F494572

General Info

Members Datasets Scaffolds Average Seq Length
1527 607 3054 284

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10085778|Ga0065707_100857781
Length 324
Sequence MDERLEHLIEHAERLLTRLEQALPHAPRAPDWSASIAFRYRRRGANAQLEPVRHVSAIRLSDLKEIDAQMERLRRNTEQFVSGRPANNVLLTGARGTGKSSLIKACLHQFCDRGLRLIEIDKADLIELPDLVELVAHRPERFVVFCDDLSFDEGEPGYKALKSVLDGSVAATSDNLLIYATSNRRHLLPEYMKENLTYTHTDDGEVHPGEVVEEKISLSERFGLWISFYPFSQQEYLAIVAQWLRTFGAAEATITQALKPSLVWALERGSRSGRVAYQFARDWAGRSAGAEGMQGVALQGTEPPGHAGPGVGADADHPDGLDHV

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
149 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
152 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
156 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
236 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
246 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
247 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
248 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
249 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
250 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
251 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
252 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
253 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
254 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
257 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
258 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
261 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
262 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
263 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
264 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
265 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
266 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
267 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
274 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
275 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
276 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
279 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
280 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
284 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
285 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
288 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
289 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
290 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
291 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
293 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
294 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
295 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
296 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
297 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
298 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
299 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
300 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
301 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
305 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
306 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
307 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
308 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
309 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
310 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
312 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
313 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
314 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
315 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
316 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
319 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
320 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
321 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
322 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
323 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
324 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
325 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
326 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
327 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
328 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
329 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
330 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
331 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
332 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
333 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
334 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
335 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
336 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
337 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
338 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
339 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
340 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
341 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
342 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
343 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
344 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
345 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
346 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
347 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
348 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
349 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
350 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
351 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
352 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
353 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
354 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
355 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
356 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
357 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
358 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
359 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
360 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
361 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
362 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
363 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
364 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
365 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
366 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
367 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
368 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
369 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
370 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
371 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
372 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
373 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
374 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
375 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
376 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
377 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
378 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
379 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
380 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
381 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
382 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
383 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
384 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
385 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
386 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
387 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
388 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
389 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
392 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
393 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
394 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
395 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
396 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
397 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
398 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
399 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
400 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
401 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
402 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
403 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
404 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
405 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
406 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
407 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
408 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
409 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
410 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
411 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
412 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
413 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
414 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
415 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
416 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
417 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
418 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
419 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
420 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
421 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
422 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
423 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
424 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
427 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
428 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
429 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
430 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
431 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
432 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
433 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
434 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
435 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
436 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
437 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
438 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
439 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
440 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
441 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
442 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
443 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
444 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
445 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
446 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
447 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
448 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
449 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
450 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
451 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
452 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
453 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
454 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
455 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
456 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
457 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
473 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
474 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
475 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
476 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
477 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
478 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
479 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
480 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
481 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
482 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
483 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
484 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
485 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
486 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
487 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
488 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
489 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
490 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
491 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
492 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
493 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
494 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
495 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
496 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
499 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
500 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
501 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
502 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
503 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
504 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
505 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
506 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
507 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
508 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
509 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
510 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
511 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
512 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
513 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
514 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
515 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
516 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
517 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
518 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
519 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
520 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
521 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
522 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
523 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
524 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
525 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
526 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
529 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
530 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
531 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
532 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
533 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
534 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
535 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
536 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
537 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
538 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
539 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
540 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
541 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
542 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
543 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
544 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
545 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
546 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
547 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
548 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
549 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
550 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
551 2643221570 Acidovorax sp. Root568 Isolate Unclassified
552 2643221585 Pelomonas sp. Root662 Isolate Unclassified
553 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
554 2643221609 Acidovorax sp. Root217 Isolate Unclassified
555 2643221611 Acidovorax sp. Root219 Isolate Unclassified
556 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
557 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
558 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
559 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
560 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
561 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
562 2643221656 Pelomonas sp. Root405 Isolate Unclassified
563 2643221658 Variovorax sp. Root411 Isolate Unclassified
564 2643221660 Methylibium sp. Root1272 Isolate Unclassified
565 2643221664 Massilia sp. Root418 Isolate Unclassified
566 2643221672 Variovorax sp. Root434 Isolate Unclassified
567 2643221683 Variovorax sp. Root473 Isolate Unclassified
568 2738541277 Variovorax sp. GV051 Isolate Unclassified
569 2738541307 Variovorax sp. GV008 Isolate Unclassified
570 2738541337 Pelomonas sp. BT06 Isolate Unclassified
571 2738543012 Acidovorax sp. CF301 Isolate Unclassified
572 2738543019 Variovorax sp. GV040 Isolate Unclassified
573 2816332133 Acidovorax radicis 2721A Isolate Unclassified
574 2818991446 Variovorax sp. 1180 Isolate Unclassified
575 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
576 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
577 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
578 2842677519 Variovorax sp. R-72495 Isolate Unclassified
579 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
580 2842733646 Variovorax sp. R-72446 Isolate Unclassified
581 2842747753 Variovorax sp. R-72060 Isolate Unclassified
582 2857564685 Duganella sp. R-74599 Isolate Unclassified
583 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
584 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
585 2885198086 Variovorax sp. 679 Isolate Unclassified
586 2885211737 Variovorax sp. 553 Isolate Unclassified
587 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
588 2899924645 Variovorax sp. 369 Isolate Unclassified
589 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
590 2904456579 Variovorax sp. 2002 Isolate Unclassified
591 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
592 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
593 2928037797 Variovorax sp. 1126 Isolate Unclassified
594 2928044640 Variovorax sp. 1128 Isolate Unclassified
595 2928051484 Variovorax sp. 1133 Isolate Unclassified
596 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
