025945 | Bacteria | 1626 |
| 648 | Ga0207667_10013717 | 3300025949 | Bacteria | 9262 |
| 649 | Ga0207667_10018933 | 3300025949 | Bacteria | 7702 |
| 650 | Ga0207667_10032117 | 3300025949 | Bacteria | 5660 |
| 651 | Ga0207667_10127841 | 3300025949 | Bacteria | 2617 |
| 652 | Ga0207667_10206964 | 3300025949 | Bacteria | 2011 |
| 653 | Ga0207667_10368586 | 3300025949 | Bacteria | 1464 |
| 654 | Ga0207667_10664660 | 3300025949 | Bacteria | 1046 |
| 655 | Ga0207651_10004672 | 3300025960 | Bacteria | 6942 |
| 656 | Ga0207651_10036834 | 3300025960 | Bacteria | 3199 |
| 657 | Ga0207651_10165825 | 3300025960 | Bacteria | 1737 |
| 658 | Ga0207651_10389188 | 3300025960 | Bacteria | 1183 |
| 659 | Ga0207712_10009623 | 3300025961 | Bacteria | 6121 |
| 660 | Ga0207712_10014447 | 3300025961 | Bacteria | 5081 |
| 661 | Ga0207668_10002951 | 3300025972 | Bacteria | 9967 |
| 662 | Ga0207668_10084418 | 3300025972 | Bacteria | 2314 |
| 663 | Ga0207658_10002509 | 3300025986 | Bacteria | 13356 |
| 664 | Ga0207658_10010175 | 3300025986 | Bacteria | 6393 |
| 665 | Ga0207658_10176662 | 3300025986 | Bacteria | 1764 |
| 666 | Ga0207677_10001522 | 3300026023 | Bacteria | 12255 |
| 667 | Ga0207677_10010555 | 3300026023 | Bacteria | 5234 |
| 668 | Ga0207677_10047763 | 3300026023 | Bacteria | 2876 |
| 669 | Ga0207677_10181062 | 3300026023 | Bacteria | 1658 |
| 670 | Ga0207677_10197871 | 3300026023 | Bacteria | 1595 |
| 671 | Ga0207677_10390810 | 3300026023 | Bacteria | 1177 |
| 672 | Ga0207703_10001789 | 3300026035 | Bacteria | 19164 |
| 673 | Ga0207703_10001816 | 3300026035 | Bacteria | 19028 |
| 674 | Ga0207703_10006009 | 3300026035 | Bacteria | 9719 |
| 675 | Ga0207703_10016897 | 3300026035 | Bacteria | 5692 |
| 676 | Ga0207639_10009069 | 3300026041 | Bacteria | 6854 |
| 677 | Ga0207639_10165449 | 3300026041 | Bacteria | 1868 |
| 678 | Ga0207678_10312806 | 3300026067 | Bacteria | 1350 |
| 679 | Ga0207708_10000049 | 3300026075 | Bacteria | 114743 |
| 680 | Ga0207708_10003647 | 3300026075 | Bacteria | 11354 |
| 681 | Ga0207708_10004718 | 3300026075 | Bacteria | 10026 |
| 682 | Ga0207708_10078562 | 3300026075 | Bacteria | 2534 |
| 683 | Ga0207702_10012590 | 3300026078 | Bacteria | 7040 |
| 684 | Ga0207702_10020851 | 3300026078 | Bacteria | 5422 |
| 685 | Ga0207702_10146847 | 3300026078 | Bacteria | 2141 |
| 686 | Ga0207702_10314205 | 3300026078 | Bacteria | 1491 |
| 687 | Ga0207702_10449591 | 3300026078 | Bacteria | 1250 |
| 688 | Ga0207702_10482142 | 3300026078 | Bacteria | 1207 |
| 689 | Ga0207641_10001603 | 3300026088 | Bacteria | 22077 |
| 690 | Ga0207641_10003329 | 3300026088 | Bacteria | 14294 |
| 691 | Ga0207641_10263333 | 3300026088 | Bacteria | 1615 |
| 692 | Ga0207641_10296484 | 3300026088 | Bacteria | 1526 |
| 693 | Ga0207641_10389054 | 3300026088 | Bacteria | 1337 |
| 694 | Ga0207648_10000018 | 3300026089 | Bacteria | 148157 |
| 695 | Ga0207648_10000161 | 3300026089 | Bacteria | 69095 |
| 696 | Ga0207648_10000179 | 3300026089 | Bacteria | 66602 |
| 697 | Ga0207648_10000685 | 3300026089 | Bacteria | 37956 |
| 698 | Ga0207648_10008674 | 3300026089 | Bacteria | 9809 |
| 699 | Ga0207648_10023777 | 3300026089 | Bacteria | 5482 |
| 700 | Ga0207648_10101337 | 3300026089 | Bacteria | 2524 |
| 701 | Ga0207648_10293534 | 3300026089 | Bacteria | 1456 |
| 702 | Ga0207648_10303785 | 3300026089 | Bacteria | 1431 |
| 703 | Ga0207648_10327087 | 3300026089 | Bacteria | 1378 |
| 704 | Ga0207676_10003295 | 3300026095 | Bacteria | 11473 |
| 705 | Ga0207676_10018334 | 3300026095 | Bacteria | 5087 |
| 706 | Ga0207676_10049237 | 3300026095 | Bacteria | 3276 |
| 707 | Ga0207676_10157716 | 3300026095 | Bacteria | 1962 |
| 708 | Ga0207676_10426060 | 3300026095 | Bacteria | 1245 |
| 709 | Ga0207674_10071765 | 3300026116 | Bacteria | 3479 |
| 710 | Ga0207674_10071832 | 3300026116 | Bacteria | 3477 |
| 711 | Ga0207674_10077512 | 3300026116 | Bacteria | 3329 |
| 712 | Ga0207674_10088100 | 3300026116 | Bacteria | 3097 |
| 713 | Ga0207674_10203789 | 3300026116 | Bacteria | 1928 |
| 714 | Ga0207675_100000050 | 3300026118 | Bacteria | 83832 |
| 715 | Ga0207675_100000176 | 3300026118 | Bacteria | 57464 |
| 716 | Ga0207675_100005391 | 3300026118 | Bacteria | 12258 |
| 717 | Ga0207675_100007479 | 3300026118 | Bacteria | 10323 |
| 718 | Ga0207675_100008096 | 3300026118 | Bacteria | 9902 |
| 719 | Ga0207683_10008432 | 3300026121 | Bacteria | 8822 |
| 720 | Ga0207683_10049731 | 3300026121 | Bacteria | 3671 |
| 721 | Ga0207683_10051569 | 3300026121 | Bacteria | 3605 |
| 722 | Ga0207683_10250689 | 3300026121 | Bacteria | 1616 |
| 723 | Ga0207683_10656968 | 3300026121 | Bacteria | 971 |
| 724 | Ga0207698_10012988 | 3300026142 | Bacteria | 5477 |
| 725 | Ga0207698_10111682 | 3300026142 | Bacteria | 2292 |
| 726 | Ga0207698_10116511 | 3300026142 | Bacteria | 2252 |
| 727 | Ga0207698_10178809 | 3300026142 | Bacteria | 1877 |
| 728 | Ga0207698_10231513 | 3300026142 | Bacteria | 1678 |
| 729 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 730 | Ga0209281_1017401 | 3300027111 | Bacteria | 1458 |
| 731 | Ga0209967_1005313 | 3300027364 | Bacteria | 1727 |
| 732 | Ga0209981_1003553 | 3300027378 | Bacteria | 2025 |
| 733 | Ga0209996_1004923 | 3300027395 | Bacteria | 1705 |
| 734 | Ga0210000_1001544 | 3300027462 | Bacteria | 3246 |
| 735 | Ga0209995_1000178 | 3300027471 | Bacteria | 10190 |
| 736 | Ga0209999_1002769 | 3300027543 | Bacteria | 3104 |
| 737 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 738 | Ga0209282_1000182 | 3300027666 | Bacteria | 34632 |
| 739 | Ga0209588_1027037 | 3300027671 | Bacteria | 1824 |
| 740 | Ga0209971_1016133 | 3300027682 | Bacteria | 1771 |
| 741 | Ga0209974_10048164 | 3300027876 | Bacteria | 1428 |
| 742 | Ga0209974_10071541 | 3300027876 | Bacteria | 1184 |
| 743 | Ga0207428_10001240 | 3300027907 | Bacteria | 27326 |
| 744 | Ga0207428_10052635 | 3300027907 | Bacteria | 3250 |
| 745 | Ga0207428_10082070 | 3300027907 | Bacteria | 2516 |
| 746 | Ga0268266_10259695 | 3300028379 | Bacteria | 1609 |
| 747 | Ga0268265_10002096 | 3300028380 | Bacteria | 15499 |
| 748 | Ga0268265_10013533 | 3300028380 | Bacteria | 5545 |
| 749 | Ga0268265_10019192 | 3300028380 | Bacteria | 4747 |
| 750 | Ga0268265_10040349 | 3300028380 | Bacteria | 3447 |
| 751 | Ga0268265_10044723 | 3300028380 | Bacteria | 3299 |
| 752 | Ga0268265_10386736 | 3300028380 | Bacteria | 1289 |
| 753 | Ga0268265_10520437 | 3300028380 | Bacteria | 1124 |
| 754 | Ga0268264_10000613 | 3300028381 | Bacteria | 42687 |
| 755 | Ga0268264_10000848 | 3300028381 | Bacteria | 32647 |
| 756 | Ga0268264_10001082 | 3300028381 | Bacteria | 26946 |
| 757 | Ga0268264_10024923 | 3300028381 | Bacteria | 4888 |
| 758 | Ga0268264_10054537 | 3300028381 | Bacteria | 3338 |
| 759 | Ga0268264_10141041 | 3300028381 | Bacteria | 2149 |
| 760 | Ga0265336_10000497 | 3300028666 | Bacteria | 22985 |
| 761 | Ga0307515_10000609 | 3300028794 | Bacteria | 83557 |
| 762 | Ga0307515_10001484 | 3300028794 | Bacteria | 52674 |
| 763 | Ga0307515_10001693 | 3300028794 | Bacteria | 49203 |
| 764 | Ga0307515_10004716 | 3300028794 | Bacteria | 27939 |
| 765 | Ga0307515_10042972 | 3300028794 | Bacteria | 7045 |
| 766 | Ga0307515_10074111 | 3300028794 | Bacteria | 4560 |
| 767 | Ga0265324_10000004 | 3300029957 | Bacteria | 356972 |
| 768 | Ga0265324_10001492 | 3300029957 | Bacteria | 13266 |
| 769 | Ga0307511_10000804 | 3300030521 | Bacteria | 33483 |
| 770 | Ga0316176_1084534 | 3300030732 | Bacteria | 3287 |
| 771 | Ga0316183_1074932 | 3300030742 | Bacteria | 5514 |
| 772 | Ga0316181_1111110 | 3300030744 | Bacteria | 3024 |
| 773 | Ga0316182_1108560 | 3300030745 | Bacteria | 2118 |
| 774 | Ga0265330_10000091 | 3300031235 | Bacteria | 76638 |
| 775 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 776 | Ga0265332_10032991 | 3300031238 | Bacteria | 2254 |
| 777 | Ga0265325_10000133 | 3300031241 | Bacteria | 51600 |
| 778 | Ga0265325_10002488 | 3300031241 | Bacteria | 12420 |
| 779 | Ga0265325_10059895 | 3300031241 | Bacteria | 1935 |
| 780 | Ga0265340_10036187 | 3300031247 | Bacteria | 2448 |
| 781 | Ga0265327_10000174 | 3300031251 | Bacteria | 138922 |
| 782 | Ga0265327_10000542 | 3300031251 | Bacteria | 64581 |
| 783 | Ga0265327_10001654 | 3300031251 | Bacteria | 26845 |
| 784 | Ga0265327_10042455 | 3300031251 | Bacteria | 2441 |
| 785 | Ga0265327_10065441 | 3300031251 | Bacteria | 1838 |
| 786 | Ga0265316_10182814 | 3300031344 | Bacteria | 1560 |
| 787 | Ga0265316_10362789 | 3300031344 | Bacteria | 1047 |
| 788 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 789 | Ga0307513_10000038 | 3300031456 | Bacteria | 174780 |
| 790 | Ga0307513_10004316 | 3300031456 | Bacteria | 18998 |
| 791 | Ga0307513_10114170 | 3300031456 | Bacteria | 2687 |
| 792 | Ga0307513_10213744 | 3300031456 | Bacteria | 1757 |
| 793 | Ga0307509_10025753 | 3300031507 | Bacteria | 6568 |
| 794 | Ga0307509_10333040 | 3300031507 | Bacteria | 1249 |
| 795 | Ga0307408_100000109 | 3300031548 | Bacteria | 91284 |
| 796 | Ga0307408_100000886 | 3300031548 | Bacteria | 23568 |
| 797 | Ga0307408_100010362 | 3300031548 | Bacteria | 6146 |
| 798 | Ga0307408_100107069 | 3300031548 | Bacteria | 2140 |
| 799 | Ga0307408_100112145 | 3300031548 | Bacteria | 2096 |
| 800 | Ga0307408_100113799 | 3300031548 | Bacteria | 2083 |
| 801 | Ga0307408_100233308 | 3300031548 | Bacteria | 1508 |
| 802 | Ga0307408_100291225 | 3300031548 | Bacteria | 1363 |
| 803 | Ga0307508_10174014 | 3300031616 | Bacteria | 1756 |
| 804 | Ga0307514_10010740 | 3300031649 | Bacteria | 7651 |
| 805 | Ga0316575_10022997 | 3300031665 | Bacteria | 2407 |
| 806 | Ga0316575_10051595 | 3300031665 | Bacteria | 1638 |
| 807 | Ga0316579_10000450 | 3300031691 | Bacteria | 13195 |
| 808 | Ga0316579_10018729 | 3300031691 | Bacteria | 3050 |
| 809 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 810 | Ga0265314_10000262 | 3300031711 | Bacteria | 77107 |
| 811 | Ga0265314_10004112 | 3300031711 | Bacteria | 13711 |
| 812 | Ga0265314_10015575 | 3300031711 | Bacteria | 6029 |
| 813 | Ga0265314_10015650 | 3300031711 | Bacteria | 6013 |
| 814 | Ga0316576_10066739 | 3300031727 | Bacteria | 2646 |
| 815 | Ga0316578_10009084 | 3300031728 | Bacteria | 5094 |
| 816 | Ga0316578_10054604 | 3300031728 | Bacteria | 2343 |
| 817 | Ga0307516_10000359 | 3300031730 | Bacteria | 59207 |
| 818 | Ga0307516_10001691 | 3300031730 | Bacteria | 30381 |
| 819 | Ga0307405_10006962 | 3300031731 | Bacteria | 5616 |
| 820 | Ga0307405_10118807 | 3300031731 | Bacteria | 1805 |
| 821 | Ga0307405_10154672 | 3300031731 | Bacteria | 1617 |
| 822 | Ga0307405_10160760 | 3300031731 | Bacteria | 1590 |
| 823 | Ga0307405_10174122 | 3300031731 | Bacteria | 1538 |
| 824 | Ga0307405_10192997 | 3300031731 | Bacteria | 1472 |
| 825 | Ga0307410_10121002 | 3300031852 | Bacteria | 1909 |
| 826 | Ga0307406_10000741 | 3300031901 | Bacteria | 18289 |
| 827 | Ga0307406_10028543 | 3300031901 | Bacteria | 3372 |
| 828 | Ga0307406_10125721 | 3300031901 | Bacteria | 1791 |
| 829 | Ga0307406_10149504 | 3300031901 | Bacteria | 1664 |
| 830 | Ga0307407_10130137 | 3300031903 | Bacteria | 1609 |
| 831 | Ga0307407_10151211 | 3300031903 | Bacteria | 1509 |
| 832 | Ga0307412_10029307 | 3300031911 | Bacteria | 3453 |
| 833 | Ga0307412_10037074 | 3300031911 | Bacteria | 3130 |
| 834 | Ga0307412_10048688 | 3300031911 | Bacteria | 2789 |
| 835 | Ga0307412_10212466 | 3300031911 | Bacteria | 1477 |
| 836 | Ga0307412_10255692 | 3300031911 | Bacteria | 1362 |
| 837 | Ga0307412_10271858 | 3300031911 | Bacteria | 1326 |
| 838 | Ga0307409_100000580 | 3300031995 | Bacteria | 15944 |
| 839 | Ga0307409_100063181 | 3300031995 | Bacteria | 2903 |
| 840 | Ga0307409_100066611 | 3300031995 | Bacteria | 2841 |
| 841 | Ga0307409_100122330 | 3300031995 | Bacteria | 2207 |
| 842 | Ga0307409_100242530 | 3300031995 | Bacteria | 1642 |
| 843 | Ga0307409_100287526 | 3300031995 | Bacteria | 1523 |
| 844 | Ga0307416_100014097 | 3300032002 | Bacteria | 5460 |
| 845 | Ga0307416_100121709 | 3300032002 | Bacteria | 2327 |
| 846 | Ga0307416_100292285 | 3300032002 | Bacteria | 1614 |
| 847 | Ga0307416_100396256 | 3300032002 | Bacteria | 1416 |
| 848 | Ga0307414_10303056 | 3300032004 | Bacteria | 1352 |
| 849 | Ga0307411_10080249 | 3300032005 | Bacteria | 2243 |
| 850 | Ga0307411_10304015 | 3300032005 | Bacteria | 1280 |
| 851 | Ga0307411_10438975 | 3300032005 | Bacteria | 1089 |
| 852 | Ga0307415_100002051 | 3300032126 | Bacteria | 9953 |
| 853 | Ga0307415_100511094 | 3300032126 | Bacteria | 1052 |
| 854 | Ga0316583_10000954 | 3300032133 | Bacteria | 9305 |
| 855 | Ga0316583_10006979 | 3300032133 | Bacteria | 4065 |
| 856 | Ga0316580_10017904 | 3300032139 | Bacteria | 2179 |
| 857 | Ga0316593_10027629 | 3300032168 | Bacteria | 1822 |
| 858 | Ga0316593_10125973 | 3300032168 | Bacteria | 922 |
| 859 | Ga0316588_1002525 | 3300033528 | Bacteria | 3191 |
| 860 | Ga0316596_1005014 | 3300033541 | Bacteria | 3002 |
| 861 | Ga0373930_0001564 | 3300034816 | Bacteria | 3432 |
| 862 | Ga0373938_0020813 | 3300034957 | Bacteria | 1325 |
| 863 | Ga0373926_0007968 | 3300035083 | Bacteria | 3529 |
| 864 | Ga0373928_0004091 | 3300035084 | Bacteria | 2780 |
| 865 | Ga0373929_0004917 | 3300035085 | Bacteria | 2396 |
| 866 | Ga0373934_0000218 | 3300035086 | Bacteria | 20872 |
