F494575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1527 | 530 | 3054 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300035117|Ga0373953_0009196|Ga0373953_0009196_2043_3224 |
| Length | 385 |
| Sequence | MLDRPTDHAGGFEIHAPSIEKFRWPCEPAQPAAAIFRMDQDEPARHNRRGGARPVYGRGDRTGKQGTMDLKVGKQAIRDASNKLKNWGRWGADDQIGTLNHVTPEDIVQAASLICSGKVFALGIPLDRSGPQNGLFGGRWNPIHTMLATGTDAIAGRQDIVPNLRYADDSINMPVQCATHWDALGHIFYEDKMYNGFDARLVDSNGLGKLGIEHAKSKMVGRGVLLDIARHKGVRHLKDGQGISNDDLDSCAKAQNIQIRRGDFVIVRTGQMERCLEEKQWGGFAGGDAPGVKFENCYWCQDKQIAAICSDTWGVEVRPNETTEANQPWHWVVIPAMGLTMGEMFYLKDLAEDCAADGTYEFFFCGPPLVITGGTGSPINPQAIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 10 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 11 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 12 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 13 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 14 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 15 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 21 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 22 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 23 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 24 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 25 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 26 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 27 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 28 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 29 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 30 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 31 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 38 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 41 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 83 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 112 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 113 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 114 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 115 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 116 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 117 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 119 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 120 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 122 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 123 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 124 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 125 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 131 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 132 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 134 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 135 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 136 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 137 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 138 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 141 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 142 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 146 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 162 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 176 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 177 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 178 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 179 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 180 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 262 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 266 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 267 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 270 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 271 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 272 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 273 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 274 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 275 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 276 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 277 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 278 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 279 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 280 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 281 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 282 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 283 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 284 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 285 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 286 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 287 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 288 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 289 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 290 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 291 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 292 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 293 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 295 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 298 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 301 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 302 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 307 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 308 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 309 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 310 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 311 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 313 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 314 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 315 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 316 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 317 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 318 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 319 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 320 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 323 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 324 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 325 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 326 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 327 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 328 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 329 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 330 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 331 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 332 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 333 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 334 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 335 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 336 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 337 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 338 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 339 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 340 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 341 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 342 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 416 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 417 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 418 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 419 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 420 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 421 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 424 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 425 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 426 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 427 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 428 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 429 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 430 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 433 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 434 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 435 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 469 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 486 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 487 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 489 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 491 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 492 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 493 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 494 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 495 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 498 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 499 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 500 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 501 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 502 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 503 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 504 