597 2928070936 Variovorax gossypii 1167 Isolate Unclassified
598 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
599 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
600 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
601 2929520902 Variovorax beijingensis 502 Isolate Unclassified
602 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
603 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
604 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
605 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
606 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
607 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0.39
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.67
Nodule 0.65
Rhizoplane 1.51
Rhizosphere 80.48
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10085778 3300005295 Bacteria 5889
2 JGI24740J21852_10010522 3300001979 Bacteria 3556
3 JGI25155J39150_1000022 3300002704 Bacteria 142950
4 JGI25156J39149_1000005 3300002705 Bacteria 263980
5 JGI25154J39366_1000017 3300002738 Bacteria 252448
6 JGI25158J39367_1005484 3300002739 Bacteria 1862
7 JGI25157J39369_1000003 3300002741 Bacteria 274935
8 JGI25152J39213_1011510 3300002773 Bacteria 1952
9 JGI25159J45721_1015079 3300002987 Bacteria 1710
10 JGI25151J46595_10007571 3300003187 Bacteria 5305
11 JGI25153J46596_10003017 3300003215 Bacteria 9528
12 Ga0006562J51391_1102770 3300003578 Bacteria 1746
13 Ga0006562J51391_1102771 3300003578 Bacteria 1580
14 Ga0055535_1000221 3300003761 Bacteria 60185
15 Ga0055542_1000129 3300003762 Bacteria 99542
16 Ga0055537_1000475 3300003773 Bacteria 25145
17 Ga0055524_1000053 3300003775 Bacteria 144892
18 Ga0055536_1001528 3300003781 Bacteria 13873
19 Ga0055536_1008131 3300003781 Bacteria 4570
20 Ga0055536_1033036 3300003781 Bacteria 1327
21 Ga0055534_1000429 3300003784 Bacteria 25145
22 Ga0055534_1003675 3300003784 Bacteria 4746
23 Ga0055534_1004148 3300003784 Bacteria 4295
24 Ga0055528_1002516 3300003790 Bacteria 9769
25 Ga0055528_1007607 3300003790 Bacteria 4766
26 Ga0055530_10001363 3300003791 Bacteria 18109
27 Ga0055530_10005013 3300003791 Bacteria 6531
28 Ga0055540_1002889 3300003792 Bacteria 8714
29 Ga0055540_1003142 3300003792 Bacteria 8171
30 Ga0055531_10000158 3300003794 Bacteria 77918
31 Ga0055531_10000179 3300003794 Bacteria 72059
32 Ga0055531_10000543 3300003794 Bacteria 33406
33 Ga0065165_1000177 3300005262 Bacteria 113446
34 Ga0065165_1001456 3300005262 Bacteria 25564
35 Ga0065165_1026655 3300005262 Bacteria 1898
36 Ga0065165_1051685 3300005262 Bacteria 1164
37 Ga0065714_10088812 3300005288 Bacteria 2002
38 Ga0065704_10134796 3300005289 Bacteria 1584
39 Ga0065707_10004626 3300005295 Bacteria 3131
40 Ga0070658_10058717 3300005327 Bacteria 3132
41 Ga0070676_10064584 3300005328 Bacteria 2183
42 Ga0070676_10165882 3300005328 Bacteria 1425
43 Ga0070683_100079043 3300005329 Bacteria 3078
44 Ga0070690_100000076 3300005330 Bacteria 48076
45 Ga0070690_100011766 3300005330 Bacteria 5129
46 Ga0070690_100076426 3300005330 Bacteria 2185
47 Ga0070690_100097702 3300005330 Bacteria 1943
48 Ga0070690_100237707 3300005330 Bacteria 1284
49 Ga0070670_100006933 3300005331 Bacteria 9605
50 Ga0070670_100098535 3300005331 Bacteria 2515
51 Ga0070670_100203438 3300005331 Bacteria 1721
52 Ga0068869_100001183 3300005334 Bacteria 15316
53 Ga0068869_100056383 3300005334 Bacteria 2865
54 Ga0068869_100153438 3300005334 Bacteria 1788
55 Ga0068869_100215564 3300005334 Bacteria 1519
56 Ga0070666_10006757 3300005335 Bacteria 7065
57 Ga0070666_10064631 3300005335 Bacteria 2481
58 Ga0070680_100000812 3300005336 Bacteria 22014
59 Ga0070680_100006232 3300005336 Bacteria 9050
60 Ga0070680_100078687 3300005336 Bacteria 2717
61 Ga0068868_100000966 3300005338 Bacteria 19576
62 Ga0068868_100118129 3300005338 Bacteria 2161
63 Ga0068868_100471099 3300005338 Bacteria 1095
64 Ga0070660_100064288 3300005339 Bacteria 2854
65 Ga0070689_100005432 3300005340 Bacteria 8699
66 Ga0070689_100009409 3300005340 Bacteria 6928
67 Ga0070689_100012393 3300005340 Bacteria 6141
68 Ga0070689_100013607 3300005340 Bacteria 5892
69 Ga0070689_100253426 3300005340 Bacteria 1453
70 Ga0070691_10003561 3300005341 Bacteria 7025
71 Ga0070691_10003688 3300005341 Bacteria 6917
72 Ga0070691_10121804 3300005341 Bacteria 1314
73 Ga0070687_100000107 3300005343 Bacteria 28094
74 Ga0070687_100083430 3300005343 Bacteria 1750
75 Ga0070687_100083699 3300005343 Bacteria 1747
76 Ga0070661_100110093 3300005344 Bacteria 2056
77 Ga0070692_10005519 3300005345 Bacteria 5402
78 Ga0070692_10019289 3300005345 Bacteria 3289
79 Ga0070692_10043349 3300005345 Bacteria 2313
80 Ga0070668_100014537 3300005347 Bacteria 5883
81 Ga0070668_100056051 3300005347 Bacteria 3043
82 Ga0070668_100079443 3300005347 Bacteria 2568
83 Ga0070669_100005844 3300005353 Bacteria 8872
84 Ga0070669_100024219 3300005353 Bacteria 4352
85 Ga0070669_100056715 3300005353 Bacteria 2872
86 Ga0070669_100080916 3300005353 Bacteria 2419
87 Ga0070669_100169668 3300005353 Bacteria 1700
88 Ga0070675_100008036 3300005354 Bacteria 8179
89 Ga0070675_100027347 3300005354 Bacteria 4582
90 Ga0070675_100042997 3300005354 Bacteria 3691
91 Ga0070671_100002643 3300005355 Bacteria 13868
92 Ga0070671_100011057 3300005355 Bacteria 7245
93 Ga0070671_100126767 3300005355 Bacteria 2149
94 Ga0070671_100142202 3300005355 Bacteria 2025
95 Ga0070671_100354492 3300005355 Bacteria 1252
96 Ga0070674_100004974 3300005356 Bacteria 7619
97 Ga0070674_100060000 3300005356 Bacteria 2650
98 Ga0070673_100046302 3300005364 Bacteria 3377
99 Ga0070673_100146969 3300005364 Bacteria 1993
100 Ga0070673_100243232 3300005364 Bacteria 1565
101 Ga0070688_100049953 3300005365 Bacteria 2604
102 Ga0070688_100201968 3300005365 Bacteria 1391
103 Ga0070659_100187177 3300005366 Bacteria 1701
104 Ga0070659_100208652 3300005366 Bacteria 1609
105 Ga0070659_100351996 3300005366 Bacteria 1236
106 Ga0070667_100016643 3300005367 Bacteria 6086
107 Ga0070667_100023158 3300005367 Bacteria 5151
108 Ga0070667_100212242 3300005367 Bacteria 1721
109 Ga0070667_100327871 3300005367 Bacteria 1382
110 Ga0070701_10000399 3300005438 Bacteria 14648
111 Ga0070705_100029021 3300005440 Bacteria 3036
112 Ga0070705_100071961 3300005440 Bacteria 2093
113 Ga0070700_100000695 3300005441 Bacteria 16626
114 Ga0070700_100003268 3300005441 Bacteria 8350
115 Ga0070700_100075600 3300005441 Bacteria 2161
116 Ga0070694_100091408 3300005444 Bacteria 2136
117 Ga0070694_100096346 3300005444 Bacteria 2085
118 Ga0070694_100110515 3300005444 Bacteria 1957
119 Ga0070694_100190004 3300005444 Bacteria 1524
120 Ga0070678_100006239 3300005456 Bacteria 6975
121 Ga0070678_100068048 3300005456 Bacteria 2653
122 Ga0070678_100189130 3300005456 Bacteria 1691
123 Ga0070662_100017313 3300005457 Bacteria 4857
124 Ga0070662_100048475 3300005457 Bacteria 3060
125 Ga0070662_100081313 3300005457 Bacteria 2413
126 Ga0070681_10000131 3300005458 Bacteria 56441
127 Ga0070681_10001310 3300005458 Bacteria 21725
128 Ga0070681_10011104 3300005458 Bacteria 8913
129 Ga0070681_10479521 3300005458 Bacteria 1156
130 Ga0068867_100001930 3300005459 Bacteria 14446
131 Ga0068867_100002071 3300005459 Bacteria 14068
132 Ga0068867_100002251 3300005459 Bacteria 13569
133 Ga0068867_100005640 3300005459 Bacteria 8872
134 Ga0068867_100049124 3300005459 Bacteria 3105
135 Ga0068867_100107037 3300005459 Bacteria 2143
136 Ga0068867_100184517 3300005459 Bacteria 1661
137 Ga0068867_100362023 3300005459 Bacteria 1213
138 Ga0070685_10062721 3300005466 Bacteria 2180
139 Ga0070706_100000463 3300005467 Bacteria 48079
140 Ga0070706_100328109 3300005467 Bacteria 1427
141 Ga0070706_100544038 3300005467 Bacteria 1080
142 Ga0070707_100084821 3300005468 Bacteria 3061
143 Ga0070707_100232052 3300005468 Bacteria 1796
144 Ga0070707_100670418 3300005468 Bacteria 1000
145 Ga0070699_100007582 3300005518 Bacteria 9436
146 Ga0070699_100477240 3300005518 Bacteria 1132
147 Ga0070699_100621188 3300005518 Bacteria 986
148 Ga0070679_100008624 3300005530 Bacteria 9608
149 Ga0070679_100025341 3300005530 Bacteria 5820
150 Ga0070679_100048778 3300005530 Bacteria 4218
151 Ga0070679_100051692 3300005530 Bacteria 4093
152 Ga0070679_100148794 3300005530 Bacteria 2319
153 Ga0070679_100623511 3300005530 Bacteria 1022
154 Ga0070684_100074042 3300005535 Bacteria 3002
155 Ga0070684_100100602 3300005535 Bacteria 2582
156 Ga0070697_100000561 3300005536 Bacteria 27986
157 Ga0068853_100019963 3300005539 Bacteria 5566
158 Ga0068853_100029057 3300005539 Bacteria 4656
159 Ga0068853_100037525 3300005539 Bacteria 4123
160 Ga0068853_100216257 3300005539 Bacteria 1748
161 Ga0070672_100007718 3300005543 Bacteria 7327
162 Ga0070672_100016975 3300005543 Bacteria 5226
163 Ga0070672_100102772 3300005543 Bacteria 2320
164 Ga0070686_100000265 3300005544 Bacteria 35750
165 Ga0070686_100049881 3300005544 Bacteria 2657
166 Ga0070686_100064529 3300005544 Bacteria 2376
167 Ga0070686_100302585 3300005544 Bacteria 1186
168 Ga0070686_100320429 3300005544 Bacteria 1156
169 Ga0070695_100010977 3300005545 Bacteria 5415
170 Ga0070695_100232474 3300005545 Bacteria 1333
171 Ga0070696_100000037 3300005546 Bacteria 62186
172 Ga0070696_100000395 3300005546 Bacteria 26958
173 Ga0070696_100009221 3300005546 Bacteria 6605
174 Ga0070696_100090356 3300005546 Bacteria 2179
175 Ga0070696_100255838 3300005546 Bacteria 1326
176 Ga0070696_100268856 3300005546 Bacteria 1296
177 Ga0070693_100009214 3300005547 Bacteria 4904
178 Ga0070693_100012997 3300005547 Bacteria 4228
179 Ga0070704_100019475 3300005549 Bacteria 4360
180 Ga0070704_100092483 3300005549 Bacteria 2258
181 Ga0068855_100004649 3300005563 Bacteria 16756
182 Ga0068855_100004857 3300005563 Bacteria 16412
183 Ga0068855_100010307 3300005563 Bacteria 11273
184 Ga0068855_100040261 3300005563 Bacteria 5547
185 Ga0068855_100052158 3300005563 Bacteria 4816
186 Ga0068855_100071465 3300005563 Bacteria 4035
187 Ga0068855_100126648 3300005563 Bacteria 2920
188 Ga0068855_100271508 3300005563 Bacteria 1886
189 Ga0068857_100050189 3300005577 Bacteria 3702
190 Ga0068857_100146465 3300005577 Bacteria 2137
191 Ga0068857_100197346 3300005577 Bacteria 1834
192 Ga0068854_100232915 3300005578 Bacteria 1463
193 Ga0068856_100014722 3300005614 Bacteria 7549
194 Ga0068856_100030042 3300005614 Bacteria 5312
195 Ga0068856_100062381 3300005614 Bacteria 3682
196 Ga0068856_100084723 3300005614 Bacteria 3149
197 Ga0068856_100091182 3300005614 Bacteria 3032
198 Ga0068856_100282997 3300005614 Bacteria 1675
199 Ga0070702_100000223 3300005615 Bacteria 19138
200 Ga0070702_100089046 3300005615 Bacteria 1867
201 Ga0068852_100028336 3300005616 Bacteria 4582
202 Ga0068852_100037752 3300005616 Bacteria 4053
203 Ga0068852_100090940 3300005616 Bacteria 2730
204 Ga0068852_100118933 3300005616 Bacteria 2415
205 Ga0068852_100403561 3300005616 Bacteria 1345
206 Ga0068859_100000813 3300005617 Bacteria 31757
207 Ga0068859_100003358 3300005617 Bacteria 16282
208 Ga0068859_100019167 3300005617 Bacteria 6872
209 Ga0068859_100022929 3300005617 Bacteria 6260
210 Ga0068859_100095785 3300005617 Bacteria 3021
211 Ga0068859_100141218 3300005617 Bacteria 2482
212 Ga0068859_100169103 3300005617 Bacteria 2267
213 Ga0068864_100002065 3300005618 Bacteria 16597
214 Ga0068864_100031868 3300005618 Bacteria 4475
215 Ga0068864_100066296 3300005618 Bacteria 3133
216 Ga0068864_100093008 3300005618 Bacteria 2663
217 Ga0068864_100094644 3300005618 Bacteria 2640
218 Ga0068866_10000107 3300005718 Bacteria 35562
219 Ga0068866_10003257 3300005718 Bacteria 6683
220 Ga0068866_10007229 3300005718 Bacteria 4645
221 Ga0068866_10085870 3300005718 Bacteria 1701
222 Ga0068861_100001908 3300005719 Bacteria 13422
223 Ga0068861_100003286 3300005719 Bacteria 10701
224 Ga0068861_100005730 3300005719 Bacteria 8421
225 Ga0068861_100016185 3300005719 Bacteria 5271
226 Ga0068851_10000590 3300005834 Bacteria 15755
227 Ga0068851_10006836 3300005834 Bacteria 5222
228 Ga0068851_10025366 3300005834 Bacteria 2908
229 Ga0068870_10005307 3300005840 Bacteria 5615
230 Ga0068863_100020937 3300005841 Bacteria 6246
231 Ga0068863_100031484 3300005841 Bacteria 5060
232 Ga0068863_100059870 3300005841 Bacteria 3603
233 Ga0068863_100126062 3300005841 Bacteria 2443
234 Ga0068863_100227676 3300005841 Bacteria 1798
235 Ga0068863_100263155 3300005841 Bacteria 1668
236 Ga0068858_100002059 3300005842 Bacteria 20475
237 Ga0068858_100002634 3300005842 Bacteria 18080
238 Ga0068858_100009260 3300005842 Bacteria 9405
239 Ga0068858_100015823 3300005842 Bacteria 7091
240 Ga0068858_100720873 3300005842 Bacteria 971
241 Ga0068860_100000823 3300005843 Bacteria 34706
242 Ga0068860_100002377 3300005843 Bacteria 19765
243 Ga0068860_100010005 3300005843 Bacteria 9401
244 Ga0068860_100013908 3300005843 Bacteria 7890
245 Ga0068860_100077614 3300005843 Bacteria 3159
246 Ga0068862_100000524 3300005844 Bacteria 40510
247 Ga0068862_100004134 3300005844 Bacteria 12303
248 Ga0068862_100053550 3300005844 Bacteria 3455
249 Ga0068862_100069467 3300005844 Bacteria 3041
250 Ga0068862_100074012 3300005844 Bacteria 2944
251 Ga0068862_100617182 3300005844 Bacteria 1043
252 Ga0081539_10000770 3300005985 Bacteria 62993
253 Ga0075365_10006791 3300006038 Bacteria 6337
254 Ga0075365_10060700 3300006038 Bacteria 2523
255 Ga0075368_10000729 3300006042 Bacteria 10069
256 Ga0075363_100006078 3300006048 Bacteria 5447
257 Ga0075363_100013051 3300006048 Bacteria 4016
258 Ga0075363_100017008 3300006048 Bacteria 3600
259 Ga0075363_100021733 3300006048 Bacteria 3237
260 Ga0075363_100023200 3300006048 Bacteria 3142
261 Ga0075432_10036342 3300006058 Bacteria 1712
262 Ga0070715_10052184 3300006163 Bacteria 1763
263 Ga0070715_10075341 3300006163 Bacteria 1518
264 Ga0075362_10006328 3300006177 Bacteria 4409
265 Ga0075362_10009223 3300006177 Bacteria 3806
266 Ga0075362_10140226 3300006177 Bacteria 1155
267 Ga0075369_10006559 3300006186 Bacteria 4403
268 Ga0075369_10065462 3300006186 Bacteria 1593
269 Ga0075366_10001345 3300006195 Bacteria 12278
270 Ga0075366_10003111 3300006195 Bacteria 8677
271 Ga0075366_10004891 3300006195 Bacteria 7226
272 Ga0075366_10005480 3300006195 Bacteria 6878
273 Ga0075366_10007403 3300006195 Bacteria 6062
274 Ga0075366_10070270 3300006195 Bacteria 2085
275 Ga0075366_10081257 3300006195 Bacteria 1936
276 Ga0075366_10082938 3300006195 Bacteria 1916
277 Ga0075366_10085706 3300006195 Bacteria 1884
278 Ga0075366_10119078 3300006195 Bacteria 1590
279 Ga0075366_10256797 3300006195 Bacteria 1066
280 Ga0097621_100001105 3300006237 Bacteria 18836
281 Ga0097621_100004475 3300006237 Bacteria 9740
282 Ga0097621_100004893 3300006237 Bacteria 9390
283 Ga0097621_100011516 3300006237 Bacteria 6517
284 Ga0097621_100015018 3300006237 Bacteria 5814
285 Ga0097621_100028244 3300006237 Bacteria 4421
286 Ga0097621_100041619 3300006237 Bacteria 3699
287 Ga0097621_100093501 3300006237 Bacteria 2520
288 Ga0097621_100271698 3300006237 Bacteria 1490
289 Ga0075370_10001747 3300006353 Bacteria 9677
290 Ga0075370_10002909 3300006353 Bacteria 8042
291 Ga0075370_10008912 3300006353 Bacteria 5184
292 Ga0075370_10018941 3300006353 Bacteria 3739
293 Ga0075370_10029361 3300006353 Bacteria 3063
294 Ga0075370_10035374 3300006353 Bacteria 2803
295 Ga0068871_100001255 3300006358 Bacteria 16960
296 Ga0068871_100005726 3300006358 Bacteria 8725
297 Ga0068871_100005895 3300006358 Bacteria 8616
298 Ga0068871_100007755 3300006358 Bacteria 7686
299 Ga0068871_100041620 3300006358 Bacteria 3684
300 Ga0068871_100102463 3300006358 Bacteria 2399
301 Ga0068871_100148527 3300006358 Bacteria 1998
302 Ga0075428_100046009 3300006844 Bacteria 4794
303 Ga0075428_100156306 3300006844 Bacteria 2477
304 Ga0075428_100161138 3300006844 Bacteria 2435
305 Ga0075430_100004390 3300006846 Bacteria 11907
306 Ga0075430_100023926 3300006846 Bacteria 5201
307 Ga0075430_100125945 3300006846 Bacteria 2135
308 Ga0075430_100232229 3300006846 Bacteria 1529
309 Ga0075430_100294579 3300006846 Bacteria 1342
310 Ga0075431_100055531 3300006847 Bacteria 4085
311 Ga0075431_100130231 3300006847 Bacteria 2595
312 Ga0075431_100216257 3300006847 Bacteria 1956
313 Ga0075431_100370035 3300006847 Bacteria 1438
314 Ga0075433_10015306 3300006852 Bacteria 6287
315 Ga0075433_10025822 3300006852 Bacteria 4967
316 Ga0075433_10161312 3300006852 Bacteria 1996
317 Ga0075433_10282682 3300006852 Bacteria 1470
318 Ga0075434_100000169 3300006871 Bacteria 41864
319 Ga0075434_100002533 3300006871 Bacteria 16119
320 Ga0075434_100044170 3300006871 Bacteria 4421
321 Ga0075434_100420951 3300006871 Bacteria 1357
322 Ga0075429_100000043 3300006880 Bacteria 57531
323 Ga0075429_100000297 3300006880 Bacteria 35129
324 Ga0075429_100031540 3300006880 Bacteria 4607
325 Ga0068865_100000281 3300006881 Bacteria 28119
326 Ga0068865_100000467 3300006881 Bacteria 22595
327 Ga0068865_100022066 3300006881 Bacteria 4146
328 Ga0068865_100047195 3300006881 Bacteria 2958
329 Ga0068865_100369920 3300006881 Bacteria 1166
330 Ga0075436_100000735 3300006914 Bacteria 21703
331 Ga0075436_100000989 3300006914 Bacteria 19059
332 Ga0075436_100002087 3300006914 Bacteria 13796
333 Ga0075436_100037921 3300006914 Bacteria 3327
334 Ga0097620_100000813 3300006931 Bacteria 31757
335 Ga0097620_100003358 3300006931 Bacteria 16282
336 Ga0097620_100019167 3300006931 Bacteria 6872
337 Ga0097620_100022929 3300006931 Bacteria 6260
338 Ga0097620_100095785 3300006931 Bacteria 3021
339 Ga0097620_100141215 3300006931 Bacteria 2482
340 Ga0097620_100154088 3300006931 Bacteria 2374
341 Ga0097620_100169112 3300006931 Bacteria 2267
342 Ga0079104_1000055 3300006946 Bacteria 166522
343 Ga0079104_1024414 3300006946 Bacteria 1592
344 Ga0099826_10000006 3300006948 Bacteria 432260
345 Ga0099826_10001433 3300006948 Bacteria 14295
346 Ga0099826_10047540 3300006948 Bacteria 2914
347 Ga0075435_100000193 3300007076 Bacteria 36806
348 Ga0075435_100003462 3300007076 Bacteria 10703
349 Ga0075435_100067670 3300007076 Bacteria 2908
350 Ga0075435_100158163 3300007076 Bacteria 1908
351 Ga0075435_100273683 3300007076 Bacteria 1441
352 Ga0075435_100327130 3300007076 Bacteria 1312
353 Ga0099794_10009590 3300007265 Bacteria 4080
354 Ga0099794_10040107 3300007265 Bacteria 2225
355 Ga0099794_10151403 3300007265 Bacteria 1178
356 Ga0099795_10004388 3300007788 Bacteria 3633
357 Ga0099795_10047104 3300007788 Bacteria 1556
358 Ga0105244_10011385 3300009036 Bacteria 5338
359 Ga0105250_10005158 3300009092 Bacteria 5895
360 Ga0105250_10098696 3300009092 Bacteria 1191
361 Ga0105240_10025383 3300009093 Bacteria 7788
362 Ga0105240_10083354 3300009093 Bacteria 3924