| 867 | Ga0373934_0000946 | 3300035086 | Bacteria | 10509 |
| 868 | Ga0373951_0017250 | 3300035091 | Bacteria | 1633 |
| 869 | Ga0373952_0000062 | 3300035092 | Bacteria | 13595 |
| 870 | Ga0373952_0012100 | 3300035092 | Bacteria | 1693 |
| 871 | Ga0373923_0000103 | 3300035111 | Bacteria | 15045 |
| 872 | Ga0373932_0002566 | 3300035112 | Bacteria | 4544 |
| 873 | Ga0373939_0000040 | 3300035114 | Bacteria | 45617 |
| 874 | Ga0373939_0004488 | 3300035114 | Bacteria | 3304 |
| 875 | Ga0373941_0009749 | 3300035115 | Bacteria | 2427 |
| 876 | Ga0373941_0128072 | 3300035115 | Bacteria | 912 |
| 877 | Ga0373945_0025798 | 3300035116 | Bacteria | 2044 |
| 878 | Ga0373953_0003648 | 3300035117 | Bacteria | 4824 |
| 879 | Ga0373954_0000153 | 3300035118 | Bacteria | 24536 |
| 880 | Ga0373954_0000939 | 3300035118 | Bacteria | 11343 |
| 881 | Ga0373956_0000081 | 3300035119 | Bacteria | 31846 |
| 882 | Ga0373956_0003816 | 3300035119 | Bacteria | 6059 |
| 883 | Ga0373956_0012068 | 3300035119 | Bacteria | 3574 |
| 884 | Ga0373957_0000956 | 3300035120 | Bacteria | 7571 |
| 885 | Ga0373960_0000506 | 3300035121 | Bacteria | 7775 |
| 886 | Ga0373943_0030168 | 3300035170 | Bacteria | 2565 |
| 887 | Ga0373943_0055619 | 3300035170 | Bacteria | 1961 |
| 888 | Ga0373943_0261689 | 3300035170 | Bacteria | 974 |
| 889 | Ga0373946_0010614 | 3300035171 | Bacteria | 3414 |
| 890 | Ga0373946_0096443 | 3300035171 | Bacteria | 1319 |
| 891 | Ga0373955_0124248 | 3300035172 | Bacteria | 1502 |
| 892 | Ga0373942_0010433 | 3300035207 | Bacteria | 2187 |
| 893 | Ga0373961_0001887 | 3300035241 | Bacteria | 5711 |
| 894 | Ga0373962_0019950 | 3300035242 | Bacteria | 1756 |
| 895 | Ga0316574_0003380 | 3300035398 | Bacteria | 8226 |
| 896 | Ga0316574_0088297 | 3300035398 | Bacteria | 1974 |
| 897 | Ga0373924_0000180 | 3300035410 | Bacteria | 18720 |
| 898 | Ga0373931_0000371 | 3300035691 | Bacteria | 18458 |
| 899 | Ga0373931_0002521 | 3300035691 | Bacteria | 8129 |
| 900 | Ga0373931_0075642 | 3300035691 | Bacteria | 1847 |
| 901 | Ga0373931_0085929 | 3300035691 | Bacteria | 1745 |
| 902 | Ga0373935_0001120 | 3300035692 | Bacteria | 14625 |
| 903 | Ga0373935_0002681 | 3300035692 | Bacteria | 10242 |
| 904 | Ga0373935_0410427 | 3300035692 | Bacteria | 974 |
| 905 | Ga0373927_0006838 | 3300035695 | Bacteria | 7759 |
| 906 | Ga0373927_0013540 | 3300035695 | Bacteria | 5418 |
| 907 | Ga0373927_0047872 | 3300035695 | Bacteria | 2765 |
| 908 | Ga0373933_0000426 | 3300035724 | Bacteria | 26557 |
| 909 | Ga0373933_0003869 | 3300035724 | Bacteria | 8263 |
| 910 | Ga0373933_0081369 | 3300035724 | Bacteria | 1987 |
| 911 | Ga0373933_0085508 | 3300035724 | Bacteria | 1939 |
| 912 | Ga0373933_0275239 | 3300035724 | Bacteria | 1087 |
| 913 | Ga0373947_0025269 | 3300035725 | Bacteria | 3463 |
| 914 | Ga0373937_0000149 | 3300036401 | Bacteria | 67267 |
| 915 | Ga0373937_0000668 | 3300036401 | Bacteria | 29873 |
| 916 | Ga0373937_0005081 | 3300036401 | Bacteria | 11203 |
| 917 | Ga0373937_0034638 | 3300036401 | Bacteria | 4593 |
| 918 | Ga0373937_0198986 | 3300036401 | Bacteria | 1883 |
| 919 | Ga0373937_0613577 | 3300036401 | Bacteria | 1032 |
| 920 | Ga0316582_0003457 | 3300036647 | Bacteria | 7748 |
| 921 | Ga0316584_0096297 | 3300036712 | Bacteria | 2215 |
| 922 | Ga0373925_0002526 | 3300037068 | Bacteria | 14599 |
| 923 | Ga0373925_0040580 | 3300037068 | Bacteria | 3446 |
| 924 | Ga0373925_0062435 | 3300037068 | Bacteria | 2801 |
| 925 | Ga0395899_0007150 | 3300037312 | Bacteria | 8637 |
| 926 | Ga0395900_0000050 | 3300037418 | Bacteria | 224616 |
| 927 | Ga0395900_0006372 | 3300037418 | Bacteria | 12301 |
| 928 | Ga0395900_0283799 | 3300037418 | Bacteria | 1647 |
| 929 | Ga0395898_0001856 | 3300037466 | Bacteria | 27096 |
| 930 | Ga0395898_0002933 | 3300037466 | Bacteria | 19401 |
| 931 | Ga0395898_0041859 | 3300037466 | Bacteria | 4522 |
| 932 | Ga0395898_0111300 | 3300037466 | Bacteria | 2624 |
| 933 | Ga0395905_0000088 | 3300037471 | Bacteria | 152506 |
| 934 | Ga0395905_0002271 | 3300037471 | Bacteria | 21567 |
| 935 | Ga0395905_0003887 | 3300037471 | Bacteria | 15759 |
| 936 | Ga0395905_0013719 | 3300037471 | Bacteria | 7757 |
| 937 | Ga0395905_0028345 | 3300037471 | Bacteria | 5279 |
| 938 | Ga0395905_0031917 | 3300037471 | Bacteria | 4955 |
| 939 | Ga0395905_0137590 | 3300037471 | Bacteria | 2298 |
| 940 | Ga0395905_0188686 | 3300037471 | Bacteria | 1934 |
| 941 | Ga0395905_0194580 | 3300037471 | Bacteria | 1901 |
| 942 | Ga0395905_0450176 | 3300037471 | Bacteria | 1185 |
| 943 | Ga0316581_0009983 | 3300037588 | Bacteria | 2622 |
| 944 | Ga0395901_0089615 | 3300038443 | Bacteria | 3219 |
| 945 | Ga0395901_0103602 | 3300038443 | Bacteria | 2985 |
| 946 | Ga0395901_0104112 | 3300038443 | Bacteria | 2978 |
| 947 | Ga0395901_0121973 | 3300038443 | Bacteria | 2739 |
| 948 | Ga0395901_0157864 | 3300038443 | Bacteria | 2382 |
| 949 | Ga0395901_0169257 | 3300038443 | Bacteria | 2293 |
| 950 | Ga0395901_0171643 | 3300038443 | Bacteria | 2275 |
| 951 | Ga0436365_1640203 | 3300039437 | Bacteria | 3024 |
| 952 | Ga0436365_1756237 | 3300039437 | Bacteria | 4549 |
| 953 | Ga0436361_0005759 | 3300039447 | Bacteria | 6838 |
| 954 | Ga0436361_0159126 | 3300039447 | Bacteria | 34073 |
| 955 | Ga0436361_0240153 | 3300039447 | Bacteria | 58400 |
| 956 | Ga0436361_0287659 | 3300039447 | Bacteria | 26995 |
| 957 | Ga0436361_0566522 | 3300039447 | Bacteria | 37173 |
| 958 | Ga0436363_0976259 | 3300039450 | Bacteria | 2302 |
| 959 | Ga0439436_0020264 | 3300041404 | Bacteria | 1981 |
| 960 | Ga0439465_0005691 | 3300041413 | Bacteria | 3966 |
| 961 | Ga0451807_2212897 | 3300041486 | Bacteria | 3169 |
| 962 | Ga0451807_2362621 | 3300041486 | Bacteria | 2644 |
| 963 | Ga0451853_0962706 | 3300041512 | Bacteria | 1767 |
| 964 | Ga0439433_0000594 | 3300041999 | Bacteria | 6892 |
| 965 | Ga0439437_000513 | 3300042000 | Bacteria | 3834 |
| 966 | Ga0439441_000066 | 3300042001 | Bacteria | 8045 |
| 967 | Ga0439442_023155 | 3300042002 | Bacteria | 1290 |
| 968 | Ga0439443_000974 | 3300042003 | Bacteria | 2941 |
| 969 | Ga0439443_011855 | 3300042003 | Bacteria | 1283 |
| 970 | Ga0439445_0006018 | 3300042004 | Bacteria | 2780 |
| 971 | Ga0439432_012324 | 3300042006 | Bacteria | 2929 |
| 972 | Ga0439432_033137 | 3300042006 | Bacteria | 1663 |
| 973 | Ga0439449_0003256 | 3300042007 | Bacteria | 6327 |
| 974 | Ga0439449_0005226 | 3300042007 | Bacteria | 4978 |
| 975 | Ga0439449_0007955 | 3300042007 | Bacteria | 4027 |
| 976 | Ga0439449_0061218 | 3300042007 | Bacteria | 1388 |
| 977 | Ga0439451_029916 | 3300042009 | Bacteria | 1096 |
| 978 | Ga0439452_030875 | 3300042010 | Bacteria | 1318 |
| 979 | Ga0439454_006088 | 3300042011 | Bacteria | 1469 |
| 980 | Ga0439457_019160 | 3300042014 | Bacteria | 1520 |
| 981 | Ga0439462_0000723 | 3300042015 | Bacteria | 6806 |
| 982 | Ga0439462_0007330 | 3300042015 | Bacteria | 2759 |
| 983 | Ga0439462_0042990 | 3300042015 | Bacteria | 1207 |
| 984 | Ga0450917_001392 | 3300042120 | Bacteria | 1731 |
| 985 | Ga0450923_010632 | 3300042125 | Bacteria | 1638 |
| 986 | Ga0450890_000746 | 3300042127 | Bacteria | 4727 |
| 987 | Ga0450891_005185 | 3300042129 | Bacteria | 1206 |
| 988 | Ga0450892_000203 | 3300042130 | Bacteria | 7032 |
| 989 | Ga0450896_005203 | 3300042133 | Bacteria | 1774 |
| 990 | Ga0450898_004891 | 3300042134 | Bacteria | 2002 |
| 991 | Ga0450906_000190 | 3300042145 | Bacteria | 11646 |
| 992 | Ga0439446_0000148 | 3300042156 | Bacteria | 12251 |
| 993 | Ga0439446_0041173 | 3300042156 | Bacteria | 1361 |
| 994 | Ga0450909_002564 | 3300042185 | Bacteria | 2575 |
| 995 | Ga0439434_0000121 | 3300042435 | Bacteria | 20613 |
| 996 | Ga0439434_0002740 | 3300042435 | Bacteria | 5136 |
| 997 | Ga0439435_0000031 | 3300042436 | Bacteria | 15689 |
| 998 | Ga0439435_0000893 | 3300042436 | Bacteria | 5136 |
| 999 | Ga0439435_0001361 | 3300042436 | Bacteria | 4473 |
| 1000 | Ga0439435_0011295 | 3300042436 | Bacteria | 2141 |
| 1001 | Ga0439444_0000800 | 3300042437 | Bacteria | 3778 |
| 1002 | Ga0439459_0051105 | 3300042438 | Bacteria | 908 |
| 1003 | Ga0439460_0000173 | 3300042461 | Bacteria | 12207 |
| 1004 | Ga0439460_0002287 | 3300042461 | Bacteria | 4611 |
| 1005 | Ga0450918_004718 | 3300042531 | Bacteria | 2470 |
| 1006 | Ga0450893_0008662 | 3300042532 | Bacteria | 1657 |
| 1007 | Ga0451577_0000085 | 3300042876 | Bacteria | 211141 |
| 1008 | Ga0451577_0002155 | 3300042876 | Bacteria | 24105 |
| 1009 | Ga0451577_0004221 | 3300042876 | Bacteria | 15320 |
| 1010 | Ga0451577_0014375 | 3300042876 | Bacteria | 7381 |
| 1011 | Ga0451577_0081052 | 3300042876 | Bacteria | 2894 |
| 1012 | Ga0451577_0307045 | 3300042876 | Bacteria | 1438 |
| 1013 | Ga0451577_0589555 | 3300042876 | Bacteria | 1009 |
| 1014 | Ga0451577_0605264 | 3300042876 | Bacteria | 994 |
| 1015 | Ga0466969_0000169 | 3300044656 | Bacteria | 35088 |
| 1016 | Ga0466969_0024849 | 3300044656 | Bacteria | 3081 |
| 1017 | Ga0466972_0011675 | 3300044658 | Bacteria | 4411 |
| 1018 | Ga0453683_0000047 | 3300044673 | Bacteria | 207763 |
| 1019 | Ga0453683_0000464 | 3300044673 | Bacteria | 46581 |
| 1020 | Ga0453683_0002014 | 3300044673 | Bacteria | 16403 |
| 1021 | Ga0453683_0095554 | 3300044673 | Bacteria | 1865 |
| 1022 | Ga0466965_0002274 | 3300044683 | Bacteria | 8096 |
| 1023 | Ga0466966_0001826 | 3300044684 | Bacteria | 13814 |
| 1024 | Ga0466961_0001054 | 3300044693 | Bacteria | 16978 |
| 1025 | Ga0466961_0004942 | 3300044693 | Bacteria | 8383 |
| 1026 | Ga0466961_0012914 | 3300044693 | Bacteria | 5342 |
| 1027 | Ga0466963_0230471 | 3300044694 | Bacteria | 1298 |
| 1028 | Ga0466964_0015945 | 3300044706 | Bacteria | 2863 |
| 1029 | Ga0453684_0000273 | 3300044712 | Bacteria | 222658 |
| 1030 | Ga0453684_0000302 | 3300044712 | Bacteria | 207763 |
| 1031 | Ga0453684_0005216 | 3300044712 | Bacteria | 26063 |
| 1032 | Ga0453684_0009340 | 3300044712 | Bacteria | 17191 |
| 1033 | Ga0453684_0029404 | 3300044712 | Bacteria | 7801 |
| 1034 | Ga0453684_0032697 | 3300044712 | Bacteria | 7270 |
| 1035 | Ga0453684_0140681 | 3300044712 | Bacteria | 2882 |
| 1036 | Ga0453684_0231917 | 3300044712 | Bacteria | 2131 |
| 1037 | Ga0453684_0284443 | 3300044712 | Bacteria | 1885 |
| 1038 | Ga0453684_0367514 | 3300044712 | Bacteria | 1618 |
| 1039 | Ga0466968_0143309 | 3300044735 | Bacteria | 1094 |
| 1040 | Ga0466957_0017735 | 3300044842 | Bacteria | 4175 |
| 1041 | Ga0466957_0089032 | 3300044842 | Bacteria | 1932 |
| 1042 | Ga0466957_0206380 | 3300044842 | Bacteria | 1292 |
| 1043 | Ga0466959_0008784 | 3300045049 | Bacteria | 7158 |
| 1044 | Ga0466959_0033437 | 3300045049 | Bacteria | 3802 |
| 1045 | Ga0466959_0036716 | 3300045049 | Bacteria | 3620 |
| 1046 | Ga0466959_0123839 | 3300045049 | Bacteria | 1836 |
| 1047 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 1048 | Ga0451576_0000116 | 3300045051 | Bacteria | 207763 |
| 1049 | Ga0451576_0000810 | 3300045051 | Bacteria | 61225 |
| 1050 | Ga0451576_0003028 | 3300045051 | Bacteria | 23722 |
| 1051 | Ga0451576_0017940 | 3300045051 | Bacteria | 7769 |
| 1052 | Ga0451576_0040503 | 3300045051 | Bacteria | 4929 |
| 1053 | Ga0451576_0052789 | 3300045051 | Bacteria | 4259 |
| 1054 | Ga0451576_0072549 | 3300045051 | Bacteria | 3582 |
| 1055 | Ga0451576_0090153 | 3300045051 | Bacteria | 3189 |
| 1056 | Ga0451576_0136460 | 3300045051 | Bacteria | 2559 |
| 1057 | Ga0451576_0164653 | 3300045051 | Bacteria | 2314 |
| 1058 | Ga0451576_0169075 | 3300045051 | Bacteria | 2281 |
| 1059 | Ga0451576_0184651 | 3300045051 | Bacteria | 2177 |
| 1060 | Ga0451576_0341786 | 3300045051 | Bacteria | 1567 |
| 1061 | Ga0451576_0379732 | 3300045051 | Bacteria | 1481 |
| 1062 | Ga0451576_0650693 | 3300045051 | Bacteria | 1107 |
| 1063 | Ga0451576_0682101 | 3300045051 | Bacteria | 1079 |
| 1064 | Ga0466958_0016792 | 3300045836 | Bacteria | 4221 |
| 1065 | Ga0466967_0095991 | 3300045976 | Bacteria | 2704 |
| 1066 | Ga0495592_0000402 | 3300046454 | Bacteria | 33287 |
| 1067 | Ga0495592_0008806 | 3300046454 | Bacteria | 7578 |
| 1068 | Ga0495592_0011017 | 3300046454 | Bacteria | 6821 |
| 1069 | Ga0495592_0012367 | 3300046454 | Bacteria | 6482 |
| 1070 | Ga0495592_0018099 | 3300046454 | Bacteria | 5353 |
| 1071 | Ga0495603_0004104 | 3300046455 | Bacteria | 8673 |
| 1072 | Ga0495629_0050922 | 3300046459 | Bacteria | 2899 |
| 1073 | Ga0495638_0045635 | 3300046460 | Bacteria | 2756 |
| 1074 | Ga0495638_0142107 | 3300046460 | Bacteria | 1400 |
| 1075 | Ga0495641_0005397 | 3300046461 | Bacteria | 8649 |
| 1076 | Ga0495641_0014457 | 3300046461 | Bacteria | 4267 |
| 1077 | Ga0495651_0000386 | 3300046462 | Bacteria | 34115 |
| 1078 | Ga0495651_0001537 | 3300046462 | Bacteria | 17839 |
| 1079 | Ga0495653_0000014 | 3300046463 | Bacteria | 215253 |
| 1080 | Ga0495653_0001467 | 3300046463 | Bacteria | 18418 |
| 1081 | Ga0495653_0104712 | 3300046463 | Bacteria | 2044 |
| 1082 | Ga0495653_0269004 | 3300046463 | Bacteria | 1123 |
| 1083 | Ga0495650_0010303 | 3300046471 | Bacteria | 5226 |
| 1084 | Ga0495580_0005123 | 3300046472 | Bacteria | 10905 |
| 1085 | Ga0495580_0022257 | 3300046472 | Bacteria | 4666 |
| 1086 | Ga0495582_0022643 | 3300046473 | Bacteria | 3438 |
| 1087 | Ga0495639_0002490 | 3300046475 | Bacteria | 8037 |
| 1088 | Ga0495639_0086817 | 3300046475 | Bacteria | 1464 |