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 505 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 506 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 507 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 508 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 509 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 510 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 511 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 512 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 513 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 514 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 515 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 516 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 517 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 518 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 519 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 520 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 521 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 522 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 523 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 524 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 525 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 526 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 527 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 528 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 529 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 530 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 0.07 |
| Isolates | 2.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.34 |
| Nodule | 1.7 |
| Rhizoplane | 8.84 |
| Rhizosphere | 83.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373953_0009196 | 3300035117 | Bacteria | 3387 |
| 2 | SwRhRL2b_contig_2503292 | 2162886007 | Bacteria | 1713 |
| 3 | 2214683826 | 2209111006 | Bacteria | 4506 |
| 4 | ARcpr5oldR_c000037 | 3300000041 | Bacteria | 26008 |
| 5 | ARSoilYngRDRAFT_c00113 | 3300000042 | Bacteria | 13805 |
| 6 | ARcpr5yngRDRAFT_c000014 | 3300000043 | Bacteria | 31433 |
| 7 | ARSoilOldRDRAFT_c000005 | 3300000044 | Bacteria | 61735 |
| 8 | ARCol0oldRDRAFT_c00471 | 3300000045 | Bacteria | 3754 |
| 9 | LJQas_1002035 | 3300000549 | Bacteria | 2893 |
| 10 | ARCol0yngRDRAFT_1000099 | 3300000652 | Bacteria | 16028 |
| 11 | JGI24032J14994_100117 | 3300001430 | Bacteria | 3699 |
| 12 | JGI24736J21556_1006279 | 3300001904 | Bacteria | 2002 |
| 13 | JGI24741J21665_1008107 | 3300001915 | Bacteria | 1997 |
| 14 | JGI24746J21847_1000648 | 3300001977 | Bacteria | 5315 |
| 15 | JGI24747J21853_1001209 | 3300001978 | Bacteria | 1888 |
| 16 | JGI24739J22299_10000871 | 3300001989 | Bacteria | 11154 |
| 17 | JGI24737J22298_10001901 | 3300001990 | Bacteria | 7464 |
| 18 | JGI24737J22298_10009338 | 3300001990 | Bacteria | 3266 |
| 19 | JGI24743J22301_10003516 | 3300001991 | Bacteria | 2485 |
| 20 | JGI24735J21928_10032226 | 3300002067 | Bacteria | 1552 |
| 21 | JGI24750J21931_1000439 | 3300002070 | Bacteria | 6761 |
| 22 | JGI24745J21846_1005235 | 3300002073 | Bacteria | 1412 |
| 23 | JGI24748J21848_1005097 | 3300002074 | Bacteria | 1520 |
| 24 | JGI24738J21930_10000856 | 3300002075 | Bacteria | 8728 |
| 25 | JGI24744J21845_10013124 | 3300002077 | Bacteria | 1673 |
| 26 | JGI24035J26624_1001996 | 3300002126 | Bacteria | 1901 |
| 27 | JGI24033J26618_1001158 | 3300002155 | Bacteria | 2569 |
| 28 | JGI24034J26672_10001465 | 3300002239 | Bacteria | 3137 |
| 29 | JGI24742J22300_10000464 | 3300002244 | Bacteria | 6004 |
| 30 | JGI24751J29686_10004435 | 3300002459 | Bacteria | 2850 |
| 31 | JGI25153J46596_10004386 | 3300003215 | Bacteria | 7611 |
| 32 | JGI25404J52841_10003777 | 3300003659 | Bacteria | 3021 |
| 33 | Ga0055536_1000524 | 3300003781 | Bacteria | 26496 |
| 34 | Ga0055530_10004363 | 3300003791 | Bacteria | 7333 |
| 35 | Ga0055540_1000054 | 3300003792 | Bacteria | 142505 |
| 36 | Ga0055531_10000037 | 3300003794 | Bacteria | 144244 |
| 37 | JGI25405J52794_10006055 | 3300003911 | Bacteria | 2202 |
| 38 | Ga0065717_1002123 | 3300005276 | Bacteria | 2843 |
| 39 | Ga0065716_1002073 | 3300005277 | Bacteria | 2333 |
| 40 | Ga0065704_10092942 | 3300005289 | Bacteria | 2611 |
| 41 | Ga0065712_10074695 | 3300005290 | Bacteria | 4031 |
| 42 | Ga0065715_10012983 | 3300005293 | Bacteria | 3599 |
| 43 | Ga0065715_10026218 | 3300005293 | Bacteria | 2017 |
| 44 | Ga0065707_10105725 | 3300005295 | Bacteria | 2631 |
| 45 | Ga0065707_10112520 | 3300005295 | Bacteria | 2358 |
| 46 | Ga0070658_10084650 | 3300005327 | Bacteria | 2607 |
| 47 | Ga0070658_10096229 | 3300005327 | Bacteria | 2444 |
| 48 | Ga0070676_10061936 | 3300005328 | Bacteria | 2225 |
| 49 | Ga0070683_100013405 | 3300005329 | Bacteria | 7149 |
| 50 | Ga0070683_100085340 | 3300005329 | Bacteria | 2959 |
| 51 | Ga0070690_100003948 | 3300005330 | Bacteria | 8189 |
| 52 | Ga0070690_100015657 | 3300005330 | Bacteria | 4530 |
| 53 | Ga0070690_100024575 | 3300005330 | Bacteria | 3706 |
| 54 | Ga0070690_100177059 | 3300005330 | Bacteria | 1472 |
| 55 | Ga0070670_100025087 | 3300005331 | Bacteria | 5129 |
| 56 | Ga0070670_100099329 | 3300005331 | Bacteria | 2504 |
| 57 | Ga0070670_100246105 | 3300005331 | Bacteria | 1557 |
| 58 | Ga0070677_10002031 | 3300005333 | Bacteria | 6438 |
| 59 | Ga0070677_10102370 | 3300005333 | Bacteria | 1265 |
| 60 | Ga0068869_100035291 | 3300005334 | Bacteria | 3543 |
| 61 | Ga0068869_100046878 | 3300005334 | Bacteria | 3119 |
| 62 | Ga0068869_100224938 | 3300005334 | Bacteria | 1489 |
| 63 | Ga0070666_10006171 | 3300005335 | Bacteria | 7371 |
| 64 | Ga0070666_10023242 | 3300005335 | Bacteria | 4035 |
| 65 | Ga0070666_10103024 | 3300005335 | Bacteria | 1969 |
| 66 | Ga0070680_100003647 | 3300005336 | Bacteria | 11501 |
| 67 | Ga0070680_100019478 | 3300005336 | Bacteria | 5376 |
| 68 | Ga0070680_100168978 | 3300005336 | Bacteria | 1839 |
| 69 | Ga0070680_100367024 | 3300005336 | Bacteria | 1225 |
| 70 | Ga0070682_100002015 | 3300005337 | Bacteria | 11351 |
| 71 | Ga0070682_100171895 | 3300005337 | Bacteria | 1507 |
| 72 | Ga0068868_100017327 | 3300005338 | Bacteria | 5364 |
| 73 | Ga0068868_100051217 | 3300005338 | Bacteria | 3246 |
| 74 | Ga0068868_100083566 | 3300005338 | Bacteria | 2563 |
| 75 | Ga0070660_100003870 | 3300005339 | Bacteria | 10336 |
| 76 | Ga0070660_100050132 | 3300005339 | Bacteria | 3211 |
| 77 | Ga0070660_100075994 | 3300005339 | Bacteria | 2630 |
| 78 | Ga0070660_100186912 | 3300005339 | Bacteria | 1677 |
| 79 | Ga0070689_100006859 | 3300005340 | Bacteria | 7922 |
| 80 | Ga0070689_100067079 | 3300005340 | Bacteria | 2796 |
| 81 | Ga0070689_100167813 | 3300005340 | Bacteria | 1777 |
| 82 | Ga0070689_100185900 | 3300005340 | Bacteria | 1690 |
| 83 | Ga0070691_10004357 | 3300005341 | Bacteria | 6432 |
| 84 | Ga0070691_10016445 | 3300005341 | Bacteria | 3398 |
| 85 | Ga0070691_10044926 | 3300005341 | Bacteria | 2096 |
| 86 | Ga0070687_100009855 | 3300005343 | Bacteria | 4103 |
| 87 | Ga0070687_100032499 | 3300005343 | Bacteria | 2568 |
| 88 | Ga0070687_100093310 | 3300005343 | Bacteria | 1669 |
| 89 | Ga0070687_100175903 | 3300005343 | Bacteria | 1278 |
| 90 | Ga0070692_10007167 | 3300005345 | Bacteria | 4895 |
| 91 | Ga0070692_10040235 | 3300005345 | Bacteria | 2390 |
| 92 | Ga0070692_10176558 | 3300005345 | Bacteria | 1235 |
| 93 | Ga0070668_100004252 | 3300005347 | Bacteria | 10629 |
| 94 | Ga0070668_100045512 | 3300005347 | Bacteria | 3367 |
| 95 | Ga0070668_100098468 | 3300005347 | Bacteria | 2314 |
| 96 | Ga0070669_100008306 | 3300005353 | Bacteria | 7414 |
| 97 | Ga0070669_100035049 | 3300005353 | Bacteria | 3635 |
| 98 | Ga0070669_100202959 | 3300005353 | Bacteria | 1561 |
| 99 | Ga0070675_100044149 | 3300005354 | Bacteria | 3645 |
| 100 | Ga0070675_100055315 | 3300005354 | Bacteria | 3266 |
| 101 | Ga0070671_100006278 | 3300005355 | Bacteria | 9471 |
| 102 | Ga0070671_100009728 | 3300005355 | Bacteria | 7722 |
| 103 | Ga0070671_100015968 | 3300005355 | Bacteria | 6067 |
| 104 | Ga0070671_100033397 | 3300005355 | Bacteria | 4254 |
| 105 | Ga0070673_100012672 | 3300005364 | Bacteria | 5798 |
| 106 | Ga0070673_100024715 | 3300005364 | Bacteria | 4409 |
| 107 | Ga0070673_100118258 | 3300005364 | Bacteria | 2206 |
| 108 | Ga0070673_100373958 | 3300005364 | Bacteria | 1269 |
| 109 | Ga0070688_100039413 | 3300005365 | Bacteria | 2891 |
| 110 | Ga0070688_100071559 | 3300005365 | Bacteria | 2220 |
| 111 | Ga0070659_100026221 | 3300005366 | Bacteria | 4482 |
| 112 | Ga0070659_100232167 | 3300005366 | Bacteria | 1525 |
| 113 | Ga0070659_100295491 | 3300005366 | Bacteria | 1349 |
| 114 | Ga0070667_100002235 | 3300005367 | Bacteria | 17041 |
| 115 | Ga0070667_100013854 | 3300005367 | Bacteria | 6665 |
| 116 | Ga0070667_100122035 | 3300005367 | Bacteria | 2267 |
| 117 | Ga0070667_100140030 | 3300005367 | Bacteria | 2118 |
| 118 | Ga0070667_100158721 | 3300005367 | Bacteria | 1991 |
| 119 | Ga0070703_10004958 | 3300005406 | Bacteria | 3714 |