363 Ga0105240_10168408 3300009093 Bacteria 2597
364 Ga0105240_10196995 3300009093 Bacteria 2364
365 Ga0105240_10221311 3300009093 Bacteria 2205
366 Ga0111539_10157611 3300009094 Bacteria 2656
367 Ga0111539_10169618 3300009094 Bacteria 2550
368 Ga0105245_10000511 3300009098 Bacteria 35566
369 Ga0105245_10002551 3300009098 Bacteria 16405
370 Ga0105245_10037219 3300009098 Bacteria 4326
371 Ga0105245_10299143 3300009098 Bacteria 1578
372 Ga0105245_10307068 3300009098 Bacteria 1559
373 Ga0105245_10453394 3300009098 Bacteria 1291
374 Ga0105247_10375689 3300009101 Bacteria 1006
375 Ga0114129_10012381 3300009147 Bacteria 12143
376 Ga0105243_10000784 3300009148 Bacteria 30492
377 Ga0105243_10001212 3300009148 Bacteria 23228
378 Ga0105243_10002490 3300009148 Bacteria 15370
379 Ga0105243_10006331 3300009148 Bacteria 9144
380 Ga0105243_10011373 3300009148 Bacteria 6735
381 Ga0105243_10012444 3300009148 Bacteria 6432
382 Ga0105243_10012837 3300009148 Bacteria 6330
383 Ga0105243_10075673 3300009148 Bacteria 2733
384 Ga0105243_10091340 3300009148 Bacteria 2507
385 Ga0105243_10258984 3300009148 Bacteria 1557
386 Ga0105241_10261988 3300009174 Bacteria 1469
387 Ga0105241_10454797 3300009174 Bacteria 1133
388 Ga0105242_10002499 3300009176 Bacteria 14416
389 Ga0105242_10002648 3300009176 Bacteria 14033
390 Ga0105242_10025474 3300009176 Bacteria 4682
391 Ga0105242_10304536 3300009176 Bacteria 1456
392 Ga0105242_10619299 3300009176 Bacteria 1048
393 Ga0105248_10000507 3300009177 Bacteria 44310
394 Ga0105248_10005804 3300009177 Bacteria 13570
395 Ga0105248_10074832 3300009177 Bacteria 3806
396 Ga0105248_10220347 3300009177 Bacteria 2136
397 Ga0105237_10098355 3300009545 Bacteria 2917
398 Ga0105237_10328713 3300009545 Bacteria 1533
399 Ga0105237_10757584 3300009545 Bacteria 977
400 Ga0105238_10062981 3300009551 Bacteria 3709
401 Ga0105238_10130674 3300009551 Bacteria 2489
402 Ga0105249_10014809 3300009553 Bacteria 6894
403 Ga0105249_10031885 3300009553 Bacteria 4768
404 Ga0105249_10051098 3300009553 Bacteria 3770
405 Ga0105249_10395340 3300009553 Bacteria 1411
406 Ga0105239_10136528 3300010375 Bacteria 2730
407 Ga0105239_10238061 3300010375 Bacteria 2043
408 Ga0105246_10307291 3300011119 Bacteria 1283
409 Ga0157370_10004427 3300013104 Bacteria 16097
410 Ga0157370_10009369 3300013104 Bacteria 10474
411 Ga0157370_10075515 3300013104 Bacteria 3177
412 Ga0157370_10225610 3300013104 Bacteria 1734
413 Ga0157370_10242427 3300013104 Bacteria 1668
414 Ga0157369_10003852 3300013105 Bacteria 17828
415 Ga0157369_10366954 3300013105 Bacteria 1495
416 Ga0157369_10540983 3300013105 Bacteria 1204
417 Ga0157374_10101114 3300013296 Bacteria 2764
418 Ga0157378_10000797 3300013297 Bacteria 29325
419 Ga0157378_10001703 3300013297 Bacteria 19776
420 Ga0157378_10003052 3300013297 Bacteria 14881
421 Ga0157378_10123159 3300013297 Unclassified 2392
422 Ga0163162_10002252 3300013306 Bacteria 18114
423 Ga0163162_10015531 3300013306 Bacteria 7442
424 Ga0163162_10084437 3300013306 Bacteria 3251
425 Ga0163162_10132115 3300013306 Bacteria 2605
426 Ga0163162_10176828 3300013306 Bacteria 2260
427 Ga0163162_10277668 3300013306 Bacteria 1807
428 Ga0157372_10037717 3300013307 Bacteria 5332
429 Ga0157372_10222146 3300013307 Bacteria 2189
430 Ga0157372_10836713 3300013307 Bacteria 1069
431 Ga0157375_10025703 3300013308 Bacteria 5478
432 Ga0157375_10026436 3300013308 Bacteria 5409
433 Ga0157375_10048298 3300013308 Bacteria 4162
434 Ga0157375_10049801 3300013308 Bacteria 4106
435 Ga0157375_10097080 3300013308 Bacteria 3020
436 Ga0157375_10152670 3300013308 Bacteria 2446
437 Ga0157375_10161194 3300013308 Bacteria 2385
438 Ga0157375_10311946 3300013308 Bacteria 1737
439 Ga0157375_10425325 3300013308 Bacteria 1494
440 Ga0163163_10009458 3300014325 Bacteria 8703
441 Ga0163163_10180537 3300014325 Bacteria 2158
442 Ga0163163_10318039 3300014325 Bacteria 1610
443 Ga0157380_10010570 3300014326 Bacteria 6638
444 Ga0157380_10014505 3300014326 Bacteria 5766
445 Ga0157380_10022401 3300014326 Bacteria 4755
446 Ga0157380_10049076 3300014326 Bacteria 3327
447 Ga0182008_10003127 3300014497 Bacteria 10128
448 Ga0182008_10004233 3300014497 Bacteria 8415
449 Ga0182008_10017487 3300014497 Bacteria 3720
450 Ga0182008_10028571 3300014497 Bacteria 2820
451 Ga0182008_10060779 3300014497 Bacteria 1862
452 Ga0157377_10041231 3300014745 Bacteria 2560
453 Ga0157377_10254452 3300014745 Bacteria 1140
454 Ga0157377_10283613 3300014745 Bacteria 1087
455 Ga0157377_10350801 3300014745 Bacteria 990
456 Ga0157379_10021513 3300014968 Bacteria 5710
457 Ga0157379_10070089 3300014968 Bacteria 3136
458 Ga0157379_10136617 3300014968 Bacteria 2209
459 Ga0157376_10004974 3300014969 Bacteria 9267
460 Ga0157376_10007718 3300014969 Bacteria 7707
461 Ga0182006_1000030 3300015261 Bacteria 242894
462 Ga0182006_1001066 3300015261 Bacteria 17656
463 Ga0182006_1008458 3300015261 Bacteria 4662
464 Ga0182007_10002485 3300015262 Bacteria 9137
465 Ga0182007_10021578 3300015262 Bacteria 2285
466 Ga0182005_1036334 3300015265 Bacteria 1340
467 Ga0183362_10003 3300015683 Bacteria 977584
468 Ga0163161_10000099 3300017792 Bacteria 83318
469 Ga0163161_10011306 3300017792 Bacteria 6186
470 Ga0163161_10020762 3300017792 Bacteria 4611
471 Ga0163161_10028787 3300017792 Bacteria 3947
472 Ga0163161_10067857 3300017792 Bacteria 2605
473 Ga0163161_10183408 3300017792 Bacteria 1606
474 Ga0163161_10334952 3300017792 Bacteria 1199
475 Ga0213872_10000169 3300021361 Bacteria 58596
476 Ga0213872_10000382 3300021361 Bacteria 37031
477 Ga0213872_10003263 3300021361 Bacteria 9053
478 Ga0213874_10021161 3300021377 Bacteria 1791
479 Ga0213876_10030362 3300021384 Bacteria 2851
480 Ga0209435_100002 3300025206 Bacteria 794178
481 Ga0209672_100660 3300025228 Bacteria 17534
482 Ga0209147_101111 3300025229 Bacteria 11165
483 Ga0209258_100240 3300025242 Bacteria 100990
484 Ga0209646_1000001 3300025246 Bacteria 3092932
485 Ga0209026_1000001 3300025250 Bacteria 1228671
486 Ga0209148_1000033 3300025254 Bacteria 555508
487 Ga0209759_1000001 3300025256 Bacteria 2799452
488 Ga0209129_1000054 3300025258 Bacteria 261997
489 Ga0209565_1000224 3300025263 Bacteria 63468
490 Ga0209565_1001443 3300025263 Bacteria 10500
491 Ga0209673_1000097 3300025273 Bacteria 193482
492 Ga0209673_1000172 3300025273 Bacteria 133472
493 Ga0209673_1002773 3300025273 Bacteria 11415
494 Ga0209673_1026389 3300025273 Bacteria 1909
495 Ga0209673_1027409 3300025273 Bacteria 1853
496 Ga0209130_1000832 3300025284 Bacteria 25922
497 Ga0209130_1001095 3300025284 Bacteria 20107
498 Ga0209130_1001276 3300025284 Bacteria 17456
499 Ga0209675_1000038 3300025291 Bacteria 250481
500 Ga0209675_1000431 3300025291 Bacteria 33567
501 Ga0209676_1000048 3300025292 Bacteria 403716
502 Ga0209676_1000739 3300025292 Bacteria 44487
503 Ga0209676_1000836 3300025292 Bacteria 39908
504 Ga0209676_1005062 3300025292 Bacteria 7045
505 Ga0209676_1016772 3300025292 Bacteria 2627
506 Ga0209025_1000174 3300025294 Bacteria 158915
507 Ga0209025_1000906 3300025294 Bacteria 45842
508 Ga0209025_1001066 3300025294 Bacteria 39849
509 Ga0209025_1034199 3300025294 Bacteria 2328
510 Ga0209025_1057319 3300025294 Bacteria 1490
511 Ga0209758_1000034 3300025297 Bacteria 467637
512 Ga0209758_1009180 3300025297 Bacteria 6217
513 Ga0209050_1000012 3300025298 Bacteria 813717
514 Ga0209050_1001075 3300025298 Bacteria 33506
515 Ga0209050_1005184 3300025298 Bacteria 8337
516 Ga0209256_1000035 3300025299 Bacteria 386754
517 Ga0209256_1000103 3300025299 Bacteria 193900
518 Ga0209256_1000165 3300025299 Bacteria 135104
519 Ga0207426_1000058 3300025302 Bacteria 363857
520 Ga0207426_1000067 3300025302 Bacteria 342108
521 Ga0209051_1000019 3300025303 Bacteria 511268
522 Ga0209051_1000099 3300025303 Bacteria 165161
523 Ga0209051_1000221 3300025303 Bacteria 96174
524 Ga0209051_1000315 3300025303 Bacteria 73579
525 Ga0209051_1000452 3300025303 Bacteria 54387
526 Ga0209051_1001491 3300025303 Bacteria 19599
527 Ga0209051_1009063 3300025303 Bacteria 5176
528 Ga0209257_1000024 3300025304 Bacteria 726068
529 Ga0209257_1000047 3300025304 Bacteria 460507
530 Ga0209257_1000057 3300025304 Bacteria 396985
531 Ga0209257_1000309 3300025304 Bacteria 104166
532 Ga0209257_1006026 3300025304 Bacteria 8101
533 Ga0209257_1006654 3300025304 Bacteria 7336
534 Ga0209257_1019426 3300025304 Bacteria 2559
535 Ga0207697_10012918 3300025315 Bacteria 3491
536 Ga0207656_10002493 3300025321 Bacteria 6219
537 Ga0207656_10023459 3300025321 Bacteria 2486
538 Ga0207656_10028846 3300025321 Bacteria 2281
539 Ga0207696_1002665 3300025711 Bacteria 8578
540 Ga0207655_1000639 3300025728 Bacteria 41880
541 Ga0207642_10000059 3300025899 Bacteria 32214
542 Ga0207642_10001537 3300025899 Bacteria 7094
543 Ga0207642_10018424 3300025899 Bacteria 2679
544 Ga0207642_10108463 3300025899 Bacteria 1409
545 Ga0207642_10109080 3300025899 Bacteria 1406
546 Ga0207688_10074185 3300025901 Bacteria 1934
547 Ga0207688_10210137 3300025901 Bacteria 1169
548 Ga0207680_10002140 3300025903 Bacteria 9255
549 Ga0207680_10056159 3300025903 Bacteria 2377
550 Ga0207685_10083974 3300025905 Bacteria 1325
551 Ga0207645_10037643 3300025907 Bacteria 3104
552 Ga0207645_10056575 3300025907 Bacteria 2504
553 Ga0207643_10072392 3300025908 Bacteria 1985
554 Ga0207705_10027726 3300025909 Bacteria 4040
555 Ga0207705_10279860 3300025909 Bacteria 1277
556 Ga0207654_10049621 3300025911 Bacteria 2408
557 Ga0207654_10199505 3300025911 Bacteria 1316
558 Ga0207654_10332635 3300025911 Bacteria 1041
559 Ga0207707_10010652 3300025912 Bacteria 7988
560 Ga0207707_10037440 3300025912 Bacteria 4240
561 Ga0207707_10128622 3300025912 Bacteria 2215
562 Ga0207707_10340259 3300025912 Bacteria 1294
563 Ga0207695_10071845 3300025913 Bacteria 3533
564 Ga0207695_10129241 3300025913 Bacteria 2485
565 Ga0207660_10005092 3300025917 Bacteria 8559
566 Ga0207660_10035234 3300025917 Bacteria 3473
567 Ga0207660_10071742 3300025917 Bacteria 2520
568 Ga0207660_10294245 3300025917 Bacteria 1291
569 Ga0207662_10000258 3300025918 Bacteria 24573
570 Ga0207662_10032494 3300025918 Bacteria 3039
571 Ga0207662_10081302 3300025918 Bacteria 1977
572 Ga0207657_10025234 3300025919 Bacteria 5485
573 Ga0207649_10003399 3300025920 Bacteria 8699
574 Ga0207652_10030048 3300025921 Bacteria 4548
575 Ga0207652_10046373 3300025921 Bacteria 3708
576 Ga0207652_10403426 3300025921 Bacteria 1233
577 Ga0207652_10606648 3300025921 Bacteria 981
578 Ga0207646_10134671 3300025922 Bacteria 2224
579 Ga0207646_10166669 3300025922 Bacteria 1989
580 Ga0207646_10355344 3300025922 Bacteria 1324
581 Ga0207646_10474246 3300025922 Bacteria 1128
582 Ga0207681_10000424 3300025923 Bacteria 29435
583 Ga0207681_10019120 3300025923 Bacteria 4325
584 Ga0207681_10041269 3300025923 Bacteria 3075
585 Ga0207694_10083398 3300025924 Bacteria 2513
586 Ga0207650_10006179 3300025925 Bacteria 8164
587 Ga0207650_10284363 3300025925 Bacteria 1347
588 Ga0207659_10020943 3300025926 Bacteria 4331
589 Ga0207659_10042740 3300025926 Bacteria 3179
590 Ga0207659_10114883 3300025926 Bacteria 2052
591 Ga0207687_10000254 3300025927 Bacteria 36273
592 Ga0207687_10002550 3300025927 Bacteria 12371
593 Ga0207687_10083007 3300025927 Bacteria 2319
594 Ga0207687_10101678 3300025927 Bacteria 2116
595 Ga0207644_10000264 3300025931 Bacteria 35311
596 Ga0207644_10002654 3300025931 Bacteria 11522
597 Ga0207644_10014945 3300025931 Bacteria 5204
598 Ga0207644_10523931 3300025931 Bacteria 979
599 Ga0207690_10110969 3300025932 Bacteria 1975
600 Ga0207706_10013512 3300025933 Bacteria 7420
601 Ga0207706_10031863 3300025933 Bacteria 4696
602 Ga0207706_10082110 3300025933 Bacteria 2833
603 Ga0207706_10332277 3300025933 Bacteria 1322
604 Ga0207686_10000084 3300025934 Bacteria 79402
605 Ga0207686_10023994 3300025934 Bacteria 3528
606 Ga0207686_10052906 3300025934 Bacteria 2536
607 Ga0207686_10192202 3300025934 Bacteria 1456
608 Ga0207709_10000111 3300025935 Bacteria 127580
609 Ga0207709_10000608 3300025935 Bacteria 29634
610 Ga0207709_10001030 3300025935 Bacteria 20608
611 Ga0207709_10001599 3300025935 Bacteria 15434
612 Ga0207709_10002253 3300025935 Bacteria 12260
613 Ga0207709_10003776 3300025935 Bacteria 8901
614 Ga0207709_10009256 3300025935 Bacteria 5425
615 Ga0207709_10018818 3300025935 Bacteria 3873
616 Ga0207709_10019289 3300025935 Bacteria 3832
617 Ga0207709_10036017 3300025935 Bacteria 2930
618 Ga0207709_10234187 3300025935 Bacteria 1332
619 Ga0207670_10007649 3300025936 Bacteria 6048
620 Ga0207670_10021569 3300025936 Bacteria 3977
621 Ga0207670_10041074 3300025936 Bacteria 3040
622 Ga0207669_10020526 3300025937 Bacteria 3467
623 Ga0207669_10042801 3300025937 Bacteria 2647
624 Ga0207704_10000722 3300025938 Bacteria 14494
625 Ga0207704_10001711 3300025938 Bacteria 9812
626 Ga0207704_10003689 3300025938 Bacteria 6966
627 Ga0207704_10010623 3300025938 Bacteria 4498
628 Ga0207704_10046802 3300025938 Bacteria 2581
629 Ga0207704_10068335 3300025938 Bacteria 2239
630 Ga0207691_10018804 3300025940 Bacteria 6544
631 Ga0207691_10066785 3300025940 Bacteria 3253
632 Ga0207691_10073889 3300025940 Bacteria 3075
633 Ga0207691_10092293 3300025940 Bacteria 2711
634 Ga0207691_10107652 3300025940 Bacteria 2481
635 Ga0207691_10276318 3300025940 Bacteria 1446
636 Ga0207711_10003550 3300025941 Bacteria 13509
637 Ga0207711_10010810 3300025941 Bacteria 7587
638 Ga0207711_10048589 3300025941 Bacteria 3630
639 Ga0207689_10000872 3300025942 Bacteria 29094
640 Ga0207689_10003506 3300025942 Bacteria 14336
641 Ga0207689_10051064 3300025942 Bacteria 3409
642 Ga0207689_10135887 3300025942 Bacteria 2025
643 Ga0207689_10159270 3300025942 Bacteria 1860
644 Ga0207689_10374332 3300025942 Bacteria 1185
645 Ga0207661_10037982 3300025944 Bacteria 3771
646 Ga0207679_10201745 3300025945 Bacteria 1662
647 Ga0207679_10211630 3300025945 Bacteria 1626
648 Ga0207667_10013717 3300025949 Bacteria 9262
649 Ga0207667_10018933 3300025949 Bacteria 7702
650 Ga0207667_10032117 3300025949 Bacteria 5660
651 Ga0207667_10127841 3300025949 Bacteria 2617
652 Ga0207667_10206964 3300025949 Bacteria 2011
653 Ga0207667_10368586 3300025949 Bacteria 1464
654 Ga0207667_10664660 3300025949 Bacteria 1046
655 Ga0207651_10004672 3300025960 Bacteria 6942
656 Ga0207651_10036834 3300025960 Bacteria 3199
657 Ga0207651_10165825 3300025960 Bacteria 1737
658 Ga0207651_10389188 3300025960 Bacteria 1183
659 Ga0207712_10009623 3300025961 Bacteria 6121
660 Ga0207712_10014447 3300025961 Bacteria 5081
661 Ga0207668_10002951 3300025972 Bacteria 9967
662 Ga0207668_10084418 3300025972 Bacteria 2314
663 Ga0207658_10002509 3300025986 Bacteria 13356
664 Ga0207658_10010175 3300025986 Bacteria 6393
665 Ga0207658_10176662 3300025986 Bacteria 1764
666 Ga0207677_10001522 3300026023 Bacteria 12255
667 Ga0207677_10010555 3300026023 Bacteria 5234
668 Ga0207677_10047763 3300026023 Bacteria 2876
669 Ga0207677_10181062 3300026023 Bacteria 1658
670 Ga0207677_10197871 3300026023 Bacteria 1595
671 Ga0207677_10390810 3300026023 Bacteria 1177
672 Ga0207703_10001789 3300026035 Bacteria 19164
673 Ga0207703_10001816 3300026035 Bacteria 19028
674 Ga0207703_10006009 3300026035 Bacteria 9719
675 Ga0207703_10016897 3300026035 Bacteria 5692
676 Ga0207639_10009069 3300026041 Bacteria 6854
677 Ga0207639_10165449 3300026041 Bacteria 1868
678 Ga0207678_10312806 3300026067 Bacteria 1350
679 Ga0207708_10000049 3300026075 Bacteria 114743
680 Ga0207708_10003647 3300026075 Bacteria 11354
681 Ga0207708_10004718 3300026075 Bacteria 10026
682 Ga0207708_10078562 3300026075 Bacteria 2534
683 Ga0207702_10012590 3300026078 Bacteria 7040
684 Ga0207702_10020851 3300026078 Bacteria 5422
685 Ga0207702_10146847 3300026078 Bacteria 2141
686 Ga0207702_10314205 3300026078 Bacteria 1491
687 Ga0207702_10449591 3300026078 Bacteria 1250
688 Ga0207702_10482142 3300026078 Bacteria 1207
689 Ga0207641_10001603 3300026088 Bacteria 22077
690 Ga0207641_10003329 3300026088 Bacteria 14294
691 Ga0207641_10263333 3300026088 Bacteria 1615
692 Ga0207641_10296484 3300026088 Bacteria 1526
693 Ga0207641_10389054 3300026088 Bacteria 1337
694 Ga0207648_10000018 3300026089 Bacteria 148157
695 Ga0207648_10000161 3300026089 Bacteria 69095
696 Ga0207648_10000179 3300026089 Bacteria 66602
697 Ga0207648_10000685 3300026089 Bacteria 37956
698 Ga0207648_10008674 3300026089 Bacteria 9809
699 Ga0207648_10023777 3300026089 Bacteria 5482
700 Ga0207648_10101337 3300026089 Bacteria 2524
701 Ga0207648_10293534 3300026089 Bacteria 1456
702 Ga0207648_10303785 3300026089 Bacteria 1431
703 Ga0207648_10327087 3300026089 Bacteria 1378
704 Ga0207676_10003295 3300026095 Bacteria 11473
705 Ga0207676_10018334 3300026095 Bacteria 5087
706 Ga0207676_10049237 3300026095 Bacteria 3276
707 Ga0207676_10157716 3300026095 Bacteria 1962
708 Ga0207676_10426060 3300026095 Bacteria 1245
709 Ga0207674_10071765 3300026116 Bacteria 3479
710 Ga0207674_10071832 3300026116 Bacteria 3477
711 Ga0207674_10077512 3300026116 Bacteria 3329
712 Ga0207674_10088100 3300026116 Bacteria 3097
713 Ga0207674_10203789 3300026116 Bacteria 1928
714 Ga0207675_100000050 3300026118 Bacteria 83832
715 Ga0207675_100000176 3300026118 Bacteria 57464
716 Ga0207675_100005391 3300026118 Bacteria 12258
717 Ga0207675_100007479 3300026118 Bacteria 10323
718 Ga0207675_100008096 3300026118 Bacteria 9902
719 Ga0207683_10008432 3300026121 Bacteria 8822
720 Ga0207683_10049731 3300026121 Bacteria 3671
721 Ga0207683_10051569 3300026121 Bacteria 3605
722 Ga0207683_10250689 3300026121 Bacteria 1616
723 Ga0207683_10656968 3300026121 Bacteria 971
724 Ga0207698_10012988 3300026142 Bacteria 5477
725 Ga0207698_10111682 3300026142 Bacteria 2292
726 Ga0207698_10116511 3300026142 Bacteria 2252
727 Ga0207698_10178809 3300026142 Bacteria 1877
728 Ga0207698_10231513 3300026142 Bacteria 1678
729 Ga0209281_1000007 3300027111 Bacteria 938265
730 Ga0209281_1017401 3300027111 Bacteria 1458
731 Ga0209967_1005313 3300027364 Bacteria 1727
732 Ga0209981_1003553 3300027378 Bacteria 2025
733 Ga0209996_1004923 3300027395 Bacteria 1705
734 Ga0210000_1001544 3300027462 Bacteria 3246
735 Ga0209995_1000178 3300027471 Bacteria 10190
736 Ga0209999_1002769 3300027543 Bacteria 3104
737 Ga0209282_1000003 3300027666 Bacteria 856377
738 Ga0209282_1000182 3300027666 Bacteria 34632
739 Ga0209588_1027037 3300027671 Bacteria 1824
740 Ga0209971_1016133 3300027682 Bacteria 1771
741 Ga0209974_10048164 3300027876 Bacteria 1428
742 Ga0209974_10071541 3300027876 Bacteria 1184
743 Ga0207428_10001240 3300027907 Bacteria 27326
744 Ga0207428_10052635 3300027907 Bacteria 3250