| 1089 | Ga0495662_0005031 | 3300046476 | Bacteria | 6625 |
| 1090 | Ga0495662_0007831 | 3300046476 | Bacteria | 5259 |
| 1091 | Ga0495662_0056211 | 3300046476 | Bacteria | 1901 |
| 1092 | Ga0495585_0004535 | 3300046492 | Bacteria | 8991 |
| 1093 | Ga0495606_0000085 | 3300046507 | Bacteria | 158006 |
| 1094 | Ga0495608_0001458 | 3300046511 | Bacteria | 16807 |
| 1095 | Ga0495608_0010334 | 3300046511 | Bacteria | 6513 |
| 1096 | Ga0495608_0024719 | 3300046511 | Bacteria | 4105 |
| 1097 | Ga0495618_0036764 | 3300046514 | Bacteria | 3073 |
| 1098 | Ga0495620_0009557 | 3300046515 | Bacteria | 5148 |
| 1099 | Ga0495628_0001323 | 3300046516 | Bacteria | 22719 |
| 1100 | Ga0495628_0003324 | 3300046516 | Bacteria | 14383 |
| 1101 | Ga0495628_0012120 | 3300046516 | Bacteria | 7268 |
| 1102 | Ga0495628_0023392 | 3300046516 | Bacteria | 5072 |
| 1103 | Ga0495628_0054659 | 3300046516 | Bacteria | 3147 |
| 1104 | Ga0495628_0082173 | 3300046516 | Bacteria | 2502 |
| 1105 | Ga0495630_0001562 | 3300046517 | Bacteria | 15915 |
| 1106 | Ga0495631_0001860 | 3300046518 | Bacteria | 12469 |
| 1107 | Ga0495637_0001254 | 3300046520 | Bacteria | 15311 |
| 1108 | Ga0495666_0005300 | 3300046526 | Bacteria | 6501 |
| 1109 | Ga0495652_0014341 | 3300046529 | Bacteria | 7114 |
| 1110 | Ga0495652_0020971 | 3300046529 | Bacteria | 5807 |
| 1111 | Ga0495652_0031771 | 3300046529 | Bacteria | 4621 |
| 1112 | Ga0495652_0340747 | 3300046529 | Bacteria | 1077 |
| 1113 | Ga0495654_0000034 | 3300046530 | Bacteria | 196519 |
| 1114 | Ga0495654_0006664 | 3300046530 | Bacteria | 6537 |
| 1115 | Ga0495665_0002051 | 3300046531 | Bacteria | 10908 |
| 1116 | Ga0495640_0167223 | 3300046533 | Bacteria | 1406 |
| 1117 | Ga0495586_0004208 | 3300046535 | Bacteria | 7709 |
| 1118 | Ga0495586_0010110 | 3300046535 | Bacteria | 5021 |
| 1119 | Ga0495586_0038227 | 3300046535 | Bacteria | 2576 |
| 1120 | Ga0495587_0005053 | 3300046536 | Bacteria | 8632 |
| 1121 | Ga0495587_0005690 | 3300046536 | Bacteria | 8127 |
| 1122 | Ga0495587_0028128 | 3300046536 | Bacteria | 3421 |
| 1123 | Ga0495598_0026266 | 3300046537 | Bacteria | 1595 |
| 1124 | Ga0495621_0006064 | 3300046539 | Bacteria | 3511 |
| 1125 | Ga0495621_0101614 | 3300046539 | Bacteria | 1095 |
| 1126 | Ga0495645_0000490 | 3300046543 | Bacteria | 27455 |
| 1127 | Ga0495645_0000505 | 3300046543 | Bacteria | 26925 |
| 1128 | Ga0495622_0018754 | 3300046557 | Bacteria | 3222 |
| 1129 | Ga0495633_0000563 | 3300046558 | Bacteria | 36212 |
| 1130 | Ga0495667_0000929 | 3300046559 | Bacteria | 18958 |
| 1131 | Ga0495667_0003624 | 3300046559 | Bacteria | 10384 |
| 1132 | Ga0495667_0016088 | 3300046559 | Bacteria | 5056 |
| 1133 | Ga0495667_0089742 | 3300046559 | Bacteria | 1992 |
| 1134 | Ga0495656_0000090 | 3300046615 | Bacteria | 39387 |
| 1135 | Ga0495656_0011534 | 3300046615 | Bacteria | 3246 |
| 1136 | Ga0495634_0004749 | 3300046642 | Bacteria | 10571 |
| 1137 | Ga0495634_0052509 | 3300046642 | Bacteria | 2732 |
| 1138 | Ga0495625_0000045 | 3300046660 | Bacteria | 202475 |
| 1139 | Ga0495625_0113489 | 3300046660 | Bacteria | 1850 |
| 1140 | Ga0495635_0013262 | 3300046663 | Bacteria | 5767 |
| 1141 | Ga0495635_0022732 | 3300046663 | Bacteria | 4371 |
| 1142 | Ga0495635_0121478 | 3300046663 | Bacteria | 1782 |
| 1143 | Ga0495659_0056632 | 3300046664 | Bacteria | 1439 |
| 1144 | Ga0495588_0099631 | 3300046674 | Bacteria | 1526 |
| 1145 | Ga0495657_0001646 | 3300046675 | Bacteria | 19198 |
| 1146 | Ga0495657_0075298 | 3300046675 | Bacteria | 2194 |
| 1147 | Ga0495599_0001724 | 3300046678 | Bacteria | 12639 |
| 1148 | Ga0495599_0005109 | 3300046678 | Bacteria | 7815 |
| 1149 | Ga0495599_0007320 | 3300046678 | Bacteria | 6690 |
| 1150 | Ga0495599_0016689 | 3300046678 | Bacteria | 4560 |
| 1151 | Ga0495646_0073811 | 3300046680 | Bacteria | 2003 |
| 1152 | Ga0495647_0000520 | 3300046681 | Bacteria | 11248 |
| 1153 | Ga0495647_0002578 | 3300046681 | Bacteria | 5747 |
| 1154 | Ga0495658_0005333 | 3300046683 | Bacteria | 6325 |
| 1155 | Ga0495658_0059067 | 3300046683 | Bacteria | 2195 |
| 1156 | Ga0495669_0039167 | 3300046684 | Bacteria | 2098 |
| 1157 | Ga0495613_0003024 | 3300046689 | Bacteria | 12577 |
| 1158 | Ga0495613_0014356 | 3300046689 | Bacteria | 5880 |
| 1159 | Ga0495624_0004534 | 3300046690 | Bacteria | 10151 |
| 1160 | Ga0495624_0045779 | 3300046690 | Bacteria | 2783 |
| 1161 | Ga0495624_0055474 | 3300046690 | Bacteria | 2496 |
| 1162 | Ga0495600_0001614 | 3300046809 | Bacteria | 12575 |
| 1163 | Ga0495600_0006471 | 3300046809 | Bacteria | 7132 |
| 1164 | Ga0495581_0296944 | 3300047315 | Bacteria | 944 |
| 1165 | Ga0495604_0001290 | 3300047317 | Bacteria | 20493 |
| 1166 | Ga0495604_0063974 | 3300047317 | Bacteria | 2805 |
| 1167 | Ga0495604_0191323 | 3300047317 | Bacteria | 1425 |
| 1168 | Ga0495604_0256034 | 3300047317 | Bacteria | 1191 |
| 1169 | Ga0495636_0096815 | 3300047318 | Bacteria | 1287 |
| 1170 | Ga0495636_0101440 | 3300047318 | Bacteria | 1259 |
| 1171 | Ga0495674_0002016 | 3300047319 | Bacteria | 19979 |
| 1172 | Ga0495676_0118617 | 3300047321 | Bacteria | 1929 |
| 1173 | Ga0495680_0000735 | 3300047322 | Bacteria | 36769 |
| 1174 | Ga0495680_0013178 | 3300047322 | Bacteria | 7224 |
| 1175 | Ga0495687_000961 | 3300047443 | Bacteria | 29557 |
| 1176 | Ga0495675_0024850 | 3300047444 | Bacteria | 3821 |
| 1177 | Ga0495684_0006542 | 3300047471 | Bacteria | 9039 |
| 1178 | Ga0495684_0071758 | 3300047471 | Bacteria | 2631 |
| 1179 | Ga0495593_0014105 | 3300047673 | Bacteria | 4548 |
| 1180 | Ga0495593_0157840 | 3300047673 | Bacteria | 1146 |
| 1181 | Ga0495602_0226614 | 3300048088 | Bacteria | 1407 |
| 1182 | Ga0495614_0037406 | 3300048089 | Bacteria | 2082 |
| 1183 | Ga0496100_0004031 | 3300048903 | Bacteria | 7734 |
| 1184 | Ga0496100_0302774 | 3300048903 | Bacteria | 1197 |
| 1185 | Ga0496102_0062695 | 3300048905 | Bacteria | 3404 |
| 1186 | Ga0496104_0017851 | 3300048907 | Bacteria | 6469 |
| 1187 | Ga0496104_0113513 | 3300048907 | Bacteria | 2598 |
| 1188 | Ga0496105_0264483 | 3300048908 | Bacteria | 1390 |
| 1189 | Ga0496108_0025181 | 3300048911 | Bacteria | 4903 |
| 1190 | Ga0496108_0030824 | 3300048911 | Bacteria | 4444 |
| 1191 | Ga0496108_0338683 | 3300048911 | Bacteria | 1312 |
| 1192 | Ga0496109_0007737 | 3300048912 | Bacteria | 9099 |
| 1193 | Ga0496109_0020515 | 3300048912 | Bacteria | 5837 |
| 1194 | Ga0496109_0082794 | 3300048912 | Bacteria | 2958 |
| 1195 | Ga0496109_0096917 | 3300048912 | Bacteria | 2733 |
| 1196 | Ga0496110_0032764 | 3300048913 | Bacteria | 4492 |
| 1197 | Ga0496110_0081553 | 3300048913 | Bacteria | 2884 |
| 1198 | Ga0496110_0146480 | 3300048913 | Bacteria | 2136 |
| 1199 | Ga0496112_0035835 | 3300048915 | Bacteria | 4835 |
| 1200 | Ga0496113_0067776 | 3300048916 | Bacteria | 2707 |
| 1201 | Ga0496116_0046660 | 3300048919 | Bacteria | 2922 |
| 1202 | Ga0496116_0072434 | 3300048919 | Bacteria | 2178 |
| 1203 | Ga0496117_0000056 | 3300048920 | Bacteria | 271417 |
| 1204 | Ga0496117_0060218 | 3300048920 | Bacteria | 2618 |
| 1205 | Ga0496118_0000047 | 3300048921 | Bacteria | 271417 |
| 1206 | Ga0496118_0005388 | 3300048921 | Bacteria | 14570 |
| 1207 | Ga0496118_0017400 | 3300048921 | Bacteria | 6544 |
| 1208 | Ga0496119_0098623 | 3300048922 | Bacteria | 1645 |
| 1209 | Ga0496121_0021767 | 3300048924 | Bacteria | 6262 |
| 1210 | Ga0496121_0027142 | 3300048924 | Bacteria | 5367 |
| 1211 | Ga0496121_0041655 | 3300048924 | Bacteria | 4010 |
| 1212 | Ga0496121_0088636 | 3300048924 | Bacteria | 2425 |
| 1213 | Ga0496122_0000747 | 3300048925 | Bacteria | 63354 |
| 1214 | Ga0496122_0006247 | 3300048925 | Bacteria | 13779 |
| 1215 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 1216 | Ga0496123_0000345 | 3300048926 | Bacteria | 87307 |
| 1217 | Ga0496124_0000596 | 3300048927 | Bacteria | 60853 |
| 1218 | Ga0496124_0028048 | 3300048927 | Bacteria | 5040 |
| 1219 | Ga0496124_0044619 | 3300048927 | Bacteria | 3802 |
| 1220 | Ga0496124_0174602 | 3300048927 | Bacteria | 1660 |
| 1221 | Ga0496124_0237264 | 3300048927 | Bacteria | 1358 |
| 1222 | Ga0496125_0006034 | 3300048928 | Bacteria | 13252 |
| 1223 | Ga0496125_0049426 | 3300048928 | Bacteria | 3495 |
| 1224 | Ga0496125_0089064 | 3300048928 | Bacteria | 2322 |
| 1225 | Ga0496125_0099879 | 3300048928 | Bacteria | 2141 |
| 1226 | Ga0496126_0031456 | 3300048929 | Bacteria | 5014 |
| 1227 | Ga0496126_0268443 | 3300048929 | Bacteria | 1416 |
| 1228 | Ga0501031_0000519 | 3300049568 | Bacteria | 22515 |
| 1229 | Ga0501031_0002448 | 3300049568 | Bacteria | 11828 |
| 1230 | Ga0501032_0021502 | 3300049569 | Bacteria | 4483 |
| 1231 | Ga0501032_0129975 | 3300049569 | Bacteria | 1662 |
| 1232 | Ga0501033_0000289 | 3300049570 | Bacteria | 48277 |
| 1233 | Ga0501033_0001878 | 3300049570 | Bacteria | 18274 |
| 1234 | Ga0501034_0009180 | 3300049571 | Bacteria | 10373 |
| 1235 | Ga0501034_0041500 | 3300049571 | Bacteria | 4655 |
| 1236 | Ga0501034_0080371 | 3300049571 | Bacteria | 3263 |
| 1237 | Ga0501034_0106998 | 3300049571 | Bacteria | 2789 |
| 1238 | Ga0501036_0000051 | 3300049572 | Bacteria | 75057 |
| 1239 | Ga0501036_0025591 | 3300049572 | Bacteria | 4980 |
| 1240 | Ga0501036_0098999 | 3300049572 | Bacteria | 2466 |
| 1241 | Ga0501037_0004183 | 3300049573 | Bacteria | 10463 |
| 1242 | Ga0501037_0007041 | 3300049573 | Bacteria | 8212 |
| 1243 | Ga0501038_0000505 | 3300049574 | Bacteria | 34234 |
| 1244 | Ga0501038_0016412 | 3300049574 | Bacteria | 6711 |
| 1245 | Ga0501039_0002690 | 3300049575 | Bacteria | 13263 |
| 1246 | Ga0501039_0113685 | 3300049575 | Bacteria | 2117 |
| 1247 | Ga0501039_0140084 | 3300049575 | Bacteria | 1900 |
| 1248 | Ga0501039_0341686 | 3300049575 | Bacteria | 1176 |
| 1249 | Ga0501040_0030316 | 3300049576 | Bacteria | 3654 |
| 1250 | Ga0501040_0033226 | 3300049576 | Bacteria | 3493 |
| 1251 | Ga0501041_0000236 | 3300049577 | Bacteria | 25702 |
| 1252 | Ga0501041_0044238 | 3300049577 | Bacteria | 2707 |
| 1253 | Ga0501042_0000107 | 3300049578 | Bacteria | 34352 |
| 1254 | Ga0501042_0040258 | 3300049578 | Bacteria | 3323 |
| 1255 | Ga0501042_0108547 | 3300049578 | Bacteria | 1998 |
| 1256 | Ga0501043_0000057 | 3300049579 | Bacteria | 103997 |
| 1257 | Ga0501043_0012140 | 3300049579 | Bacteria | 6733 |
| 1258 | Ga0501043_0012436 | 3300049579 | Bacteria | 6657 |
| 1259 | Ga0501043_0117192 | 3300049579 | Bacteria | 2090 |
| 1260 | Ga0501043_0172037 | 3300049579 | Bacteria | 1690 |
| 1261 | Ga0501046_0000075 | 3300049580 | Bacteria | 104000 |
| 1262 | Ga0501046_0000548 | 3300049580 | Bacteria | 37400 |
| 1263 | Ga0501046_0016131 | 3300049580 | Bacteria | 6265 |
| 1264 | Ga0501046_0036963 | 3300049580 | Bacteria | 3926 |
| 1265 | Ga0501046_0099823 | 3300049580 | Bacteria | 2228 |
| 1266 | Ga0501047_0000081 | 3300049581 | Bacteria | 122697 |
| 1267 | Ga0501047_0005071 | 3300049581 | Bacteria | 12359 |
| 1268 | Ga0501047_0006131 | 3300049581 | Bacteria | 11299 |
| 1269 | Ga0501047_0058948 | 3300049581 | Bacteria | 3708 |
| 1270 | Ga0501047_0193772 | 3300049581 | Bacteria | 1895 |
| 1271 | Ga0501048_0000076 | 3300049582 | Bacteria | 51144 |
| 1272 | Ga0501048_0002636 | 3300049582 | Bacteria | 13718 |
| 1273 | Ga0501048_0289042 | 3300049582 | Bacteria | 1166 |
| 1274 | Ga0501067_0044166 | 3300049583 | Bacteria | 2476 |
| 1275 | Ga0501069_0002988 | 3300049585 | Bacteria | 8709 |
| 1276 | Ga0501070_0003556 | 3300049586 | Bacteria | 13482 |
| 1277 | Ga0501070_0015557 | 3300049586 | Bacteria | 6397 |
| 1278 | Ga0501070_0027035 | 3300049586 | Bacteria | 4813 |
| 1279 | Ga0501070_0084597 | 3300049586 | Bacteria | 2626 |
| 1280 | Ga0501070_0126469 | 3300049586 | Bacteria | 2112 |
| 1281 | Ga0501071_0000836 | 3300049587 | Bacteria | 16486 |
| 1282 | Ga0501071_0050258 | 3300049587 | Bacteria | 3003 |
| 1283 | Ga0501071_0094569 | 3300049587 | Bacteria | 2198 |
| 1284 | Ga0501071_0140717 | 3300049587 | Bacteria | 1796 |
| 1285 | Ga0501072_0000201 | 3300049588 | Bacteria | 43540 |
| 1286 | Ga0501072_0001610 | 3300049588 | Bacteria | 16870 |
| 1287 | Ga0501072_0018650 | 3300049588 | Bacteria | 5348 |
| 1288 | Ga0501072_0025495 | 3300049588 | Bacteria | 4606 |
| 1289 | Ga0501072_0043676 | 3300049588 | Bacteria | 3523 |
| 1290 | Ga0501073_0000403 | 3300049589 | Bacteria | 29490 |
| 1291 | Ga0501073_0000710 | 3300049589 | Bacteria | 23547 |
| 1292 | Ga0501073_0001421 | 3300049589 | Bacteria | 17674 |
| 1293 | Ga0501073_0137263 | 3300049589 | Bacteria | 1695 |
| 1294 | Ga0501073_0402902 | 3300049589 | Bacteria | 945 |
| 1295 | Ga0501074_0003228 | 3300049590 | Bacteria | 11518 |
| 1296 | Ga0501074_0073065 | 3300049590 | Bacteria | 2464 |
| 1297 | Ga0501074_0206705 | 3300049590 | Bacteria | 1399 |
| 1298 | Ga0501075_0000544 | 3300049591 | Bacteria | 22874 |
| 1299 | Ga0501075_0014368 | 3300049591 | Bacteria | 5672 |
| 1300 | Ga0501075_0122411 | 3300049591 | Bacteria | 1980 |
| 1301 | Ga0501075_0232921 | 3300049591 | Bacteria | 1404 |
| 1302 | Ga0501075_0282334 | 3300049591 | Bacteria | 1265 |
| 1303 | Ga0501075_0324530 | 3300049591 | Bacteria | 1173 |
| 1304 | Ga0501076_0000771 | 3300049592 | Bacteria | 20696 |
| 1305 | Ga0501076_0001109 | 3300049592 | Bacteria | 17761 |
| 1306 | Ga0501077_0025685 | 3300049593 | Bacteria | 3738 |
| 1307 | Ga0501198_000012 | 3300049649 | Bacteria | 113529 |