| 120 | Ga0070703_10007397 | 3300005406 | Bacteria | 3084 |
| 121 | Ga0070709_10011016 | 3300005434 | Bacteria | 5024 |
| 122 | Ga0070709_10047697 | 3300005434 | Bacteria | 2669 |
| 123 | Ga0070709_10067778 | 3300005434 | Bacteria | 2293 |
| 124 | Ga0070714_100015917 | 3300005435 | Bacteria | 6063 |
| 125 | Ga0070714_100053843 | 3300005435 | Bacteria | 3437 |
| 126 | Ga0070713_100037939 | 3300005436 | Bacteria | 3899 |
| 127 | Ga0070713_100064751 | 3300005436 | Bacteria | 3069 |
| 128 | Ga0070713_100383500 | 3300005436 | Bacteria | 1310 |
| 129 | Ga0070710_10002325 | 3300005437 | Bacteria | 8998 |
| 130 | Ga0070710_10050700 | 3300005437 | Bacteria | 2328 |
| 131 | Ga0070710_10067770 | 3300005437 | Bacteria | 2048 |
| 132 | Ga0070710_10085486 | 3300005437 | Bacteria | 1850 |
| 133 | Ga0070701_10002068 | 3300005438 | Bacteria | 7625 |
| 134 | Ga0070701_10043327 | 3300005438 | Bacteria | 2302 |
| 135 | Ga0070701_10108305 | 3300005438 | Bacteria | 1549 |
| 136 | Ga0070711_100032612 | 3300005439 | Bacteria | 3464 |
| 137 | Ga0070711_100154160 | 3300005439 | Bacteria | 1735 |
| 138 | Ga0070711_100196272 | 3300005439 | Bacteria | 1555 |
| 139 | Ga0070705_100000528 | 3300005440 | Bacteria | 22027 |
| 140 | Ga0070705_100010364 | 3300005440 | Bacteria | 4663 |
| 141 | Ga0070705_100031013 | 3300005440 | Bacteria | 2956 |
| 142 | Ga0070705_100347503 | 3300005440 | Bacteria | 1080 |
| 143 | Ga0070700_100024158 | 3300005441 | Bacteria | 3565 |
| 144 | Ga0070700_100034214 | 3300005441 | Bacteria | 3067 |
| 145 | Ga0070700_100277436 | 3300005441 | Bacteria | 1214 |
| 146 | Ga0070694_100006551 | 3300005444 | Bacteria | 7073 |
| 147 | Ga0070694_100011702 | 3300005444 | Bacteria | 5436 |
| 148 | Ga0070694_100032984 | 3300005444 | Bacteria | 3403 |
| 149 | Ga0070694_100368662 | 3300005444 | Bacteria | 1117 |
| 150 | Ga0070708_100001688 | 3300005445 | Bacteria | 16974 |
| 151 | Ga0070708_100055433 | 3300005445 | Bacteria | 3525 |
| 152 | Ga0070708_100080088 | 3300005445 | Bacteria | 2955 |
| 153 | Ga0070663_100009202 | 3300005455 | Bacteria | 6109 |
| 154 | Ga0070663_100159867 | 3300005455 | Bacteria | 1733 |
| 155 | Ga0070678_100034053 | 3300005456 | Bacteria | 3544 |
| 156 | Ga0070678_100079875 | 3300005456 | Bacteria | 2475 |
| 157 | Ga0070678_100213473 | 3300005456 | Bacteria | 1600 |
| 158 | Ga0070678_100235032 | 3300005456 | Bacteria | 1530 |
| 159 | Ga0070662_100011393 | 3300005457 | Bacteria | 5868 |
| 160 | Ga0070662_100035015 | 3300005457 | Bacteria | 3543 |
| 161 | Ga0070662_100127028 | 3300005457 | Bacteria | 1961 |
| 162 | Ga0070681_10018493 | 3300005458 | Bacteria | 6965 |
| 163 | Ga0070681_10040914 | 3300005458 | Bacteria | 4643 |
| 164 | Ga0070681_10065168 | 3300005458 | Bacteria | 3612 |
| 165 | Ga0070681_10075350 | 3300005458 | Bacteria | 3334 |
| 166 | Ga0070681_10204988 | 3300005458 | Bacteria | 1889 |
| 167 | Ga0068867_100005646 | 3300005459 | Bacteria | 8867 |
| 168 | Ga0070685_10017763 | 3300005466 | Bacteria | 3814 |
| 169 | Ga0070706_100104467 | 3300005467 | Bacteria | 2635 |
| 170 | Ga0070707_100317375 | 3300005468 | Bacteria | 1514 |
| 171 | Ga0070698_100221862 | 3300005471 | Bacteria | 1824 |
| 172 | Ga0070698_100251705 | 3300005471 | Bacteria | 1699 |
| 173 | Ga0074259_12010023 | 3300005507 | Bacteria | 2242 |
| 174 | Ga0070699_100000147 | 3300005518 | Bacteria | 66774 |
| 175 | Ga0070699_100099812 | 3300005518 | Bacteria | 2544 |
| 176 | Ga0070699_100271659 | 3300005518 | Bacteria | 1517 |
| 177 | Ga0070679_100016159 | 3300005530 | Bacteria | 7192 |
| 178 | Ga0070679_100072533 | 3300005530 | Bacteria | 3435 |
| 179 | Ga0070679_100139867 | 3300005530 | Bacteria | 2401 |
| 180 | Ga0070679_100299686 | 3300005530 | Bacteria | 1558 |
| 181 | Ga0070679_100299893 | 3300005530 | Bacteria | 1557 |
| 182 | Ga0070679_100369957 | 3300005530 | Bacteria | 1380 |
| 183 | Ga0070684_100020014 | 3300005535 | Bacteria | 5547 |
| 184 | Ga0070684_100079026 | 3300005535 | Bacteria | 2907 |
| 185 | Ga0070684_100082068 | 3300005535 | Bacteria | 2854 |
| 186 | Ga0070684_100095019 | 3300005535 | Bacteria | 2655 |
| 187 | Ga0070697_100006410 | 3300005536 | Bacteria | 9109 |
| 188 | Ga0070697_100023710 | 3300005536 | Bacteria | 4882 |
| 189 | Ga0070697_100225527 | 3300005536 | Bacteria | 1597 |
| 190 | Ga0068853_100003634 | 3300005539 | Bacteria | 11828 |
| 191 | Ga0068853_100188539 | 3300005539 | Bacteria | 1873 |
| 192 | Ga0070672_100044896 | 3300005543 | Bacteria | 3415 |
| 193 | Ga0070672_100245750 | 3300005543 | Bacteria | 1506 |
| 194 | Ga0070686_100007349 | 3300005544 | Bacteria | 6142 |
| 195 | Ga0070686_100055380 | 3300005544 | Bacteria | 2540 |
| 196 | Ga0070686_100124883 | 3300005544 | Bacteria | 1772 |
| 197 | Ga0070686_100208658 | 3300005544 | Bacteria | 1405 |
| 198 | Ga0070695_100002809 | 3300005545 | Bacteria | 10113 |
| 199 | Ga0070695_100016690 | 3300005545 | Bacteria | 4446 |
| 200 | Ga0070695_100121973 | 3300005545 | Bacteria | 1784 |
| 201 | Ga0070695_100264948 | 3300005545 | Bacteria | 1256 |
| 202 | Ga0070696_100002859 | 3300005546 | Bacteria | 11479 |
| 203 | Ga0070696_100010889 | 3300005546 | Bacteria | 6095 |
| 204 | Ga0070696_100013307 | 3300005546 | Bacteria | 5520 |
| 205 | Ga0070693_100004174 | 3300005547 | Bacteria | 6817 |
| 206 | Ga0070693_100025730 | 3300005547 | Bacteria | 3169 |
| 207 | Ga0070693_100157032 | 3300005547 | Bacteria | 1446 |
| 208 | Ga0070665_100004170 | 3300005548 | Bacteria | 15207 |
| 209 | Ga0070665_100006016 | 3300005548 | Bacteria | 12404 |
| 210 | Ga0070665_100195770 | 3300005548 | Bacteria | 2022 |
| 211 | Ga0070704_100022446 | 3300005549 | Bacteria | 4107 |
| 212 | Ga0070704_100034292 | 3300005549 | Bacteria | 3440 |
| 213 | Ga0070704_100177163 | 3300005549 | Bacteria | 1702 |
| 214 | Ga0068855_100026130 | 3300005563 | Bacteria | 6985 |
| 215 | Ga0068855_100275071 | 3300005563 | Bacteria | 1871 |
| 216 | Ga0070664_100114890 | 3300005564 | Bacteria | 2352 |
| 217 | Ga0070664_100135966 | 3300005564 | Bacteria | 2161 |
| 218 | Ga0068857_100019002 | 3300005577 | Bacteria | 6029 |
| 219 | Ga0068857_100110898 | 3300005577 | Bacteria | 2466 |
| 220 | Ga0068857_100126963 | 3300005577 | Bacteria | 2299 |
| 221 | Ga0068854_100002965 | 3300005578 | Bacteria | 10527 |
| 222 | Ga0068854_100039626 | 3300005578 | Bacteria | 3321 |
| 223 | Ga0068856_100005225 | 3300005614 | Bacteria | 12811 |
| 224 | Ga0068856_100058468 | 3300005614 | Bacteria | 3807 |
| 225 | Ga0068856_100125316 | 3300005614 | Bacteria | 2572 |
| 226 | Ga0068852_100047369 | 3300005616 | Bacteria | 3667 |
| 227 | Ga0068852_100071202 | 3300005616 | Bacteria | 3052 |
| 228 | Ga0068852_100123780 | 3300005616 | Bacteria | 2371 |
| 229 | Ga0068859_100008928 | 3300005617 | Bacteria | 10125 |
| 230 | Ga0068859_100039892 | 3300005617 | Bacteria | 4712 |
| 231 | Ga0068864_100013072 | 3300005618 | Bacteria | 6875 |
| 232 | Ga0068864_100030146 | 3300005618 | Bacteria | 4597 |
| 233 | Ga0068864_100079478 | 3300005618 | Bacteria | 2871 |
| 234 | Ga0068864_100175221 | 3300005618 | Bacteria | 1958 |
| 235 | Ga0068866_10017245 | 3300005718 | Bacteria | 3244 |
| 236 | Ga0068861_100016579 | 3300005719 | Bacteria | 5215 |
| 237 | Ga0068861_100038178 | 3300005719 | Bacteria | 3574 |
| 238 | Ga0068861_100038636 | 3300005719 | Bacteria | 3557 |
| 239 | Ga0068861_100119494 | 3300005719 | Bacteria | 2124 |
| 240 | Ga0068851_10058728 | 3300005834 | Bacteria | 1966 |
| 241 | Ga0068870_10008836 | 3300005840 | Bacteria | 4547 |
| 242 | Ga0068870_10023842 | 3300005840 | Bacteria | 3023 |
| 243 | Ga0068870_10031956 | 3300005840 | Bacteria | 2671 |
| 244 | Ga0068863_100053128 | 3300005841 | Bacteria | 3839 |
| 245 | Ga0068863_100099230 | 3300005841 | Bacteria | 2767 |
| 246 | Ga0068863_100135514 | 3300005841 | Bacteria | 2352 |
| 247 | Ga0068863_100230610 | 3300005841 | Bacteria | 1786 |
| 248 | Ga0068858_100026832 | 3300005842 | Bacteria | 5350 |
| 249 | Ga0068858_100031436 | 3300005842 | Bacteria | 4930 |
| 250 | Ga0068858_100121393 | 3300005842 | Bacteria | 2444 |
| 251 | Ga0068858_100198645 | 3300005842 | Bacteria | 1896 |
| 252 | Ga0068860_100003101 | 3300005843 | Bacteria | 17176 |
| 253 | Ga0068860_100023337 | 3300005843 | Bacteria | 5979 |
| 254 | Ga0068860_100052065 | 3300005843 | Bacteria | 3894 |
| 255 | Ga0068860_100060789 | 3300005843 | Bacteria | 3590 |
| 256 | Ga0068860_100073921 | 3300005843 | Bacteria | 3240 |
| 257 | Ga0068860_100125246 | 3300005843 | Bacteria | 2462 |
| 258 | Ga0068860_100172469 | 3300005843 | Bacteria | 2090 |
| 259 | Ga0068862_100001380 | 3300005844 | Bacteria | 22519 |
| 260 | Ga0068862_100010646 | 3300005844 | Bacteria | 7598 |
| 261 | Ga0068862_100078169 | 3300005844 | Bacteria | 2866 |
| 262 | Ga0081455_10000096 | 3300005937 | Bacteria | 96503 |
| 263 | Ga0081455_10000200 | 3300005937 | Bacteria | 76013 |
| 264 | Ga0081455_10000768 | 3300005937 | Bacteria | 41613 |
| 265 | Ga0081455_10045366 | 3300005937 | Bacteria | 3825 |
| 266 | Ga0081455_10174039 | 3300005937 | Bacteria | 1636 |