745 Ga0207428_10082070 3300027907 Bacteria 2516
746 Ga0268266_10259695 3300028379 Bacteria 1609
747 Ga0268265_10002096 3300028380 Bacteria 15499
748 Ga0268265_10013533 3300028380 Bacteria 5545
749 Ga0268265_10019192 3300028380 Bacteria 4747
750 Ga0268265_10040349 3300028380 Bacteria 3447
751 Ga0268265_10044723 3300028380 Bacteria 3299
752 Ga0268265_10386736 3300028380 Bacteria 1289
753 Ga0268265_10520437 3300028380 Bacteria 1124
754 Ga0268264_10000613 3300028381 Bacteria 42687
755 Ga0268264_10000848 3300028381 Bacteria 32647
756 Ga0268264_10001082 3300028381 Bacteria 26946
757 Ga0268264_10024923 3300028381 Bacteria 4888
758 Ga0268264_10054537 3300028381 Bacteria 3338
759 Ga0268264_10141041 3300028381 Bacteria 2149
760 Ga0265336_10000497 3300028666 Bacteria 22985
761 Ga0307515_10000609 3300028794 Bacteria 83557
762 Ga0307515_10001484 3300028794 Bacteria 52674
763 Ga0307515_10001693 3300028794 Bacteria 49203
764 Ga0307515_10004716 3300028794 Bacteria 27939
765 Ga0307515_10042972 3300028794 Bacteria 7045
766 Ga0307515_10074111 3300028794 Bacteria 4560
767 Ga0265324_10000004 3300029957 Bacteria 356972
768 Ga0265324_10001492 3300029957 Bacteria 13266
769 Ga0307511_10000804 3300030521 Bacteria 33483
770 Ga0316176_1084534 3300030732 Bacteria 3287
771 Ga0316183_1074932 3300030742 Bacteria 5514
772 Ga0316181_1111110 3300030744 Bacteria 3024
773 Ga0316182_1108560 3300030745 Bacteria 2118
774 Ga0265330_10000091 3300031235 Bacteria 76638
775 Ga0265332_10000028 3300031238 Bacteria 184029
776 Ga0265332_10032991 3300031238 Bacteria 2254
777 Ga0265325_10000133 3300031241 Bacteria 51600
778 Ga0265325_10002488 3300031241 Bacteria 12420
779 Ga0265325_10059895 3300031241 Bacteria 1935
780 Ga0265340_10036187 3300031247 Bacteria 2448
781 Ga0265327_10000174 3300031251 Bacteria 138922
782 Ga0265327_10000542 3300031251 Bacteria 64581
783 Ga0265327_10001654 3300031251 Bacteria 26845
784 Ga0265327_10042455 3300031251 Bacteria 2441
785 Ga0265327_10065441 3300031251 Bacteria 1838
786 Ga0265316_10182814 3300031344 Bacteria 1560
787 Ga0265316_10362789 3300031344 Bacteria 1047
788 Ga0307513_10000008 3300031456 Bacteria 442128
789 Ga0307513_10000038 3300031456 Bacteria 174780
790 Ga0307513_10004316 3300031456 Bacteria 18998
791 Ga0307513_10114170 3300031456 Bacteria 2687
792 Ga0307513_10213744 3300031456 Bacteria 1757
793 Ga0307509_10025753 3300031507 Bacteria 6568
794 Ga0307509_10333040 3300031507 Bacteria 1249
795 Ga0307408_100000109 3300031548 Bacteria 91284
796 Ga0307408_100000886 3300031548 Bacteria 23568
797 Ga0307408_100010362 3300031548 Bacteria 6146
798 Ga0307408_100107069 3300031548 Bacteria 2140
799 Ga0307408_100112145 3300031548 Bacteria 2096
800 Ga0307408_100113799 3300031548 Bacteria 2083
801 Ga0307408_100233308 3300031548 Bacteria 1508
802 Ga0307408_100291225 3300031548 Bacteria 1363
803 Ga0307508_10174014 3300031616 Bacteria 1756
804 Ga0307514_10010740 3300031649 Bacteria 7651
805 Ga0316575_10022997 3300031665 Bacteria 2407
806 Ga0316575_10051595 3300031665 Bacteria 1638
807 Ga0316579_10000450 3300031691 Bacteria 13195
808 Ga0316579_10018729 3300031691 Bacteria 3050
809 Ga0265314_10000054 3300031711 Bacteria 184029
810 Ga0265314_10000262 3300031711 Bacteria 77107
811 Ga0265314_10004112 3300031711 Bacteria 13711
812 Ga0265314_10015575 3300031711 Bacteria 6029
813 Ga0265314_10015650 3300031711 Bacteria 6013
814 Ga0316576_10066739 3300031727 Bacteria 2646
815 Ga0316578_10009084 3300031728 Bacteria 5094
816 Ga0316578_10054604 3300031728 Bacteria 2343
817 Ga0307516_10000359 3300031730 Bacteria 59207
818 Ga0307516_10001691 3300031730 Bacteria 30381
819 Ga0307405_10006962 3300031731 Bacteria 5616
820 Ga0307405_10118807 3300031731 Bacteria 1805
821 Ga0307405_10154672 3300031731 Bacteria 1617
822 Ga0307405_10160760 3300031731 Bacteria 1590
823 Ga0307405_10174122 3300031731 Bacteria 1538
824 Ga0307405_10192997 3300031731 Bacteria 1472
825 Ga0307410_10121002 3300031852 Bacteria 1909
826 Ga0307406_10000741 3300031901 Bacteria 18289
827 Ga0307406_10028543 3300031901 Bacteria 3372
828 Ga0307406_10125721 3300031901 Bacteria 1791
829 Ga0307406_10149504 3300031901 Bacteria 1664
830 Ga0307407_10130137 3300031903 Bacteria 1609
831 Ga0307407_10151211 3300031903 Bacteria 1509
832 Ga0307412_10029307 3300031911 Bacteria 3453
833 Ga0307412_10037074 3300031911 Bacteria 3130
834 Ga0307412_10048688 3300031911 Bacteria 2789
835 Ga0307412_10212466 3300031911 Bacteria 1477
836 Ga0307412_10255692 3300031911 Bacteria 1362
837 Ga0307412_10271858 3300031911 Bacteria 1326
838 Ga0307409_100000580 3300031995 Bacteria 15944
839 Ga0307409_100063181 3300031995 Bacteria 2903
840 Ga0307409_100066611 3300031995 Bacteria 2841
841 Ga0307409_100122330 3300031995 Bacteria 2207
842 Ga0307409_100242530 3300031995 Bacteria 1642
843 Ga0307409_100287526 3300031995 Bacteria 1523
844 Ga0307416_100014097 3300032002 Bacteria 5460
845 Ga0307416_100121709 3300032002 Bacteria 2327
846 Ga0307416_100292285 3300032002 Bacteria 1614
847 Ga0307416_100396256 3300032002 Bacteria 1416
848 Ga0307414_10303056 3300032004 Bacteria 1352
849 Ga0307411_10080249 3300032005 Bacteria 2243
850 Ga0307411_10304015 3300032005 Bacteria 1280
851 Ga0307411_10438975 3300032005 Bacteria 1089
852 Ga0307415_100002051 3300032126 Bacteria 9953
853 Ga0307415_100511094 3300032126 Bacteria 1052
854 Ga0316583_10000954 3300032133 Bacteria 9305
855 Ga0316583_10006979 3300032133 Bacteria 4065
856 Ga0316580_10017904 3300032139 Bacteria 2179
857 Ga0316593_10027629 3300032168 Bacteria 1822
858 Ga0316593_10125973 3300032168 Bacteria 922
859 Ga0316588_1002525 3300033528 Bacteria 3191
860 Ga0316596_1005014 3300033541 Bacteria 3002
861 Ga0373930_0001564 3300034816 Bacteria 3432
862 Ga0373938_0020813 3300034957 Bacteria 1325
863 Ga0373926_0007968 3300035083 Bacteria 3529
864 Ga0373928_0004091 3300035084 Bacteria 2780
865 Ga0373929_0004917 3300035085 Bacteria 2396
866 Ga0373934_0000218 3300035086 Bacteria 20872
867 Ga0373934_0000946 3300035086 Bacteria 10509
868 Ga0373951_0017250 3300035091 Bacteria 1633
869 Ga0373952_0000062 3300035092 Bacteria 13595
870 Ga0373952_0012100 3300035092 Bacteria 1693
871 Ga0373923_0000103 3300035111 Bacteria 15045
872 Ga0373932_0002566 3300035112 Bacteria 4544
873 Ga0373939_0000040 3300035114 Bacteria 45617
874 Ga0373939_0004488 3300035114 Bacteria 3304
875 Ga0373941_0009749 3300035115 Bacteria 2427
876 Ga0373941_0128072 3300035115 Bacteria 912
877 Ga0373945_0025798 3300035116 Bacteria 2044
878 Ga0373953_0003648 3300035117 Bacteria 4824
879 Ga0373954_0000153 3300035118 Bacteria 24536
880 Ga0373954_0000939 3300035118 Bacteria 11343
881 Ga0373956_0000081 3300035119 Bacteria 31846
882 Ga0373956_0003816 3300035119 Bacteria 6059
883 Ga0373956_0012068 3300035119 Bacteria 3574
884 Ga0373957_0000956 3300035120 Bacteria 7571
885 Ga0373960_0000506 3300035121 Bacteria 7775
886 Ga0373943_0030168 3300035170 Bacteria 2565
887 Ga0373943_0055619 3300035170 Bacteria 1961
888 Ga0373943_0261689 3300035170 Bacteria 974
889 Ga0373946_0010614 3300035171 Bacteria 3414
890 Ga0373946_0096443 3300035171 Bacteria 1319
891 Ga0373955_0124248 3300035172 Bacteria 1502
892 Ga0373942_0010433 3300035207 Bacteria 2187
893 Ga0373961_0001887 3300035241 Bacteria 5711
894 Ga0373962_0019950 3300035242 Bacteria 1756
895 Ga0316574_0003380 3300035398 Bacteria 8226
896 Ga0316574_0088297 3300035398 Bacteria 1974
897 Ga0373924_0000180 3300035410 Bacteria 18720
898 Ga0373931_0000371 3300035691 Bacteria 18458
899 Ga0373931_0002521 3300035691 Bacteria 8129
900 Ga0373931_0075642 3300035691 Bacteria 1847
901 Ga0373931_0085929 3300035691 Bacteria 1745
902 Ga0373935_0001120 3300035692 Bacteria 14625
903 Ga0373935_0002681 3300035692 Bacteria 10242
904 Ga0373935_0410427 3300035692 Bacteria 974
905 Ga0373927_0006838 3300035695 Bacteria 7759
906 Ga0373927_0013540 3300035695 Bacteria 5418
907 Ga0373927_0047872 3300035695 Bacteria 2765
908 Ga0373933_0000426 3300035724 Bacteria 26557
909 Ga0373933_0003869 3300035724 Bacteria 8263
910 Ga0373933_0081369 3300035724 Bacteria 1987
911 Ga0373933_0085508 3300035724 Bacteria 1939
912 Ga0373933_0275239 3300035724 Bacteria 1087
913 Ga0373947_0025269 3300035725 Bacteria 3463
914 Ga0373937_0000149 3300036401 Bacteria 67267
915 Ga0373937_0000668 3300036401 Bacteria 29873
916 Ga0373937_0005081 3300036401 Bacteria 11203
917 Ga0373937_0034638 3300036401 Bacteria 4593
918 Ga0373937_0198986 3300036401 Bacteria 1883
919 Ga0373937_0613577 3300036401 Bacteria 1032
920 Ga0316582_0003457 3300036647 Bacteria 7748
921 Ga0316584_0096297 3300036712 Bacteria 2215
922 Ga0373925_0002526 3300037068 Bacteria 14599
923 Ga0373925_0040580 3300037068 Bacteria 3446
924 Ga0373925_0062435 3300037068 Bacteria 2801
925 Ga0395899_0007150 3300037312 Bacteria 8637
926 Ga0395900_0000050 3300037418 Bacteria 224616
927 Ga0395900_0006372 3300037418 Bacteria 12301
928 Ga0395900_0283799 3300037418 Bacteria 1647
929 Ga0395898_0001856 3300037466 Bacteria 27096
930 Ga0395898_0002933 3300037466 Bacteria 19401
931 Ga0395898_0041859 3300037466 Bacteria 4522
932 Ga0395898_0111300 3300037466 Bacteria 2624
933 Ga0395905_0000088 3300037471 Bacteria 152506
934 Ga0395905_0002271 3300037471 Bacteria 21567
935 Ga0395905_0003887 3300037471 Bacteria 15759
936 Ga0395905_0013719 3300037471 Bacteria 7757
937 Ga0395905_0028345 3300037471 Bacteria 5279
938 Ga0395905_0031917 3300037471 Bacteria 4955
939 Ga0395905_0137590 3300037471 Bacteria 2298
940 Ga0395905_0188686 3300037471 Bacteria 1934
941 Ga0395905_0194580 3300037471 Bacteria 1901
942 Ga0395905_0450176 3300037471 Bacteria 1185
943 Ga0316581_0009983 3300037588 Bacteria 2622
944 Ga0395901_0089615 3300038443 Bacteria 3219
945 Ga0395901_0103602 3300038443 Bacteria 2985
946 Ga0395901_0104112 3300038443 Bacteria 2978
947 Ga0395901_0121973 3300038443 Bacteria 2739
948 Ga0395901_0157864 3300038443 Bacteria 2382
949 Ga0395901_0169257 3300038443 Bacteria 2293
950 Ga0395901_0171643 3300038443 Bacteria 2275
951 Ga0436365_1640203 3300039437 Bacteria 3024
952 Ga0436365_1756237 3300039437 Bacteria 4549
953 Ga0436361_0005759 3300039447 Bacteria 6838
954 Ga0436361_0159126 3300039447 Bacteria 34073
955 Ga0436361_0240153 3300039447 Bacteria 58400
956 Ga0436361_0287659 3300039447 Bacteria 26995
957 Ga0436361_0566522 3300039447 Bacteria 37173
958 Ga0436363_0976259 3300039450 Bacteria 2302
959 Ga0439436_0020264 3300041404 Bacteria 1981
960 Ga0439465_0005691 3300041413 Bacteria 3966
961 Ga0451807_2212897 3300041486 Bacteria 3169
962 Ga0451807_2362621 3300041486 Bacteria 2644
963 Ga0451853_0962706 3300041512 Bacteria 1767
964 Ga0439433_0000594 3300041999 Bacteria 6892
965 Ga0439437_000513 3300042000 Bacteria 3834
966 Ga0439441_000066 3300042001 Bacteria 8045
967 Ga0439442_023155 3300042002 Bacteria 1290
968 Ga0439443_000974 3300042003 Bacteria 2941
969 Ga0439443_011855 3300042003 Bacteria 1283
970 Ga0439445_0006018 3300042004 Bacteria 2780
971 Ga0439432_012324 3300042006 Bacteria 2929
972 Ga0439432_033137 3300042006 Bacteria 1663
973 Ga0439449_0003256 3300042007 Bacteria 6327
974 Ga0439449_0005226 3300042007 Bacteria 4978
975 Ga0439449_0007955 3300042007 Bacteria 4027
976 Ga0439449_0061218 3300042007 Bacteria 1388
977 Ga0439451_029916 3300042009 Bacteria 1096
978 Ga0439452_030875 3300042010 Bacteria 1318
979 Ga0439454_006088 3300042011 Bacteria 1469
980 Ga0439457_019160 3300042014 Bacteria 1520
981 Ga0439462_0000723 3300042015 Bacteria 6806
982 Ga0439462_0007330 3300042015 Bacteria 2759
983 Ga0439462_0042990 3300042015 Bacteria 1207
984 Ga0450917_001392 3300042120 Bacteria 1731
985 Ga0450923_010632 3300042125 Bacteria 1638
986 Ga0450890_000746 3300042127 Bacteria 4727
987 Ga0450891_005185 3300042129 Bacteria 1206
988 Ga0450892_000203 3300042130 Bacteria 7032
989 Ga0450896_005203 3300042133 Bacteria 1774
990 Ga0450898_004891 3300042134 Bacteria 2002
991 Ga0450906_000190 3300042145 Bacteria 11646
992 Ga0439446_0000148 3300042156 Bacteria 12251
993 Ga0439446_0041173 3300042156 Bacteria 1361
994 Ga0450909_002564 3300042185 Bacteria 2575
995 Ga0439434_0000121 3300042435 Bacteria 20613
996 Ga0439434_0002740 3300042435 Bacteria 5136
997 Ga0439435_0000031 3300042436 Bacteria 15689
998 Ga0439435_0000893 3300042436 Bacteria 5136
999 Ga0439435_0001361 3300042436 Bacteria 4473
1000 Ga0439435_0011295 3300042436 Bacteria 2141
1001 Ga0439444_0000800 3300042437 Bacteria 3778
1002 Ga0439459_0051105 3300042438 Bacteria 908
1003 Ga0439460_0000173 3300042461 Bacteria 12207
1004 Ga0439460_0002287 3300042461 Bacteria 4611
1005 Ga0450918_004718 3300042531 Bacteria 2470
1006 Ga0450893_0008662 3300042532 Bacteria 1657
1007 Ga0451577_0000085 3300042876 Bacteria 211141
1008 Ga0451577_0002155 3300042876 Bacteria 24105
1009 Ga0451577_0004221 3300042876 Bacteria 15320
1010 Ga0451577_0014375 3300042876 Bacteria 7381
1011 Ga0451577_0081052 3300042876 Bacteria 2894
1012 Ga0451577_0307045 3300042876 Bacteria 1438
1013 Ga0451577_0589555 3300042876 Bacteria 1009
1014 Ga0451577_0605264 3300042876 Bacteria 994
1015 Ga0466969_0000169 3300044656 Bacteria 35088
1016 Ga0466969_0024849 3300044656 Bacteria 3081
1017 Ga0466972_0011675 3300044658 Bacteria 4411
1018 Ga0453683_0000047 3300044673 Bacteria 207763
1019 Ga0453683_0000464 3300044673 Bacteria 46581
1020 Ga0453683_0002014 3300044673 Bacteria 16403
1021 Ga0453683_0095554 3300044673 Bacteria 1865
1022 Ga0466965_0002274 3300044683 Bacteria 8096
1023 Ga0466966_0001826 3300044684 Bacteria 13814
1024 Ga0466961_0001054 3300044693 Bacteria 16978
1025 Ga0466961_0004942 3300044693 Bacteria 8383
1026 Ga0466961_0012914 3300044693 Bacteria 5342
1027 Ga0466963_0230471 3300044694 Bacteria 1298
1028 Ga0466964_0015945 3300044706 Bacteria 2863
1029 Ga0453684_0000273 3300044712 Bacteria 222658
1030 Ga0453684_0000302 3300044712 Bacteria 207763
1031 Ga0453684_0005216 3300044712 Bacteria 26063
1032 Ga0453684_0009340 3300044712 Bacteria 17191
1033 Ga0453684_0029404 3300044712 Bacteria 7801
1034 Ga0453684_0032697 3300044712 Bacteria 7270
1035 Ga0453684_0140681 3300044712 Bacteria 2882
1036 Ga0453684_0231917 3300044712 Bacteria 2131
1037 Ga0453684_0284443 3300044712 Bacteria 1885
1038 Ga0453684_0367514 3300044712 Bacteria 1618
1039 Ga0466968_0143309 3300044735 Bacteria 1094
1040 Ga0466957_0017735 3300044842 Bacteria 4175
1041 Ga0466957_0089032 3300044842 Bacteria 1932
1042 Ga0466957_0206380 3300044842 Bacteria 1292
1043 Ga0466959_0008784 3300045049 Bacteria 7158
1044 Ga0466959_0033437 3300045049 Bacteria 3802
1045 Ga0466959_0036716 3300045049 Bacteria 3620
1046 Ga0466959_0123839 3300045049 Bacteria 1836
1047 Ga0451576_0000006 3300045051 Bacteria 949698
1048 Ga0451576_0000116 3300045051 Bacteria 207763
1049 Ga0451576_0000810 3300045051 Bacteria 61225
1050 Ga0451576_0003028 3300045051 Bacteria 23722
1051 Ga0451576_0017940 3300045051 Bacteria 7769
1052 Ga0451576_0040503 3300045051 Bacteria 4929
1053 Ga0451576_0052789 3300045051 Bacteria 4259
1054 Ga0451576_0072549 3300045051 Bacteria 3582
1055 Ga0451576_0090153 3300045051 Bacteria 3189
1056 Ga0451576_0136460 3300045051 Bacteria 2559
1057 Ga0451576_0164653 3300045051 Bacteria 2314
1058 Ga0451576_0169075 3300045051 Bacteria 2281
1059 Ga0451576_0184651 3300045051 Bacteria 2177
1060 Ga0451576_0341786 3300045051 Bacteria 1567
1061 Ga0451576_0379732 3300045051 Bacteria 1481
1062 Ga0451576_0650693 3300045051 Bacteria 1107
1063 Ga0451576_0682101 3300045051 Bacteria 1079
1064 Ga0466958_0016792 3300045836 Bacteria 4221
1065 Ga0466967_0095991 3300045976 Bacteria 2704
1066 Ga0495592_0000402 3300046454 Bacteria 33287
1067 Ga0495592_0008806 3300046454 Bacteria 7578
1068 Ga0495592_0011017 3300046454 Bacteria 6821
1069 Ga0495592_0012367 3300046454 Bacteria 6482
1070 Ga0495592_0018099 3300046454 Bacteria 5353
1071 Ga0495603_0004104 3300046455 Bacteria 8673
1072 Ga0495629_0050922 3300046459 Bacteria 2899
1073 Ga0495638_0045635 3300046460 Bacteria 2756
1074 Ga0495638_0142107 3300046460 Bacteria 1400
1075 Ga0495641_0005397 3300046461 Bacteria 8649
1076 Ga0495641_0014457 3300046461 Bacteria 4267
1077 Ga0495651_0000386 3300046462 Bacteria 34115
1078 Ga0495651_0001537 3300046462 Bacteria 17839
1079 Ga0495653_0000014 3300046463 Bacteria 215253
1080 Ga0495653_0001467 3300046463 Bacteria 18418
1081 Ga0495653_0104712 3300046463 Bacteria 2044
1082 Ga0495653_0269004 3300046463 Bacteria 1123
1083 Ga0495650_0010303 3300046471 Bacteria 5226
1084 Ga0495580_0005123 3300046472 Bacteria 10905
1085 Ga0495580_0022257 3300046472 Bacteria 4666
1086 Ga0495582_0022643 3300046473 Bacteria 3438
1087 Ga0495639_0002490 3300046475 Bacteria 8037
1088 Ga0495639_0086817 3300046475 Bacteria 1464
1089 Ga0495662_0005031 3300046476 Bacteria 6625
1090 Ga0495662_0007831 3300046476 Bacteria 5259
1091 Ga0495662_0056211 3300046476 Bacteria 1901
1092 Ga0495585_0004535 3300046492 Bacteria 8991
1093 Ga0495606_0000085 3300046507 Bacteria 158006
1094 Ga0495608_0001458 3300046511 Bacteria 16807
1095 Ga0495608_0010334 3300046511 Bacteria 6513
1096 Ga0495608_0024719 3300046511 Bacteria 4105
1097 Ga0495618_0036764 3300046514 Bacteria 3073
1098 Ga0495620_0009557 3300046515 Bacteria 5148
1099 Ga0495628_0001323 3300046516 Bacteria 22719
1100 Ga0495628_0003324 3300046516 Bacteria 14383
1101 Ga0495628_0012120 3300046516 Bacteria 7268
1102 Ga0495628_0023392 3300046516 Bacteria 5072
1103 Ga0495628_0054659 3300046516 Bacteria 3147
1104 Ga0495628_0082173 3300046516 Bacteria 2502
1105 Ga0495630_0001562 3300046517 Bacteria 15915
1106 Ga0495631_0001860 3300046518 Bacteria 12469
1107 Ga0495637_0001254 3300046520 Bacteria 15311
1108 Ga0495666_0005300 3300046526 Bacteria 6501
1109 Ga0495652_0014341 3300046529 Bacteria 7114
1110 Ga0495652_0020971 3300046529 Bacteria 5807
1111 Ga0495652_0031771 3300046529 Bacteria 4621
1112 Ga0495652_0340747 3300046529 Bacteria 1077
1113 Ga0495654_0000034 3300046530 Bacteria 196519
1114 Ga0495654_0006664 3300046530 Bacteria 6537
1115 Ga0495665_0002051 3300046531 Bacteria 10908
1116 Ga0495640_0167223 3300046533 Bacteria 1406
1117 Ga0495586_0004208 3300046535 Bacteria 7709
1118 Ga0495586_0010110 3300046535 Bacteria 5021
1119 Ga0495586_0038227 3300046535 Bacteria 2576
1120 Ga0495587_0005053 3300046536 Bacteria 8632
1121 Ga0495587_0005690 3300046536 Bacteria 8127
1122 Ga0495587_0028128 3300046536 Bacteria 3421
1123 Ga0495598_0026266 3300046537 Bacteria 1595
1124 Ga0495621_0006064 3300046539 Bacteria 3511
1125 Ga0495621_0101614 3300046539 Bacteria 1095
1126 Ga0495645_0000490 3300046543 Bacteria 27455
1127 Ga0495645_0000505 3300046543 Bacteria 26925
1128 Ga0495622_0018754 3300046557 Bacteria 3222
1129 Ga0495633_0000563 3300046558 Bacteria 36212