| 1308 | Ga0501222_000010 | 3300049662 | Bacteria | 113536 |
| 1309 | Ga0501222_001940 | 3300049662 | Bacteria | 2869 |
| 1310 | Ga0501223_000534 | 3300049663 | Bacteria | 9173 |
| 1311 | Ga0501233_001974 | 3300049668 | Bacteria | 3572 |
| 1312 | Ga0501253_001770 | 3300049683 | Bacteria | 2287 |
| 1313 | Ga0501221_000686 | 3300049704 | Bacteria | 5423 |
| 1314 | Ga0501225_0003774 | 3300049705 | Bacteria | 4554 |
| 1315 | Ga0501225_0032555 | 3300049705 | Bacteria | 1434 |
| 1316 | Ga0501229_000069 | 3300049706 | Bacteria | 10281 |
| 1317 | Ga0501079_0000441 | 3300049741 | Bacteria | 26973 |
| 1318 | Ga0501079_0007491 | 3300049741 | Bacteria | 8256 |
| 1319 | Ga0501079_0017995 | 3300049741 | Bacteria | 5396 |
| 1320 | Ga0501080_0000762 | 3300049742 | Bacteria | 26133 |
| 1321 | Ga0501080_0014631 | 3300049742 | Bacteria | 7227 |
| 1322 | Ga0501080_0034459 | 3300049742 | Bacteria | 4727 |
| 1323 | Ga0501080_0131792 | 3300049742 | Bacteria | 2314 |
| 1324 | Ga0501080_0287094 | 3300049742 | Bacteria | 1495 |
| 1325 | Ga0501080_0375073 | 3300049742 | Bacteria | 1282 |
| 1326 | Ga0501081_0001178 | 3300049743 | Bacteria | 15807 |
| 1327 | Ga0501081_0008200 | 3300049743 | Bacteria | 6781 |
| 1328 | Ga0501081_0071858 | 3300049743 | Bacteria | 2412 |
| 1329 | Ga0501081_0195693 | 3300049743 | Bacteria | 1465 |
| 1330 | Ga0501083_0003281 | 3300049744 | Bacteria | 11301 |
| 1331 | Ga0501083_0020668 | 3300049744 | Bacteria | 4577 |
| 1332 | Ga0501083_0033807 | 3300049744 | Bacteria | 3499 |
| 1333 | Ga0501083_0125143 | 3300049744 | Bacteria | 1685 |
| 1334 | Ga0501266_000713 | 3300049763 | Bacteria | 4324 |
| 1335 | Ga0501272_004105 | 3300049769 | Bacteria | 1505 |
| 1336 | Ga0501035_0009359 | 3300049822 | Bacteria | 9106 |
| 1337 | Ga0501035_0093945 | 3300049822 | Bacteria | 2638 |
| 1338 | Ga0501035_0120920 | 3300049822 | Bacteria | 2289 |
| 1339 | Ga0501035_0179968 | 3300049822 | Bacteria | 1822 |
| 1340 | Ga0501044_0004209 | 3300049823 | Bacteria | 16167 |
| 1341 | Ga0501044_0530435 | 3300049823 | Bacteria | 1076 |
| 1342 | Ga0501044_0620666 | 3300049823 | Bacteria | 973 |
| 1343 | Ga0501045_0000911 | 3300049824 | Bacteria | 19278 |
| 1344 | Ga0501045_0227956 | 3300049824 | Bacteria | 1387 |
| 1345 | nmdc:mga03683_112035_c1 | 3300050489 | Bacteria | 1207 |
| 1346 | nmdc:mga03683_5307_c1 | 3300050489 | Bacteria | 4346 |
| 1347 | nmdc:mga03683_6760_c1 | 3300050489 | Bacteria | 3947 |
| 1348 | nmdc:mga03n38_21506_c1 | 3300050490 | Bacteria | 2597 |
| 1349 | nmdc:mga03n38_311636_c1 | 3300050490 | Bacteria | 848 |
| 1350 | nmdc:mga00v17_45226_c1 | 3300050491 | Bacteria | 2659 |
| 1351 | nmdc:mga0yw44_337042_c1 | 3300050492 | Bacteria | 1014 |
| 1352 | nmdc:mga0yw44_34515_c1 | 3300050492 | Bacteria | 2965 |
| 1353 | nmdc:mga0yw44_56081_c1 | 3300050492 | Bacteria | 2399 |
| 1354 | nmdc:mga0k408_109209_c1 | 3300050493 | Bacteria | 1634 |
| 1355 | nmdc:mga0k408_14580_c1 | 3300050493 | Bacteria | 4335 |
| 1356 | nmdc:mga0k408_161_c1 | 3300050493 | Bacteria | 34843 |
| 1357 | nmdc:mga0k408_16652_c1 | 3300050493 | Bacteria | 4083 |
| 1358 | nmdc:mga0k408_1875_c1 | 3300050493 | Bacteria | 11271 |
| 1359 | nmdc:mga0k408_249692_c1 | 3300050493 | Bacteria | 1059 |
| 1360 | nmdc:mga0k408_35602_c1 | 3300050493 | Bacteria | 2854 |
| 1361 | nmdc:mga0k408_4724_c1 | 3300050493 | Bacteria | 7214 |
| 1362 | nmdc:mga0k408_60277_c1 | 3300050493 | Bacteria | 2205 |
| 1363 | nmdc:mga07m45_11075_c1 | 3300050496 | Bacteria | 4730 |
| 1364 | nmdc:mga07m45_22932_c1 | 3300050496 | Bacteria | 3410 |
| 1365 | nmdc:mga07m45_33279_c1 | 3300050496 | Bacteria | 2862 |
| 1366 | nmdc:mga07m45_4223_c1 | 3300050496 | Bacteria | 7028 |
| 1367 | nmdc:mga07m45_46597_c1 | 3300050496 | Bacteria | 2436 |
| 1368 | nmdc:mga07m45_73795_c1 | 3300050496 | Bacteria | 1943 |
| 1369 | nmdc:mga07m45_8519_c1 | 3300050496 | Bacteria | 5276 |
| 1370 | nmdc:mga05p37_1040_c1 | 3300050507 | Bacteria | 31616 |
| 1371 | nmdc:mga05p37_822234_c1 | 3300050507 | Bacteria | 1013 |
| 1372 | nmdc:mga05p37_97434_c1 | 3300050507 | Bacteria | 3623 |
| 1373 | nmdc:mga09592_179179_c1 | 3300050508 | Bacteria | 1833 |
| 1374 | nmdc:mga09592_321446_c1 | 3300050508 | Bacteria | 1340 |
| 1375 | nmdc:mga09592_507_c1 | 3300050508 | Bacteria | 29420 |
| 1376 | nmdc:mga09592_52198_c1 | 3300050508 | Bacteria | 3451 |
| 1377 | nmdc:mga09592_90937_c1 | 3300050508 | Bacteria | 2608 |
| 1378 | nmdc:mga0qj67_101996_c1 | 3300050509 | Bacteria | 2314 |
| 1379 | nmdc:mga0qj67_21296_c1 | 3300050509 | Bacteria | 4972 |
| 1380 | nmdc:mga0qj67_21367_c1 | 3300050509 | Bacteria | 4965 |
| 1381 | nmdc:mga0qj67_60057_c1 | 3300050509 | Bacteria | 3016 |
| 1382 | nmdc:mga06r32_250227_c1 | 3300050510 | Bacteria | 1760 |
| 1383 | nmdc:mga06r32_2510_c1 | 3300050510 | Bacteria | 16409 |
| 1384 | nmdc:mga06r32_417730_c1 | 3300050510 | Bacteria | 1323 |
| 1385 | nmdc:mga06r32_51214_c1 | 3300050510 | Bacteria | 3951 |
| 1386 | nmdc:mga08y16_203250_c1 | 3300050511 | Bacteria | 2053 |
| 1387 | nmdc:mga08y16_315043_c1 | 3300050511 | Bacteria | 1611 |
| 1388 | nmdc:mga08y16_6498_c1 | 3300050511 | Bacteria | 12257 |
| 1389 | nmdc:mga08y16_69561_c1 | 3300050511 | Bacteria | 3670 |
| 1390 | nmdc:mga08y16_95492_c1 | 3300050511 | Bacteria | 3097 |
| 1391 | nmdc:mga0n895_13969_c1 | 3300050512 | Bacteria | 7273 |
| 1392 | nmdc:mga0n895_458_c1 | 3300050512 | Bacteria | 27351 |
| 1393 | nmdc:mga0n895_463400_c1 | 3300050512 | Bacteria | 1279 |
| 1394 | nmdc:mga0rr50_156_c1 | 3300050513 | Bacteria | 36930 |
| 1395 | nmdc:mga0rr50_23873_c1 | 3300050513 | Bacteria | 2776 |
| 1396 | nmdc:mga0rr50_29997_c1 | 3300050513 | Bacteria | 3844 |
| 1397 | nmdc:mga0rr50_303958_c1 | 3300050513 | Bacteria | 1335 |
| 1398 | nmdc:mga0rr50_309755_c1 | 3300050513 | Bacteria | 1322 |
| 1399 | nmdc:mga08x19_341_c1 | 3300050514 | Bacteria | 33752 |
| 1400 | nmdc:mga08x19_4042_c1 | 3300050514 | Bacteria | 8716 |
| 1401 | nmdc:mga08x19_54115_c1 | 3300050514 | Bacteria | 2583 |
| 1402 | nmdc:mga08x19_7621_c1 | 3300050514 | Bacteria | 6430 |
| 1403 | nmdc:mga08x19_81_c1 | 3300050514 | Bacteria | 87015 |
| 1404 | nmdc:mga0a205_127550_c1 | 3300050515 | Bacteria | 2444 |
| 1405 | nmdc:mga0a205_161597_c1 | 3300050515 | Bacteria | 2136 |
| 1406 | nmdc:mga0a205_299_c1 | 3300050515 | Bacteria | 36719 |
| 1407 | nmdc:mga0a205_302797_c1 | 3300050515 | Bacteria | 1471 |
| 1408 | nmdc:mga0a205_354577_c1 | 3300050515 | Bacteria | 1334 |
| 1409 | nmdc:mga0a205_43986_c1 | 3300050515 | Bacteria | 4304 |
| 1410 | nmdc:mga0a205_572403_c1 | 3300050515 | Bacteria | 984 |
| 1411 | nmdc:mga0a205_57923_c1 | 3300050515 | Bacteria | 3741 |
| 1412 | Ga0495601_0000627 | 3300053077 | Bacteria | 18859 |
| 1413 | Ga0495601_0001241 | 3300053077 | Bacteria | 13988 |
| 1414 | Ga0495601_0224741 | 3300053077 | Bacteria | 1226 |
| 1415 | Ga0495612_0016150 | 3300053078 | Bacteria | 2991 |
| 1416 | Ga0495612_0060180 | 3300053078 | Bacteria | 1572 |
| 1417 | Ga0500610_0001655 | 3300053079 | Bacteria | 7750 |
| 1418 | Ga0500610_0004732 | 3300053079 | Bacteria | 5460 |
| 1419 | Ga0495595_0002323 | 3300053084 | Bacteria | 7418 |
| 1420 | Ga0495595_0019707 | 3300053084 | Bacteria | 2930 |
| 1421 | Ga0495595_0040606 | 3300053084 | Bacteria | 2127 |
| 1422 | Ga0500643_004741 | 3300053087 | Bacteria | 6038 |
| 1423 | Ga0500646_0001015 | 3300053090 | Bacteria | 7678 |
| 1424 | Ga0500651_0000223 | 3300053093 | Bacteria | 35661 |
| 1425 | Ga0500566_0186570 | 3300053094 | Bacteria | 1059 |
| 1426 | Ga0500571_000129 | 3300053110 | Bacteria | 25327 |
| 1427 | Ga0500592_007345 | 3300053116 | Bacteria | 1754 |
| 1428 | Ga0500593_000472 | 3300053117 | Bacteria | 15997 |
| 1429 | Ga0500593_000526 | 3300053117 | Bacteria | 15083 |
| 1430 | Ga0500607_004161 | 3300053121 | Bacteria | 10094 |
| 1431 | Ga0500607_051714 | 3300053121 | Bacteria | 2184 |
| 1432 | Ga0500655_001764 | 3300053133 | Bacteria | 4053 |
| 1433 | Ga0500655_020384 | 3300053133 | Bacteria | 1238 |
| 1434 | Ga0500559_0004481 | 3300053136 | Bacteria | 6614 |
| 1435 | Ga0500559_0119174 | 3300053136 | Bacteria | 1227 |
| 1436 | Ga0500568_0009007 | 3300053139 | Bacteria | 4762 |
| 1437 | Ga0500568_0021891 | 3300053139 | Bacteria | 2744 |
| 1438 | Ga0500574_011933 | 3300053141 | Bacteria | 1975 |
| 1439 | Ga0500604_0002378 | 3300053151 | Bacteria | 5143 |
| 1440 | Ga0500604_0020845 | 3300053151 | Bacteria | 1848 |
| 1441 | Ga0500616_0023945 | 3300053153 | Bacteria | 3398 |
| 1442 | Ga0500622_0059421 | 3300053156 | Bacteria | 1952 |
| 1443 | Ga0500627_0000567 | 3300053158 | Bacteria | 9948 |
| 1444 | Ga0500634_0009885 | 3300053161 | Bacteria | 4853 |
| 1445 | Ga0500634_0022949 | 3300053161 | Bacteria | 3391 |
| 1446 | Ga0500636_0021704 | 3300053177 | Bacteria | 3801 |
| 1447 | Ga0500645_005298 | 3300053730 | Bacteria | 4774 |
| 1448 | Ga0501084_0014223 | 3300054114 | Bacteria | 6589 |
| 1449 | Ga0501084_0061169 | 3300054114 | Bacteria | 3153 |
| 1450 | Ga0501084_0070133 | 3300054114 | Bacteria | 2935 |
| 1451 | Ga0501084_0162371 | 3300054114 | Bacteria | 1885 |
| 1452 | Ga0590071_000494 | 3300059421 | Bacteria | 11506 |
| 1453 | Ga0590074_009073 | 3300059423 | Bacteria | 1658 |
| 1454 | Ga0590074_009443 | 3300059423 | Bacteria | 1625 |
| 1455 | Ga0501082_0006025 | 3300060353 | Bacteria | 10515 |
| 1456 | Ga0501082_0018607 | 3300060353 | Bacteria | 5986 |
| 1457 | Ga0501082_0047642 | 3300060353 | Bacteria | 3694 |
| 1458 | Ga0501082_0060097 | 3300060353 | Bacteria | 3274 |
| 1459 | Ga0501082_0080902 | 3300060353 | Bacteria | 2804 |
| 1460 | Ga0530510_0000543 | 3300061734 | Bacteria | 24227 |
| 1461 | Ga0530510_0000585 | 3300061734 | Bacteria | 23421 |
| 1462 | 2513229154 | 2513020051 | Bacteria | 6053213 |
| 1463 | 2587724932 | 2585428057 | Bacteria | 6737412 |
| 1464 | 2587731701 | 2585428058 | Bacteria | 6853932 |
| 1465 | 2588292434 | 2588253510 | Bacteria | 6901809 |
| 1466 | 2599623423 | 2599185214 | Bacteria | 8209958 |
| 1467 | 2599675359 | 2599185226 | Bacteria | 8233575 |
| 1468 | 2599681028 | 2599185227 | Bacteria | 8246414 |
| 1469 | 2599693043 | 2599185229 | Bacteria | 8216126 |
| 1470 | 2643743744 | 2643221544 | Bacteria | 5886209 |
| 1471 | 2643867750 | 2643221570 | Bacteria | 5103772 |
| 1472 | 2643936506 | 2643221585 | Bacteria | 5812563 |
| 1473 | 2643968186 | 2643221592 | Bacteria | 6608788 |
| 1474 | 2644062216 | 2643221609 | Bacteria | 6756331 |
| 1475 | 2644071404 | 2643221611 | Bacteria | 6820941 |
| 1476 | 2644142458 | 2643221625 | Bacteria | 6512927 |
| 1477 | 2644161820 | 2643221628 | Bacteria | 5745828 |
| 1478 | 2644222343 | 2643221639 | Bacteria | 6649903 |
| 1479 | 2644256357 | 2643221646 | Bacteria | 6433402 |
| 1480 | 2644277043 | 2643221648 | Bacteria | 6521465 |
| 1481 | 2644301365 | 2643221654 | Bacteria | 5273570 |
| 1482 | 2644317862 | 2643221656 | Bacteria | 5809961 |
| 1483 | 2644325584 | 2643221658 | Bacteria | 6064537 |
| 1484 | 2644340870 | 2643221660 | Bacteria | 4208257 |
| 1485 | 2644358534 | 2643221664 | Bacteria | 7272945 |
| 1486 | 2644399303 | 2643221672 | Bacteria | 6322190 |
| 1487 | 2644467009 | 2643221683 | Bacteria | 5749203 |
| 1488 | 2738718171 | 2738541277 | Bacteria | 7458140 |
| 1489 | 2738880444 | 2738541307 | Bacteria | 8606193 |
| 1490 | 2739058402 | 2738541337 | Bacteria | 6183410 |
| 1491 | 2739245827 | 2738543012 | Bacteria | 7115078 |
| 1492 | 2739281358 | 2738543019 | Bacteria | 7459457 |
| 1493 | 2816470521 | 2816332133 | Bacteria | 7249298 |
| 1494 | 2819600599 | 2818991446 | Bacteria | 7757362 |
| 1495 | 2831267675 | 2831265667 | Bacteria | 7184833 |
| 1496 | 2838061119 | 2838054893 | Bacteria | 7451788 |
| 1497 | 2839141861 | 2839138175 | Bacteria | 6549354 |
| 1498 | 2842679801 | 2842677519 | Bacteria | 5615038 |
| 1499 | 2842718703 | 2842718218 | Bacteria | 4560148 |
| 1500 | 2842736382 | 2842733646 | Bacteria | 5716726 |
| 1501 | 2842748890 | 2842747753 | Bacteria | 5578255 |
| 1502 | 2857569270 | 2857564685 | Bacteria | 6290584 |
| 1503 | 2885085895 | 2885080285 | Bacteria | 6355622 |
| 1504 | 2885196958 | 2885192300 | Bacteria | 5882526 |
| 1505 | 2885198855 | 2885198086 | Bacteria | 7212419 |
| 1506 | 2885211765 | 2885211737 | Bacteria | 7212420 |
| 1507 | 2895517910 | 2895511927 | Bacteria | 6802080 |
| 1508 | 2899928254 | 2899924645 | Bacteria | 7487985 |
| 1509 | 2904452469 | 2904449895 | Bacteria | 6927402 |
| 1510 | 2904460932 | 2904456579 | Bacteria | 6819253 |
| 1511 | 2904545154 | 2904541872 | Bacteria | 8915136 |
| 1512 | 2919463899 | 2919462493 | Bacteria | 5817112 |
| 1513 | 2928041206 | 2928037797 | Bacteria | 7273642 |
| 1514 | 2928048048 | 2928044640 | Bacteria | 7271509 |
| 1515 | 2928055889 | 2928051484 | Bacteria | 7773759 |
| 1516 | 2928066630 | 2928064002 | Bacteria | 7419480 |
| 1517 | 2928077216 | 2928070936 | Bacteria | 8062541 |
| 1518 | 2928087517 | 2928084124 | Bacteria | 7159212 |
| 1519 | 2928120635 | 2928115317 | Bacteria | 6477646 |
| 1520 | 2929165332 | 2929160207 | Bacteria | 9075316 |
| 1521 | 2929522915 | 2929520902 | Bacteria | 6765052 |
| 1522 | 2932424025 | 2932422444 | Bacteria | 4678430 |
| 1523 | 2945910062 | 2945909444 | Bacteria | 7065066 |
| 1524 | 2945946035 | 2945945610 | Bacteria | 5951079 |
| 1525 | 2945975634 | 2945972063 | Bacteria | 6086495 |
| 1526 | 2945987922 | 2945984333 | Bacteria | 7358892 |