| 267 | Ga0081538_10007210 | 3300005981 | Bacteria | 9653 |
| 268 | Ga0081538_10008625 | 3300005981 | Bacteria | 8621 |
| 269 | Ga0081538_10016051 | 3300005981 | Bacteria | 5761 |
| 270 | Ga0081538_10094613 | 3300005981 | Bacteria | 1529 |
| 271 | Ga0081540_1000158 | 3300005983 | Bacteria | 69951 |
| 272 | Ga0081540_1006707 | 3300005983 | Bacteria | 8324 |
| 273 | Ga0081540_1025349 | 3300005983 | Bacteria | 3414 |
| 274 | Ga0081540_1057025 | 3300005983 | Bacteria | 1892 |
| 275 | Ga0081540_1086712 | 3300005983 | Bacteria | 1390 |
| 276 | Ga0081539_10020277 | 3300005985 | Bacteria | 4502 |
| 277 | Ga0081539_10027151 | 3300005985 | Bacteria | 3632 |
| 278 | Ga0070717_10086802 | 3300006028 | Bacteria | 2634 |
| 279 | Ga0070717_10147771 | 3300006028 | Bacteria | 2031 |
| 280 | Ga0070717_10157079 | 3300006028 | Bacteria | 1971 |
| 281 | Ga0070717_10309908 | 3300006028 | Bacteria | 1404 |
| 282 | Ga0075365_10044325 | 3300006038 | Bacteria | 2914 |
| 283 | Ga0075365_10079762 | 3300006038 | Bacteria | 2215 |
| 284 | Ga0075368_10045474 | 3300006042 | Bacteria | 1734 |
| 285 | Ga0075363_100054897 | 3300006048 | Bacteria | 2132 |
| 286 | Ga0075432_10010891 | 3300006058 | Bacteria | 3087 |
| 287 | Ga0070715_10038507 | 3300006163 | Bacteria | 1986 |
| 288 | Ga0070716_100004647 | 3300006173 | Bacteria | 6580 |
| 289 | Ga0070716_100066278 | 3300006173 | Bacteria | 2106 |
| 290 | Ga0070716_100199148 | 3300006173 | Bacteria | 1330 |
| 291 | Ga0070712_100000210 | 3300006175 | Bacteria | 32927 |
| 292 | Ga0070712_100161297 | 3300006175 | Bacteria | 1732 |
| 293 | Ga0070712_100409334 | 3300006175 | Bacteria | 1122 |
| 294 | Ga0075362_10084393 | 3300006177 | Bacteria | 1467 |
| 295 | Ga0075367_10021871 | 3300006178 | Bacteria | 3581 |
| 296 | Ga0075367_10098232 | 3300006178 | Bacteria | 1787 |
| 297 | Ga0075367_10135444 | 3300006178 | Bacteria | 1523 |
| 298 | Ga0075369_10070243 | 3300006186 | Bacteria | 1540 |
| 299 | Ga0075366_10013125 | 3300006195 | Bacteria | 4711 |
| 300 | Ga0097621_100029343 | 3300006237 | Bacteria | 4343 |
| 301 | Ga0097621_100039390 | 3300006237 | Bacteria | 3796 |
| 302 | Ga0097621_100088576 | 3300006237 | Bacteria | 2586 |
| 303 | Ga0097621_100208169 | 3300006237 | Bacteria | 1700 |
| 304 | Ga0075370_10028731 | 3300006353 | Bacteria | 3093 |
| 305 | Ga0068871_100003405 | 3300006358 | Bacteria | 10932 |
| 306 | Ga0068871_100012612 | 3300006358 | Bacteria | 6240 |
| 307 | Ga0068871_100044409 | 3300006358 | Bacteria | 3574 |
| 308 | Ga0075428_100003646 | 3300006844 | Bacteria | 16887 |
| 309 | Ga0075428_100058917 | 3300006844 | Bacteria | 4205 |
| 310 | Ga0075428_100065348 | 3300006844 | Bacteria | 3984 |
| 311 | Ga0075428_100153837 | 3300006844 | Bacteria | 2499 |
| 312 | Ga0075428_100155914 | 3300006844 | Bacteria | 2481 |
| 313 | Ga0075428_100326861 | 3300006844 | Bacteria | 1647 |
| 314 | Ga0075430_100000133 | 3300006846 | Bacteria | 47377 |
| 315 | Ga0075430_100001032 | 3300006846 | Bacteria | 22005 |
| 316 | Ga0075430_100022952 | 3300006846 | Bacteria | 5307 |
| 317 | Ga0075431_100000602 | 3300006847 | Bacteria | 30370 |
| 318 | Ga0075431_100001362 | 3300006847 | Bacteria | 22408 |
| 319 | Ga0075431_100057185 | 3300006847 | Bacteria | 4023 |
| 320 | Ga0075431_100074190 | 3300006847 | Bacteria | 3510 |
| 321 | Ga0075431_100120962 | 3300006847 | Bacteria | 2702 |
| 322 | Ga0075433_10000328 | 3300006852 | Bacteria | 29209 |
| 323 | Ga0075433_10028663 | 3300006852 | Bacteria | 4736 |
| 324 | Ga0075433_10136920 | 3300006852 | Bacteria | 2177 |
| 325 | Ga0075434_100001713 | 3300006871 | Bacteria | 18786 |
| 326 | Ga0075434_100006226 | 3300006871 | Bacteria | 10934 |
| 327 | Ga0075434_100018385 | 3300006871 | Bacteria | 6752 |
| 328 | Ga0075434_100289224 | 3300006871 | Bacteria | 1659 |
| 329 | Ga0075429_100000163 | 3300006880 | Bacteria | 42270 |
| 330 | Ga0075429_100137894 | 3300006880 | Bacteria | 2135 |
| 331 | Ga0068865_100001544 | 3300006881 | Bacteria | 13429 |
| 332 | Ga0068865_100003466 | 3300006881 | Bacteria | 9451 |
| 333 | Ga0075436_100025848 | 3300006914 | Bacteria | 4040 |
| 334 | Ga0075436_100271637 | 3300006914 | Bacteria | 1211 |
| 335 | Ga0097620_100008928 | 3300006931 | Bacteria | 10125 |
| 336 | Ga0097620_100039897 | 3300006931 | Bacteria | 4712 |
| 337 | Ga0075435_100001972 | 3300007076 | Bacteria | 13386 |
| 338 | Ga0075435_100024791 | 3300007076 | Bacteria | 4661 |
| 339 | Ga0075435_100081761 | 3300007076 | Bacteria | 2654 |
| 340 | Ga0075435_100175333 | 3300007076 | Bacteria | 1810 |
| 341 | Ga0099794_10132838 | 3300007265 | Bacteria | 1258 |
| 342 | Ga0105244_10059189 | 3300009036 | Bacteria | 1932 |
| 343 | Ga0105244_10136458 | 3300009036 | Bacteria | 1182 |
| 344 | Ga0105240_10378029 | 3300009093 | Bacteria | 1600 |
| 345 | Ga0111539_10000389 | 3300009094 | Bacteria | 54333 |
| 346 | Ga0111539_10000725 | 3300009094 | Bacteria | 42875 |
| 347 | Ga0111539_10001696 | 3300009094 | Bacteria | 29343 |
| 348 | Ga0111539_10001808 | 3300009094 | Bacteria | 28479 |
| 349 | Ga0111539_10018474 | 3300009094 | Bacteria | 8635 |
| 350 | Ga0111539_10047916 | 3300009094 | Bacteria | 5105 |
| 351 | Ga0111539_10065823 | 3300009094 | Bacteria | 4281 |
| 352 | Ga0111539_10103174 | 3300009094 | Bacteria | 3347 |
| 353 | Ga0111539_10122383 | 3300009094 | Bacteria | 3049 |
| 354 | Ga0111539_10146602 | 3300009094 | Bacteria | 2763 |
| 355 | Ga0111539_10186046 | 3300009094 | Bacteria | 2425 |
| 356 | Ga0111539_10410216 | 3300009094 | Bacteria | 1578 |
| 357 | Ga0111539_10482939 | 3300009094 | Bacteria | 1443 |
| 358 | Ga0105245_10010250 | 3300009098 | Bacteria | 8160 |
| 359 | Ga0105245_10015250 | 3300009098 | Bacteria | 6695 |
| 360 | Ga0105245_10391633 | 3300009098 | Bacteria | 1386 |
| 361 | Ga0105247_10022803 | 3300009101 | Bacteria | 3771 |
| 362 | Ga0105247_10035997 | 3300009101 | Bacteria | 3018 |
| 363 | Ga0105247_10041832 | 3300009101 | Bacteria | 2804 |
| 364 | Ga0114129_10000227 | 3300009147 | Bacteria | 62698 |
| 365 | Ga0114129_10008509 | 3300009147 | Bacteria | 14626 |
| 366 | Ga0114129_10040105 | 3300009147 | Bacteria | 6602 |
| 367 | Ga0114129_10225242 | 3300009147 | Bacteria | 2528 |
| 368 | Ga0114129_10255373 | 3300009147 | Bacteria | 2351 |
| 369 | Ga0105243_10003521 | 3300009148 | Bacteria | 12651 |
| 370 | Ga0105243_10060998 | 3300009148 | Bacteria | 3014 |
| 371 | Ga0105243_10067549 | 3300009148 | Bacteria | 2878 |
| 372 | Ga0105241_10007067 | 3300009174 | Bacteria | 8267 |
| 373 | Ga0105241_10195297 | 3300009174 | Bacteria | 1687 |
| 374 | Ga0105242_10026334 | 3300009176 | Bacteria | 4608 |
| 375 | Ga0105242_10035954 | 3300009176 | Bacteria | 3971 |
| 376 | Ga0105242_10040216 | 3300009176 | Bacteria | 3767 |
| 377 | Ga0105248_10011072 | 3300009177 | Bacteria | 9949 |
| 378 | Ga0105248_10070147 | 3300009177 | Bacteria | 3935 |
| 379 | Ga0105248_10109495 | 3300009177 | Bacteria | 3114 |
| 380 | Ga0105248_10244342 | 3300009177 | Bacteria | 2020 |
| 381 | Ga0105237_10007432 | 3300009545 | Bacteria | 11993 |
| 382 | Ga0105237_10102994 | 3300009545 | Bacteria | 2846 |
| 383 | Ga0105238_10034621 | 3300009551 | Bacteria | 5138 |
| 384 | Ga0105249_10011087 | 3300009553 | Bacteria | 7919 |
| 385 | Ga0105249_10019349 | 3300009553 | Bacteria | 6073 |
| 386 | Ga0105249_10285547 | 3300009553 | Bacteria | 1650 |
| 387 | Ga0105239_10033880 | 3300010375 | Bacteria | 5606 |
| 388 | Ga0105239_10105997 | 3300010375 | Bacteria | 3113 |
| 389 | Ga0105239_10152129 | 3300010375 | Bacteria | 2582 |
| 390 | Ga0105239_10277133 | 3300010375 | Bacteria | 1887 |
| 391 | Ga0105246_10004169 | 3300011119 | Bacteria | 8786 |
| 392 | Ga0105246_10016137 | 3300011119 | Bacteria | 4726 |
| 393 | Ga0105246_10035014 | 3300011119 | Bacteria | 3352 |
| 394 | Ga0105246_10049515 | 3300011119 | Bacteria | 2877 |
| 395 | Ga0105246_10136956 | 3300011119 | Bacteria | 1836 |
| 396 | Ga0157335_1000780 | 3300012492 | Bacteria | 1569 |
| 397 | Ga0157373_10035983 | 3300013100 | Bacteria | 3554 |
| 398 | Ga0157371_10050774 | 3300013102 | Bacteria | 2948 |
| 399 | Ga0157374_10002692 | 3300013296 | Bacteria | 14940 |
| 400 | Ga0157374_10070776 | 3300013296 | Bacteria | 3287 |
| 401 | Ga0157374_10175996 | 3300013296 | Bacteria | 2089 |
| 402 | Ga0157378_10085517 | 3300013297 | Bacteria | 2857 |
| 403 | Ga0157378_10102635 | 3300013297 | Bacteria | 2612 |
| 404 | Ga0157378_10694426 | 3300013297 | Bacteria | 1036 |
| 405 | Ga0163162_10017826 | 3300013306 | Bacteria | 6947 |
| 406 | Ga0163162_10063021 | 3300013306 | Bacteria | 3749 |
| 407 | Ga0163162_10206806 | 3300013306 | Bacteria | 2092 |
| 408 | Ga0163162_10430330 | 3300013306 | Bacteria | 1452 |
| 409 | Ga0157372_10040791 | 3300013307 | Bacteria | 5129 |
| 410 | Ga0157375_10024786 | 3300013308 | Bacteria | 5559 |
| 411 | Ga0157375_10061773 | 3300013308 | Bacteria | 3721 |
| 412 | Ga0157375_10092850 | 3300013308 | Bacteria | 3083 |
| 413 | Ga0157375_10104406 | 3300013308 | Bacteria | 2922 |
| 414 | Ga0157375_10168893 | 3300013308 | Bacteria | 2334 |
| 415 | Ga0163163_10001273 | 3300014325 | Bacteria | 21307 |