1130 Ga0495667_0000929 3300046559 Bacteria 18958
1131 Ga0495667_0003624 3300046559 Bacteria 10384
1132 Ga0495667_0016088 3300046559 Bacteria 5056
1133 Ga0495667_0089742 3300046559 Bacteria 1992
1134 Ga0495656_0000090 3300046615 Bacteria 39387
1135 Ga0495656_0011534 3300046615 Bacteria 3246
1136 Ga0495634_0004749 3300046642 Bacteria 10571
1137 Ga0495634_0052509 3300046642 Bacteria 2732
1138 Ga0495625_0000045 3300046660 Bacteria 202475
1139 Ga0495625_0113489 3300046660 Bacteria 1850
1140 Ga0495635_0013262 3300046663 Bacteria 5767
1141 Ga0495635_0022732 3300046663 Bacteria 4371
1142 Ga0495635_0121478 3300046663 Bacteria 1782
1143 Ga0495659_0056632 3300046664 Bacteria 1439
1144 Ga0495588_0099631 3300046674 Bacteria 1526
1145 Ga0495657_0001646 3300046675 Bacteria 19198
1146 Ga0495657_0075298 3300046675 Bacteria 2194
1147 Ga0495599_0001724 3300046678 Bacteria 12639
1148 Ga0495599_0005109 3300046678 Bacteria 7815
1149 Ga0495599_0007320 3300046678 Bacteria 6690
1150 Ga0495599_0016689 3300046678 Bacteria 4560
1151 Ga0495646_0073811 3300046680 Bacteria 2003
1152 Ga0495647_0000520 3300046681 Bacteria 11248
1153 Ga0495647_0002578 3300046681 Bacteria 5747
1154 Ga0495658_0005333 3300046683 Bacteria 6325
1155 Ga0495658_0059067 3300046683 Bacteria 2195
1156 Ga0495669_0039167 3300046684 Bacteria 2098
1157 Ga0495613_0003024 3300046689 Bacteria 12577
1158 Ga0495613_0014356 3300046689 Bacteria 5880
1159 Ga0495624_0004534 3300046690 Bacteria 10151
1160 Ga0495624_0045779 3300046690 Bacteria 2783
1161 Ga0495624_0055474 3300046690 Bacteria 2496
1162 Ga0495600_0001614 3300046809 Bacteria 12575
1163 Ga0495600_0006471 3300046809 Bacteria 7132
1164 Ga0495581_0296944 3300047315 Bacteria 944
1165 Ga0495604_0001290 3300047317 Bacteria 20493
1166 Ga0495604_0063974 3300047317 Bacteria 2805
1167 Ga0495604_0191323 3300047317 Bacteria 1425
1168 Ga0495604_0256034 3300047317 Bacteria 1191
1169 Ga0495636_0096815 3300047318 Bacteria 1287
1170 Ga0495636_0101440 3300047318 Bacteria 1259
1171 Ga0495674_0002016 3300047319 Bacteria 19979
1172 Ga0495676_0118617 3300047321 Bacteria 1929
1173 Ga0495680_0000735 3300047322 Bacteria 36769
1174 Ga0495680_0013178 3300047322 Bacteria 7224
1175 Ga0495687_000961 3300047443 Bacteria 29557
1176 Ga0495675_0024850 3300047444 Bacteria 3821
1177 Ga0495684_0006542 3300047471 Bacteria 9039
1178 Ga0495684_0071758 3300047471 Bacteria 2631
1179 Ga0495593_0014105 3300047673 Bacteria 4548
1180 Ga0495593_0157840 3300047673 Bacteria 1146
1181 Ga0495602_0226614 3300048088 Bacteria 1407
1182 Ga0495614_0037406 3300048089 Bacteria 2082
1183 Ga0496100_0004031 3300048903 Bacteria 7734
1184 Ga0496100_0302774 3300048903 Bacteria 1197
1185 Ga0496102_0062695 3300048905 Bacteria 3404
1186 Ga0496104_0017851 3300048907 Bacteria 6469
1187 Ga0496104_0113513 3300048907 Bacteria 2598
1188 Ga0496105_0264483 3300048908 Bacteria 1390
1189 Ga0496108_0025181 3300048911 Bacteria 4903
1190 Ga0496108_0030824 3300048911 Bacteria 4444
1191 Ga0496108_0338683 3300048911 Bacteria 1312
1192 Ga0496109_0007737 3300048912 Bacteria 9099
1193 Ga0496109_0020515 3300048912 Bacteria 5837
1194 Ga0496109_0082794 3300048912 Bacteria 2958
1195 Ga0496109_0096917 3300048912 Bacteria 2733
1196 Ga0496110_0032764 3300048913 Bacteria 4492
1197 Ga0496110_0081553 3300048913 Bacteria 2884
1198 Ga0496110_0146480 3300048913 Bacteria 2136
1199 Ga0496112_0035835 3300048915 Bacteria 4835
1200 Ga0496113_0067776 3300048916 Bacteria 2707
1201 Ga0496116_0046660 3300048919 Bacteria 2922
1202 Ga0496116_0072434 3300048919 Bacteria 2178
1203 Ga0496117_0000056 3300048920 Bacteria 271417
1204 Ga0496117_0060218 3300048920 Bacteria 2618
1205 Ga0496118_0000047 3300048921 Bacteria 271417
1206 Ga0496118_0005388 3300048921 Bacteria 14570
1207 Ga0496118_0017400 3300048921 Bacteria 6544
1208 Ga0496119_0098623 3300048922 Bacteria 1645
1209 Ga0496121_0021767 3300048924 Bacteria 6262
1210 Ga0496121_0027142 3300048924 Bacteria 5367
1211 Ga0496121_0041655 3300048924 Bacteria 4010
1212 Ga0496121_0088636 3300048924 Bacteria 2425
1213 Ga0496122_0000747 3300048925 Bacteria 63354
1214 Ga0496122_0006247 3300048925 Bacteria 13779
1215 Ga0496123_0000274 3300048926 Bacteria 101783
1216 Ga0496123_0000345 3300048926 Bacteria 87307
1217 Ga0496124_0000596 3300048927 Bacteria 60853
1218 Ga0496124_0028048 3300048927 Bacteria 5040
1219 Ga0496124_0044619 3300048927 Bacteria 3802
1220 Ga0496124_0174602 3300048927 Bacteria 1660
1221 Ga0496124_0237264 3300048927 Bacteria 1358
1222 Ga0496125_0006034 3300048928 Bacteria 13252
1223 Ga0496125_0049426 3300048928 Bacteria 3495
1224 Ga0496125_0089064 3300048928 Bacteria 2322
1225 Ga0496125_0099879 3300048928 Bacteria 2141
1226 Ga0496126_0031456 3300048929 Bacteria 5014
1227 Ga0496126_0268443 3300048929 Bacteria 1416
1228 Ga0501031_0000519 3300049568 Bacteria 22515
1229 Ga0501031_0002448 3300049568 Bacteria 11828
1230 Ga0501032_0021502 3300049569 Bacteria 4483
1231 Ga0501032_0129975 3300049569 Bacteria 1662
1232 Ga0501033_0000289 3300049570 Bacteria 48277
1233 Ga0501033_0001878 3300049570 Bacteria 18274
1234 Ga0501034_0009180 3300049571 Bacteria 10373
1235 Ga0501034_0041500 3300049571 Bacteria 4655
1236 Ga0501034_0080371 3300049571 Bacteria 3263
1237 Ga0501034_0106998 3300049571 Bacteria 2789
1238 Ga0501036_0000051 3300049572 Bacteria 75057
1239 Ga0501036_0025591 3300049572 Bacteria 4980
1240 Ga0501036_0098999 3300049572 Bacteria 2466
1241 Ga0501037_0004183 3300049573 Bacteria 10463
1242 Ga0501037_0007041 3300049573 Bacteria 8212
1243 Ga0501038_0000505 3300049574 Bacteria 34234
1244 Ga0501038_0016412 3300049574 Bacteria 6711
1245 Ga0501039_0002690 3300049575 Bacteria 13263
1246 Ga0501039_0113685 3300049575 Bacteria 2117
1247 Ga0501039_0140084 3300049575 Bacteria 1900
1248 Ga0501039_0341686 3300049575 Bacteria 1176
1249 Ga0501040_0030316 3300049576 Bacteria 3654
1250 Ga0501040_0033226 3300049576 Bacteria 3493
1251 Ga0501041_0000236 3300049577 Bacteria 25702
1252 Ga0501041_0044238 3300049577 Bacteria 2707
1253 Ga0501042_0000107 3300049578 Bacteria 34352
1254 Ga0501042_0040258 3300049578 Bacteria 3323
1255 Ga0501042_0108547 3300049578 Bacteria 1998
1256 Ga0501043_0000057 3300049579 Bacteria 103997
1257 Ga0501043_0012140 3300049579 Bacteria 6733
1258 Ga0501043_0012436 3300049579 Bacteria 6657
1259 Ga0501043_0117192 3300049579 Bacteria 2090
1260 Ga0501043_0172037 3300049579 Bacteria 1690
1261 Ga0501046_0000075 3300049580 Bacteria 104000
1262 Ga0501046_0000548 3300049580 Bacteria 37400
1263 Ga0501046_0016131 3300049580 Bacteria 6265
1264 Ga0501046_0036963 3300049580 Bacteria 3926
1265 Ga0501046_0099823 3300049580 Bacteria 2228
1266 Ga0501047_0000081 3300049581 Bacteria 122697
1267 Ga0501047_0005071 3300049581 Bacteria 12359
1268 Ga0501047_0006131 3300049581 Bacteria 11299
1269 Ga0501047_0058948 3300049581 Bacteria 3708
1270 Ga0501047_0193772 3300049581 Bacteria 1895
1271 Ga0501048_0000076 3300049582 Bacteria 51144
1272 Ga0501048_0002636 3300049582 Bacteria 13718
1273 Ga0501048_0289042 3300049582 Bacteria 1166
1274 Ga0501067_0044166 3300049583 Bacteria 2476
1275 Ga0501069_0002988 3300049585 Bacteria 8709
1276 Ga0501070_0003556 3300049586 Bacteria 13482
1277 Ga0501070_0015557 3300049586 Bacteria 6397
1278 Ga0501070_0027035 3300049586 Bacteria 4813
1279 Ga0501070_0084597 3300049586 Bacteria 2626
1280 Ga0501070_0126469 3300049586 Bacteria 2112
1281 Ga0501071_0000836 3300049587 Bacteria 16486
1282 Ga0501071_0050258 3300049587 Bacteria 3003
1283 Ga0501071_0094569 3300049587 Bacteria 2198
1284 Ga0501071_0140717 3300049587 Bacteria 1796
1285 Ga0501072_0000201 3300049588 Bacteria 43540
1286 Ga0501072_0001610 3300049588 Bacteria 16870
1287 Ga0501072_0018650 3300049588 Bacteria 5348
1288 Ga0501072_0025495 3300049588 Bacteria 4606
1289 Ga0501072_0043676 3300049588 Bacteria 3523
1290 Ga0501073_0000403 3300049589 Bacteria 29490
1291 Ga0501073_0000710 3300049589 Bacteria 23547
1292 Ga0501073_0001421 3300049589 Bacteria 17674
1293 Ga0501073_0137263 3300049589 Bacteria 1695
1294 Ga0501073_0402902 3300049589 Bacteria 945
1295 Ga0501074_0003228 3300049590 Bacteria 11518
1296 Ga0501074_0073065 3300049590 Bacteria 2464
1297 Ga0501074_0206705 3300049590 Bacteria 1399
1298 Ga0501075_0000544 3300049591 Bacteria 22874
1299 Ga0501075_0014368 3300049591 Bacteria 5672
1300 Ga0501075_0122411 3300049591 Bacteria 1980
1301 Ga0501075_0232921 3300049591 Bacteria 1404
1302 Ga0501075_0282334 3300049591 Bacteria 1265
1303 Ga0501075_0324530 3300049591 Bacteria 1173
1304 Ga0501076_0000771 3300049592 Bacteria 20696
1305 Ga0501076_0001109 3300049592 Bacteria 17761
1306 Ga0501077_0025685 3300049593 Bacteria 3738
1307 Ga0501198_000012 3300049649 Bacteria 113529
1308 Ga0501222_000010 3300049662 Bacteria 113536
1309 Ga0501222_001940 3300049662 Bacteria 2869
1310 Ga0501223_000534 3300049663 Bacteria 9173
1311 Ga0501233_001974 3300049668 Bacteria 3572
1312 Ga0501253_001770 3300049683 Bacteria 2287
1313 Ga0501221_000686 3300049704 Bacteria 5423
1314 Ga0501225_0003774 3300049705 Bacteria 4554
1315 Ga0501225_0032555 3300049705 Bacteria 1434
1316 Ga0501229_000069 3300049706 Bacteria 10281
1317 Ga0501079_0000441 3300049741 Bacteria 26973
1318 Ga0501079_0007491 3300049741 Bacteria 8256
1319 Ga0501079_0017995 3300049741 Bacteria 5396
1320 Ga0501080_0000762 3300049742 Bacteria 26133
1321 Ga0501080_0014631 3300049742 Bacteria 7227
1322 Ga0501080_0034459 3300049742 Bacteria 4727
1323 Ga0501080_0131792 3300049742 Bacteria 2314
1324 Ga0501080_0287094 3300049742 Bacteria 1495
1325 Ga0501080_0375073 3300049742 Bacteria 1282
1326 Ga0501081_0001178 3300049743 Bacteria 15807
1327 Ga0501081_0008200 3300049743 Bacteria 6781
1328 Ga0501081_0071858 3300049743 Bacteria 2412
1329 Ga0501081_0195693 3300049743 Bacteria 1465
1330 Ga0501083_0003281 3300049744 Bacteria 11301
1331 Ga0501083_0020668 3300049744 Bacteria 4577
1332 Ga0501083_0033807 3300049744 Bacteria 3499
1333 Ga0501083_0125143 3300049744 Bacteria 1685
1334 Ga0501266_000713 3300049763 Bacteria 4324
1335 Ga0501272_004105 3300049769 Bacteria 1505
1336 Ga0501035_0009359 3300049822 Bacteria 9106
1337 Ga0501035_0093945 3300049822 Bacteria 2638
1338 Ga0501035_0120920 3300049822 Bacteria 2289
1339 Ga0501035_0179968 3300049822 Bacteria 1822
1340 Ga0501044_0004209 3300049823 Bacteria 16167
1341 Ga0501044_0530435 3300049823 Bacteria 1076
1342 Ga0501044_0620666 3300049823 Bacteria 973
1343 Ga0501045_0000911 3300049824 Bacteria 19278
1344 Ga0501045_0227956 3300049824 Bacteria 1387
1345 nmdc:mga03683_112035_c1 3300050489 Bacteria 1207
1346 nmdc:mga03683_5307_c1 3300050489 Bacteria 4346
1347 nmdc:mga03683_6760_c1 3300050489 Bacteria 3947
1348 nmdc:mga03n38_21506_c1 3300050490 Bacteria 2597
1349 nmdc:mga03n38_311636_c1 3300050490 Bacteria 848
1350 nmdc:mga00v17_45226_c1 3300050491 Bacteria 2659
1351 nmdc:mga0yw44_337042_c1 3300050492 Bacteria 1014
1352 nmdc:mga0yw44_34515_c1 3300050492 Bacteria 2965
1353 nmdc:mga0yw44_56081_c1 3300050492 Bacteria 2399
1354 nmdc:mga0k408_109209_c1 3300050493 Bacteria 1634
1355 nmdc:mga0k408_14580_c1 3300050493 Bacteria 4335
1356 nmdc:mga0k408_161_c1 3300050493 Bacteria 34843
1357 nmdc:mga0k408_16652_c1 3300050493 Bacteria 4083
1358 nmdc:mga0k408_1875_c1 3300050493 Bacteria 11271
1359 nmdc:mga0k408_249692_c1 3300050493 Bacteria 1059
1360 nmdc:mga0k408_35602_c1 3300050493 Bacteria 2854
1361 nmdc:mga0k408_4724_c1 3300050493 Bacteria 7214
1362 nmdc:mga0k408_60277_c1 3300050493 Bacteria 2205
1363 nmdc:mga07m45_11075_c1 3300050496 Bacteria 4730
1364 nmdc:mga07m45_22932_c1 3300050496 Bacteria 3410
1365 nmdc:mga07m45_33279_c1 3300050496 Bacteria 2862
1366 nmdc:mga07m45_4223_c1 3300050496 Bacteria 7028
1367 nmdc:mga07m45_46597_c1 3300050496 Bacteria 2436
1368 nmdc:mga07m45_73795_c1 3300050496 Bacteria 1943
1369 nmdc:mga07m45_8519_c1 3300050496 Bacteria 5276
1370 nmdc:mga05p37_1040_c1 3300050507 Bacteria 31616
1371 nmdc:mga05p37_822234_c1 3300050507 Bacteria 1013
1372 nmdc:mga05p37_97434_c1 3300050507 Bacteria 3623
1373 nmdc:mga09592_179179_c1 3300050508 Bacteria 1833
1374 nmdc:mga09592_321446_c1 3300050508 Bacteria 1340
1375 nmdc:mga09592_507_c1 3300050508 Bacteria 29420
1376 nmdc:mga09592_52198_c1 3300050508 Bacteria 3451
1377 nmdc:mga09592_90937_c1 3300050508 Bacteria 2608
1378 nmdc:mga0qj67_101996_c1 3300050509 Bacteria 2314
1379 nmdc:mga0qj67_21296_c1 3300050509 Bacteria 4972
1380 nmdc:mga0qj67_21367_c1 3300050509 Bacteria 4965
1381 nmdc:mga0qj67_60057_c1 3300050509 Bacteria 3016
1382 nmdc:mga06r32_250227_c1 3300050510 Bacteria 1760
1383 nmdc:mga06r32_2510_c1 3300050510 Bacteria 16409
1384 nmdc:mga06r32_417730_c1 3300050510 Bacteria 1323
1385 nmdc:mga06r32_51214_c1 3300050510 Bacteria 3951
1386 nmdc:mga08y16_203250_c1 3300050511 Bacteria 2053
1387 nmdc:mga08y16_315043_c1 3300050511 Bacteria 1611
1388 nmdc:mga08y16_6498_c1 3300050511 Bacteria 12257
1389 nmdc:mga08y16_69561_c1 3300050511 Bacteria 3670
1390 nmdc:mga08y16_95492_c1 3300050511 Bacteria 3097
1391 nmdc:mga0n895_13969_c1 3300050512 Bacteria 7273
1392 nmdc:mga0n895_458_c1 3300050512 Bacteria 27351
1393 nmdc:mga0n895_463400_c1 3300050512 Bacteria 1279
1394 nmdc:mga0rr50_156_c1 3300050513 Bacteria 36930
1395 nmdc:mga0rr50_23873_c1 3300050513 Bacteria 2776
1396 nmdc:mga0rr50_29997_c1 3300050513 Bacteria 3844
1397 nmdc:mga0rr50_303958_c1 3300050513 Bacteria 1335
1398 nmdc:mga0rr50_309755_c1 3300050513 Bacteria 1322
1399 nmdc:mga08x19_341_c1 3300050514 Bacteria 33752
1400 nmdc:mga08x19_4042_c1 3300050514 Bacteria 8716
1401 nmdc:mga08x19_54115_c1 3300050514 Bacteria 2583
1402 nmdc:mga08x19_7621_c1 3300050514 Bacteria 6430
1403 nmdc:mga08x19_81_c1 3300050514 Bacteria 87015
1404 nmdc:mga0a205_127550_c1 3300050515 Bacteria 2444
1405 nmdc:mga0a205_161597_c1 3300050515 Bacteria 2136
1406 nmdc:mga0a205_299_c1 3300050515 Bacteria 36719
1407 nmdc:mga0a205_302797_c1 3300050515 Bacteria 1471
1408 nmdc:mga0a205_354577_c1 3300050515 Bacteria 1334
1409 nmdc:mga0a205_43986_c1 3300050515 Bacteria 4304
1410 nmdc:mga0a205_572403_c1 3300050515 Bacteria 984
1411 nmdc:mga0a205_57923_c1 3300050515 Bacteria 3741
1412 Ga0495601_0000627 3300053077 Bacteria 18859
1413 Ga0495601_0001241 3300053077 Bacteria 13988
1414 Ga0495601_0224741 3300053077 Bacteria 1226
1415 Ga0495612_0016150 3300053078 Bacteria 2991
1416 Ga0495612_0060180 3300053078 Bacteria 1572
1417 Ga0500610_0001655 3300053079 Bacteria 7750
1418 Ga0500610_0004732 3300053079 Bacteria 5460
1419 Ga0495595_0002323 3300053084 Bacteria 7418
1420 Ga0495595_0019707 3300053084 Bacteria 2930
1421 Ga0495595_0040606 3300053084 Bacteria 2127
1422 Ga0500643_004741 3300053087 Bacteria 6038
1423 Ga0500646_0001015 3300053090 Bacteria 7678
1424 Ga0500651_0000223 3300053093 Bacteria 35661
1425 Ga0500566_0186570 3300053094 Bacteria 1059
1426 Ga0500571_000129 3300053110 Bacteria 25327
1427 Ga0500592_007345 3300053116 Bacteria 1754
1428 Ga0500593_000472 3300053117 Bacteria 15997
1429 Ga0500593_000526 3300053117 Bacteria 15083
1430 Ga0500607_004161 3300053121 Bacteria 10094
1431 Ga0500607_051714 3300053121 Bacteria 2184
1432 Ga0500655_001764 3300053133 Bacteria 4053
1433 Ga0500655_020384 3300053133 Bacteria 1238
1434 Ga0500559_0004481 3300053136 Bacteria 6614
1435 Ga0500559_0119174 3300053136 Bacteria 1227
1436 Ga0500568_0009007 3300053139 Bacteria 4762
1437 Ga0500568_0021891 3300053139 Bacteria 2744
1438 Ga0500574_011933 3300053141 Bacteria 1975
1439 Ga0500604_0002378 3300053151 Bacteria 5143
1440 Ga0500604_0020845 3300053151 Bacteria 1848
1441 Ga0500616_0023945 3300053153 Bacteria 3398
1442 Ga0500622_0059421 3300053156 Bacteria 1952
1443 Ga0500627_0000567 3300053158 Bacteria 9948
1444 Ga0500634_0009885 3300053161 Bacteria 4853
1445 Ga0500634_0022949 3300053161 Bacteria 3391
1446 Ga0500636_0021704 3300053177 Bacteria 3801
1447 Ga0500645_005298 3300053730 Bacteria 4774
1448 Ga0501084_0014223 3300054114 Bacteria 6589
1449 Ga0501084_0061169 3300054114 Bacteria 3153
1450 Ga0501084_0070133 3300054114 Bacteria 2935
1451 Ga0501084_0162371 3300054114 Bacteria 1885
1452 Ga0590071_000494 3300059421 Bacteria 11506
1453 Ga0590074_009073 3300059423 Bacteria 1658
1454 Ga0590074_009443 3300059423 Bacteria 1625
1455 Ga0501082_0006025 3300060353 Bacteria 10515
1456 Ga0501082_0018607 3300060353 Bacteria 5986
1457 Ga0501082_0047642 3300060353 Bacteria 3694
1458 Ga0501082_0060097 3300060353 Bacteria 3274
1459 Ga0501082_0080902 3300060353 Bacteria 2804
1460 Ga0530510_0000543 3300061734 Bacteria 24227
1461 Ga0530510_0000585 3300061734 Bacteria 23421
1462 2513229154 2513020051 Bacteria 6053213
1463 2587724932 2585428057 Bacteria 6737412
1464 2587731701 2585428058 Bacteria 6853932
1465 2588292434 2588253510 Bacteria 6901809
1466 2599623423 2599185214 Bacteria 8209958
1467 2599675359 2599185226 Bacteria 8233575
1468 2599681028 2599185227 Bacteria 8246414
1469 2599693043 2599185229 Bacteria 8216126
1470 2643743744 2643221544 Bacteria 5886209
1471 2643867750 2643221570 Bacteria 5103772
1472 2643936506 2643221585 Bacteria 5812563
1473 2643968186 2643221592 Bacteria 6608788
1474 2644062216 2643221609 Bacteria 6756331
1475 2644071404 2643221611 Bacteria 6820941
1476 2644142458 2643221625 Bacteria 6512927
1477 2644161820 2643221628 Bacteria 5745828
1478 2644222343 2643221639 Bacteria 6649903
1479 2644256357 2643221646 Bacteria 6433402
1480 2644277043 2643221648 Bacteria 6521465
1481 2644301365 2643221654 Bacteria 5273570
1482 2644317862 2643221656 Bacteria 5809961
1483 2644325584 2643221658 Bacteria 6064537
1484 2644340870 2643221660 Bacteria 4208257
1485 2644358534 2643221664 Bacteria 7272945
1486 2644399303 2643221672 Bacteria 6322190
1487 2644467009 2643221683 Bacteria 5749203
1488 2738718171 2738541277 Bacteria 7458140
1489 2738880444 2738541307 Bacteria 8606193
1490 2739058402 2738541337 Bacteria 6183410
1491 2739245827 2738543012 Bacteria 7115078
1492 2739281358 2738543019 Bacteria 7459457
1493 2816470521 2816332133 Bacteria 7249298
1494 2819600599 2818991446 Bacteria 7757362
1495 2831267675 2831265667 Bacteria 7184833
1496 2838061119 2838054893 Bacteria 7451788
1497 2839141861 2839138175 Bacteria 6549354
1498 2842679801 2842677519 Bacteria 5615038
1499 2842718703 2842718218 Bacteria 4560148
1500 2842736382 2842733646 Bacteria 5716726
1501 2842748890 2842747753 Bacteria 5578255
1502 2857569270 2857564685 Bacteria 6290584
1503 2885085895 2885080285 Bacteria 6355622
1504 2885196958 2885192300 Bacteria 5882526
1505 2885198855 2885198086 Bacteria 7212419
1506 2885211765 2885211737 Bacteria 7212420
1507 2895517910 2895511927 Bacteria 6802080
1508 2899928254 2899924645 Bacteria 7487985