| 1527 | 2954768922 | 2954767861 | Bacteria | 5535784 |
| 1528 | Ga0065707_10085778 | |||
| 1529 | JGI24740J21852_10010522 | |||
| 1530 | JGI25155J39150_1000022 | |||
| 1531 | JGI25156J39149_1000005 | |||
| 1532 | JGI25154J39366_1000017 | |||
| 1533 | JGI25158J39367_1005484 | |||
| 1534 | JGI25157J39369_1000003 | |||
| 1535 | JGI25152J39213_1011510 | |||
| 1536 | JGI25159J45721_1015079 | |||
| 1537 | JGI25151J46595_10007571 | |||
| 1538 | JGI25153J46596_10003017 | |||
| 1539 | Ga0006562J51391_1102770 | |||
| 1540 | Ga0006562J51391_1102771 | |||
| 1541 | Ga0055535_1000221 | |||
| 1542 | Ga0055542_1000129 | |||
| 1543 | Ga0055537_1000475 | |||
| 1544 | Ga0055524_1000053 | |||
| 1545 | Ga0055536_1001528 | |||
| 1546 | Ga0055536_1008131 | |||
| 1547 | Ga0055536_1033036 | |||
| 1548 | Ga0055534_1000429 | |||
| 1549 | Ga0055534_1003675 | |||
| 1550 | Ga0055534_1004148 | |||
| 1551 | Ga0055528_1002516 | |||
| 1552 | Ga0055528_1007607 | |||
| 1553 | Ga0055530_10001363 | |||
| 1554 | Ga0055530_10005013 | |||
| 1555 | Ga0055540_1002889 | |||
| 1556 | Ga0055540_1003142 | |||
| 1557 | Ga0055531_10000158 | |||
| 1558 | Ga0055531_10000179 | |||
| 1559 | Ga0055531_10000543 | |||
| 1560 | Ga0065165_1000177 | |||
| 1561 | Ga0065165_1001456 | |||
| 1562 | Ga0065165_1026655 | |||
| 1563 | Ga0065165_1051685 | |||
| 1564 | Ga0065714_10088812 | |||
| 1565 | Ga0065704_10134796 | |||
| 1566 | Ga0065707_10004626 | |||
| 1567 | Ga0070658_10058717 | |||
| 1568 | Ga0070676_10064584 | |||
| 1569 | Ga0070676_10165882 | |||
| 1570 | Ga0070683_100079043 | |||
| 1571 | Ga0070690_100000076 | |||
| 1572 | Ga0070690_100011766 | |||
| 1573 | Ga0070690_100076426 | |||
| 1574 | Ga0070690_100097702 | |||
| 1575 | Ga0070690_100237707 | |||
| 1576 | Ga0070670_100006933 | |||
| 1577 | Ga0070670_100098535 | |||
| 1578 | Ga0070670_100203438 | |||
| 1579 | Ga0068869_100001183 | |||
| 1580 | Ga0068869_100056383 | |||
| 1581 | Ga0068869_100153438 | |||
| 1582 | Ga0068869_100215564 | |||
| 1583 | Ga0070666_10006757 | |||
| 1584 | Ga0070666_10064631 | |||
| 1585 | Ga0070680_100000812 | |||
| 1586 | Ga0070680_100006232 | |||
| 1587 | Ga0070680_100078687 | |||
| 1588 | Ga0068868_100000966 | |||
| 1589 | Ga0068868_100118129 | |||
| 1590 | Ga0068868_100471099 | |||
| 1591 | Ga0070660_100064288 | |||
| 1592 | Ga0070689_100005432 | |||
| 1593 | Ga0070689_100009409 | |||
| 1594 | Ga0070689_100012393 | |||
| 1595 | Ga0070689_100013607 | |||
| 1596 | Ga0070689_100253426 | |||
| 1597 | Ga0070691_10003561 | |||
| 1598 | Ga0070691_10003688 | |||
| 1599 | Ga0070691_10121804 | |||
| 1600 | Ga0070687_100000107 | |||
| 1601 | Ga0070687_100083430 | |||
| 1602 | Ga0070687_100083699 | |||
| 1603 | Ga0070661_100110093 | |||
| 1604 | Ga0070692_10005519 | |||
| 1605 | Ga0070692_10019289 | |||
| 1606 | Ga0070692_10043349 | |||
| 1607 | Ga0070668_100014537 | |||
| 1608 | Ga0070668_100056051 | |||
| 1609 | Ga0070668_100079443 | |||
| 1610 | Ga0070669_100005844 | |||
| 1611 | Ga0070669_100024219 | |||
| 1612 | Ga0070669_100056715 | |||
| 1613 | Ga0070669_100080916 | |||
| 1614 | Ga0070669_100169668 | |||
| 1615 | Ga0070675_100008036 | |||
| 1616 | Ga0070675_100027347 | |||
| 1617 | Ga0070675_100042997 | |||
| 1618 | Ga0070671_100002643 | |||
| 1619 | Ga0070671_100011057 | |||
| 1620 | Ga0070671_100126767 | |||
| 1621 | Ga0070671_100142202 | |||
| 1622 | Ga0070671_100354492 | |||
| 1623 | Ga0070674_100004974 | |||
| 1624 | Ga0070674_100060000 | |||
| 1625 | Ga0070673_100046302 | |||
| 1626 | Ga0070673_100146969 | |||
| 1627 | Ga0070673_100243232 | |||
| 1628 | Ga0070688_100049953 | |||
| 1629 | Ga0070688_100201968 | |||
| 1630 | Ga0070659_100187177 | |||
| 1631 | Ga0070659_100208652 | |||
| 1632 | Ga0070659_100351996 | |||
| 1633 | Ga0070667_100016643 | |||
| 1634 | Ga0070667_100023158 | |||
| 1635 | Ga0070667_100212242 | |||
| 1636 | Ga0070667_100327871 | |||
| 1637 | Ga0070701_10000399 | |||
| 1638 | Ga0070705_100029021 | |||
| 1639 | Ga0070705_100071961 | |||
| 1640 | Ga0070700_100000695 | |||
| 1641 | Ga0070700_100003268 | |||
| 1642 | Ga0070700_100075600 | |||
| 1643 | Ga0070694_100091408 | |||
| 1644 | Ga0070694_100096346 | |||
| 1645 | Ga0070694_100110515 | |||
| 1646 | Ga0070694_100190004 | |||
| 1647 | Ga0070678_100006239 | |||
| 1648 | Ga0070678_100068048 | |||
| 1649 | Ga0070678_100189130 | |||
| 1650 | Ga0070662_100017313 | |||
| 1651 | Ga0070662_100048475 | |||
| 1652 | Ga0070662_100081313 | |||
| 1653 | Ga0070681_10000131 | |||
| 1654 | Ga0070681_10001310 | |||
| 1655 | Ga0070681_10011104 | |||
| 1656 | Ga0070681_10479521 | |||
| 1657 | Ga0068867_100001930 | |||
| 1658 | Ga0068867_100002071 | |||
| 1659 | Ga0068867_100002251 | |||
| 1660 | Ga0068867_100005640 | |||
| 1661 | Ga0068867_100049124 | |||
| 1662 | Ga0068867_100107037 | |||
| 1663 | Ga0068867_100184517 | |||
| 1664 | Ga0068867_100362023 | |||
| 1665 | Ga0070685_10062721 | |||
| 1666 | Ga0070706_100000463 | |||
| 1667 | Ga0070706_100328109 | |||
| 1668 | Ga0070706_100544038 | |||
| 1669 | Ga0070707_100084821 | |||
| 1670 | Ga0070707_100232052 | |||
| 1671 | Ga0070707_100670418 | |||
| 1672 | Ga0070699_100007582 | |||
| 1673 | Ga0070699_100477240 | |||
| 1674 | Ga0070699_100621188 | |||
| 1675 | Ga0070679_100008624 | |||
| 1676 | Ga0070679_100025341 | |||
| 1677 | Ga0070679_100048778 | |||
| 1678 | Ga0070679_100051692 | |||
| 1679 | Ga0070679_100148794 | |||
| 1680 | Ga0070679_100623511 | |||
| 1681 | Ga0070684_100074042 | |||
| 1682 | Ga0070684_100100602 | |||
| 1683 | Ga0070697_100000561 | |||
| 1684 | Ga0068853_100019963 | |||
| 1685 | Ga0068853_100029057 | |||
| 1686 | Ga0068853_100037525 | |||
| 1687 | Ga0068853_100216257 | |||
| 1688 | Ga0070672_100007718 | |||
| 1689 | Ga0070672_100016975 | |||
| 1690 | Ga0070672_100102772 | |||
| 1691 | Ga0070686_100000265 | |||
| 1692 | Ga0070686_100049881 | |||
| 1693 | Ga0070686_100064529 | |||
| 1694 | Ga0070686_100302585 | |||
| 1695 | Ga0070686_100320429 | |||
| 1696 | Ga0070695_100010977 | |||
| 1697 | Ga0070695_100232474 | |||
| 1698 | Ga0070696_100000037 | |||
| 1699 | Ga0070696_100000395 | |||
| 1700 | Ga0070696_100009221 | |||
| 1701 | Ga0070696_100090356 | |||
| 1702 | Ga0070696_100255838 | |||
| 1703 | Ga0070696_100268856 | |||
| 1704 | Ga0070693_100009214 | |||
| 1705 | Ga0070693_100012997 | |||
| 1706 | Ga0070704_100019475 | |||
| 1707 | Ga0070704_100092483 | |||
| 1708 | Ga0068855_100004649 | |||
| 1709 | Ga0068855_100004857 | |||
| 1710 | Ga0068855_100010307 | |||
| 1711 | Ga0068855_100040261 | |||
| 1712 | Ga0068855_100052158 | |||
| 1713 | Ga0068855_100071465 | |||
| 1714 | Ga0068855_100126648 | |||
| 1715 | Ga0068855_100271508 | |||
| 1716 | Ga0068857_100050189 | |||
| 1717 | Ga0068857_100146465 | |||
| 1718 | Ga0068857_100197346 | |||
| 1719 | Ga0068854_100232915 | |||
| 1720 | Ga0068856_100014722 | |||
| 1721 | Ga0068856_100030042 | |||
| 1722 | Ga0068856_100062381 | |||
| 1723 | Ga0068856_100084723 | |||
| 1724 | Ga0068856_100091182 | |||
| 1725 | Ga0068856_100282997 | |||
| 1726 | Ga0070702_100000223 | |||
| 1727 | Ga0070702_100089046 | |||
| 1728 | Ga0068852_100028336 | |||
| 1729 | Ga0068852_100037752 | |||
| 1730 | Ga0068852_100090940 | |||
| 1731 | Ga0068852_100118933 | |||
| 1732 | Ga0068852_100403561 | |||
| 1733 | Ga0068859_100000813 | |||
| 1734 | Ga0068859_100003358 | |||
| 1735 | Ga0068859_100019167 | |||
| 1736 | Ga0068859_100022929 | |||
| 1737 | Ga0068859_100095785 | |||
| 1738 | Ga0068859_100141218 | |||
| 1739 | Ga0068859_100169103 | |||
| 1740 | Ga0068864_100002065 | |||
| 1741 | Ga0068864_100031868 | |||
| 1742 | Ga0068864_100066296 | |||
| 1743 | Ga0068864_100093008 | |||
| 1744 | Ga0068864_100094644 | |||
| 1745 | Ga0068866_10000107 | |||
| 1746 | Ga0068866_10003257 | |||
| 1747 | Ga0068866_10007229 | |||
| 1748 | Ga0068866_10085870 | |||
| 1749 | Ga0068861_100001908 | |||
| 1750 | Ga0068861_100003286 | |||
| 1751 | Ga0068861_100005730 | |||
| 1752 | Ga0068861_100016185 | |||
| 1753 | Ga0068851_10000590 | |||
| 1754 | Ga0068851_10006836 | |||
| 1755 | Ga0068851_10025366 | |||
| 1756 | Ga0068870_10005307 | |||
| 1757 | Ga0068863_100020937 | |||
| 1758 | Ga0068863_100031484 | |||
| 1759 | Ga0068863_100059870 | |||
| 1760 | Ga0068863_100126062 | |||
| 1761 | Ga0068863_100227676 | |||
| 1762 | Ga0068863_100263155 | |||
| 1763 | Ga0068858_100002059 | |||
| 1764 | Ga0068858_100002634 | |||
| 1765 | Ga0068858_100009260 | |||
| 1766 | Ga0068858_100015823 | |||
| 1767 | Ga0068858_100720873 | |||
| 1768 | Ga0068860_100000823 | |||
| 1769 | Ga0068860_100002377 | |||
| 1770 | Ga0068860_100010005 | |||
| 1771 | Ga0068860_100013908 | |||
| 1772 | Ga0068860_100077614 | |||
| 1773 | Ga0068862_100000524 | |||
| 1774 | Ga0068862_100004134 | |||
| 1775 | Ga0068862_100053550 | |||
| 1776 | Ga0068862_100069467 | |||
| 1777 | Ga0068862_100074012 | |||
| 1778 | Ga0068862_100617182 | |||
| 1779 | Ga0081539_10000770 | |||
| 1780 | Ga0075365_10006791 | |||
| 1781 | Ga0075365_10060700 | |||
| 1782 | Ga0075368_10000729 | |||
| 1783 | Ga0075363_100006078 | |||
| 1784 | Ga0075363_100013051 | |||
| 1785 | Ga0075363_100017008 | |||
| 1786 | Ga0075363_100021733 | |||
| 1787 | Ga0075363_100023200 | |||
| 1788 | Ga0075432_10036342 | |||
| 1789 | Ga0070715_10052184 | |||
| 1790 | Ga0070715_10075341 | |||
| 1791 | Ga0075362_10006328 | |||
| 1792 | Ga0075362_10009223 | |||
| 1793 | Ga0075362_10140226 | |||
| 1794 | Ga0075369_10006559 | |||
| 1795 | Ga0075369_10065462 | |||
| 1796 | Ga0075366_10001345 | |||
| 1797 | Ga0075366_10003111 | |||
| 1798 | Ga0075366_10004891 | |||
| 1799 | Ga0075366_10005480 | |||
| 1800 | Ga0075366_10007403 | |||
| 1801 | Ga0075366_10070270 | |||
| 1802 | Ga0075366_10081257 | |||
| 1803 | Ga0075366_10082938 | |||
| 1804 | Ga0075366_10085706 | |||
| 1805 | Ga0075366_10119078 | |||
| 1806 | Ga0075366_10256797 | |||
| 1807 | Ga0097621_100001105 | |||
| 1808 | Ga0097621_100004475 | |||
| 1809 | Ga0097621_100004893 | |||
| 1810 | Ga0097621_100011516 | |||
| 1811 | Ga0097621_100015018 | |||
| 1812 | Ga0097621_100028244 | |||
| 1813 | Ga0097621_100041619 | |||
| 1814 | Ga0097621_100093501 | |||
| 1815 | Ga0097621_100271698 | |||
| 1816 | Ga0075370_10001747 | |||
| 1817 | Ga0075370_10002909 | |||
| 1818 | Ga0075370_10008912 | |||
| 1819 | Ga0075370_10018941 | |||
| 1820 | Ga0075370_10029361 | |||
| 1821 | Ga0075370_10035374 | |||
| 1822 | Ga0068871_100001255 | |||
| 1823 | Ga0068871_100005726 | |||
| 1824 | Ga0068871_100005895 | |||
| 1825 | Ga0068871_100007755 | |||
| 1826 | Ga0068871_100041620 | |||
| 1827 | Ga0068871_100102463 | |||
| 1828 | Ga0068871_100148527 | |||
| 1829 | Ga0075428_100046009 | |||
| 1830 | Ga0075428_100156306 | |||
| 1831 | Ga0075428_100161138 | |||
| 1832 | Ga0075430_100004390 | |||
| 1833 | Ga0075430_100023926 | |||
| 1834 | Ga0075430_100125945 | |||
| 1835 | Ga0075430_100232229 | |||
| 1836 | Ga0075430_100294579 | |||
| 1837 | Ga0075431_100055531 | |||
| 1838 | Ga0075431_100130231 | |||
| 1839 | Ga0075431_100216257 | |||
| 1840 | Ga0075431_100370035 | |||
| 1841 | Ga0075433_10015306 | |||
| 1842 | Ga0075433_10025822 | |||
| 1843 | Ga0075433_10161312 | |||
| 1844 | Ga0075433_10282682 | |||
| 1845 | Ga0075434_100000169 | |||
| 1846 | Ga0075434_100002533 | |||
| 1847 | Ga0075434_100044170 | |||
| 1848 | Ga0075434_100420951 | |||
| 1849 | Ga0075429_100000043 | |||
| 1850 | Ga0075429_100000297 | |||
| 1851 | Ga0075429_100031540 | |||
| 1852 | Ga0068865_100000281 | |||
| 1853 | Ga0068865_100000467 | |||
| 1854 | Ga0068865_100022066 | |||
| 1855 | Ga0068865_100047195 | |||
| 1856 | Ga0068865_100369920 | |||
| 1857 | Ga0075436_100000735 | |||
| 1858 | Ga0075436_100000989 | |||
| 1859 | Ga0075436_100002087 | |||
| 1860 | Ga0075436_100037921 | |||
| 1861 | Ga0097620_100000813 | |||
| 1862 | Ga0097620_100003358 | |||
| 1863 | Ga0097620_100019167 | |||
| 1864 | Ga0097620_100022929 | |||
| 1865 | Ga0097620_100095785 | |||
| 1866 | Ga0097620_100141215 | |||
| 1867 | Ga0097620_100154088 | |||
| 1868 | Ga0097620_100169112 | |||
| 1869 | Ga0079104_1000055 | |||
| 1870 | Ga0079104_1024414 | |||
| 1871 | Ga0099826_10000006 | |||
| 1872 | Ga0099826_10001433 | |||
| 1873 | Ga0099826_10047540 | |||
| 1874 | Ga0075435_100000193 | |||
| 1875 | Ga0075435_100003462 | |||
| 1876 | Ga0075435_100067670 | |||
| 1877 | Ga0075435_100158163 | |||
| 1878 | Ga0075435_100273683 | |||
| 1879 | Ga0075435_100327130 | |||
| 1880 | Ga0099794_10009590 | |||
| 1881 | Ga0099794_10040107 | |||
| 1882 | Ga0099794_10151403 | |||
| 1883 | Ga0099795_10004388 | |||
| 1884 | Ga0099795_10047104 | |||
| 1885 | Ga0105244_10011385 | |||
| 1886 | Ga0105250_10005158 | |||
| 1887 | Ga0105250_10098696 | |||
| 1888 | Ga0105240_10025383 | |||
| 1889 | Ga0105240_10083354 | |||
| 1890 | Ga0105240_10168408 | |||
| 1891 | Ga0105240_10196995 | |||
| 1892 | Ga0105240_10221311 | |||
| 1893 | Ga0111539_10157611 | |||
| 1894 | Ga0111539_10169618 | |||
| 1895 | Ga0105245_10000511 | |||
| 1896 | Ga0105245_10002551 | |||
| 1897 | Ga0105245_10037219 | |||
| 1898 | Ga0105245_10299143 | |||
| 1899 | Ga0105245_10307068 | |||
| 1900 | Ga0105245_10453394 | |||
| 1901 | Ga0105247_10375689 | |||
| 1902 | Ga0114129_10012381 | |||
| 1903 | Ga0105243_10000784 | |||
| 1904 | Ga0105243_10001212 | |||
| 1905 | Ga0105243_10002490 | |||