| 416 | Ga0163163_10095739 | 3300014325 | Bacteria | 2988 |
| 417 | Ga0163163_10122477 | 3300014325 | Bacteria | 2635 |
| 418 | Ga0163163_10380939 | 3300014325 | Bacteria | 1468 |
| 419 | Ga0157380_10006550 | 3300014326 | Bacteria | 8213 |
| 420 | Ga0157377_10001621 | 3300014745 | Bacteria | 9812 |
| 421 | Ga0157377_10042979 | 3300014745 | Bacteria | 2513 |
| 422 | Ga0157376_10034213 | 3300014969 | Bacteria | 4101 |
| 423 | Ga0157376_10104691 | 3300014969 | Bacteria | 2480 |
| 424 | Ga0163161_10000266 | 3300017792 | Bacteria | 45979 |
| 425 | Ga0163161_10076015 | 3300017792 | Bacteria | 2465 |
| 426 | Ga0163161_10078274 | 3300017792 | Bacteria | 2430 |
| 427 | Ga0163161_10137337 | 3300017792 | Bacteria | 1849 |
| 428 | Ga0206354_11439474 | 3300020081 | Bacteria | 1420 |
| 429 | Ga0213872_10013367 | 3300021361 | Bacteria | 3848 |
| 430 | Ga0213874_10007563 | 3300021377 | Bacteria | 2613 |
| 431 | Ga0213876_10000603 | 3300021384 | Bacteria | 26611 |
| 432 | Ga0213876_10032997 | 3300021384 | Bacteria | 2730 |
| 433 | Ga0213876_10035830 | 3300021384 | Bacteria | 2617 |
| 434 | Ga0213876_10048232 | 3300021384 | Bacteria | 2251 |
| 435 | Ga0213876_10150269 | 3300021384 | Bacteria | 1239 |
| 436 | Ga0213875_10000918 | 3300021388 | Bacteria | 21317 |
| 437 | Ga0213875_10146050 | 3300021388 | Bacteria | 1108 |
| 438 | Ga0224572_1002050 | 3300024225 | Bacteria | 3172 |
| 439 | Ga0207666_1000534 | 3300025271 | Bacteria | 4641 |
| 440 | Ga0207666_1001132 | 3300025271 | Bacteria | 3153 |
| 441 | Ga0207673_1000597 | 3300025290 | Bacteria | 3841 |
| 442 | Ga0209676_1000105 | 3300025292 | Bacteria | 224151 |
| 443 | Ga0209758_1001548 | 3300025297 | Bacteria | 26409 |
| 444 | Ga0209758_1001765 | 3300025297 | Bacteria | 23988 |
| 445 | Ga0209050_1001283 | 3300025298 | Bacteria | 28639 |
| 446 | Ga0209051_1000064 | 3300025303 | Bacteria | 231735 |
| 447 | Ga0209257_1000109 | 3300025304 | Bacteria | 239439 |
| 448 | Ga0207697_10002026 | 3300025315 | Bacteria | 10716 |
| 449 | Ga0207697_10003146 | 3300025315 | Bacteria | 8232 |
| 450 | Ga0207656_10020871 | 3300025321 | Bacteria | 2609 |
| 451 | Ga0207655_1055096 | 3300025728 | Bacteria | 1576 |
| 452 | Ga0207653_10002185 | 3300025885 | Bacteria | 6229 |
| 453 | Ga0207653_10002726 | 3300025885 | Bacteria | 5622 |
| 454 | Ga0207682_10000009 | 3300025893 | Bacteria | 86366 |
| 455 | Ga0207682_10003948 | 3300025893 | Bacteria | 6320 |
| 456 | Ga0207692_10010088 | 3300025898 | Bacteria | 3967 |
| 457 | Ga0207642_10007417 | 3300025899 | Bacteria | 3705 |
| 458 | Ga0207642_10010905 | 3300025899 | Bacteria | 3223 |
| 459 | Ga0207710_10001303 | 3300025900 | Bacteria | 12616 |
| 460 | Ga0207688_10000892 | 3300025901 | Bacteria | 15087 |
| 461 | Ga0207688_10110652 | 3300025901 | Bacteria | 1594 |
| 462 | Ga0207688_10132250 | 3300025901 | Bacteria | 1463 |
| 463 | Ga0207680_10004104 | 3300025903 | Bacteria | 6890 |
| 464 | Ga0207680_10025243 | 3300025903 | Bacteria | 3276 |
| 465 | Ga0207647_10002160 | 3300025904 | Bacteria | 15015 |
| 466 | Ga0207685_10031650 | 3300025905 | Bacteria | 1896 |
| 467 | Ga0207685_10055893 | 3300025905 | Bacteria | 1542 |
| 468 | Ga0207699_10037062 | 3300025906 | Bacteria | 2785 |
| 469 | Ga0207645_10000999 | 3300025907 | Bacteria | 23365 |
| 470 | Ga0207645_10035204 | 3300025907 | Bacteria | 3215 |
| 471 | Ga0207643_10001172 | 3300025908 | Bacteria | 15576 |
| 472 | Ga0207643_10028428 | 3300025908 | Bacteria | 3105 |
| 473 | Ga0207705_10076146 | 3300025909 | Bacteria | 2439 |
| 474 | Ga0207705_10114279 | 3300025909 | Bacteria | 1997 |
| 475 | Ga0207684_10019788 | 3300025910 | Bacteria | 5757 |
| 476 | Ga0207654_10015486 | 3300025911 | Bacteria | 3958 |
| 477 | Ga0207654_10156190 | 3300025911 | Bacteria | 1469 |
| 478 | Ga0207707_10006761 | 3300025912 | Bacteria | 10013 |
| 479 | Ga0207707_10045583 | 3300025912 | Bacteria | 3821 |
| 480 | Ga0207707_10163271 | 3300025912 | Bacteria | 1947 |
| 481 | Ga0207707_10247057 | 3300025912 | Bacteria | 1550 |
| 482 | Ga0207707_10386783 | 3300025912 | Bacteria | 1202 |
| 483 | Ga0207707_10448620 | 3300025912 | Bacteria | 1104 |
| 484 | Ga0207695_10154802 | 3300025913 | Bacteria | 2228 |
| 485 | Ga0207695_10170648 | 3300025913 | Bacteria | 2101 |
| 486 | Ga0207671_10070082 | 3300025914 | Bacteria | 2613 |
| 487 | Ga0207671_10113096 | 3300025914 | Bacteria | 2068 |
| 488 | Ga0207693_10002396 | 3300025915 | Bacteria | 16268 |
| 489 | Ga0207693_10007042 | 3300025915 | Bacteria | 9281 |
| 490 | Ga0207693_10012580 | 3300025915 | Bacteria | 6835 |
| 491 | Ga0207693_10024070 | 3300025915 | Bacteria | 4834 |
| 492 | Ga0207693_10128480 | 3300025915 | Bacteria | 1992 |
| 493 | Ga0207693_10192406 | 3300025915 | Bacteria | 1605 |
| 494 | Ga0207663_10194477 | 3300025916 | Bacteria | 1459 |
| 495 | Ga0207663_10266655 | 3300025916 | Bacteria | 1267 |
| 496 | Ga0207660_10001283 | 3300025917 | Bacteria | 16867 |
| 497 | Ga0207660_10096292 | 3300025917 | Bacteria | 2203 |
| 498 | Ga0207662_10000025 | 3300025918 | Bacteria | 70078 |
| 499 | Ga0207662_10007904 | 3300025918 | Bacteria | 5793 |
| 500 | Ga0207662_10043635 | 3300025918 | Bacteria | 2645 |
| 501 | Ga0207657_10010579 | 3300025919 | Bacteria | 9200 |
| 502 | Ga0207657_10086122 | 3300025919 | Bacteria | 2630 |
| 503 | Ga0207657_10146148 | 3300025919 | Bacteria | 1928 |
| 504 | Ga0207657_10320484 | 3300025919 | Bacteria | 1226 |
| 505 | Ga0207649_10006638 | 3300025920 | Bacteria | 6288 |
| 506 | Ga0207649_10115293 | 3300025920 | Bacteria | 1802 |
| 507 | Ga0207649_10176922 | 3300025920 | Bacteria | 1491 |
| 508 | Ga0207652_10006125 | 3300025921 | Bacteria | 9727 |
| 509 | Ga0207652_10059120 | 3300025921 | Bacteria | 3304 |
| 510 | Ga0207652_10069453 | 3300025921 | Bacteria | 3058 |
| 511 | Ga0207652_10103214 | 3300025921 | Bacteria | 2521 |
| 512 | Ga0207652_10264514 | 3300025921 | Bacteria | 1551 |
| 513 | Ga0207652_10371714 | 3300025921 | Bacteria | 1290 |
| 514 | Ga0207652_10506786 | 3300025921 | Bacteria | 1086 |
| 515 | Ga0207646_10051439 | 3300025922 | Bacteria | 3686 |
| 516 | Ga0207681_10002039 | 3300025923 | Bacteria | 12958 |
| 517 | Ga0207681_10012199 | 3300025923 | Bacteria | 5298 |
| 518 | Ga0207694_10037333 | 3300025924 | Bacteria | 3731 |
| 519 | Ga0207694_10353411 | 3300025924 | Bacteria | 1217 |
| 520 | Ga0207650_10074985 | 3300025925 | Bacteria | 2552 |
| 521 | Ga0207650_10237350 | 3300025925 | Bacteria | 1472 |
| 522 | Ga0207659_10014716 | 3300025926 | Bacteria | 5053 |
| 523 | Ga0207687_10003202 | 3300025927 | Bacteria | 11093 |
| 524 | Ga0207687_10011809 | 3300025927 | Bacteria | 5714 |
| 525 | Ga0207687_10255936 | 3300025927 | Bacteria | 1394 |
| 526 | Ga0207700_10064877 | 3300025928 | Bacteria | 2784 |
| 527 | Ga0207700_10155337 | 3300025928 | Bacteria | 1895 |
| 528 | Ga0207644_10003326 | 3300025931 | Bacteria | 10373 |
| 529 | Ga0207644_10009497 | 3300025931 | Bacteria | 6389 |
| 530 | Ga0207644_10025426 | 3300025931 | Bacteria | 4072 |
| 531 | Ga0207644_10190507 | 3300025931 | Bacteria | 1612 |
| 532 | Ga0207690_10007239 | 3300025932 | Bacteria | 6589 |
| 533 | Ga0207690_10264505 | 3300025932 | Bacteria | 1334 |
| 534 | Ga0207706_10005363 | 3300025933 | Bacteria | 11952 |
| 535 | Ga0207706_10007588 | 3300025933 | Bacteria | 10034 |
| 536 | Ga0207706_10015532 | 3300025933 | Bacteria | 6879 |
| 537 | Ga0207706_10016523 | 3300025933 | Bacteria | 6661 |
| 538 | Ga0207706_10063677 | 3300025933 | Bacteria | 3246 |
| 539 | Ga0207706_10107599 | 3300025933 | Bacteria | 2454 |
| 540 | Ga0207686_10020623 | 3300025934 | Bacteria | 3768 |
| 541 | Ga0207709_10002970 | 3300025935 | Bacteria | 10336 |
| 542 | Ga0207709_10020213 | 3300025935 | Bacteria | 3753 |
| 543 | Ga0207709_10027140 | 3300025935 | Bacteria | 3296 |
| 544 | Ga0207709_10037377 | 3300025935 | Bacteria | 2885 |
| 545 | Ga0207670_10003489 | 3300025936 | Bacteria | 8346 |
| 546 | Ga0207670_10048850 | 3300025936 | Bacteria | 2826 |
| 547 | Ga0207670_10082490 | 3300025936 | Bacteria | 2253 |
| 548 | Ga0207670_10209815 | 3300025936 | Bacteria | 1485 |
| 549 | Ga0207670_10391355 | 3300025936 | Bacteria | 1109 |
| 550 | Ga0207669_10001324 | 3300025937 | Bacteria | 10540 |
| 551 | Ga0207669_10022747 | 3300025937 | Bacteria | 3335 |
| 552 | Ga0207669_10046762 | 3300025937 | Bacteria | 2559 |
| 553 | Ga0207669_10082786 | 3300025937 | Bacteria | 2061 |
| 554 | Ga0207669_10094727 | 3300025937 | Bacteria | 1955 |
| 555 | Ga0207669_10187070 | 3300025937 | Bacteria | 1490 |
| 556 | Ga0207669_10222069 | 3300025937 | Bacteria | 1387 |
| 557 | Ga0207704_10000130 | 3300025938 | Bacteria | 41287 |
| 558 | Ga0207704_10122991 | 3300025938 | Bacteria | 1780 |
| 559 | Ga0207704_10184642 | 3300025938 | Bacteria | 1510 |
| 560 | Ga0207665_10002113 | 3300025939 | Bacteria | 13436 |
| 561 | Ga0207665_10024373 | 3300025939 | Bacteria | 3989 |
| 562 | Ga0207665_10417650 | 3300025939 | Bacteria | 1024 |
| 563 | Ga0207691_10001422 | 3300025940 | Bacteria | 23867 |
| 564 | Ga0207691_10002604 | 3300025940 | Bacteria | 17616 |