1509 2904452469 2904449895 Bacteria 6927402
1510 2904460932 2904456579 Bacteria 6819253
1511 2904545154 2904541872 Bacteria 8915136
1512 2919463899 2919462493 Bacteria 5817112
1513 2928041206 2928037797 Bacteria 7273642
1514 2928048048 2928044640 Bacteria 7271509
1515 2928055889 2928051484 Bacteria 7773759
1516 2928066630 2928064002 Bacteria 7419480
1517 2928077216 2928070936 Bacteria 8062541
1518 2928087517 2928084124 Bacteria 7159212
1519 2928120635 2928115317 Bacteria 6477646
1520 2929165332 2929160207 Bacteria 9075316
1521 2929522915 2929520902 Bacteria 6765052
1522 2932424025 2932422444 Bacteria 4678430
1523 2945910062 2945909444 Bacteria 7065066
1524 2945946035 2945945610 Bacteria 5951079
1525 2945975634 2945972063 Bacteria 6086495
1526 2945987922 2945984333 Bacteria 7358892
1527 2954768922 2954767861 Bacteria 5535784
1528 Ga0065707_10085778
1529 JGI24740J21852_10010522
1530 JGI25155J39150_1000022
1531 JGI25156J39149_1000005
1532 JGI25154J39366_1000017
1533 JGI25158J39367_1005484
1534 JGI25157J39369_1000003
1535 JGI25152J39213_1011510
1536 JGI25159J45721_1015079
1537 JGI25151J46595_10007571
1538 JGI25153J46596_10003017
1539 Ga0006562J51391_1102770
1540 Ga0006562J51391_1102771
1541 Ga0055535_1000221
1542 Ga0055542_1000129
1543 Ga0055537_1000475
1544 Ga0055524_1000053
1545 Ga0055536_1001528
1546 Ga0055536_1008131
1547 Ga0055536_1033036
1548 Ga0055534_1000429
1549 Ga0055534_1003675
1550 Ga0055534_1004148
1551 Ga0055528_1002516
1552 Ga0055528_1007607
1553 Ga0055530_10001363
1554 Ga0055530_10005013
1555 Ga0055540_1002889
1556 Ga0055540_1003142
1557 Ga0055531_10000158
1558 Ga0055531_10000179
1559 Ga0055531_10000543
1560 Ga0065165_1000177
1561 Ga0065165_1001456
1562 Ga0065165_1026655
1563 Ga0065165_1051685
1564 Ga0065714_10088812
1565 Ga0065704_10134796
1566 Ga0065707_10004626
1567 Ga0070658_10058717
1568 Ga0070676_10064584
1569 Ga0070676_10165882
1570 Ga0070683_100079043
1571 Ga0070690_100000076
1572 Ga0070690_100011766
1573 Ga0070690_100076426
1574 Ga0070690_100097702
1575 Ga0070690_100237707
1576 Ga0070670_100006933
1577 Ga0070670_100098535
1578 Ga0070670_100203438
1579 Ga0068869_100001183
1580 Ga0068869_100056383
1581 Ga0068869_100153438
1582 Ga0068869_100215564
1583 Ga0070666_10006757
1584 Ga0070666_10064631
1585 Ga0070680_100000812
1586 Ga0070680_100006232
1587 Ga0070680_100078687
1588 Ga0068868_100000966
1589 Ga0068868_100118129
1590 Ga0068868_100471099
1591 Ga0070660_100064288
1592 Ga0070689_100005432
1593 Ga0070689_100009409
1594 Ga0070689_100012393
1595 Ga0070689_100013607
1596 Ga0070689_100253426
1597 Ga0070691_10003561
1598 Ga0070691_10003688
1599 Ga0070691_10121804
1600 Ga0070687_100000107
1601 Ga0070687_100083430
1602 Ga0070687_100083699
1603 Ga0070661_100110093
1604 Ga0070692_10005519
1605 Ga0070692_10019289
1606 Ga0070692_10043349
1607 Ga0070668_100014537
1608 Ga0070668_100056051
1609 Ga0070668_100079443
1610 Ga0070669_100005844
1611 Ga0070669_100024219
1612 Ga0070669_100056715
1613 Ga0070669_100080916
1614 Ga0070669_100169668
1615 Ga0070675_100008036
1616 Ga0070675_100027347
1617 Ga0070675_100042997
1618 Ga0070671_100002643
1619 Ga0070671_100011057
1620 Ga0070671_100126767
1621 Ga0070671_100142202
1622 Ga0070671_100354492
1623 Ga0070674_100004974
1624 Ga0070674_100060000
1625 Ga0070673_100046302
1626 Ga0070673_100146969
1627 Ga0070673_100243232
1628 Ga0070688_100049953
1629 Ga0070688_100201968
1630 Ga0070659_100187177
1631 Ga0070659_100208652
1632 Ga0070659_100351996
1633 Ga0070667_100016643
1634 Ga0070667_100023158
1635 Ga0070667_100212242
1636 Ga0070667_100327871
1637 Ga0070701_10000399
1638 Ga0070705_100029021
1639 Ga0070705_100071961
1640 Ga0070700_100000695
1641 Ga0070700_100003268
1642 Ga0070700_100075600
1643 Ga0070694_100091408
1644 Ga0070694_100096346
1645 Ga0070694_100110515
1646 Ga0070694_100190004
1647 Ga0070678_100006239
1648 Ga0070678_100068048
1649 Ga0070678_100189130
1650 Ga0070662_100017313
1651 Ga0070662_100048475
1652 Ga0070662_100081313
1653 Ga0070681_10000131
1654 Ga0070681_10001310
1655 Ga0070681_10011104
1656 Ga0070681_10479521
1657 Ga0068867_100001930
1658 Ga0068867_100002071
1659 Ga0068867_100002251
1660 Ga0068867_100005640
1661 Ga0068867_100049124
1662 Ga0068867_100107037
1663 Ga0068867_100184517
1664 Ga0068867_100362023
1665 Ga0070685_10062721
1666 Ga0070706_100000463
1667 Ga0070706_100328109
1668 Ga0070706_100544038
1669 Ga0070707_100084821
1670 Ga0070707_100232052
1671 Ga0070707_100670418
1672 Ga0070699_100007582
1673 Ga0070699_100477240
1674 Ga0070699_100621188
1675 Ga0070679_100008624
1676 Ga0070679_100025341
1677 Ga0070679_100048778
1678 Ga0070679_100051692
1679 Ga0070679_100148794
1680 Ga0070679_100623511
1681 Ga0070684_100074042
1682 Ga0070684_100100602
1683 Ga0070697_100000561
1684 Ga0068853_100019963
1685 Ga0068853_100029057
1686 Ga0068853_100037525
1687 Ga0068853_100216257
1688 Ga0070672_100007718
1689 Ga0070672_100016975
1690 Ga0070672_100102772
1691 Ga0070686_100000265
1692 Ga0070686_100049881
1693 Ga0070686_100064529
1694 Ga0070686_100302585
1695 Ga0070686_100320429
1696 Ga0070695_100010977
1697 Ga0070695_100232474
1698 Ga0070696_100000037
1699 Ga0070696_100000395
1700 Ga0070696_100009221
1701 Ga0070696_100090356
1702 Ga0070696_100255838
1703 Ga0070696_100268856
1704 Ga0070693_100009214
1705 Ga0070693_100012997
1706 Ga0070704_100019475
1707 Ga0070704_100092483
1708 Ga0068855_100004649
1709 Ga0068855_100004857
1710 Ga0068855_100010307
1711 Ga0068855_100040261
1712 Ga0068855_100052158
1713 Ga0068855_100071465
1714 Ga0068855_100126648
1715 Ga0068855_100271508
1716 Ga0068857_100050189
1717 Ga0068857_100146465
1718 Ga0068857_100197346
1719 Ga0068854_100232915
1720 Ga0068856_100014722
1721 Ga0068856_100030042
1722 Ga0068856_100062381
1723 Ga0068856_100084723
1724 Ga0068856_100091182
1725 Ga0068856_100282997
1726 Ga0070702_100000223
1727 Ga0070702_100089046
1728 Ga0068852_100028336
1729 Ga0068852_100037752
1730 Ga0068852_100090940
1731 Ga0068852_100118933
1732 Ga0068852_100403561
1733 Ga0068859_100000813
1734 Ga0068859_100003358
1735 Ga0068859_100019167
1736 Ga0068859_100022929
1737 Ga0068859_100095785
1738 Ga0068859_100141218
1739 Ga0068859_100169103
1740 Ga0068864_100002065
1741 Ga0068864_100031868
1742 Ga0068864_100066296
1743 Ga0068864_100093008
1744 Ga0068864_100094644
1745 Ga0068866_10000107
1746 Ga0068866_10003257
1747 Ga0068866_10007229
1748 Ga0068866_10085870
1749 Ga0068861_100001908
1750 Ga0068861_100003286
1751 Ga0068861_100005730
1752 Ga0068861_100016185
1753 Ga0068851_10000590
1754 Ga0068851_10006836
1755 Ga0068851_10025366
1756 Ga0068870_10005307
1757 Ga0068863_100020937
1758 Ga0068863_100031484
1759 Ga0068863_100059870
1760 Ga0068863_100126062
1761 Ga0068863_100227676
1762 Ga0068863_100263155
1763 Ga0068858_100002059
1764 Ga0068858_100002634
1765 Ga0068858_100009260
1766 Ga0068858_100015823
1767 Ga0068858_100720873
1768 Ga0068860_100000823
1769 Ga0068860_100002377
1770 Ga0068860_100010005
1771 Ga0068860_100013908
1772 Ga0068860_100077614
1773 Ga0068862_100000524
1774 Ga0068862_100004134
1775 Ga0068862_100053550
1776 Ga0068862_100069467
1777 Ga0068862_100074012
1778 Ga0068862_100617182
1779 Ga0081539_10000770
1780 Ga0075365_10006791
1781 Ga0075365_10060700
1782 Ga0075368_10000729
1783 Ga0075363_100006078
1784 Ga0075363_100013051
1785 Ga0075363_100017008
1786 Ga0075363_100021733
1787 Ga0075363_100023200
1788 Ga0075432_10036342
1789 Ga0070715_10052184
1790 Ga0070715_10075341
1791 Ga0075362_10006328
1792 Ga0075362_10009223
1793 Ga0075362_10140226
1794 Ga0075369_10006559
1795 Ga0075369_10065462
1796 Ga0075366_10001345
1797 Ga0075366_10003111
1798 Ga0075366_10004891
1799 Ga0075366_10005480
1800 Ga0075366_10007403
1801 Ga0075366_10070270
1802 Ga0075366_10081257
1803 Ga0075366_10082938
1804 Ga0075366_10085706
1805 Ga0075366_10119078
1806 Ga0075366_10256797
1807 Ga0097621_100001105
1808 Ga0097621_100004475
1809 Ga0097621_100004893
1810 Ga0097621_100011516
1811 Ga0097621_100015018
1812 Ga0097621_100028244
1813 Ga0097621_100041619
1814 Ga0097621_100093501
1815 Ga0097621_100271698
1816 Ga0075370_10001747
1817 Ga0075370_10002909
1818 Ga0075370_10008912
1819 Ga0075370_10018941
1820 Ga0075370_10029361
1821 Ga0075370_10035374
1822 Ga0068871_100001255
1823 Ga0068871_100005726
1824 Ga0068871_100005895
1825 Ga0068871_100007755
1826 Ga0068871_100041620
1827 Ga0068871_100102463
1828 Ga0068871_100148527
1829 Ga0075428_100046009
1830 Ga0075428_100156306
1831 Ga0075428_100161138
1832 Ga0075430_100004390
1833 Ga0075430_100023926
1834 Ga0075430_100125945
1835 Ga0075430_100232229
1836 Ga0075430_100294579
1837 Ga0075431_100055531
1838 Ga0075431_100130231
1839 Ga0075431_100216257
1840 Ga0075431_100370035
1841 Ga0075433_10015306
1842 Ga0075433_10025822
1843 Ga0075433_10161312
1844 Ga0075433_10282682
1845 Ga0075434_100000169
1846 Ga0075434_100002533
1847 Ga0075434_100044170
1848 Ga0075434_100420951
1849 Ga0075429_100000043
1850 Ga0075429_100000297
1851 Ga0075429_100031540
1852 Ga0068865_100000281
1853 Ga0068865_100000467
1854 Ga0068865_100022066
1855 Ga0068865_100047195
1856 Ga0068865_100369920
1857 Ga0075436_100000735
1858 Ga0075436_100000989
1859 Ga0075436_100002087
1860 Ga0075436_100037921
1861 Ga0097620_100000813
1862 Ga0097620_100003358
1863 Ga0097620_100019167
1864 Ga0097620_100022929
1865 Ga0097620_100095785
1866 Ga0097620_100141215
1867 Ga0097620_100154088
1868 Ga0097620_100169112
1869 Ga0079104_1000055
1870 Ga0079104_1024414
1871 Ga0099826_10000006
1872 Ga0099826_10001433
1873 Ga0099826_10047540
1874 Ga0075435_100000193
1875 Ga0075435_100003462
1876 Ga0075435_100067670
1877 Ga0075435_100158163
1878 Ga0075435_100273683
1879 Ga0075435_100327130
1880 Ga0099794_10009590
1881 Ga0099794_10040107
1882 Ga0099794_10151403
1883 Ga0099795_10004388
1884 Ga0099795_10047104
1885 Ga0105244_10011385
1886 Ga0105250_10005158
1887 Ga0105250_10098696
1888 Ga0105240_10025383
1889 Ga0105240_10083354
1890 Ga0105240_10168408
1891 Ga0105240_10196995
1892 Ga0105240_10221311
1893 Ga0111539_10157611
1894 Ga0111539_10169618
1895 Ga0105245_10000511
1896 Ga0105245_10002551
1897 Ga0105245_10037219
1898 Ga0105245_10299143
1899 Ga0105245_10307068
1900 Ga0105245_10453394
1901 Ga0105247_10375689
1902 Ga0114129_10012381
1903 Ga0105243_10000784
1904 Ga0105243_10001212
1905 Ga0105243_10002490
1906 Ga0105243_10006331
1907 Ga0105243_10011373
1908 Ga0105243_10012444
1909 Ga0105243_10012837
1910 Ga0105243_10075673
1911 Ga0105243_10091340
1912 Ga0105243_10258984
1913 Ga0105241_10261988
1914 Ga0105241_10454797
1915 Ga0105242_10002499
1916 Ga0105242_10002648
1917 Ga0105242_10025474
1918 Ga0105242_10304536
1919 Ga0105242_10619299
1920 Ga0105248_10000507
1921 Ga0105248_10005804
1922 Ga0105248_10074832
1923 Ga0105248_10220347
1924 Ga0105237_10098355
1925 Ga0105237_10328713
1926 Ga0105237_10757584
1927 Ga0105238_10062981
1928 Ga0105238_10130674
1929 Ga0105249_10014809
1930 Ga0105249_10031885
1931 Ga0105249_10051098
1932 Ga0105249_10395340
1933 Ga0105239_10136528
1934 Ga0105239_10238061
1935 Ga0105246_10307291
1936 Ga0157370_10004427
1937 Ga0157370_10009369
1938 Ga0157370_10075515
1939 Ga0157370_10225610
1940 Ga0157370_10242427
1941 Ga0157369_10003852
1942 Ga0157369_10366954
1943 Ga0157369_10540983
1944 Ga0157374_10101114
1945 Ga0157378_10000797
1946 Ga0157378_10001703
1947 Ga0157378_10003052
1948 Ga0157378_10123159
1949 Ga0163162_10002252
1950 Ga0163162_10015531
1951 Ga0163162_10084437
1952 Ga0163162_10132115
1953 Ga0163162_10176828
1954 Ga0163162_10277668
1955 Ga0157372_10037717
1956 Ga0157372_10222146
1957 Ga0157372_10836713
1958 Ga0157375_10025703
1959 Ga0157375_10026436
1960 Ga0157375_10048298
1961 Ga0157375_10049801
1962 Ga0157375_10097080
1963 Ga0157375_10152670
1964 Ga0157375_10161194
1965 Ga0157375_10311946
1966 Ga0157375_10425325
1967 Ga0163163_10009458
1968 Ga0163163_10180537
1969 Ga0163163_10318039
1970 Ga0157380_10010570
1971 Ga0157380_10014505
1972 Ga0157380_10022401
1973 Ga0157380_10049076
1974 Ga0182008_10003127
1975 Ga0182008_10004233
1976 Ga0182008_10017487
1977 Ga0182008_10028571
1978 Ga0182008_10060779
1979 Ga0157377_10041231
1980 Ga0157377_10254452
1981 Ga0157377_10283613
1982 Ga0157377_10350801
1983 Ga0157379_10021513
1984 Ga0157379_10070089
1985 Ga0157379_10136617
1986 Ga0157376_10004974
1987 Ga0157376_10007718
1988 Ga0182006_1000030
1989 Ga0182006_1001066
1990 Ga0182006_1008458
1991 Ga0182007_10002485
1992 Ga0182007_10021578
1993 Ga0182005_1036334
1994 Ga0183362_10003
1995 Ga0163161_10000099
1996 Ga0163161_10011306
1997 Ga0163161_10020762
1998 Ga0163161_10028787
1999 Ga0163161_10067857
2000 Ga0163161_10183408
2001 Ga0163161_10334952
2002 Ga0213872_10000169
2003 Ga0213872_10000382
2004 Ga0213872_10003263
2005 Ga0213874_10021161
2006 Ga0213876_10030362
2007 Ga0209435_100002
2008 Ga0209672_100660
2009 Ga0209147_101111
2010 Ga0209258_100240
2011 Ga0209646_1000001
2012 Ga0209026_1000001
2013 Ga0209148_1000033
2014 Ga0209759_1000001
2015 Ga0209129_1000054
2016 Ga0209565_1000224
2017 Ga0209565_1001443
2018 Ga0209673_1000097
2019 Ga0209673_1000172
2020 Ga0209673_1002773
2021 Ga0209673_1026389
2022 Ga0209673_1027409
2023 Ga0209130_1000832
2024 Ga0209130_1001095
2025 Ga0209130_1001276
2026 Ga0209675_1000038
2027 Ga0209675_1000431
2028 Ga0209676_1000048
2029 Ga0209676_1000739
2030 Ga0209676_1000836
2031 Ga0209676_1005062
2032 Ga0209676_1016772
2033 Ga0209025_1000174
2034 Ga0209025_1000906
2035 Ga0209025_1001066
2036 Ga0209025_1034199
2037 Ga0209025_1057319
2038 Ga0209758_1000034
2039 Ga0209758_1009180
2040 Ga0209050_1000012
2041 Ga0209050_1001075
2042 Ga0209050_1005184
2043 Ga0209256_1000035
2044 Ga0209256_1000103
2045 Ga0209256_1000165
2046 Ga0207426_1000058
2047 Ga0207426_1000067
2048 Ga0209051_1000019
2049 Ga0209051_1000099
2050 Ga0209051_1000221
2051 Ga0209051_1000315
2052 Ga0209051_1000452
2053 Ga0209051_1001491
2054 Ga0209051_1009063
2055 Ga0209257_1000024
2056 Ga0209257_1000047
2057 Ga0209257_1000057
2058 Ga0209257_1000309
2059 Ga0209257_1006026
2060 Ga0209257_1006654
2061 Ga0209257_1019426
2062 Ga0207697_10012918
2063 Ga0207656_10002493
2064 Ga0207656_10023459
2065 Ga0207656_10028846
2066 Ga0207696_1002665
2067 Ga0207655_1000639
2068 Ga0207642_10000059
2069 Ga0207642_10001537
2070 Ga0207642_10018424
2071 Ga0207642_10108463
2072 Ga0207642_10109080
2073 Ga0207688_10074185
2074 Ga0207688_10210137
2075 Ga0207680_10002140
2076 Ga0207680_10056159
2077 Ga0207685_10083974
2078 Ga0207645_10037643
2079 Ga0207645_10056575
2080 Ga0207643_10072392
2081 Ga0207705_10027726
2082 Ga0207705_10279860
2083 Ga0207654_10049621
2084 Ga0207654_10199505
2085 Ga0207654_10332635
2086 Ga0207707_10010652
2087 Ga0207707_10037440
2088 Ga0207707_10128622
2089 Ga0207707_10340259
2090 Ga0207695_10071845
2091 Ga0207695_10129241
2092 Ga0207660_10005092
2093 Ga0207660_10035234
2094 Ga0207660_10071742
2095 Ga0207660_10294245
2096 Ga0207662_10000258
2097 Ga0207662_10032494
2098 Ga0207662_10081302
2099 Ga0207657_10025234
2100 Ga0207649_10003399
2101 Ga0207652_10030048
2102 Ga0207652_10046373
2103 Ga0207652_10403426
2104 Ga0207652_10606648
2105 Ga0207646_10134671
2106 Ga0207646_10166669
2107 Ga0207646_10355344
2108 Ga0207646_10474246
2109 Ga0207681_10000424
2110 Ga0207681_10019120
2111 Ga0207681_10041269
2112 Ga0207694_10083398
2113 Ga0207650_10006179
2114 Ga0207650_10284363
2115 Ga0207659_10020943
2116 Ga0207659_10042740
2117 Ga0207659_10114883
2118 Ga0207687_10000254
2119 Ga0207687_10002550
2120 Ga0207687_10083007
2121 Ga0207687_10101678
2122 Ga0207644_10000264
2123 Ga0207644_10002654
2124 Ga0207644_10014945
2125 Ga0207644_10523931
2126 Ga0207690_10110969
2127 Ga0207706_10013512
2128 Ga0207706_10031863
2129 Ga0207706_10082110
2130 Ga0207706_10332277
2131 Ga0207686_10000084
2132 Ga0207686_10023994
2133 Ga0207686_10052906
2134 Ga0207686_10192202
2135 Ga0207709_10000111
2136 Ga0207709_10000608
2137 Ga0207709_10001030
2138 Ga0207709_10001599
2139 Ga0207709_10002253
2140 Ga0207709_10003776
2141 Ga0207709_10009256
2142 Ga0207709_10018818
2143 Ga0207709_10019289
2144 Ga0207709_10036017
2145 Ga0207709_10234187
2146 Ga0207670_10007649
2147 Ga0207670_10021569
2148 Ga0207670_10041074
2149 Ga0207669_10020526
2150 Ga0207669_10042801
2151 Ga0207704_10000722
2152 Ga0207704_10001711
2153 Ga0207704_10003689
2154 Ga0207704_10010623
2155 Ga0207704_10046802
2156 Ga0207704_10068335
2157 Ga0207691_10018804
2158 Ga0207691_10066785
2159 Ga0207691_10073889
2160 Ga0207691_10092293
2161 Ga0207691_10107652
2162 Ga0207691_10276318
2163 Ga0207711_10003550
2164 Ga0207711_10010810
2165 Ga0207711_10048589
2166 Ga0207689_10000872
2167 Ga0207689_10003506
2168 Ga0207689_10051064
2169 Ga0207689_10135887
2170 Ga0207689_10159270
2171 Ga0207689_10374332
2172 Ga0207661_10037982
2173 Ga0207679_10201745
2174 Ga0207679_10211630
2175 Ga0207667_10013717
2176 Ga0207667_10018933
2177 Ga0207667_10032117
2178 Ga0207667_10127841
2179 Ga0207667_10206964
2180 Ga0207667_10368586
2181 Ga0207667_10664660
2182 Ga0207651_10004672
2183 Ga0207651_10036834
2184 Ga0207651_10165825
2185 Ga0207651_10389188
2186 Ga0207712_10009623
2187 Ga0207712_10014447
2188 Ga0207668_10002951
2189 Ga0207668_10084418
2190 Ga0207658_10002509
2191 Ga0207658_10010175
2192 Ga0207658_10176662
2193 Ga0207677_10001522
2194 Ga0207677_10010555
2195 Ga0207677_10047763
2196 Ga0207677_10181062
2197 Ga0207677_10197871
2198 Ga0207677_10390810
2199 Ga0207703_10001789
2200 Ga0207703_10001816
2201 Ga0207703_10006009
2202 Ga0207703_10016897
2203 Ga0207639_10009069
2204 Ga0207639_10165449
2205 Ga0207678_10312806
2206 Ga0207708_10000049
2207 Ga0207708_10003647
2208 Ga0207708_10004718
2209 Ga0207708_10078562
2210 Ga0207702_10012590
2211 Ga0207702_10020851
2212 Ga0207702_10146847
2213 Ga0207702_10314205
2214 Ga0207702_10449591
2215 Ga0207702_10482142
2216 Ga0207641_10001603
2217 Ga0207641_10003329
2218 Ga0207641_10263333
2219 Ga0207641_10296484
2220 Ga0207641_10389054
2221 Ga0207648_10000018
2222 Ga0207648_10000161
2223 Ga0207648_10000179
2224 Ga0207648_10000685
2225 Ga0207648_10008674
2226 Ga0207648_10023777
2227 Ga0207648_10101337
2228 Ga0207648_10293534
2229 Ga0207648_10303785
2230 Ga0207648_10327087
2231 Ga0207676_10003295
2232 Ga0207676_10018334
2233 Ga0207676_10049237
2234 Ga0207676_10157716
2235 Ga0207676_10426060
2236 Ga0207674_10071765
2237 Ga0207674_10071832
2238 Ga0207674_10077512
2239 Ga0207674_10088100
2240 Ga0207674_10203789
2241 Ga0207675_100000050
2242 Ga0207675_100000176
2243 Ga0207675_100005391
2244 Ga0207675_100007479
2245 Ga0207675_100008096
2246 Ga0207683_10008432
2247 Ga0207683_10049731
2248 Ga0207683_10051569
2249 Ga0207683_10250689
2250 Ga0207683_10656968
2251 Ga0207698_10012988