| 1906 | Ga0105243_10006331 | |||
| 1907 | Ga0105243_10011373 | |||
| 1908 | Ga0105243_10012444 | |||
| 1909 | Ga0105243_10012837 | |||
| 1910 | Ga0105243_10075673 | |||
| 1911 | Ga0105243_10091340 | |||
| 1912 | Ga0105243_10258984 | |||
| 1913 | Ga0105241_10261988 | |||
| 1914 | Ga0105241_10454797 | |||
| 1915 | Ga0105242_10002499 | |||
| 1916 | Ga0105242_10002648 | |||
| 1917 | Ga0105242_10025474 | |||
| 1918 | Ga0105242_10304536 | |||
| 1919 | Ga0105242_10619299 | |||
| 1920 | Ga0105248_10000507 | |||
| 1921 | Ga0105248_10005804 | |||
| 1922 | Ga0105248_10074832 | |||
| 1923 | Ga0105248_10220347 | |||
| 1924 | Ga0105237_10098355 | |||
| 1925 | Ga0105237_10328713 | |||
| 1926 | Ga0105237_10757584 | |||
| 1927 | Ga0105238_10062981 | |||
| 1928 | Ga0105238_10130674 | |||
| 1929 | Ga0105249_10014809 | |||
| 1930 | Ga0105249_10031885 | |||
| 1931 | Ga0105249_10051098 | |||
| 1932 | Ga0105249_10395340 | |||
| 1933 | Ga0105239_10136528 | |||
| 1934 | Ga0105239_10238061 | |||
| 1935 | Ga0105246_10307291 | |||
| 1936 | Ga0157370_10004427 | |||
| 1937 | Ga0157370_10009369 | |||
| 1938 | Ga0157370_10075515 | |||
| 1939 | Ga0157370_10225610 | |||
| 1940 | Ga0157370_10242427 | |||
| 1941 | Ga0157369_10003852 | |||
| 1942 | Ga0157369_10366954 | |||
| 1943 | Ga0157369_10540983 | |||
| 1944 | Ga0157374_10101114 | |||
| 1945 | Ga0157378_10000797 | |||
| 1946 | Ga0157378_10001703 | |||
| 1947 | Ga0157378_10003052 | |||
| 1948 | Ga0157378_10123159 | |||
| 1949 | Ga0163162_10002252 | |||
| 1950 | Ga0163162_10015531 | |||
| 1951 | Ga0163162_10084437 | |||
| 1952 | Ga0163162_10132115 | |||
| 1953 | Ga0163162_10176828 | |||
| 1954 | Ga0163162_10277668 | |||
| 1955 | Ga0157372_10037717 | |||
| 1956 | Ga0157372_10222146 | |||
| 1957 | Ga0157372_10836713 | |||
| 1958 | Ga0157375_10025703 | |||
| 1959 | Ga0157375_10026436 | |||
| 1960 | Ga0157375_10048298 | |||
| 1961 | Ga0157375_10049801 | |||
| 1962 | Ga0157375_10097080 | |||
| 1963 | Ga0157375_10152670 | |||
| 1964 | Ga0157375_10161194 | |||
| 1965 | Ga0157375_10311946 | |||
| 1966 | Ga0157375_10425325 | |||
| 1967 | Ga0163163_10009458 | |||
| 1968 | Ga0163163_10180537 | |||
| 1969 | Ga0163163_10318039 | |||
| 1970 | Ga0157380_10010570 | |||
| 1971 | Ga0157380_10014505 | |||
| 1972 | Ga0157380_10022401 | |||
| 1973 | Ga0157380_10049076 | |||
| 1974 | Ga0182008_10003127 | |||
| 1975 | Ga0182008_10004233 | |||
| 1976 | Ga0182008_10017487 | |||
| 1977 | Ga0182008_10028571 | |||
| 1978 | Ga0182008_10060779 | |||
| 1979 | Ga0157377_10041231 | |||
| 1980 | Ga0157377_10254452 | |||
| 1981 | Ga0157377_10283613 | |||
| 1982 | Ga0157377_10350801 | |||
| 1983 | Ga0157379_10021513 | |||
| 1984 | Ga0157379_10070089 | |||
| 1985 | Ga0157379_10136617 | |||
| 1986 | Ga0157376_10004974 | |||
| 1987 | Ga0157376_10007718 | |||
| 1988 | Ga0182006_1000030 | |||
| 1989 | Ga0182006_1001066 | |||
| 1990 | Ga0182006_1008458 | |||
| 1991 | Ga0182007_10002485 | |||
| 1992 | Ga0182007_10021578 | |||
| 1993 | Ga0182005_1036334 | |||
| 1994 | Ga0183362_10003 | |||
| 1995 | Ga0163161_10000099 | |||
| 1996 | Ga0163161_10011306 | |||
| 1997 | Ga0163161_10020762 | |||
| 1998 | Ga0163161_10028787 | |||
| 1999 | Ga0163161_10067857 | |||
| 2000 | Ga0163161_10183408 | |||
| 2001 | Ga0163161_10334952 | |||
| 2002 | Ga0213872_10000169 | |||
| 2003 | Ga0213872_10000382 | |||
| 2004 | Ga0213872_10003263 | |||
| 2005 | Ga0213874_10021161 | |||
| 2006 | Ga0213876_10030362 | |||
| 2007 | Ga0209435_100002 | |||
| 2008 | Ga0209672_100660 | |||
| 2009 | Ga0209147_101111 | |||
| 2010 | Ga0209258_100240 | |||
| 2011 | Ga0209646_1000001 | |||
| 2012 | Ga0209026_1000001 | |||
| 2013 | Ga0209148_1000033 | |||
| 2014 | Ga0209759_1000001 | |||
| 2015 | Ga0209129_1000054 | |||
| 2016 | Ga0209565_1000224 | |||
| 2017 | Ga0209565_1001443 | |||
| 2018 | Ga0209673_1000097 | |||
| 2019 | Ga0209673_1000172 | |||
| 2020 | Ga0209673_1002773 | |||
| 2021 | Ga0209673_1026389 | |||
| 2022 | Ga0209673_1027409 | |||
| 2023 | Ga0209130_1000832 | |||
| 2024 | Ga0209130_1001095 | |||
| 2025 | Ga0209130_1001276 | |||
| 2026 | Ga0209675_1000038 | |||
| 2027 | Ga0209675_1000431 | |||
| 2028 | Ga0209676_1000048 | |||
| 2029 | Ga0209676_1000739 | |||
| 2030 | Ga0209676_1000836 | |||
| 2031 | Ga0209676_1005062 | |||
| 2032 | Ga0209676_1016772 | |||
| 2033 | Ga0209025_1000174 | |||
| 2034 | Ga0209025_1000906 | |||
| 2035 | Ga0209025_1001066 | |||
| 2036 | Ga0209025_1034199 | |||
| 2037 | Ga0209025_1057319 | |||
| 2038 | Ga0209758_1000034 | |||
| 2039 | Ga0209758_1009180 | |||
| 2040 | Ga0209050_1000012 | |||
| 2041 | Ga0209050_1001075 | |||
| 2042 | Ga0209050_1005184 | |||
| 2043 | Ga0209256_1000035 | |||
| 2044 | Ga0209256_1000103 | |||
| 2045 | Ga0209256_1000165 | |||
| 2046 | Ga0207426_1000058 | |||
| 2047 | Ga0207426_1000067 | |||
| 2048 | Ga0209051_1000019 | |||
| 2049 | Ga0209051_1000099 | |||
| 2050 | Ga0209051_1000221 | |||
| 2051 | Ga0209051_1000315 | |||
| 2052 | Ga0209051_1000452 | |||
| 2053 | Ga0209051_1001491 | |||
| 2054 | Ga0209051_1009063 | |||
| 2055 | Ga0209257_1000024 | |||
| 2056 | Ga0209257_1000047 | |||
| 2057 | Ga0209257_1000057 | |||
| 2058 | Ga0209257_1000309 | |||
| 2059 | Ga0209257_1006026 | |||
| 2060 | Ga0209257_1006654 | |||
| 2061 | Ga0209257_1019426 | |||
| 2062 | Ga0207697_10012918 | |||
| 2063 | Ga0207656_10002493 | |||
| 2064 | Ga0207656_10023459 | |||
| 2065 | Ga0207656_10028846 | |||
| 2066 | Ga0207696_1002665 | |||
| 2067 | Ga0207655_1000639 | |||
| 2068 | Ga0207642_10000059 | |||
| 2069 | Ga0207642_10001537 | |||
| 2070 | Ga0207642_10018424 | |||
| 2071 | Ga0207642_10108463 | |||
| 2072 | Ga0207642_10109080 | |||
| 2073 | Ga0207688_10074185 | |||
| 2074 | Ga0207688_10210137 | |||
| 2075 | Ga0207680_10002140 | |||
| 2076 | Ga0207680_10056159 | |||
| 2077 | Ga0207685_10083974 | |||
| 2078 | Ga0207645_10037643 | |||
| 2079 | Ga0207645_10056575 | |||
| 2080 | Ga0207643_10072392 | |||
| 2081 | Ga0207705_10027726 | |||
| 2082 | Ga0207705_10279860 | |||
| 2083 | Ga0207654_10049621 | |||
| 2084 | Ga0207654_10199505 | |||
| 2085 | Ga0207654_10332635 | |||
| 2086 | Ga0207707_10010652 | |||
| 2087 | Ga0207707_10037440 | |||
| 2088 | Ga0207707_10128622 | |||
| 2089 | Ga0207707_10340259 | |||
| 2090 | Ga0207695_10071845 | |||
| 2091 | Ga0207695_10129241 | |||
| 2092 | Ga0207660_10005092 | |||
| 2093 | Ga0207660_10035234 | |||
| 2094 | Ga0207660_10071742 | |||
| 2095 | Ga0207660_10294245 | |||
| 2096 | Ga0207662_10000258 | |||
| 2097 | Ga0207662_10032494 | |||
| 2098 | Ga0207662_10081302 | |||
| 2099 | Ga0207657_10025234 | |||
| 2100 | Ga0207649_10003399 | |||
| 2101 | Ga0207652_10030048 | |||
| 2102 | Ga0207652_10046373 | |||
| 2103 | Ga0207652_10403426 | |||
| 2104 | Ga0207652_10606648 | |||
| 2105 | Ga0207646_10134671 | |||
| 2106 | Ga0207646_10166669 | |||
| 2107 | Ga0207646_10355344 | |||
| 2108 | Ga0207646_10474246 | |||
| 2109 | Ga0207681_10000424 | |||
| 2110 | Ga0207681_10019120 | |||
| 2111 | Ga0207681_10041269 | |||
| 2112 | Ga0207694_10083398 | |||
| 2113 | Ga0207650_10006179 | |||
| 2114 | Ga0207650_10284363 | |||
| 2115 | Ga0207659_10020943 | |||
| 2116 | Ga0207659_10042740 | |||
| 2117 | Ga0207659_10114883 | |||
| 2118 | Ga0207687_10000254 | |||
| 2119 | Ga0207687_10002550 | |||
| 2120 | Ga0207687_10083007 | |||
| 2121 | Ga0207687_10101678 | |||
| 2122 | Ga0207644_10000264 | |||
| 2123 | Ga0207644_10002654 | |||
| 2124 | Ga0207644_10014945 | |||
| 2125 | Ga0207644_10523931 | |||
| 2126 | Ga0207690_10110969 | |||
| 2127 | Ga0207706_10013512 | |||
| 2128 | Ga0207706_10031863 | |||
| 2129 | Ga0207706_10082110 | |||
| 2130 | Ga0207706_10332277 | |||
| 2131 | Ga0207686_10000084 | |||
| 2132 | Ga0207686_10023994 | |||
| 2133 | Ga0207686_10052906 | |||
| 2134 | Ga0207686_10192202 | |||
| 2135 | Ga0207709_10000111 | |||
| 2136 | Ga0207709_10000608 | |||
| 2137 | Ga0207709_10001030 | |||
| 2138 | Ga0207709_10001599 | |||
| 2139 | Ga0207709_10002253 | |||
| 2140 | Ga0207709_10003776 | |||
| 2141 | Ga0207709_10009256 | |||
| 2142 | Ga0207709_10018818 | |||
| 2143 | Ga0207709_10019289 | |||
| 2144 | Ga0207709_10036017 | |||
| 2145 | Ga0207709_10234187 | |||
| 2146 | Ga0207670_10007649 | |||
| 2147 | Ga0207670_10021569 | |||
| 2148 | Ga0207670_10041074 | |||
| 2149 | Ga0207669_10020526 | |||
| 2150 | Ga0207669_10042801 | |||
| 2151 | Ga0207704_10000722 | |||
| 2152 | Ga0207704_10001711 | |||
| 2153 | Ga0207704_10003689 | |||
| 2154 | Ga0207704_10010623 | |||
| 2155 | Ga0207704_10046802 | |||
| 2156 | Ga0207704_10068335 | |||
| 2157 | Ga0207691_10018804 | |||
| 2158 | Ga0207691_10066785 | |||
| 2159 | Ga0207691_10073889 | |||
| 2160 | Ga0207691_10092293 | |||
| 2161 | Ga0207691_10107652 | |||
| 2162 | Ga0207691_10276318 | |||
| 2163 | Ga0207711_10003550 | |||
| 2164 | Ga0207711_10010810 | |||
| 2165 | Ga0207711_10048589 | |||
| 2166 | Ga0207689_10000872 | |||
| 2167 | Ga0207689_10003506 | |||
| 2168 | Ga0207689_10051064 | |||
| 2169 | Ga0207689_10135887 | |||
| 2170 | Ga0207689_10159270 | |||
| 2171 | Ga0207689_10374332 | |||
| 2172 | Ga0207661_10037982 | |||
| 2173 | Ga0207679_10201745 | |||
| 2174 | Ga0207679_10211630 | |||
| 2175 | Ga0207667_10013717 | |||
| 2176 | Ga0207667_10018933 | |||
| 2177 | Ga0207667_10032117 | |||
| 2178 | Ga0207667_10127841 | |||
| 2179 | Ga0207667_10206964 | |||
| 2180 | Ga0207667_10368586 | |||
| 2181 | Ga0207667_10664660 | |||
| 2182 | Ga0207651_10004672 | |||
| 2183 | Ga0207651_10036834 | |||
| 2184 | Ga0207651_10165825 | |||
| 2185 | Ga0207651_10389188 | |||
| 2186 | Ga0207712_10009623 | |||
| 2187 | Ga0207712_10014447 | |||
| 2188 | Ga0207668_10002951 | |||
| 2189 | Ga0207668_10084418 | |||
| 2190 | Ga0207658_10002509 | |||
| 2191 | Ga0207658_10010175 | |||
| 2192 | Ga0207658_10176662 | |||
| 2193 | Ga0207677_10001522 | |||
| 2194 | Ga0207677_10010555 | |||
| 2195 | Ga0207677_10047763 | |||
| 2196 | Ga0207677_10181062 | |||
| 2197 | Ga0207677_10197871 | |||
| 2198 | Ga0207677_10390810 | |||
| 2199 | Ga0207703_10001789 | |||
| 2200 | Ga0207703_10001816 | |||
| 2201 | Ga0207703_10006009 | |||
| 2202 | Ga0207703_10016897 | |||
| 2203 | Ga0207639_10009069 | |||
| 2204 | Ga0207639_10165449 | |||
| 2205 | Ga0207678_10312806 | |||
| 2206 | Ga0207708_10000049 | |||
| 2207 | Ga0207708_10003647 | |||
| 2208 | Ga0207708_10004718 | |||
| 2209 | Ga0207708_10078562 | |||
| 2210 | Ga0207702_10012590 | |||
| 2211 | Ga0207702_10020851 | |||
| 2212 | Ga0207702_10146847 | |||
| 2213 | Ga0207702_10314205 | |||
| 2214 | Ga0207702_10449591 | |||
| 2215 | Ga0207702_10482142 | |||
| 2216 | Ga0207641_10001603 | |||
| 2217 | Ga0207641_10003329 | |||
| 2218 | Ga0207641_10263333 | |||
| 2219 | Ga0207641_10296484 | |||
| 2220 | Ga0207641_10389054 | |||
| 2221 | Ga0207648_10000018 | |||
| 2222 | Ga0207648_10000161 | |||
| 2223 | Ga0207648_10000179 | |||
| 2224 | Ga0207648_10000685 | |||
| 2225 | Ga0207648_10008674 | |||
| 2226 | Ga0207648_10023777 | |||
| 2227 | Ga0207648_10101337 | |||
| 2228 | Ga0207648_10293534 | |||
| 2229 | Ga0207648_10303785 | |||
| 2230 | Ga0207648_10327087 | |||
| 2231 | Ga0207676_10003295 | |||
| 2232 | Ga0207676_10018334 | |||
| 2233 | Ga0207676_10049237 | |||
| 2234 | Ga0207676_10157716 | |||
| 2235 | Ga0207676_10426060 | |||
| 2236 | Ga0207674_10071765 | |||
| 2237 | Ga0207674_10071832 | |||
| 2238 | Ga0207674_10077512 | |||
| 2239 | Ga0207674_10088100 | |||
| 2240 | Ga0207674_10203789 | |||
| 2241 | Ga0207675_100000050 | |||
| 2242 | Ga0207675_100000176 | |||
| 2243 | Ga0207675_100005391 | |||
| 2244 | Ga0207675_100007479 | |||
| 2245 | Ga0207675_100008096 | |||
| 2246 | Ga0207683_10008432 | |||
| 2247 | Ga0207683_10049731 | |||
| 2248 | Ga0207683_10051569 | |||
| 2249 | Ga0207683_10250689 | |||
| 2250 | Ga0207683_10656968 | |||
| 2251 | Ga0207698_10012988 | |||
| 2252 | Ga0207698_10111682 | |||
| 2253 | Ga0207698_10116511 | |||
| 2254 | Ga0207698_10178809 | |||
| 2255 | Ga0207698_10231513 | |||
| 2256 | Ga0209281_1000007 | |||
| 2257 | Ga0209281_1017401 | |||
| 2258 | Ga0209967_1005313 | |||
| 2259 | Ga0209981_1003553 | |||
| 2260 | Ga0209996_1004923 | |||
| 2261 | Ga0210000_1001544 | |||
| 2262 | Ga0209995_1000178 | |||
| 2263 | Ga0209999_1002769 | |||
| 2264 | Ga0209282_1000003 | |||
| 2265 | Ga0209282_1000182 | |||
| 2266 | Ga0209588_1027037 | |||
| 2267 | Ga0209971_1016133 | |||
| 2268 | Ga0209974_10048164 | |||
| 2269 | Ga0209974_10071541 | |||
| 2270 | Ga0207428_10001240 | |||
| 2271 | Ga0207428_10052635 | |||
| 2272 | Ga0207428_10082070 | |||
| 2273 | Ga0268266_10259695 | |||
| 2274 | Ga0268265_10002096 | |||
| 2275 | Ga0268265_10013533 | |||
| 2276 | Ga0268265_10019192 | |||
| 2277 | Ga0268265_10040349 | |||
| 2278 | Ga0268265_10044723 | |||
| 2279 | Ga0268265_10386736 | |||
| 2280 | Ga0268265_10520437 | |||
| 2281 | Ga0268264_10000613 | |||
| 2282 | Ga0268264_10000848 | |||
| 2283 | Ga0268264_10001082 | |||
| 2284 | Ga0268264_10024923 | |||
| 2285 | Ga0268264_10054537 | |||
| 2286 | Ga0268264_10141041 | |||
| 2287 | Ga0265336_10000497 | |||
| 2288 | Ga0307515_10000609 | |||
| 2289 | Ga0307515_10001484 | |||
| 2290 | Ga0307515_10001693 | |||
| 2291 | Ga0307515_10004716 | |||
| 2292 | Ga0307515_10042972 | |||
| 2293 | Ga0307515_10074111 | |||
| 2294 | Ga0265324_10000004 | |||
| 2295 | Ga0265324_10001492 | |||
| 2296 | Ga0307511_10000804 | |||