| 565 | Ga0207691_10103504 | 3300025940 | Bacteria | 2539 |
| 566 | Ga0207691_10175920 | 3300025940 | Bacteria | 1872 |
| 567 | Ga0207691_10386682 | 3300025940 | Bacteria | 1194 |
| 568 | Ga0207711_10001071 | 3300025941 | Bacteria | 26139 |
| 569 | Ga0207711_10012903 | 3300025941 | Bacteria | 6939 |
| 570 | Ga0207711_10019431 | 3300025941 | Bacteria | 5657 |
| 571 | Ga0207711_10081889 | 3300025941 | Bacteria | 2821 |
| 572 | Ga0207711_10100479 | 3300025941 | Bacteria | 2558 |
| 573 | Ga0207689_10001156 | 3300025942 | Bacteria | 25400 |
| 574 | Ga0207689_10066148 | 3300025942 | Bacteria | 2973 |
| 575 | Ga0207689_10254733 | 3300025942 | Bacteria | 1452 |
| 576 | Ga0207661_10028696 | 3300025944 | Bacteria | 4264 |
| 577 | Ga0207661_10186261 | 3300025944 | Bacteria | 1817 |
| 578 | Ga0207661_10237224 | 3300025944 | Bacteria | 1617 |
| 579 | Ga0207661_10415447 | 3300025944 | Bacteria | 1221 |
| 580 | Ga0207661_10429362 | 3300025944 | Bacteria | 1201 |
| 581 | Ga0207679_10003209 | 3300025945 | Bacteria | 10084 |
| 582 | Ga0207679_10390710 | 3300025945 | Bacteria | 1222 |
| 583 | Ga0207667_10028359 | 3300025949 | Bacteria | 6081 |
| 584 | Ga0207667_10089076 | 3300025949 | Bacteria | 3190 |
| 585 | Ga0207667_10272091 | 3300025949 | Bacteria | 1731 |
| 586 | Ga0207667_10436413 | 3300025949 | Bacteria | 1332 |
| 587 | Ga0207651_10010192 | 3300025960 | Bacteria | 5194 |
| 588 | Ga0207651_10212060 | 3300025960 | Bacteria | 1560 |
| 589 | Ga0207712_10000579 | 3300025961 | Bacteria | 29666 |
| 590 | Ga0207712_10007061 | 3300025961 | Bacteria | 7084 |
| 591 | Ga0207712_10020831 | 3300025961 | Bacteria | 4300 |
| 592 | Ga0207668_10000815 | 3300025972 | Bacteria | 19101 |
| 593 | Ga0207668_10003465 | 3300025972 | Bacteria | 9258 |
| 594 | Ga0207668_10108641 | 3300025972 | Bacteria | 2076 |
| 595 | Ga0207668_10203378 | 3300025972 | Bacteria | 1579 |
| 596 | Ga0207640_10122108 | 3300025981 | Bacteria | 1868 |
| 597 | Ga0207658_10002475 | 3300025986 | Bacteria | 13483 |
| 598 | Ga0207658_10003151 | 3300025986 | Bacteria | 11783 |
| 599 | Ga0207658_10015729 | 3300025986 | Bacteria | 5194 |
| 600 | Ga0207658_10124397 | 3300025986 | Bacteria | 2061 |
| 601 | Ga0207677_10011181 | 3300026023 | Bacteria | 5106 |
| 602 | Ga0207677_10252437 | 3300026023 | Bacteria | 1433 |
| 603 | Ga0207703_10010308 | 3300026035 | Bacteria | 7318 |
| 604 | Ga0207703_10033374 | 3300026035 | Bacteria | 4080 |
| 605 | Ga0207639_10001866 | 3300026041 | Bacteria | 14170 |
| 606 | Ga0207639_10159860 | 3300026041 | Bacteria | 1897 |
| 607 | Ga0207639_10383618 | 3300026041 | Bacteria | 1262 |
| 608 | Ga0207678_10008348 | 3300026067 | Bacteria | 9133 |
| 609 | Ga0207678_10008633 | 3300026067 | Bacteria | 8980 |
| 610 | Ga0207678_10046782 | 3300026067 | Bacteria | 3742 |
| 611 | Ga0207708_10000402 | 3300026075 | Bacteria | 34168 |
| 612 | Ga0207708_10002738 | 3300026075 | Bacteria | 12941 |
| 613 | Ga0207708_10055684 | 3300026075 | Bacteria | 3015 |
| 614 | Ga0207708_10147325 | 3300026075 | Bacteria | 1851 |
| 615 | Ga0207708_10437374 | 3300026075 | Bacteria | 1087 |
| 616 | Ga0207702_10046199 | 3300026078 | Bacteria | 3665 |
| 617 | Ga0207702_10091417 | 3300026078 | Bacteria | 2665 |
| 618 | Ga0207641_10014704 | 3300026088 | Bacteria | 6417 |
| 619 | Ga0207641_10072572 | 3300026088 | Bacteria | 2964 |
| 620 | Ga0207641_10087180 | 3300026088 | Bacteria | 2723 |
| 621 | Ga0207641_10095692 | 3300026088 | Bacteria | 2607 |
| 622 | Ga0207648_10001500 | 3300026089 | Bacteria | 25704 |
| 623 | Ga0207648_10004627 | 3300026089 | Bacteria | 14090 |
| 624 | Ga0207676_10017931 | 3300026095 | Bacteria | 5136 |
| 625 | Ga0207676_10071930 | 3300026095 | Bacteria | 2778 |
| 626 | Ga0207676_10101902 | 3300026095 | Bacteria | 2381 |
| 627 | Ga0207676_10137857 | 3300026095 | Bacteria | 2084 |
| 628 | Ga0207674_10007131 | 3300026116 | Bacteria | 13059 |
| 629 | Ga0207674_10021894 | 3300026116 | Bacteria | 6877 |
| 630 | Ga0207674_10043375 | 3300026116 | Bacteria | 4638 |
| 631 | Ga0207675_100002311 | 3300026118 | Bacteria | 18934 |
| 632 | Ga0207675_100003859 | 3300026118 | Bacteria | 14570 |
| 633 | Ga0207675_100019447 | 3300026118 | Bacteria | 6336 |
| 634 | Ga0207675_100051796 | 3300026118 | Bacteria | 3831 |
| 635 | Ga0207683_10000850 | 3300026121 | Bacteria | 28050 |
| 636 | Ga0207683_10010051 | 3300026121 | Bacteria | 8075 |
| 637 | Ga0207683_10062694 | 3300026121 | Bacteria | 3274 |
| 638 | Ga0207683_10096310 | 3300026121 | Bacteria | 2639 |
| 639 | Ga0207683_10208074 | 3300026121 | Bacteria | 1780 |
| 640 | Ga0207683_10211505 | 3300026121 | Bacteria | 1765 |
| 641 | Ga0207698_10005963 | 3300026142 | Bacteria | 7570 |
| 642 | Ga0207698_10052400 | 3300026142 | Bacteria | 3126 |
| 643 | Ga0207698_10344543 | 3300026142 | Bacteria | 1405 |
| 644 | Ga0209995_1009515 | 3300027471 | Bacteria | 1572 |
| 645 | Ga0210002_1000490 | 3300027617 | Bacteria | 5383 |
| 646 | Ga0209971_1023345 | 3300027682 | Bacteria | 1475 |
| 647 | Ga0209966_1003846 | 3300027695 | Bacteria | 2533 |
| 648 | Ga0209998_10000759 | 3300027717 | Bacteria | 8436 |
| 649 | Ga0209998_10001051 | 3300027717 | Bacteria | 6935 |
| 650 | Ga0209974_10039214 | 3300027876 | Bacteria | 1575 |
| 651 | Ga0207428_10000164 | 3300027907 | Bacteria | 91968 |
| 652 | Ga0207428_10000391 | 3300027907 | Bacteria | 54825 |
| 653 | Ga0207428_10001108 | 3300027907 | Bacteria | 29314 |
| 654 | Ga0207428_10008433 | 3300027907 | Bacteria | 9303 |
| 655 | Ga0207428_10024777 | 3300027907 | Bacteria | 5036 |
| 656 | Ga0268266_10002016 | 3300028379 | Bacteria | 22644 |
| 657 | Ga0268266_10127443 | 3300028379 | Bacteria | 2273 |
| 658 | Ga0268265_10003240 | 3300028380 | Bacteria | 11822 |
| 659 | Ga0268265_10042298 | 3300028380 | Bacteria | 3379 |
| 660 | Ga0268265_10265390 | 3300028380 | Bacteria | 1529 |
| 661 | Ga0268264_10020827 | 3300028381 | Bacteria | 5359 |
| 662 | Ga0268264_10061652 | 3300028381 | Bacteria | 3147 |
| 663 | Ga0268264_10061975 | 3300028381 | Bacteria | 3139 |
| 664 | Ga0268264_10128256 | 3300028381 | Bacteria | 2245 |
| 665 | Ga0268264_10144215 | 3300028381 | Bacteria | 2127 |
| 666 | Ga0268264_10151718 | 3300028381 | Bacteria | 2078 |
| 667 | Ga0268264_10167044 | 3300028381 | Bacteria | 1987 |
| 668 | Ga0265337_1000284 | 3300028556 | Bacteria | 27492 |
| 669 | Ga0307515_10248642 | 3300028794 | Bacteria | 1535 |
| 670 | Ga0265338_10005223 | 3300028800 | Bacteria | 17029 |
| 671 | Ga0265330_10027948 | 3300031235 | Bacteria | 2545 |
| 672 | Ga0265330_10102093 | 3300031235 | Bacteria | 1227 |
| 673 | Ga0265332_10000508 | 3300031238 | Bacteria | 26654 |
| 674 | Ga0265332_10026267 | 3300031238 | Bacteria | 2554 |
| 675 | Ga0265332_10073934 | 3300031238 | Bacteria | 1450 |
| 676 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 677 | Ga0265325_10001329 | 3300031241 | Bacteria | 17514 |
| 678 | Ga0265325_10003017 | 3300031241 | Bacteria | 11157 |
| 679 | Ga0265325_10004090 | 3300031241 | Bacteria | 9294 |
| 680 | Ga0265325_10025995 | 3300031241 | Bacteria | 3175 |
| 681 | Ga0265325_10034256 | 3300031241 | Bacteria | 2703 |
| 682 | Ga0265325_10063293 | 3300031241 | Bacteria | 1872 |
| 683 | Ga0265325_10067790 | 3300031241 | Bacteria | 1797 |
| 684 | Ga0265340_10009669 | 3300031247 | Bacteria | 5168 |
| 685 | Ga0265340_10024385 | 3300031247 | Bacteria | 3073 |
| 686 | Ga0265340_10024647 | 3300031247 | Bacteria | 3053 |
| 687 | Ga0265340_10037227 | 3300031247 | Bacteria | 2411 |
| 688 | Ga0265339_10000096 | 3300031249 | Bacteria | 74964 |
| 689 | Ga0265339_10001912 | 3300031249 | Bacteria | 15282 |
| 690 | Ga0265339_10006450 | 3300031249 | Bacteria | 7694 |
| 691 | Ga0265339_10008869 | 3300031249 | Bacteria | 6368 |
| 692 | Ga0265339_10015052 | 3300031249 | Bacteria | 4648 |
| 693 | Ga0265331_10042725 | 3300031250 | Bacteria | 2198 |
| 694 | Ga0265327_10000177 | 3300031251 | Bacteria | 136559 |
| 695 | Ga0265313_10000024 | 3300031595 | Bacteria | 138587 |
| 696 | Ga0265313_10004465 | 3300031595 | Bacteria | 10721 |
| 697 | Ga0265313_10006000 | 3300031595 | Bacteria | 8776 |
| 698 | Ga0265313_10025519 | 3300031595 | Bacteria | 3129 |
| 699 | Ga0265313_10028957 | 3300031595 | Bacteria | 2871 |
| 700 | Ga0265313_10047499 | 3300031595 | Bacteria | 2077 |
| 701 | Ga0265313_10100613 | 3300031595 | Bacteria | 1284 |
| 702 | Ga0265314_10001355 | 3300031711 | Bacteria | 27657 |
| 703 | Ga0265342_10000573 | 3300031712 | Bacteria | 38852 |
| 704 | Ga0265342_10001257 | 3300031712 | Bacteria | 23945 |
| 705 | Ga0307516_10054650 | 3300031730 | Bacteria | 3901 |
| 706 | Ga0307407_10177306 | 3300031903 | Bacteria | 1409 |
| 707 | Ga0307414_10063480 | 3300032004 | Bacteria | 2625 |
| 708 | Ga0307415_100147752 | 3300032126 | Bacteria | 1805 |
| 709 | Ga0316583_10001118 | 3300032133 | Bacteria | 8745 |
| 710 | Ga0373930_0000713 | 3300034816 | Bacteria | 4686 |
| 711 | Ga0373948_0000426 | 3300034817 | Bacteria | 5204 |
| 712 | Ga0373948_0001212 | 3300034817 | Bacteria | 3513 |
| 713 | Ga0373950_0004976 | 3300034818 | Bacteria | 1968 |