2252 Ga0207698_10111682
2253 Ga0207698_10116511
2254 Ga0207698_10178809
2255 Ga0207698_10231513
2256 Ga0209281_1000007
2257 Ga0209281_1017401
2258 Ga0209967_1005313
2259 Ga0209981_1003553
2260 Ga0209996_1004923
2261 Ga0210000_1001544
2262 Ga0209995_1000178
2263 Ga0209999_1002769
2264 Ga0209282_1000003
2265 Ga0209282_1000182
2266 Ga0209588_1027037
2267 Ga0209971_1016133
2268 Ga0209974_10048164
2269 Ga0209974_10071541
2270 Ga0207428_10001240
2271 Ga0207428_10052635
2272 Ga0207428_10082070
2273 Ga0268266_10259695
2274 Ga0268265_10002096
2275 Ga0268265_10013533
2276 Ga0268265_10019192
2277 Ga0268265_10040349
2278 Ga0268265_10044723
2279 Ga0268265_10386736
2280 Ga0268265_10520437
2281 Ga0268264_10000613
2282 Ga0268264_10000848
2283 Ga0268264_10001082
2284 Ga0268264_10024923
2285 Ga0268264_10054537
2286 Ga0268264_10141041
2287 Ga0265336_10000497
2288 Ga0307515_10000609
2289 Ga0307515_10001484
2290 Ga0307515_10001693
2291 Ga0307515_10004716
2292 Ga0307515_10042972
2293 Ga0307515_10074111
2294 Ga0265324_10000004
2295 Ga0265324_10001492
2296 Ga0307511_10000804
2297 Ga0316176_1084534
2298 Ga0316183_1074932
2299 Ga0316181_1111110
2300 Ga0316182_1108560
2301 Ga0265330_10000091
2302 Ga0265332_10000028
2303 Ga0265332_10032991
2304 Ga0265325_10000133
2305 Ga0265325_10002488
2306 Ga0265325_10059895
2307 Ga0265340_10036187
2308 Ga0265327_10000174
2309 Ga0265327_10000542
2310 Ga0265327_10001654
2311 Ga0265327_10042455
2312 Ga0265327_10065441
2313 Ga0265316_10182814
2314 Ga0265316_10362789
2315 Ga0307513_10000008
2316 Ga0307513_10000038
2317 Ga0307513_10004316
2318 Ga0307513_10114170
2319 Ga0307513_10213744
2320 Ga0307509_10025753
2321 Ga0307509_10333040
2322 Ga0307408_100000109
2323 Ga0307408_100000886
2324 Ga0307408_100010362
2325 Ga0307408_100107069
2326 Ga0307408_100112145
2327 Ga0307408_100113799
2328 Ga0307408_100233308
2329 Ga0307408_100291225
2330 Ga0307508_10174014
2331 Ga0307514_10010740
2332 Ga0316575_10022997
2333 Ga0316575_10051595
2334 Ga0316579_10000450
2335 Ga0316579_10018729
2336 Ga0265314_10000054
2337 Ga0265314_10000262
2338 Ga0265314_10004112
2339 Ga0265314_10015575
2340 Ga0265314_10015650
2341 Ga0316576_10066739
2342 Ga0316578_10009084
2343 Ga0316578_10054604
2344 Ga0307516_10000359
2345 Ga0307516_10001691
2346 Ga0307405_10006962
2347 Ga0307405_10118807
2348 Ga0307405_10154672
2349 Ga0307405_10160760
2350 Ga0307405_10174122
2351 Ga0307405_10192997
2352 Ga0307410_10121002
2353 Ga0307406_10000741
2354 Ga0307406_10028543
2355 Ga0307406_10125721
2356 Ga0307406_10149504
2357 Ga0307407_10130137
2358 Ga0307407_10151211
2359 Ga0307412_10029307
2360 Ga0307412_10037074
2361 Ga0307412_10048688
2362 Ga0307412_10212466
2363 Ga0307412_10255692
2364 Ga0307412_10271858
2365 Ga0307409_100000580
2366 Ga0307409_100063181
2367 Ga0307409_100066611
2368 Ga0307409_100122330
2369 Ga0307409_100242530
2370 Ga0307409_100287526
2371 Ga0307416_100014097
2372 Ga0307416_100121709
2373 Ga0307416_100292285
2374 Ga0307416_100396256
2375 Ga0307414_10303056
2376 Ga0307411_10080249
2377 Ga0307411_10304015
2378 Ga0307411_10438975
2379 Ga0307415_100002051
2380 Ga0307415_100511094
2381 Ga0316583_10000954
2382 Ga0316583_10006979
2383 Ga0316580_10017904
2384 Ga0316593_10027629
2385 Ga0316593_10125973
2386 Ga0316588_1002525
2387 Ga0316596_1005014
2388 Ga0373930_0001564
2389 Ga0373938_0020813
2390 Ga0373926_0007968
2391 Ga0373928_0004091
2392 Ga0373929_0004917
2393 Ga0373934_0000218
2394 Ga0373934_0000946
2395 Ga0373951_0017250
2396 Ga0373952_0000062
2397 Ga0373952_0012100
2398 Ga0373923_0000103
2399 Ga0373932_0002566
2400 Ga0373939_0000040
2401 Ga0373939_0004488
2402 Ga0373941_0009749
2403 Ga0373941_0128072
2404 Ga0373945_0025798
2405 Ga0373953_0003648
2406 Ga0373954_0000153
2407 Ga0373954_0000939
2408 Ga0373956_0000081
2409 Ga0373956_0003816
2410 Ga0373956_0012068
2411 Ga0373957_0000956
2412 Ga0373960_0000506
2413 Ga0373943_0030168
2414 Ga0373943_0055619
2415 Ga0373943_0261689
2416 Ga0373946_0010614
2417 Ga0373946_0096443
2418 Ga0373955_0124248
2419 Ga0373942_0010433
2420 Ga0373961_0001887
2421 Ga0373962_0019950
2422 Ga0316574_0003380
2423 Ga0316574_0088297
2424 Ga0373924_0000180
2425 Ga0373931_0000371
2426 Ga0373931_0002521
2427 Ga0373931_0075642
2428 Ga0373931_0085929
2429 Ga0373935_0001120
2430 Ga0373935_0002681
2431 Ga0373935_0410427
2432 Ga0373927_0006838
2433 Ga0373927_0013540
2434 Ga0373927_0047872
2435 Ga0373933_0000426
2436 Ga0373933_0003869
2437 Ga0373933_0081369
2438 Ga0373933_0085508
2439 Ga0373933_0275239
2440 Ga0373947_0025269
2441 Ga0373937_0000149
2442 Ga0373937_0000668
2443 Ga0373937_0005081
2444 Ga0373937_0034638
2445 Ga0373937_0198986
2446 Ga0373937_0613577
2447 Ga0316582_0003457
2448 Ga0316584_0096297
2449 Ga0373925_0002526
2450 Ga0373925_0040580
2451 Ga0373925_0062435
2452 Ga0395899_0007150
2453 Ga0395900_0000050
2454 Ga0395900_0006372
2455 Ga0395900_0283799
2456 Ga0395898_0001856
2457 Ga0395898_0002933
2458 Ga0395898_0041859
2459 Ga0395898_0111300
2460 Ga0395905_0000088
2461 Ga0395905_0002271
2462 Ga0395905_0003887
2463 Ga0395905_0013719
2464 Ga0395905_0028345
2465 Ga0395905_0031917
2466 Ga0395905_0137590
2467 Ga0395905_0188686
2468 Ga0395905_0194580
2469 Ga0395905_0450176
2470 Ga0316581_0009983
2471 Ga0395901_0089615
2472 Ga0395901_0103602
2473 Ga0395901_0104112
2474 Ga0395901_0121973
2475 Ga0395901_0157864
2476 Ga0395901_0169257
2477 Ga0395901_0171643
2478 Ga0436365_1640203
2479 Ga0436365_1756237
2480 Ga0436361_0005759
2481 Ga0436361_0159126
2482 Ga0436361_0240153
2483 Ga0436361_0287659
2484 Ga0436361_0566522
2485 Ga0436363_0976259
2486 Ga0439436_0020264
2487 Ga0439465_0005691
2488 Ga0451807_2212897
2489 Ga0451807_2362621
2490 Ga0451853_0962706
2491 Ga0439433_0000594
2492 Ga0439437_000513
2493 Ga0439441_000066
2494 Ga0439442_023155
2495 Ga0439443_000974
2496 Ga0439443_011855
2497 Ga0439445_0006018
2498 Ga0439432_012324
2499 Ga0439432_033137
2500 Ga0439449_0003256
2501 Ga0439449_0005226
2502 Ga0439449_0007955
2503 Ga0439449_0061218
2504 Ga0439451_029916
2505 Ga0439452_030875
2506 Ga0439454_006088
2507 Ga0439457_019160
2508 Ga0439462_0000723
2509 Ga0439462_0007330
2510 Ga0439462_0042990
2511 Ga0450917_001392
2512 Ga0450923_010632
2513 Ga0450890_000746
2514 Ga0450891_005185
2515 Ga0450892_000203
2516 Ga0450896_005203
2517 Ga0450898_004891
2518 Ga0450906_000190
2519 Ga0439446_0000148
2520 Ga0439446_0041173
2521 Ga0450909_002564
2522 Ga0439434_0000121
2523 Ga0439434_0002740
2524 Ga0439435_0000031
2525 Ga0439435_0000893
2526 Ga0439435_0001361
2527 Ga0439435_0011295
2528 Ga0439444_0000800
2529 Ga0439459_0051105
2530 Ga0439460_0000173
2531 Ga0439460_0002287
2532 Ga0450918_004718
2533 Ga0450893_0008662
2534 Ga0451577_0000085
2535 Ga0451577_0002155
2536 Ga0451577_0004221
2537 Ga0451577_0014375
2538 Ga0451577_0081052
2539 Ga0451577_0307045
2540 Ga0451577_0589555
2541 Ga0451577_0605264
2542 Ga0466969_0000169
2543 Ga0466969_0024849
2544 Ga0466972_0011675
2545 Ga0453683_0000047
2546 Ga0453683_0000464
2547 Ga0453683_0002014
2548 Ga0453683_0095554
2549 Ga0466965_0002274
2550 Ga0466966_0001826
2551 Ga0466961_0001054
2552 Ga0466961_0004942
2553 Ga0466961_0012914
2554 Ga0466963_0230471
2555 Ga0466964_0015945
2556 Ga0453684_0000273
2557 Ga0453684_0000302
2558 Ga0453684_0005216
2559 Ga0453684_0009340
2560 Ga0453684_0029404
2561 Ga0453684_0032697
2562 Ga0453684_0140681
2563 Ga0453684_0231917
2564 Ga0453684_0284443
2565 Ga0453684_0367514
2566 Ga0466968_0143309
2567 Ga0466957_0017735
2568 Ga0466957_0089032
2569 Ga0466957_0206380
2570 Ga0466959_0008784
2571 Ga0466959_0033437
2572 Ga0466959_0036716
2573 Ga0466959_0123839
2574 Ga0451576_0000006
2575 Ga0451576_0000116
2576 Ga0451576_0000810
2577 Ga0451576_0003028
2578 Ga0451576_0017940
2579 Ga0451576_0040503
2580 Ga0451576_0052789
2581 Ga0451576_0072549
2582 Ga0451576_0090153
2583 Ga0451576_0136460
2584 Ga0451576_0164653
2585 Ga0451576_0169075
2586 Ga0451576_0184651
2587 Ga0451576_0341786
2588 Ga0451576_0379732
2589 Ga0451576_0650693
2590 Ga0451576_0682101
2591 Ga0466958_0016792
2592 Ga0466967_0095991
2593 Ga0495592_0000402
2594 Ga0495592_0008806
2595 Ga0495592_0011017
2596 Ga0495592_0012367
2597 Ga0495592_0018099
2598 Ga0495603_0004104
2599 Ga0495629_0050922
2600 Ga0495638_0045635
2601 Ga0495638_0142107
2602 Ga0495641_0005397
2603 Ga0495641_0014457
2604 Ga0495651_0000386
2605 Ga0495651_0001537
2606 Ga0495653_0000014
2607 Ga0495653_0001467
2608 Ga0495653_0104712
2609 Ga0495653_0269004
2610 Ga0495650_0010303
2611 Ga0495580_0005123
2612 Ga0495580_0022257
2613 Ga0495582_0022643
2614 Ga0495639_0002490
2615 Ga0495639_0086817
2616 Ga0495662_0005031
2617 Ga0495662_0007831
2618 Ga0495662_0056211
2619 Ga0495585_0004535
2620 Ga0495606_0000085
2621 Ga0495608_0001458
2622 Ga0495608_0010334
2623 Ga0495608_0024719
2624 Ga0495618_0036764
2625 Ga0495620_0009557
2626 Ga0495628_0001323
2627 Ga0495628_0003324
2628 Ga0495628_0012120
2629 Ga0495628_0023392
2630 Ga0495628_0054659
2631 Ga0495628_0082173
2632 Ga0495630_0001562
2633 Ga0495631_0001860
2634 Ga0495637_0001254
2635 Ga0495666_0005300
2636 Ga0495652_0014341
2637 Ga0495652_0020971
2638 Ga0495652_0031771
2639 Ga0495652_0340747
2640 Ga0495654_0000034
2641 Ga0495654_0006664
2642 Ga0495665_0002051
2643 Ga0495640_0167223
2644 Ga0495586_0004208
2645 Ga0495586_0010110
2646 Ga0495586_0038227
2647 Ga0495587_0005053
2648 Ga0495587_0005690
2649 Ga0495587_0028128
2650 Ga0495598_0026266
2651 Ga0495621_0006064
2652 Ga0495621_0101614
2653 Ga0495645_0000490
2654 Ga0495645_0000505
2655 Ga0495622_0018754
2656 Ga0495633_0000563
2657 Ga0495667_0000929
2658 Ga0495667_0003624
2659 Ga0495667_0016088
2660 Ga0495667_0089742
2661 Ga0495656_0000090
2662 Ga0495656_0011534
2663 Ga0495634_0004749
2664 Ga0495634_0052509
2665 Ga0495625_0000045
2666 Ga0495625_0113489
2667 Ga0495635_0013262
2668 Ga0495635_0022732
2669 Ga0495635_0121478
2670 Ga0495659_0056632
2671 Ga0495588_0099631
2672 Ga0495657_0001646
2673 Ga0495657_0075298
2674 Ga0495599_0001724
2675 Ga0495599_0005109
2676 Ga0495599_0007320
2677 Ga0495599_0016689
2678 Ga0495646_0073811
2679 Ga0495647_0000520
2680 Ga0495647_0002578
2681 Ga0495658_0005333
2682 Ga0495658_0059067
2683 Ga0495669_0039167
2684 Ga0495613_0003024
2685 Ga0495613_0014356
2686 Ga0495624_0004534
2687 Ga0495624_0045779
2688 Ga0495624_0055474
2689 Ga0495600_0001614
2690 Ga0495600_0006471
2691 Ga0495581_0296944
2692 Ga0495604_0001290
2693 Ga0495604_0063974
2694 Ga0495604_0191323
2695 Ga0495604_0256034
2696 Ga0495636_0096815
2697 Ga0495636_0101440
2698 Ga0495674_0002016
2699 Ga0495676_0118617
2700 Ga0495680_0000735
2701 Ga0495680_0013178
2702 Ga0495687_000961
2703 Ga0495675_0024850
2704 Ga0495684_0006542
2705 Ga0495684_0071758
2706 Ga0495593_0014105
2707 Ga0495593_0157840
2708 Ga0495602_0226614
2709 Ga0495614_0037406
2710 Ga0496100_0004031
2711 Ga0496100_0302774
2712 Ga0496102_0062695
2713 Ga0496104_0017851
2714 Ga0496104_0113513
2715 Ga0496105_0264483
2716 Ga0496108_0025181
2717 Ga0496108_0030824
2718 Ga0496108_0338683
2719 Ga0496109_0007737
2720 Ga0496109_0020515
2721 Ga0496109_0082794
2722 Ga0496109_0096917
2723 Ga0496110_0032764
2724 Ga0496110_0081553
2725 Ga0496110_0146480
2726 Ga0496112_0035835
2727 Ga0496113_0067776
2728 Ga0496116_0046660
2729 Ga0496116_0072434
2730 Ga0496117_0000056
2731 Ga0496117_0060218
2732 Ga0496118_0000047
2733 Ga0496118_0005388
2734 Ga0496118_0017400
2735 Ga0496119_0098623
2736 Ga0496121_0021767
2737 Ga0496121_0027142
2738 Ga0496121_0041655
2739 Ga0496121_0088636
2740 Ga0496122_0000747
2741 Ga0496122_0006247
2742 Ga0496123_0000274
2743 Ga0496123_0000345
2744 Ga0496124_0000596
2745 Ga0496124_0028048
2746 Ga0496124_0044619
2747 Ga0496124_0174602
2748 Ga0496124_0237264
2749 Ga0496125_0006034
2750 Ga0496125_0049426
2751 Ga0496125_0089064
2752 Ga0496125_0099879
2753 Ga0496126_0031456
2754 Ga0496126_0268443
2755 Ga0501031_0000519
2756 Ga0501031_0002448
2757 Ga0501032_0021502
2758 Ga0501032_0129975
2759 Ga0501033_0000289
2760 Ga0501033_0001878
2761 Ga0501034_0009180
2762 Ga0501034_0041500
2763 Ga0501034_0080371
2764 Ga0501034_0106998
2765 Ga0501036_0000051
2766 Ga0501036_0025591
2767 Ga0501036_0098999
2768 Ga0501037_0004183
2769 Ga0501037_0007041
2770 Ga0501038_0000505
2771 Ga0501038_0016412
2772 Ga0501039_0002690
2773 Ga0501039_0113685
2774 Ga0501039_0140084
2775 Ga0501039_0341686
2776 Ga0501040_0030316
2777 Ga0501040_0033226
2778 Ga0501041_0000236
2779 Ga0501041_0044238
2780 Ga0501042_0000107
2781 Ga0501042_0040258
2782 Ga0501042_0108547
2783 Ga0501043_0000057
2784 Ga0501043_0012140
2785 Ga0501043_0012436
2786 Ga0501043_0117192
2787 Ga0501043_0172037
2788 Ga0501046_0000075
2789 Ga0501046_0000548
2790 Ga0501046_0016131
2791 Ga0501046_0036963
2792 Ga0501046_0099823
2793 Ga0501047_0000081
2794 Ga0501047_0005071
2795 Ga0501047_0006131
2796 Ga0501047_0058948
2797 Ga0501047_0193772
2798 Ga0501048_0000076
2799 Ga0501048_0002636
2800 Ga0501048_0289042
2801 Ga0501067_0044166
2802 Ga0501069_0002988
2803 Ga0501070_0003556
2804 Ga0501070_0015557
2805 Ga0501070_0027035
2806 Ga0501070_0084597
2807 Ga0501070_0126469
2808 Ga0501071_0000836
2809 Ga0501071_0050258
2810 Ga0501071_0094569
2811 Ga0501071_0140717
2812 Ga0501072_0000201
2813 Ga0501072_0001610
2814 Ga0501072_0018650
2815 Ga0501072_0025495
2816 Ga0501072_0043676
2817 Ga0501073_0000403
2818 Ga0501073_0000710
2819 Ga0501073_0001421
2820 Ga0501073_0137263
2821 Ga0501073_0402902
2822 Ga0501074_0003228
2823 Ga0501074_0073065
2824 Ga0501074_0206705
2825 Ga0501075_0000544
2826 Ga0501075_0014368
2827 Ga0501075_0122411
2828 Ga0501075_0232921
2829 Ga0501075_0282334
2830 Ga0501075_0324530
2831 Ga0501076_0000771
2832 Ga0501076_0001109
2833 Ga0501077_0025685
2834 Ga0501198_000012
2835 Ga0501222_000010
2836 Ga0501222_001940
2837 Ga0501223_000534
2838 Ga0501233_001974
2839 Ga0501253_001770
2840 Ga0501221_000686
2841 Ga0501225_0003774
2842 Ga0501225_0032555
2843 Ga0501229_000069
2844 Ga0501079_0000441
2845 Ga0501079_0007491
2846 Ga0501079_0017995
2847 Ga0501080_0000762
2848 Ga0501080_0014631
2849 Ga0501080_0034459
2850 Ga0501080_0131792
2851 Ga0501080_0287094
2852 Ga0501080_0375073
2853 Ga0501081_0001178
2854 Ga0501081_0008200
2855 Ga0501081_0071858
2856 Ga0501081_0195693
2857 Ga0501083_0003281
2858 Ga0501083_0020668
2859 Ga0501083_0033807
2860 Ga0501083_0125143
2861 Ga0501266_000713
2862 Ga0501272_004105
2863 Ga0501035_0009359
2864 Ga0501035_0093945
2865 Ga0501035_0120920
2866 Ga0501035_0179968
2867 Ga0501044_0004209
2868 Ga0501044_0530435
2869 Ga0501044_0620666
2870 Ga0501045_0000911
2871 Ga0501045_0227956
2872 nmdc:mga03683_112035_c1
2873 nmdc:mga03683_5307_c1
2874 nmdc:mga03683_6760_c1
2875 nmdc:mga03n38_21506_c1
2876 nmdc:mga03n38_311636_c1
2877 nmdc:mga00v17_45226_c1
2878 nmdc:mga0yw44_337042_c1
2879 nmdc:mga0yw44_34515_c1
2880 nmdc:mga0yw44_56081_c1
2881 nmdc:mga0k408_109209_c1
2882 nmdc:mga0k408_14580_c1
2883 nmdc:mga0k408_161_c1
2884 nmdc:mga0k408_16652_c1
2885 nmdc:mga0k408_1875_c1
2886 nmdc:mga0k408_249692_c1
2887 nmdc:mga0k408_35602_c1
2888 nmdc:mga0k408_4724_c1
2889 nmdc:mga0k408_60277_c1
2890 nmdc:mga07m45_11075_c1
2891 nmdc:mga07m45_22932_c1
2892 nmdc:mga07m45_33279_c1
2893 nmdc:mga07m45_4223_c1
2894 nmdc:mga07m45_46597_c1
2895 nmdc:mga07m45_73795_c1
2896 nmdc:mga07m45_8519_c1
2897 nmdc:mga05p37_1040_c1
2898 nmdc:mga05p37_822234_c1
2899 nmdc:mga05p37_97434_c1
2900 nmdc:mga09592_179179_c1
2901 nmdc:mga09592_321446_c1
2902 nmdc:mga09592_507_c1
2903 nmdc:mga09592_52198_c1
2904 nmdc:mga09592_90937_c1
2905 nmdc:mga0qj67_101996_c1
2906 nmdc:mga0qj67_21296_c1
2907 nmdc:mga0qj67_21367_c1
2908 nmdc:mga0qj67_60057_c1
2909 nmdc:mga06r32_250227_c1
2910 nmdc:mga06r32_2510_c1
2911 nmdc:mga06r32_417730_c1
2912 nmdc:mga06r32_51214_c1
2913 nmdc:mga08y16_203250_c1
2914 nmdc:mga08y16_315043_c1
2915 nmdc:mga08y16_6498_c1
2916 nmdc:mga08y16_69561_c1
2917 nmdc:mga08y16_95492_c1
2918 nmdc:mga0n895_13969_c1
2919 nmdc:mga0n895_458_c1
2920 nmdc:mga0n895_463400_c1
2921 nmdc:mga0rr50_156_c1
2922 nmdc:mga0rr50_23873_c1
2923 nmdc:mga0rr50_29997_c1
2924 nmdc:mga0rr50_303958_c1
2925 nmdc:mga0rr50_309755_c1
2926 nmdc:mga08x19_341_c1
2927 nmdc:mga08x19_4042_c1
2928 nmdc:mga08x19_54115_c1
2929 nmdc:mga08x19_7621_c1
2930 nmdc:mga08x19_81_c1
2931 nmdc:mga0a205_127550_c1
2932 nmdc:mga0a205_161597_c1
2933 nmdc:mga0a205_299_c1
2934 nmdc:mga0a205_302797_c1
2935 nmdc:mga0a205_354577_c1
2936 nmdc:mga0a205_43986_c1
2937 nmdc:mga0a205_572403_c1
2938 nmdc:mga0a205_57923_c1
2939 Ga0495601_0000627
2940 Ga0495601_0001241
2941 Ga0495601_0224741
2942 Ga0495612_0016150
2943 Ga0495612_0060180
2944 Ga0500610_0001655
2945 Ga0500610_0004732
2946 Ga0495595_0002323
2947 Ga0495595_0019707
2948 Ga0495595_0040606
2949 Ga0500643_004741
2950 Ga0500646_0001015
2951 Ga0500651_0000223
2952 Ga0500566_0186570
2953 Ga0500571_000129
2954 Ga0500592_007345
2955 Ga0500593_000472
2956 Ga0500593_000526
2957 Ga0500607_004161
2958 Ga0500607_051714
2959 Ga0500655_001764
2960 Ga0500655_020384
2961 Ga0500559_0004481
2962 Ga0500559_0119174
2963 Ga0500568_0009007
2964 Ga0500568_0021891
2965 Ga0500574_011933
2966 Ga0500604_0002378
2967 Ga0500604_0020845
2968 Ga0500616_0023945
2969 Ga0500622_0059421
2970 Ga0500627_0000567
2971 Ga0500634_0009885
2972 Ga0500634_0022949
2973 Ga0500636_0021704
2974 Ga0500645_005298
2975 Ga0501084_0014223
2976 Ga0501084_0061169
2977 Ga0501084_0070133
2978 Ga0501084_0162371
2979 Ga0590071_000494
2980 Ga0590074_009073
2981 Ga0590074_009443
2982 Ga0501082_0006025
2983 Ga0501082_0018607
2984 Ga0501082_0047642
2985 Ga0501082_0060097
2986 Ga0501082_0080902
2987 Ga0530510_0000543
2988 Ga0530510_0000585
2989 2513229154
2990 2587724932
2991 2587731701
2992 2588292434
2993 2599623423
2994 2599675359
2995 2599681028
2996 2599693043
2997 2643743744
2998 2643867750
2999 2643936506
3000 2643968186
3001 2644062216
3002 2644071404
3003 2644142458
3004 2644161820
3005 2644222343
3006 2644256357
3007 2644277043
3008 2644301365
3009 2644317862
3010 2644325584
3011 2644340870
3012 2644358534
3013 2644399303
3014 2644467009
3015 2738718171
3016 2738880444
3017 2739058402
3018 2739245827
3019 2739281358
3020 2816470521
3021 2819600599
3022 2831267675
3023 2838061119
3024 2839141861
3025 2842679801
3026 2842718703
3027 2842736382
3028 2842748890
3029 2857569270
3030 2885085895
3031 2885196958
3032 2885198855
3033 2885211765
3034 2895517910
3035 2899928254
3036 2904452469
3037 2904460932
3038 2904545154
3039 2919463899
3040 2928041206
3041 2928048048
3042 2928055889
3043 2928066630
3044 2928077216
3045 2928087517
3046 2928120635
3047 2929165332
3048 2929522915
3049 2932424025
3050 2945910062
3051 2945946035
3052 2945975634
3053 2945987922
3054 2954768922