| 2297 | Ga0316176_1084534 | |||
| 2298 | Ga0316183_1074932 | |||
| 2299 | Ga0316181_1111110 | |||
| 2300 | Ga0316182_1108560 | |||
| 2301 | Ga0265330_10000091 | |||
| 2302 | Ga0265332_10000028 | |||
| 2303 | Ga0265332_10032991 | |||
| 2304 | Ga0265325_10000133 | |||
| 2305 | Ga0265325_10002488 | |||
| 2306 | Ga0265325_10059895 | |||
| 2307 | Ga0265340_10036187 | |||
| 2308 | Ga0265327_10000174 | |||
| 2309 | Ga0265327_10000542 | |||
| 2310 | Ga0265327_10001654 | |||
| 2311 | Ga0265327_10042455 | |||
| 2312 | Ga0265327_10065441 | |||
| 2313 | Ga0265316_10182814 | |||
| 2314 | Ga0265316_10362789 | |||
| 2315 | Ga0307513_10000008 | |||
| 2316 | Ga0307513_10000038 | |||
| 2317 | Ga0307513_10004316 | |||
| 2318 | Ga0307513_10114170 | |||
| 2319 | Ga0307513_10213744 | |||
| 2320 | Ga0307509_10025753 | |||
| 2321 | Ga0307509_10333040 | |||
| 2322 | Ga0307408_100000109 | |||
| 2323 | Ga0307408_100000886 | |||
| 2324 | Ga0307408_100010362 | |||
| 2325 | Ga0307408_100107069 | |||
| 2326 | Ga0307408_100112145 | |||
| 2327 | Ga0307408_100113799 | |||
| 2328 | Ga0307408_100233308 | |||
| 2329 | Ga0307408_100291225 | |||
| 2330 | Ga0307508_10174014 | |||
| 2331 | Ga0307514_10010740 | |||
| 2332 | Ga0316575_10022997 | |||
| 2333 | Ga0316575_10051595 | |||
| 2334 | Ga0316579_10000450 | |||
| 2335 | Ga0316579_10018729 | |||
| 2336 | Ga0265314_10000054 | |||
| 2337 | Ga0265314_10000262 | |||
| 2338 | Ga0265314_10004112 | |||
| 2339 | Ga0265314_10015575 | |||
| 2340 | Ga0265314_10015650 | |||
| 2341 | Ga0316576_10066739 | |||
| 2342 | Ga0316578_10009084 | |||
| 2343 | Ga0316578_10054604 | |||
| 2344 | Ga0307516_10000359 | |||
| 2345 | Ga0307516_10001691 | |||
| 2346 | Ga0307405_10006962 | |||
| 2347 | Ga0307405_10118807 | |||
| 2348 | Ga0307405_10154672 | |||
| 2349 | Ga0307405_10160760 | |||
| 2350 | Ga0307405_10174122 | |||
| 2351 | Ga0307405_10192997 | |||
| 2352 | Ga0307410_10121002 | |||
| 2353 | Ga0307406_10000741 | |||
| 2354 | Ga0307406_10028543 | |||
| 2355 | Ga0307406_10125721 | |||
| 2356 | Ga0307406_10149504 | |||
| 2357 | Ga0307407_10130137 | |||
| 2358 | Ga0307407_10151211 | |||
| 2359 | Ga0307412_10029307 | |||
| 2360 | Ga0307412_10037074 | |||
| 2361 | Ga0307412_10048688 | |||
| 2362 | Ga0307412_10212466 | |||
| 2363 | Ga0307412_10255692 | |||
| 2364 | Ga0307412_10271858 | |||
| 2365 | Ga0307409_100000580 | |||
| 2366 | Ga0307409_100063181 | |||
| 2367 | Ga0307409_100066611 | |||
| 2368 | Ga0307409_100122330 | |||
| 2369 | Ga0307409_100242530 | |||
| 2370 | Ga0307409_100287526 | |||
| 2371 | Ga0307416_100014097 | |||
| 2372 | Ga0307416_100121709 | |||
| 2373 | Ga0307416_100292285 | |||
| 2374 | Ga0307416_100396256 | |||
| 2375 | Ga0307414_10303056 | |||
| 2376 | Ga0307411_10080249 | |||
| 2377 | Ga0307411_10304015 | |||
| 2378 | Ga0307411_10438975 | |||
| 2379 | Ga0307415_100002051 | |||
| 2380 | Ga0307415_100511094 | |||
| 2381 | Ga0316583_10000954 | |||
| 2382 | Ga0316583_10006979 | |||
| 2383 | Ga0316580_10017904 | |||
| 2384 | Ga0316593_10027629 | |||
| 2385 | Ga0316593_10125973 | |||
| 2386 | Ga0316588_1002525 | |||
| 2387 | Ga0316596_1005014 | |||
| 2388 | Ga0373930_0001564 | |||
| 2389 | Ga0373938_0020813 | |||
| 2390 | Ga0373926_0007968 | |||
| 2391 | Ga0373928_0004091 | |||
| 2392 | Ga0373929_0004917 | |||
| 2393 | Ga0373934_0000218 | |||
| 2394 | Ga0373934_0000946 | |||
| 2395 | Ga0373951_0017250 | |||
| 2396 | Ga0373952_0000062 | |||
| 2397 | Ga0373952_0012100 | |||
| 2398 | Ga0373923_0000103 | |||
| 2399 | Ga0373932_0002566 | |||
| 2400 | Ga0373939_0000040 | |||
| 2401 | Ga0373939_0004488 | |||
| 2402 | Ga0373941_0009749 | |||
| 2403 | Ga0373941_0128072 | |||
| 2404 | Ga0373945_0025798 | |||
| 2405 | Ga0373953_0003648 | |||
| 2406 | Ga0373954_0000153 | |||
| 2407 | Ga0373954_0000939 | |||
| 2408 | Ga0373956_0000081 | |||
| 2409 | Ga0373956_0003816 | |||
| 2410 | Ga0373956_0012068 | |||
| 2411 | Ga0373957_0000956 | |||
| 2412 | Ga0373960_0000506 | |||
| 2413 | Ga0373943_0030168 | |||
| 2414 | Ga0373943_0055619 | |||
| 2415 | Ga0373943_0261689 | |||
| 2416 | Ga0373946_0010614 | |||
| 2417 | Ga0373946_0096443 | |||
| 2418 | Ga0373955_0124248 | |||
| 2419 | Ga0373942_0010433 | |||
| 2420 | Ga0373961_0001887 | |||
| 2421 | Ga0373962_0019950 | |||
| 2422 | Ga0316574_0003380 | |||
| 2423 | Ga0316574_0088297 | |||
| 2424 | Ga0373924_0000180 | |||
| 2425 | Ga0373931_0000371 | |||
| 2426 | Ga0373931_0002521 | |||
| 2427 | Ga0373931_0075642 | |||
| 2428 | Ga0373931_0085929 | |||
| 2429 | Ga0373935_0001120 | |||
| 2430 | Ga0373935_0002681 | |||
| 2431 | Ga0373935_0410427 | |||
| 2432 | Ga0373927_0006838 | |||
| 2433 | Ga0373927_0013540 | |||
| 2434 | Ga0373927_0047872 | |||
| 2435 | Ga0373933_0000426 | |||
| 2436 | Ga0373933_0003869 | |||
| 2437 | Ga0373933_0081369 | |||
| 2438 | Ga0373933_0085508 | |||
| 2439 | Ga0373933_0275239 | |||
| 2440 | Ga0373947_0025269 | |||
| 2441 | Ga0373937_0000149 | |||
| 2442 | Ga0373937_0000668 | |||
| 2443 | Ga0373937_0005081 | |||
| 2444 | Ga0373937_0034638 | |||
| 2445 | Ga0373937_0198986 | |||
| 2446 | Ga0373937_0613577 | |||
| 2447 | Ga0316582_0003457 | |||
| 2448 | Ga0316584_0096297 | |||
| 2449 | Ga0373925_0002526 | |||
| 2450 | Ga0373925_0040580 | |||
| 2451 | Ga0373925_0062435 | |||
| 2452 | Ga0395899_0007150 | |||
| 2453 | Ga0395900_0000050 | |||
| 2454 | Ga0395900_0006372 | |||
| 2455 | Ga0395900_0283799 | |||
| 2456 | Ga0395898_0001856 | |||
| 2457 | Ga0395898_0002933 | |||
| 2458 | Ga0395898_0041859 | |||
| 2459 | Ga0395898_0111300 | |||
| 2460 | Ga0395905_0000088 | |||
| 2461 | Ga0395905_0002271 | |||
| 2462 | Ga0395905_0003887 | |||
| 2463 | Ga0395905_0013719 | |||
| 2464 | Ga0395905_0028345 | |||
| 2465 | Ga0395905_0031917 | |||
| 2466 | Ga0395905_0137590 | |||
| 2467 | Ga0395905_0188686 | |||
| 2468 | Ga0395905_0194580 | |||
| 2469 | Ga0395905_0450176 | |||
| 2470 | Ga0316581_0009983 | |||
| 2471 | Ga0395901_0089615 | |||
| 2472 | Ga0395901_0103602 | |||
| 2473 | Ga0395901_0104112 | |||
| 2474 | Ga0395901_0121973 | |||
| 2475 | Ga0395901_0157864 | |||
| 2476 | Ga0395901_0169257 | |||
| 2477 | Ga0395901_0171643 | |||
| 2478 | Ga0436365_1640203 | |||
| 2479 | Ga0436365_1756237 | |||
| 2480 | Ga0436361_0005759 | |||
| 2481 | Ga0436361_0159126 | |||
| 2482 | Ga0436361_0240153 | |||
| 2483 | Ga0436361_0287659 | |||
| 2484 | Ga0436361_0566522 | |||
| 2485 | Ga0436363_0976259 | |||
| 2486 | Ga0439436_0020264 | |||
| 2487 | Ga0439465_0005691 | |||
| 2488 | Ga0451807_2212897 | |||
| 2489 | Ga0451807_2362621 | |||
| 2490 | Ga0451853_0962706 | |||
| 2491 | Ga0439433_0000594 | |||
| 2492 | Ga0439437_000513 | |||
| 2493 | Ga0439441_000066 | |||
| 2494 | Ga0439442_023155 | |||
| 2495 | Ga0439443_000974 | |||
| 2496 | Ga0439443_011855 | |||
| 2497 | Ga0439445_0006018 | |||
| 2498 | Ga0439432_012324 | |||
| 2499 | Ga0439432_033137 | |||
| 2500 | Ga0439449_0003256 | |||
| 2501 | Ga0439449_0005226 | |||
| 2502 | Ga0439449_0007955 | |||
| 2503 | Ga0439449_0061218 | |||
| 2504 | Ga0439451_029916 | |||
| 2505 | Ga0439452_030875 | |||
| 2506 | Ga0439454_006088 | |||
| 2507 | Ga0439457_019160 | |||
| 2508 | Ga0439462_0000723 | |||
| 2509 | Ga0439462_0007330 | |||
| 2510 | Ga0439462_0042990 | |||
| 2511 | Ga0450917_001392 | |||
| 2512 | Ga0450923_010632 | |||
| 2513 | Ga0450890_000746 | |||
| 2514 | Ga0450891_005185 | |||
| 2515 | Ga0450892_000203 | |||
| 2516 | Ga0450896_005203 | |||
| 2517 | Ga0450898_004891 | |||
| 2518 | Ga0450906_000190 | |||
| 2519 | Ga0439446_0000148 | |||
| 2520 | Ga0439446_0041173 | |||
| 2521 | Ga0450909_002564 | |||
| 2522 | Ga0439434_0000121 | |||
| 2523 | Ga0439434_0002740 | |||
| 2524 | Ga0439435_0000031 | |||
| 2525 | Ga0439435_0000893 | |||
| 2526 | Ga0439435_0001361 | |||
| 2527 | Ga0439435_0011295 | |||
| 2528 | Ga0439444_0000800 | |||
| 2529 | Ga0439459_0051105 | |||
| 2530 | Ga0439460_0000173 | |||
| 2531 | Ga0439460_0002287 | |||
| 2532 | Ga0450918_004718 | |||
| 2533 | Ga0450893_0008662 | |||
| 2534 | Ga0451577_0000085 | |||
| 2535 | Ga0451577_0002155 | |||
| 2536 | Ga0451577_0004221 | |||
| 2537 | Ga0451577_0014375 | |||
| 2538 | Ga0451577_0081052 | |||
| 2539 | Ga0451577_0307045 | |||
| 2540 | Ga0451577_0589555 | |||
| 2541 | Ga0451577_0605264 | |||
| 2542 | Ga0466969_0000169 | |||
| 2543 | Ga0466969_0024849 | |||
| 2544 | Ga0466972_0011675 | |||
| 2545 | Ga0453683_0000047 | |||
| 2546 | Ga0453683_0000464 | |||
| 2547 | Ga0453683_0002014 | |||
| 2548 | Ga0453683_0095554 | |||
| 2549 | Ga0466965_0002274 | |||
| 2550 | Ga0466966_0001826 | |||
| 2551 | Ga0466961_0001054 | |||
| 2552 | Ga0466961_0004942 | |||
| 2553 | Ga0466961_0012914 | |||
| 2554 | Ga0466963_0230471 | |||
| 2555 | Ga0466964_0015945 | |||
| 2556 | Ga0453684_0000273 | |||
| 2557 | Ga0453684_0000302 | |||
| 2558 | Ga0453684_0005216 | |||
| 2559 | Ga0453684_0009340 | |||
| 2560 | Ga0453684_0029404 | |||
| 2561 | Ga0453684_0032697 | |||
| 2562 | Ga0453684_0140681 | |||
| 2563 | Ga0453684_0231917 | |||
| 2564 | Ga0453684_0284443 | |||
| 2565 | Ga0453684_0367514 | |||
| 2566 | Ga0466968_0143309 | |||
| 2567 | Ga0466957_0017735 | |||
| 2568 | Ga0466957_0089032 | |||
| 2569 | Ga0466957_0206380 | |||
| 2570 | Ga0466959_0008784 | |||
| 2571 | Ga0466959_0033437 | |||
| 2572 | Ga0466959_0036716 | |||
| 2573 | Ga0466959_0123839 | |||
| 2574 | Ga0451576_0000006 | |||
| 2575 | Ga0451576_0000116 | |||
| 2576 | Ga0451576_0000810 | |||
| 2577 | Ga0451576_0003028 | |||
| 2578 | Ga0451576_0017940 | |||
| 2579 | Ga0451576_0040503 | |||
| 2580 | Ga0451576_0052789 | |||
| 2581 | Ga0451576_0072549 | |||
| 2582 | Ga0451576_0090153 | |||
| 2583 | Ga0451576_0136460 | |||
| 2584 | Ga0451576_0164653 | |||
| 2585 | Ga0451576_0169075 | |||
| 2586 | Ga0451576_0184651 | |||
| 2587 | Ga0451576_0341786 | |||
| 2588 | Ga0451576_0379732 | |||
| 2589 | Ga0451576_0650693 | |||
| 2590 | Ga0451576_0682101 | |||
| 2591 | Ga0466958_0016792 | |||
| 2592 | Ga0466967_0095991 | |||
| 2593 | Ga0495592_0000402 | |||
| 2594 | Ga0495592_0008806 | |||
| 2595 | Ga0495592_0011017 | |||
| 2596 | Ga0495592_0012367 | |||
| 2597 | Ga0495592_0018099 | |||
| 2598 | Ga0495603_0004104 | |||
| 2599 | Ga0495629_0050922 | |||
| 2600 | Ga0495638_0045635 | |||
| 2601 | Ga0495638_0142107 | |||
| 2602 | Ga0495641_0005397 | |||
| 2603 | Ga0495641_0014457 | |||
| 2604 | Ga0495651_0000386 | |||
| 2605 | Ga0495651_0001537 | |||
| 2606 | Ga0495653_0000014 | |||
| 2607 | Ga0495653_0001467 | |||
| 2608 | Ga0495653_0104712 | |||
| 2609 | Ga0495653_0269004 | |||
| 2610 | Ga0495650_0010303 | |||
| 2611 | Ga0495580_0005123 | |||
| 2612 | Ga0495580_0022257 | |||
| 2613 | Ga0495582_0022643 | |||
| 2614 | Ga0495639_0002490 | |||
| 2615 | Ga0495639_0086817 | |||
| 2616 | Ga0495662_0005031 | |||
| 2617 | Ga0495662_0007831 | |||
| 2618 | Ga0495662_0056211 | |||
| 2619 | Ga0495585_0004535 | |||
| 2620 | Ga0495606_0000085 | |||
| 2621 | Ga0495608_0001458 | |||
| 2622 | Ga0495608_0010334 | |||
| 2623 | Ga0495608_0024719 | |||
| 2624 | Ga0495618_0036764 | |||
| 2625 | Ga0495620_0009557 | |||
| 2626 | Ga0495628_0001323 | |||
| 2627 | Ga0495628_0003324 | |||
| 2628 | Ga0495628_0012120 | |||
| 2629 | Ga0495628_0023392 | |||
| 2630 | Ga0495628_0054659 | |||
| 2631 | Ga0495628_0082173 | |||
| 2632 | Ga0495630_0001562 | |||
| 2633 | Ga0495631_0001860 | |||
| 2634 | Ga0495637_0001254 | |||
| 2635 | Ga0495666_0005300 | |||
| 2636 | Ga0495652_0014341 | |||
| 2637 | Ga0495652_0020971 | |||
| 2638 | Ga0495652_0031771 | |||
| 2639 | Ga0495652_0340747 | |||
| 2640 | Ga0495654_0000034 | |||
| 2641 | Ga0495654_0006664 | |||
| 2642 | Ga0495665_0002051 | |||
| 2643 | Ga0495640_0167223 | |||
| 2644 | Ga0495586_0004208 | |||
| 2645 | Ga0495586_0010110 | |||
| 2646 | Ga0495586_0038227 | |||
| 2647 | Ga0495587_0005053 | |||
| 2648 | Ga0495587_0005690 | |||
| 2649 | Ga0495587_0028128 | |||
| 2650 | Ga0495598_0026266 | |||
| 2651 | Ga0495621_0006064 | |||
| 2652 | Ga0495621_0101614 | |||
| 2653 | Ga0495645_0000490 | |||
| 2654 | Ga0495645_0000505 | |||
| 2655 | Ga0495622_0018754 | |||
| 2656 | Ga0495633_0000563 | |||
| 2657 | Ga0495667_0000929 | |||
| 2658 | Ga0495667_0003624 | |||
| 2659 | Ga0495667_0016088 | |||
| 2660 | Ga0495667_0089742 | |||
| 2661 | Ga0495656_0000090 | |||
| 2662 | Ga0495656_0011534 | |||
| 2663 | Ga0495634_0004749 | |||
| 2664 | Ga0495634_0052509 | |||
| 2665 | Ga0495625_0000045 | |||
| 2666 | Ga0495625_0113489 | |||
| 2667 | Ga0495635_0013262 | |||
| 2668 | Ga0495635_0022732 | |||
| 2669 | Ga0495635_0121478 | |||
| 2670 | Ga0495659_0056632 | |||
| 2671 | Ga0495588_0099631 | |||
| 2672 | Ga0495657_0001646 | |||
| 2673 | Ga0495657_0075298 | |||
| 2674 | Ga0495599_0001724 | |||
| 2675 | Ga0495599_0005109 | |||
| 2676 | Ga0495599_0007320 | |||
| 2677 | Ga0495599_0016689 | |||
| 2678 | Ga0495646_0073811 | |||
| 2679 | Ga0495647_0000520 | |||
| 2680 | Ga0495647_0002578 | |||
| 2681 | Ga0495658_0005333 | |||
| 2682 | Ga0495658_0059067 | |||
| 2683 | Ga0495669_0039167 | |||
| 2684 | Ga0495613_0003024 | |||
| 2685 | Ga0495613_0014356 | |||
| 2686 | Ga0495624_0004534 | |||
| 2687 | Ga0495624_0045779 | |||
| 2688 | Ga0495624_0055474 | |||
| 2689 | Ga0495600_0001614 | |||
| 2690 | Ga0495600_0006471 | |||
| 2691 | Ga0495581_0296944 | |||
| 2692 | Ga0495604_0001290 | |||
| 2693 | Ga0495604_0063974 | |||
| 2694 | Ga0495604_0191323 | |||