| 714 | Ga0373958_0000992 | 3300034819 | Bacteria | 3699 |
| 715 | Ga0373958_0005970 | 3300034819 | Bacteria | 1876 |
| 716 | Ga0373959_0000111 | 3300034820 | Bacteria | 18330 |
| 717 | Ga0373938_0000386 | 3300034957 | Bacteria | 7080 |
| 718 | Ga0373938_0000527 | 3300034957 | Bacteria | 6207 |
| 719 | Ga0373938_0004135 | 3300034957 | Bacteria | 2406 |
| 720 | Ga0373926_0000388 | 3300035083 | Bacteria | 11245 |
| 721 | Ga0373926_0012315 | 3300035083 | Bacteria | 2889 |
| 722 | Ga0373928_0000045 | 3300035084 | Bacteria | 21176 |
| 723 | Ga0373929_0000214 | 3300035085 | Bacteria | 10508 |
| 724 | Ga0373934_0073810 | 3300035086 | Bacteria | 1366 |
| 725 | Ga0373940_0003391 | 3300035088 | Bacteria | 3249 |
| 726 | Ga0373940_0008685 | 3300035088 | Bacteria | 2341 |
| 727 | Ga0373940_0016914 | 3300035088 | Bacteria | 1812 |
| 728 | Ga0373944_0000734 | 3300035089 | Bacteria | 7963 |
| 729 | Ga0373944_0013920 | 3300035089 | Bacteria | 2238 |
| 730 | Ga0373944_0019891 | 3300035089 | Bacteria | 1930 |
| 731 | Ga0373949_0002131 | 3300035090 | Bacteria | 5202 |
| 732 | Ga0373949_0002981 | 3300035090 | Bacteria | 4164 |
| 733 | Ga0373951_0000335 | 3300035091 | Bacteria | 14582 |
| 734 | Ga0373951_0005629 | 3300035091 | Bacteria | 2901 |
| 735 | Ga0373951_0013871 | 3300035091 | Bacteria | 1812 |
| 736 | Ga0373952_0000179 | 3300035092 | Bacteria | 9804 |
| 737 | Ga0373952_0004378 | 3300035092 | Bacteria | 2562 |
| 738 | Ga0373923_0000978 | 3300035111 | Bacteria | 7693 |
| 739 | Ga0373932_0000271 | 3300035112 | Bacteria | 15633 |
| 740 | Ga0373932_0002322 | 3300035112 | Bacteria | 4835 |
| 741 | Ga0373932_0023548 | 3300035112 | Bacteria | 1648 |
| 742 | Ga0373936_0001860 | 3300035113 | Bacteria | 7784 |
| 743 | Ga0373936_0011435 | 3300035113 | Bacteria | 3358 |
| 744 | Ga0373936_0036477 | 3300035113 | Bacteria | 1961 |
| 745 | Ga0373939_0008122 | 3300035114 | Bacteria | 2567 |
| 746 | Ga0373939_0011931 | 3300035114 | Bacteria | 2205 |
| 747 | Ga0373941_0000241 | 3300035115 | Bacteria | 10507 |
| 748 | Ga0373941_0033442 | 3300035115 | Bacteria | 1545 |
| 749 | Ga0373945_0016965 | 3300035116 | Bacteria | 2463 |
| 750 | Ga0373945_0018406 | 3300035116 | Bacteria | 2376 |
| 751 | Ga0373945_0028858 | 3300035116 | Bacteria | 1946 |
| 752 | Ga0373954_0000707 | 3300035118 | Bacteria | 12831 |
| 753 | Ga0373954_0025763 | 3300035118 | Bacteria | 2692 |
| 754 | Ga0373954_0045424 | 3300035118 | Bacteria | 2052 |
| 755 | Ga0373954_0077547 | 3300035118 | Bacteria | 1585 |
| 756 | Ga0373956_0023428 | 3300035119 | Bacteria | 2650 |
| 757 | Ga0373956_0029934 | 3300035119 | Bacteria | 2377 |
| 758 | Ga0373957_0002977 | 3300035120 | Bacteria | 4915 |
| 759 | Ga0373957_0036321 | 3300035120 | Bacteria | 1835 |
| 760 | Ga0373957_0047844 | 3300035120 | Bacteria | 1628 |
| 761 | Ga0373960_0003102 | 3300035121 | Bacteria | 3752 |
| 762 | Ga0373960_0024562 | 3300035121 | Bacteria | 1631 |
| 763 | Ga0373943_0000233 | 3300035170 | Bacteria | 22738 |
| 764 | Ga0373943_0000997 | 3300035170 | Bacteria | 12584 |
| 765 | Ga0373943_0007851 | 3300035170 | Bacteria | 4791 |
| 766 | Ga0373943_0047269 | 3300035170 | Bacteria | 2103 |
| 767 | Ga0373946_0007488 | 3300035171 | Bacteria | 3991 |
| 768 | Ga0373946_0011741 | 3300035171 | Bacteria | 3274 |
| 769 | Ga0373946_0026501 | 3300035171 | Bacteria | 2287 |
| 770 | Ga0373955_0001092 | 3300035172 | Bacteria | 11522 |
| 771 | Ga0373955_0002224 | 3300035172 | Bacteria | 8418 |
| 772 | Ga0373955_0005439 | 3300035172 | Bacteria | 5722 |
| 773 | Ga0373955_0014964 | 3300035172 | Bacteria | 3788 |
| 774 | Ga0373942_0008878 | 3300035207 | Bacteria | 2347 |
| 775 | Ga0373961_0000592 | 3300035241 | Bacteria | 13503 |
| 776 | Ga0373961_0003081 | 3300035241 | Bacteria | 4192 |
| 777 | Ga0373961_0005827 | 3300035241 | Bacteria | 2960 |
| 778 | Ga0373961_0011637 | 3300035241 | Bacteria | 2186 |
| 779 | Ga0373962_0000848 | 3300035242 | Bacteria | 6984 |
| 780 | Ga0373962_0002023 | 3300035242 | Bacteria | 4831 |
| 781 | Ga0373962_0020380 | 3300035242 | Bacteria | 1741 |
| 782 | Ga0373924_0070650 | 3300035410 | Bacteria | 1472 |
| 783 | Ga0373924_0145353 | 3300035410 | Bacteria | 1036 |
| 784 | Ga0373931_0001210 | 3300035691 | Bacteria | 11038 |
| 785 | Ga0373931_0003979 | 3300035691 | Bacteria | 6696 |
| 786 | Ga0373931_0004155 | 3300035691 | Bacteria | 6578 |
| 787 | Ga0373931_0004514 | 3300035691 | Bacteria | 6366 |
| 788 | Ga0373931_0018978 | 3300035691 | Bacteria | 3426 |
| 789 | Ga0373931_0174512 | 3300035691 | Bacteria | 1269 |
| 790 | Ga0373931_0275359 | 3300035691 | Bacteria | 1032 |
| 791 | Ga0373935_0000377 | 3300035692 | Bacteria | 22883 |
| 792 | Ga0373935_0001455 | 3300035692 | Bacteria | 13125 |
| 793 | Ga0373935_0003956 | 3300035692 | Bacteria | 8651 |
| 794 | Ga0373935_0084931 | 3300035692 | Bacteria | 2062 |
| 795 | Ga0373935_0188072 | 3300035692 | Bacteria | 1421 |
| 796 | Ga0373927_0000113 | 3300035695 | Bacteria | 60608 |
| 797 | Ga0373927_0013803 | 3300035695 | Bacteria | 5362 |
| 798 | Ga0373927_0017901 | 3300035695 | Bacteria | 4660 |
| 799 | Ga0373927_0021648 | 3300035695 | Bacteria | 4214 |
| 800 | Ga0373927_0035757 | 3300035695 | Bacteria | 3230 |
| 801 | Ga0373927_0041852 | 3300035695 | Bacteria | 2970 |
| 802 | Ga0373927_0060060 | 3300035695 | Bacteria | 2459 |
| 803 | Ga0373927_0067856 | 3300035695 | Bacteria | 2307 |
| 804 | Ga0373927_0080694 | 3300035695 | Bacteria | 2108 |
| 805 | Ga0373933_0000258 | 3300035724 | Bacteria | 34845 |
| 806 | Ga0373933_0010567 | 3300035724 | Bacteria | 5062 |
| 807 | Ga0373933_0017191 | 3300035724 | Bacteria | 4055 |
| 808 | Ga0373933_0034562 | 3300035724 | Bacteria | 2946 |
| 809 | Ga0373933_0043589 | 3300035724 | Bacteria | 2655 |
| 810 | Ga0373933_0129767 | 3300035724 | Bacteria | 1584 |
| 811 | Ga0373947_0000168 | 3300035725 | Bacteria | 35315 |
| 812 | Ga0373947_0000280 | 3300035725 | Bacteria | 28900 |
| 813 | Ga0373947_0012523 | 3300035725 | Bacteria | 4865 |
| 814 | Ga0373947_0013179 | 3300035725 | Bacteria | 4738 |
| 815 | Ga0373947_0019089 | 3300035725 | Bacteria | 3951 |
| 816 | Ga0373947_0020590 | 3300035725 | Bacteria | 3809 |
| 817 | Ga0373937_0000814 | 3300036401 | Bacteria | 26684 |
| 818 | Ga0373937_0001849 | 3300036401 | Bacteria | 17776 |
| 819 | Ga0373937_0005769 | 3300036401 | Bacteria | 10643 |
| 820 | Ga0373937_0008814 | 3300036401 | Bacteria | 8750 |
| 821 | Ga0373937_0011708 | 3300036401 | Bacteria | 7693 |
| 822 | Ga0373937_0017925 | 3300036401 | Bacteria | 6315 |
| 823 | Ga0373937_0059689 | 3300036401 | Bacteria | 3505 |
| 824 | Ga0373937_0191559 | 3300036401 | Bacteria | 1921 |
| 825 | Ga0373925_0000075 | 3300037068 | Bacteria | 105395 |
| 826 | Ga0373925_0001434 | 3300037068 | Bacteria | 20657 |
| 827 | Ga0373925_0003256 | 3300037068 | Bacteria | 12656 |
| 828 | Ga0373925_0013932 | 3300037068 | Bacteria | 5820 |
| 829 | Ga0373925_0115233 | 3300037068 | Bacteria | 2081 |
| 830 | Ga0373925_0136762 | 3300037068 | Bacteria | 1915 |
| 831 | Ga0373925_0198248 | 3300037068 | Bacteria | 1596 |
| 832 | Ga0373925_0313423 | 3300037068 | Bacteria | 1268 |
| 833 | Ga0395899_0005270 | 3300037312 | Bacteria | 10041 |
| 834 | Ga0395899_0083216 | 3300037312 | Bacteria | 2327 |
| 835 | Ga0395900_0004997 | 3300037418 | Bacteria | 13928 |
| 836 | Ga0395900_0334631 | 3300037418 | Bacteria | 1491 |
| 837 | Ga0395898_0005343 | 3300037466 | Bacteria | 13890 |
| 838 | Ga0395898_0109287 | 3300037466 | Bacteria | 2651 |
| 839 | Ga0395898_0211384 | 3300037466 | Bacteria | 1850 |
| 840 | Ga0395898_0252358 | 3300037466 | Bacteria | 1682 |
| 841 | Ga0436364_0266645 | 3300037853 | Bacteria | 19395 |
| 842 | Ga0436364_0611324 | 3300037853 | Bacteria | 1556 |
| 843 | Ga0436364_1284638 | 3300037853 | Bacteria | 5477 |
| 844 | Ga0395901_0009254 | 3300038443 | Bacteria | 9986 |
| 845 | Ga0395901_0114297 | 3300038443 | Bacteria | 2835 |
| 846 | Ga0242420_010110 | 3300038996 | Bacteria | 1561 |
| 847 | Ga0436365_0117548 | 3300039437 | Bacteria | 62327 |
| 848 | Ga0436365_0321935 | 3300039437 | Bacteria | 1084 |
| 849 | Ga0436365_0448461 | 3300039437 | Bacteria | 3249 |
| 850 | Ga0436365_0692136 | 3300039437 | Bacteria | 2988 |
| 851 | Ga0436365_0827365 | 3300039437 | Bacteria | 2583 |
| 852 | Ga0436365_1485216 | 3300039437 | Bacteria | 1943 |
| 853 | Ga0436365_1545760 | 3300039437 | Bacteria | 2496 |
| 854 | Ga0436361_0569994 | 3300039447 | Bacteria | 6230 |
| 855 | Ga0436361_0679413 | 3300039447 | Bacteria | 1247 |
| 856 | Ga0436361_1044250 | 3300039447 | Bacteria | 1373 |
| 857 | Ga0436363_0519487 | 3300039450 | Bacteria | 1050 |
| 858 | Ga0436363_1624569 | 3300039450 | Bacteria | 5180 |
| 859 | Ga0436363_1706863 | 3300039450 | Bacteria | 1125 |
| 860 | Ga0439453_0021580 | 3300041408 | Bacteria | 1162 |
| 861 | Ga0451853_2607190 | 3300041512 | Bacteria | 1136 |
| 862 | Ga0451853_3173075 | 3300041512 | Bacteria | 1259 |
| 863 | Ga0439441_006469 | 3300042001 | Bacteria | 1860 |
| 864 | Ga0439443_005645 | 3300042003 | Bacteria | 1681 |