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05673

DUF815

Protein of unknown function (DUF815)

33

287

0.97

PF13191

AAA_16

AAA ATPase domain

67

187

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7k-assembly1.cif.gz_A thermotoga maritima ruvb p216g mutant 0.7454 72 296
1sxj-assembly1.cif.gz_E crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna) 0.7417 74 299
1in7-assembly1.cif.gz_A thermotoga maritima ruvb r170a 0.7341 68 296
1in6-assembly1.cif.gz_A thermotoga maritima ruvb k64r mutant 0.7256 70 296
1in5-assembly1.cif.gz_A thermogota maritima ruvb a156s mutant 0.7147 70 296
ID Description Score Start End Superfamily
af_Q58294_3_157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7648 74 199 3.40.50.300
af_K7TUL7_284_471_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7383 67 200 3.40.50.300
1sxjE01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7362 74 205 3.40.50.300
af_A0A0R0FGW9_202_366_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7343 65 200 3.40.50.300
af_A0A1D6NFD7_32_192_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7302 80 199 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537EAG2-F1-model_v4 DUF815 domain-containing protein 0.9868 88 207
AF-A0A537EAG2-F1-model_v4 DUF815 domain-containing protein 0.9708 88 207
AF-A0A6J4QIJ5-F1-model_v4 Uncharacterized protein 0.965 49 160
AF-A0A7S1DKY2-F1-model_v4 AAA+ ATPase domain-containing protein 0.9569 55 165
AF-A0A259P737-F1-model_v4 AAA family ATPase 0.9498 67 304

Map