| 2695 | Ga0495604_0256034 | |||
| 2696 | Ga0495636_0096815 | |||
| 2697 | Ga0495636_0101440 | |||
| 2698 | Ga0495674_0002016 | |||
| 2699 | Ga0495676_0118617 | |||
| 2700 | Ga0495680_0000735 | |||
| 2701 | Ga0495680_0013178 | |||
| 2702 | Ga0495687_000961 | |||
| 2703 | Ga0495675_0024850 | |||
| 2704 | Ga0495684_0006542 | |||
| 2705 | Ga0495684_0071758 | |||
| 2706 | Ga0495593_0014105 | |||
| 2707 | Ga0495593_0157840 | |||
| 2708 | Ga0495602_0226614 | |||
| 2709 | Ga0495614_0037406 | |||
| 2710 | Ga0496100_0004031 | |||
| 2711 | Ga0496100_0302774 | |||
| 2712 | Ga0496102_0062695 | |||
| 2713 | Ga0496104_0017851 | |||
| 2714 | Ga0496104_0113513 | |||
| 2715 | Ga0496105_0264483 | |||
| 2716 | Ga0496108_0025181 | |||
| 2717 | Ga0496108_0030824 | |||
| 2718 | Ga0496108_0338683 | |||
| 2719 | Ga0496109_0007737 | |||
| 2720 | Ga0496109_0020515 | |||
| 2721 | Ga0496109_0082794 | |||
| 2722 | Ga0496109_0096917 | |||
| 2723 | Ga0496110_0032764 | |||
| 2724 | Ga0496110_0081553 | |||
| 2725 | Ga0496110_0146480 | |||
| 2726 | Ga0496112_0035835 | |||
| 2727 | Ga0496113_0067776 | |||
| 2728 | Ga0496116_0046660 | |||
| 2729 | Ga0496116_0072434 | |||
| 2730 | Ga0496117_0000056 | |||
| 2731 | Ga0496117_0060218 | |||
| 2732 | Ga0496118_0000047 | |||
| 2733 | Ga0496118_0005388 | |||
| 2734 | Ga0496118_0017400 | |||
| 2735 | Ga0496119_0098623 | |||
| 2736 | Ga0496121_0021767 | |||
| 2737 | Ga0496121_0027142 | |||
| 2738 | Ga0496121_0041655 | |||
| 2739 | Ga0496121_0088636 | |||
| 2740 | Ga0496122_0000747 | |||
| 2741 | Ga0496122_0006247 | |||
| 2742 | Ga0496123_0000274 | |||
| 2743 | Ga0496123_0000345 | |||
| 2744 | Ga0496124_0000596 | |||
| 2745 | Ga0496124_0028048 | |||
| 2746 | Ga0496124_0044619 | |||
| 2747 | Ga0496124_0174602 | |||
| 2748 | Ga0496124_0237264 | |||
| 2749 | Ga0496125_0006034 | |||
| 2750 | Ga0496125_0049426 | |||
| 2751 | Ga0496125_0089064 | |||
| 2752 | Ga0496125_0099879 | |||
| 2753 | Ga0496126_0031456 | |||
| 2754 | Ga0496126_0268443 | |||
| 2755 | Ga0501031_0000519 | |||
| 2756 | Ga0501031_0002448 | |||
| 2757 | Ga0501032_0021502 | |||
| 2758 | Ga0501032_0129975 | |||
| 2759 | Ga0501033_0000289 | |||
| 2760 | Ga0501033_0001878 | |||
| 2761 | Ga0501034_0009180 | |||
| 2762 | Ga0501034_0041500 | |||
| 2763 | Ga0501034_0080371 | |||
| 2764 | Ga0501034_0106998 | |||
| 2765 | Ga0501036_0000051 | |||
| 2766 | Ga0501036_0025591 | |||
| 2767 | Ga0501036_0098999 | |||
| 2768 | Ga0501037_0004183 | |||
| 2769 | Ga0501037_0007041 | |||
| 2770 | Ga0501038_0000505 | |||
| 2771 | Ga0501038_0016412 | |||
| 2772 | Ga0501039_0002690 | |||
| 2773 | Ga0501039_0113685 | |||
| 2774 | Ga0501039_0140084 | |||
| 2775 | Ga0501039_0341686 | |||
| 2776 | Ga0501040_0030316 | |||
| 2777 | Ga0501040_0033226 | |||
| 2778 | Ga0501041_0000236 | |||
| 2779 | Ga0501041_0044238 | |||
| 2780 | Ga0501042_0000107 | |||
| 2781 | Ga0501042_0040258 | |||
| 2782 | Ga0501042_0108547 | |||
| 2783 | Ga0501043_0000057 | |||
| 2784 | Ga0501043_0012140 | |||
| 2785 | Ga0501043_0012436 | |||
| 2786 | Ga0501043_0117192 | |||
| 2787 | Ga0501043_0172037 | |||
| 2788 | Ga0501046_0000075 | |||
| 2789 | Ga0501046_0000548 | |||
| 2790 | Ga0501046_0016131 | |||
| 2791 | Ga0501046_0036963 | |||
| 2792 | Ga0501046_0099823 | |||
| 2793 | Ga0501047_0000081 | |||
| 2794 | Ga0501047_0005071 | |||
| 2795 | Ga0501047_0006131 | |||
| 2796 | Ga0501047_0058948 | |||
| 2797 | Ga0501047_0193772 | |||
| 2798 | Ga0501048_0000076 | |||
| 2799 | Ga0501048_0002636 | |||
| 2800 | Ga0501048_0289042 | |||
| 2801 | Ga0501067_0044166 | |||
| 2802 | Ga0501069_0002988 | |||
| 2803 | Ga0501070_0003556 | |||
| 2804 | Ga0501070_0015557 | |||
| 2805 | Ga0501070_0027035 | |||
| 2806 | Ga0501070_0084597 | |||
| 2807 | Ga0501070_0126469 | |||
| 2808 | Ga0501071_0000836 | |||
| 2809 | Ga0501071_0050258 | |||
| 2810 | Ga0501071_0094569 | |||
| 2811 | Ga0501071_0140717 | |||
| 2812 | Ga0501072_0000201 | |||
| 2813 | Ga0501072_0001610 | |||
| 2814 | Ga0501072_0018650 | |||
| 2815 | Ga0501072_0025495 | |||
| 2816 | Ga0501072_0043676 | |||
| 2817 | Ga0501073_0000403 | |||
| 2818 | Ga0501073_0000710 | |||
| 2819 | Ga0501073_0001421 | |||
| 2820 | Ga0501073_0137263 | |||
| 2821 | Ga0501073_0402902 | |||
| 2822 | Ga0501074_0003228 | |||
| 2823 | Ga0501074_0073065 | |||
| 2824 | Ga0501074_0206705 | |||
| 2825 | Ga0501075_0000544 | |||
| 2826 | Ga0501075_0014368 | |||
| 2827 | Ga0501075_0122411 | |||
| 2828 | Ga0501075_0232921 | |||
| 2829 | Ga0501075_0282334 | |||
| 2830 | Ga0501075_0324530 | |||
| 2831 | Ga0501076_0000771 | |||
| 2832 | Ga0501076_0001109 | |||
| 2833 | Ga0501077_0025685 | |||
| 2834 | Ga0501198_000012 | |||
| 2835 | Ga0501222_000010 | |||
| 2836 | Ga0501222_001940 | |||
| 2837 | Ga0501223_000534 | |||
| 2838 | Ga0501233_001974 | |||
| 2839 | Ga0501253_001770 | |||
| 2840 | Ga0501221_000686 | |||
| 2841 | Ga0501225_0003774 | |||
| 2842 | Ga0501225_0032555 | |||
| 2843 | Ga0501229_000069 | |||
| 2844 | Ga0501079_0000441 | |||
| 2845 | Ga0501079_0007491 | |||
| 2846 | Ga0501079_0017995 | |||
| 2847 | Ga0501080_0000762 | |||
| 2848 | Ga0501080_0014631 | |||
| 2849 | Ga0501080_0034459 | |||
| 2850 | Ga0501080_0131792 | |||
| 2851 | Ga0501080_0287094 | |||
| 2852 | Ga0501080_0375073 | |||
| 2853 | Ga0501081_0001178 | |||
| 2854 | Ga0501081_0008200 | |||
| 2855 | Ga0501081_0071858 | |||
| 2856 | Ga0501081_0195693 | |||
| 2857 | Ga0501083_0003281 | |||
| 2858 | Ga0501083_0020668 | |||
| 2859 | Ga0501083_0033807 | |||
| 2860 | Ga0501083_0125143 | |||
| 2861 | Ga0501266_000713 | |||
| 2862 | Ga0501272_004105 | |||
| 2863 | Ga0501035_0009359 | |||
| 2864 | Ga0501035_0093945 | |||
| 2865 | Ga0501035_0120920 | |||
| 2866 | Ga0501035_0179968 | |||
| 2867 | Ga0501044_0004209 | |||
| 2868 | Ga0501044_0530435 | |||
| 2869 | Ga0501044_0620666 | |||
| 2870 | Ga0501045_0000911 | |||
| 2871 | Ga0501045_0227956 | |||
| 2872 | nmdc:mga03683_112035_c1 | |||
| 2873 | nmdc:mga03683_5307_c1 | |||
| 2874 | nmdc:mga03683_6760_c1 | |||
| 2875 | nmdc:mga03n38_21506_c1 | |||
| 2876 | nmdc:mga03n38_311636_c1 | |||
| 2877 | nmdc:mga00v17_45226_c1 | |||
| 2878 | nmdc:mga0yw44_337042_c1 | |||
| 2879 | nmdc:mga0yw44_34515_c1 | |||
| 2880 | nmdc:mga0yw44_56081_c1 | |||
| 2881 | nmdc:mga0k408_109209_c1 | |||
| 2882 | nmdc:mga0k408_14580_c1 | |||
| 2883 | nmdc:mga0k408_161_c1 | |||
| 2884 | nmdc:mga0k408_16652_c1 | |||
| 2885 | nmdc:mga0k408_1875_c1 | |||
| 2886 | nmdc:mga0k408_249692_c1 | |||
| 2887 | nmdc:mga0k408_35602_c1 | |||
| 2888 | nmdc:mga0k408_4724_c1 | |||
| 2889 | nmdc:mga0k408_60277_c1 | |||
| 2890 | nmdc:mga07m45_11075_c1 | |||
| 2891 | nmdc:mga07m45_22932_c1 | |||
| 2892 | nmdc:mga07m45_33279_c1 | |||
| 2893 | nmdc:mga07m45_4223_c1 | |||
| 2894 | nmdc:mga07m45_46597_c1 | |||
| 2895 | nmdc:mga07m45_73795_c1 | |||
| 2896 | nmdc:mga07m45_8519_c1 | |||
| 2897 | nmdc:mga05p37_1040_c1 | |||
| 2898 | nmdc:mga05p37_822234_c1 | |||
| 2899 | nmdc:mga05p37_97434_c1 | |||
| 2900 | nmdc:mga09592_179179_c1 | |||
| 2901 | nmdc:mga09592_321446_c1 | |||
| 2902 | nmdc:mga09592_507_c1 | |||
| 2903 | nmdc:mga09592_52198_c1 | |||
| 2904 | nmdc:mga09592_90937_c1 | |||
| 2905 | nmdc:mga0qj67_101996_c1 | |||
| 2906 | nmdc:mga0qj67_21296_c1 | |||
| 2907 | nmdc:mga0qj67_21367_c1 | |||
| 2908 | nmdc:mga0qj67_60057_c1 | |||
| 2909 | nmdc:mga06r32_250227_c1 | |||
| 2910 | nmdc:mga06r32_2510_c1 | |||
| 2911 | nmdc:mga06r32_417730_c1 | |||
| 2912 | nmdc:mga06r32_51214_c1 | |||
| 2913 | nmdc:mga08y16_203250_c1 | |||
| 2914 | nmdc:mga08y16_315043_c1 | |||
| 2915 | nmdc:mga08y16_6498_c1 | |||
| 2916 | nmdc:mga08y16_69561_c1 | |||
| 2917 | nmdc:mga08y16_95492_c1 | |||
| 2918 | nmdc:mga0n895_13969_c1 | |||
| 2919 | nmdc:mga0n895_458_c1 | |||
| 2920 | nmdc:mga0n895_463400_c1 | |||
| 2921 | nmdc:mga0rr50_156_c1 | |||
| 2922 | nmdc:mga0rr50_23873_c1 | |||
| 2923 | nmdc:mga0rr50_29997_c1 | |||
| 2924 | nmdc:mga0rr50_303958_c1 | |||
| 2925 | nmdc:mga0rr50_309755_c1 | |||
| 2926 | nmdc:mga08x19_341_c1 | |||
| 2927 | nmdc:mga08x19_4042_c1 | |||
| 2928 | nmdc:mga08x19_54115_c1 | |||
| 2929 | nmdc:mga08x19_7621_c1 | |||
| 2930 | nmdc:mga08x19_81_c1 | |||
| 2931 | nmdc:mga0a205_127550_c1 | |||
| 2932 | nmdc:mga0a205_161597_c1 | |||
| 2933 | nmdc:mga0a205_299_c1 | |||
| 2934 | nmdc:mga0a205_302797_c1 | |||
| 2935 | nmdc:mga0a205_354577_c1 | |||
| 2936 | nmdc:mga0a205_43986_c1 | |||
| 2937 | nmdc:mga0a205_572403_c1 | |||
| 2938 | nmdc:mga0a205_57923_c1 | |||
| 2939 | Ga0495601_0000627 | |||
| 2940 | Ga0495601_0001241 | |||
| 2941 | Ga0495601_0224741 | |||
| 2942 | Ga0495612_0016150 | |||
| 2943 | Ga0495612_0060180 | |||
| 2944 | Ga0500610_0001655 | |||
| 2945 | Ga0500610_0004732 | |||
| 2946 | Ga0495595_0002323 | |||
| 2947 | Ga0495595_0019707 | |||
| 2948 | Ga0495595_0040606 | |||
| 2949 | Ga0500643_004741 | |||
| 2950 | Ga0500646_0001015 | |||
| 2951 | Ga0500651_0000223 | |||
| 2952 | Ga0500566_0186570 | |||
| 2953 | Ga0500571_000129 | |||
| 2954 | Ga0500592_007345 | |||
| 2955 | Ga0500593_000472 | |||
| 2956 | Ga0500593_000526 | |||
| 2957 | Ga0500607_004161 | |||
| 2958 | Ga0500607_051714 | |||
| 2959 | Ga0500655_001764 | |||
| 2960 | Ga0500655_020384 | |||
| 2961 | Ga0500559_0004481 | |||
| 2962 | Ga0500559_0119174 | |||
| 2963 | Ga0500568_0009007 | |||
| 2964 | Ga0500568_0021891 | |||
| 2965 | Ga0500574_011933 | |||
| 2966 | Ga0500604_0002378 | |||
| 2967 | Ga0500604_0020845 | |||
| 2968 | Ga0500616_0023945 | |||
| 2969 | Ga0500622_0059421 | |||
| 2970 | Ga0500627_0000567 | |||
| 2971 | Ga0500634_0009885 | |||
| 2972 | Ga0500634_0022949 | |||
| 2973 | Ga0500636_0021704 | |||
| 2974 | Ga0500645_005298 | |||
| 2975 | Ga0501084_0014223 | |||
| 2976 | Ga0501084_0061169 | |||
| 2977 | Ga0501084_0070133 | |||
| 2978 | Ga0501084_0162371 | |||
| 2979 | Ga0590071_000494 | |||
| 2980 | Ga0590074_009073 | |||
| 2981 | Ga0590074_009443 | |||
| 2982 | Ga0501082_0006025 | |||
| 2983 | Ga0501082_0018607 | |||
| 2984 | Ga0501082_0047642 | |||
| 2985 | Ga0501082_0060097 | |||
| 2986 | Ga0501082_0080902 | |||
| 2987 | Ga0530510_0000543 | |||
| 2988 | Ga0530510_0000585 | |||
| 2989 | 2513229154 | |||
| 2990 | 2587724932 | |||
| 2991 | 2587731701 | |||
| 2992 | 2588292434 | |||
| 2993 | 2599623423 | |||
| 2994 | 2599675359 | |||
| 2995 | 2599681028 | |||
| 2996 | 2599693043 | |||
| 2997 | 2643743744 | |||
| 2998 | 2643867750 | |||
| 2999 | 2643936506 | |||
| 3000 | 2643968186 | |||
| 3001 | 2644062216 | |||
| 3002 | 2644071404 | |||
| 3003 | 2644142458 | |||
| 3004 | 2644161820 | |||
| 3005 | 2644222343 | |||
| 3006 | 2644256357 | |||
| 3007 | 2644277043 | |||
| 3008 | 2644301365 | |||
| 3009 | 2644317862 | |||
| 3010 | 2644325584 | |||
| 3011 | 2644340870 | |||
| 3012 | 2644358534 | |||
| 3013 | 2644399303 | |||
| 3014 | 2644467009 | |||
| 3015 | 2738718171 | |||
| 3016 | 2738880444 | |||
| 3017 | 2739058402 | |||
| 3018 | 2739245827 | |||
| 3019 | 2739281358 | |||
| 3020 | 2816470521 | |||
| 3021 | 2819600599 | |||
| 3022 | 2831267675 | |||
| 3023 | 2838061119 | |||
| 3024 | 2839141861 | |||
| 3025 | 2842679801 | |||
| 3026 | 2842718703 | |||
| 3027 | 2842736382 | |||
| 3028 | 2842748890 | |||
| 3029 | 2857569270 | |||
| 3030 | 2885085895 | |||
| 3031 | 2885196958 | |||
| 3032 | 2885198855 | |||
| 3033 | 2885211765 | |||
| 3034 | 2895517910 | |||
| 3035 | 2899928254 | |||
| 3036 | 2904452469 | |||
| 3037 | 2904460932 | |||
| 3038 | 2904545154 | |||
| 3039 | 2919463899 | |||
| 3040 | 2928041206 | |||
| 3041 | 2928048048 | |||
| 3042 | 2928055889 | |||
| 3043 | 2928066630 | |||
| 3044 | 2928077216 | |||
| 3045 | 2928087517 | |||
| 3046 | 2928120635 | |||
| 3047 | 2929165332 | |||
| 3048 | 2929522915 | |||
| 3049 | 2932424025 | |||
| 3050 | 2945910062 | |||
| 3051 | 2945946035 | |||
| 3052 | 2945975634 | |||
| 3053 | 2945987922 | |||
| 3054 | 2954768922 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j7k-assembly1.cif.gz_A | thermotoga maritima ruvb p216g mutant | 0.7454 | 72 | 296 |
| 1sxj-assembly1.cif.gz_E | crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna) | 0.7417 | 74 | 299 |
| 1in7-assembly1.cif.gz_A | thermotoga maritima ruvb r170a | 0.7341 | 68 | 296 |
| 1in6-assembly1.cif.gz_A | thermotoga maritima ruvb k64r mutant | 0.7256 | 70 | 296 |
| 1in5-assembly1.cif.gz_A | thermogota maritima ruvb a156s mutant | 0.7147 | 70 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58294_3_157_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7648 | 74 | 199 | 3.40.50.300 |
| af_K7TUL7_284_471_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7383 | 67 | 200 | 3.40.50.300 |
| 1sxjE01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7362 | 74 | 205 | 3.40.50.300 |
| af_A0A0R0FGW9_202_366_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7343 | 65 | 200 | 3.40.50.300 |
| af_A0A1D6NFD7_32_192_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7302 | 80 | 199 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537EAG2-F1-model_v4 | DUF815 domain-containing protein | 0.9868 | 88 | 207 |
|
| AF-A0A537EAG2-F1-model_v4 | DUF815 domain-containing protein | 0.9708 | 88 | 207 |
|
| AF-A0A6J4QIJ5-F1-model_v4 | Uncharacterized protein | 0.965 | 49 | 160 |
|
| AF-A0A7S1DKY2-F1-model_v4 | AAA+ ATPase domain-containing protein | 0.9569 | 55 | 165 |
|
| AF-A0A259P737-F1-model_v4 | AAA family ATPase | 0.9498 | 67 | 304 |
|