| 865 | Ga0439450_002586 | 3300042008 | Bacteria | 2870 |
| 866 | Ga0466963_0002455 | 3300044694 | Bacteria | 10366 |
| 867 | Ga0466963_0059496 | 3300044694 | Bacteria | 2550 |
| 868 | Ga0466968_0009361 | 3300044735 | Bacteria | 3766 |
| 869 | Ga0466957_0012658 | 3300044842 | Bacteria | 4887 |
| 870 | Ga0466959_0045768 | 3300045049 | Bacteria | 3222 |
| 871 | Ga0451576_0006479 | 3300045051 | Bacteria | 14344 |
| 872 | Ga0466967_0006697 | 3300045976 | Bacteria | 8194 |
| 873 | Ga0466967_0104801 | 3300045976 | Bacteria | 2590 |
| 874 | Ga0466967_0180663 | 3300045976 | Bacteria | 1990 |
| 875 | Ga0495592_0000060 | 3300046454 | Bacteria | 100113 |
| 876 | Ga0495592_0003878 | 3300046454 | Bacteria | 10821 |
| 877 | Ga0495592_0026131 | 3300046454 | Bacteria | 4430 |
| 878 | Ga0495592_0051488 | 3300046454 | Bacteria | 3058 |
| 879 | Ga0495592_0052855 | 3300046454 | Bacteria | 3014 |
| 880 | Ga0495603_0004025 | 3300046455 | Bacteria | 8751 |
| 881 | Ga0495603_0023263 | 3300046455 | Bacteria | 3751 |
| 882 | Ga0495629_0000118 | 3300046459 | Bacteria | 70632 |
| 883 | Ga0495629_0000139 | 3300046459 | Bacteria | 63649 |
| 884 | Ga0495629_0027523 | 3300046459 | Bacteria | 4037 |
| 885 | Ga0495629_0115745 | 3300046459 | Bacteria | 1868 |
| 886 | Ga0495629_0117691 | 3300046459 | Bacteria | 1851 |
| 887 | Ga0495629_0139108 | 3300046459 | Bacteria | 1690 |
| 888 | Ga0495629_0145651 | 3300046459 | Bacteria | 1647 |
| 889 | Ga0495629_0159256 | 3300046459 | Bacteria | 1568 |
| 890 | Ga0495638_0043216 | 3300046460 | Bacteria | 2844 |
| 891 | Ga0495641_0026615 | 3300046461 | Bacteria | 2820 |
| 892 | Ga0495651_0000181 | 3300046462 | Bacteria | 46803 |
| 893 | Ga0495651_0001419 | 3300046462 | Bacteria | 18593 |
| 894 | Ga0495651_0004794 | 3300046462 | Bacteria | 10354 |
| 895 | Ga0495651_0084089 | 3300046462 | Bacteria | 2398 |
| 896 | Ga0495651_0086259 | 3300046462 | Bacteria | 2362 |
| 897 | Ga0495653_0000141 | 3300046463 | Bacteria | 60033 |
| 898 | Ga0495653_0006362 | 3300046463 | Bacteria | 9690 |
| 899 | Ga0495653_0067003 | 3300046463 | Bacteria | 2698 |
| 900 | Ga0495580_0005444 | 3300046472 | Bacteria | 10519 |
| 901 | Ga0495580_0018852 | 3300046472 | Bacteria | 5133 |
| 902 | Ga0495580_0047339 | 3300046472 | Bacteria | 3048 |
| 903 | Ga0495580_0126130 | 3300046472 | Bacteria | 1776 |
| 904 | Ga0495582_0037925 | 3300046473 | Bacteria | 2651 |
| 905 | Ga0495582_0042876 | 3300046473 | Bacteria | 2491 |
| 906 | Ga0495582_0044124 | 3300046473 | Bacteria | 2456 |
| 907 | Ga0495582_0244600 | 3300046473 | Bacteria | 1028 |
| 908 | Ga0495605_0065887 | 3300046474 | Bacteria | 1722 |
| 909 | Ga0495639_0005719 | 3300046475 | Bacteria | 5349 |
| 910 | Ga0495639_0037816 | 3300046475 | Bacteria | 2165 |
| 911 | Ga0495639_0055354 | 3300046475 | Bacteria | 1809 |
| 912 | Ga0495662_0000223 | 3300046476 | Bacteria | 23829 |
| 913 | Ga0495662_0001139 | 3300046476 | Bacteria | 13118 |
| 914 | Ga0495662_0028741 | 3300046476 | Bacteria | 2684 |
| 915 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 916 | Ga0495664_0000800 | 3300046477 | Bacteria | 16088 |
| 917 | Ga0495664_0017877 | 3300046477 | Bacteria | 4054 |
| 918 | Ga0495664_0076038 | 3300046477 | Bacteria | 2009 |
| 919 | Ga0495664_0132456 | 3300046477 | Bacteria | 1510 |
| 920 | Ga0495584_0039361 | 3300046491 | Bacteria | 2388 |
| 921 | Ga0495585_0001030 | 3300046492 | Bacteria | 23180 |
| 922 | Ga0495594_0002129 | 3300046499 | Bacteria | 10306 |
| 923 | Ga0495594_0015379 | 3300046499 | Bacteria | 4019 |
| 924 | Ga0495594_0026453 | 3300046499 | Bacteria | 3121 |
| 925 | Ga0495607_0006002 | 3300046501 | Bacteria | 8613 |
| 926 | Ga0495607_0187944 | 3300046501 | Bacteria | 1031 |
| 927 | Ga0495606_0020594 | 3300046507 | Bacteria | 4855 |
| 928 | Ga0495606_0034704 | 3300046507 | Bacteria | 3459 |
| 929 | Ga0495608_0000011 | 3300046511 | Bacteria | 248514 |
| 930 | Ga0495608_0000398 | 3300046511 | Bacteria | 30359 |
| 931 | Ga0495608_0000911 | 3300046511 | Bacteria | 20725 |
| 932 | Ga0495608_0030340 | 3300046511 | Bacteria | 3661 |
| 933 | Ga0495608_0036267 | 3300046511 | Bacteria | 3320 |
| 934 | Ga0495608_0061262 | 3300046511 | Bacteria | 2475 |
| 935 | Ga0495608_0120492 | 3300046511 | Bacteria | 1683 |
| 936 | Ga0495618_0000044 | 3300046514 | Bacteria | 95526 |
| 937 | Ga0495618_0017292 | 3300046514 | Bacteria | 4419 |
| 938 | Ga0495618_0019414 | 3300046514 | Bacteria | 4181 |
| 939 | Ga0495618_0028428 | 3300046514 | Bacteria | 3484 |
| 940 | Ga0495618_0067596 | 3300046514 | Bacteria | 2272 |
| 941 | Ga0495618_0069530 | 3300046514 | Bacteria | 2238 |
| 942 | Ga0495618_0126539 | 3300046514 | Bacteria | 1636 |
| 943 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 944 | Ga0495628_0005139 | 3300046516 | Bacteria | 11502 |
| 945 | Ga0495628_0006666 | 3300046516 | Bacteria | 10072 |
| 946 | Ga0495628_0024922 | 3300046516 | Bacteria | 4892 |
| 947 | Ga0495628_0258755 | 3300046516 | Bacteria | 1298 |
| 948 | Ga0495630_0000574 | 3300046517 | Bacteria | 26824 |
| 949 | Ga0495630_0011656 | 3300046517 | Bacteria | 6370 |
| 950 | Ga0495630_0047151 | 3300046517 | Bacteria | 3222 |
| 951 | Ga0495630_0070201 | 3300046517 | Bacteria | 2635 |
| 952 | Ga0495630_0100159 | 3300046517 | Bacteria | 2192 |
| 953 | Ga0495630_0200181 | 3300046517 | Bacteria | 1524 |
| 954 | Ga0495637_0054463 | 3300046520 | Bacteria | 1662 |
| 955 | Ga0495644_0000513 | 3300046523 | Bacteria | 16576 |
| 956 | Ga0495648_0004446 | 3300046524 | Bacteria | 11977 |
| 957 | Ga0495663_0053960 | 3300046525 | Bacteria | 1250 |
| 958 | Ga0495666_0002030 | 3300046526 | Bacteria | 10010 |
| 959 | Ga0495666_0009646 | 3300046526 | Bacteria | 4827 |
| 960 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 961 | Ga0495652_0014420 | 3300046529 | Bacteria | 7096 |
| 962 | Ga0495652_0016128 | 3300046529 | Bacteria | 6683 |
| 963 | Ga0495652_0016289 | 3300046529 | Bacteria | 6649 |
| 964 | Ga0495652_0032084 | 3300046529 | Bacteria | 4595 |
| 965 | Ga0495652_0081927 | 3300046529 | Bacteria | 2661 |
| 966 | Ga0495652_0134264 | 3300046529 | Bacteria | 1955 |
| 967 | Ga0495652_0136862 | 3300046529 | Bacteria | 1931 |
| 968 | Ga0495665_0003032 | 3300046531 | Bacteria | 9074 |
| 969 | Ga0495665_0004686 | 3300046531 | Bacteria | 7373 |
| 970 | Ga0495665_0028599 | 3300046531 | Bacteria | 2988 |
| 971 | Ga0495665_0032349 | 3300046531 | Bacteria | 2798 |
| 972 | Ga0495665_0041588 | 3300046531 | Bacteria | 2447 |
| 973 | Ga0495665_0056169 | 3300046531 | Bacteria | 2078 |
| 974 | Ga0495665_0074346 | 3300046531 | Bacteria | 1789 |
| 975 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 976 | Ga0495640_0000544 | 3300046533 | Bacteria | 27687 |
| 977 | Ga0495640_0015185 | 3300046533 | Bacteria | 5801 |
| 978 | Ga0495640_0108952 | 3300046533 | Bacteria | 1811 |
| 979 | Ga0495640_0141892 | 3300046533 | Bacteria | 1548 |
| 980 | Ga0495586_0037924 | 3300046535 | Bacteria | 2587 |
| 981 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 982 | Ga0495587_0000599 | 3300046536 | Bacteria | 24689 |
| 983 | Ga0495587_0002174 | 3300046536 | Bacteria | 13130 |
| 984 | Ga0495587_0003798 | 3300046536 | Bacteria | 10023 |
| 985 | Ga0495587_0015799 | 3300046536 | Bacteria | 4706 |
| 986 | Ga0495587_0048234 | 3300046536 | Bacteria | 2522 |
| 987 | Ga0495587_0100622 | 3300046536 | Bacteria | 1666 |
| 988 | Ga0495621_0006662 | 3300046539 | Bacteria | 3383 |
| 989 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 990 | Ga0495645_0008747 | 3300046543 | Bacteria | 7070 |
| 991 | Ga0495645_0016750 | 3300046543 | Bacteria | 5243 |
| 992 | Ga0495645_0026193 | 3300046543 | Bacteria | 4232 |
| 993 | Ga0495645_0072642 | 3300046543 | Bacteria | 2479 |
| 994 | Ga0495633_0004113 | 3300046558 | Bacteria | 9379 |
| 995 | Ga0495633_0134210 | 3300046558 | Bacteria | 1145 |
| 996 | Ga0495667_0000039 | 3300046559 | Bacteria | 131308 |
| 997 | Ga0495667_0008770 | 3300046559 | Bacteria | 6874 |
| 998 | Ga0495667_0023899 | 3300046559 | Bacteria | 4116 |
| 999 | Ga0495667_0047251 | 3300046559 | Bacteria | 2844 |
| 1000 | Ga0495667_0056128 | 3300046559 | Bacteria | 2590 |
| 1001 | Ga0495656_0000091 | 3300046615 | Bacteria | 38995 |
| 1002 | Ga0495656_0046837 | 3300046615 | Bacteria | 1831 |
| 1003 | Ga0495634_0000010 | 3300046642 | Bacteria | 143792 |
| 1004 | Ga0495634_0023758 | 3300046642 | Bacteria | 4306 |
| 1005 | Ga0495634_0126332 | 3300046642 | Bacteria | 1634 |
| 1006 | Ga0495634_0182707 | 3300046642 | Bacteria | 1312 |
| 1007 | Ga0495625_0000012 | 3300046660 | Bacteria | 363006 |
| 1008 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 1009 | Ga0495635_0004203 | 3300046663 | Bacteria | 9986 |
| 1010 | Ga0495635_0006281 | 3300046663 | Bacteria | 8276 |
| 1011 | Ga0495635_0018687 | 3300046663 | Bacteria | 4834 |
| 1012 | Ga0495659_0059779 | 3300046664 | Bacteria | 1405 |
| 1013 | Ga0495588_0010028 | 3300046674 | Bacteria | 4391 |
| 1014 | Ga0495588_0033132 | 3300046674 | Bacteria | 2608 |
| 1015 | Ga0495588_0041177 | 3300046674 | Bacteria | 2358 |
| 1016 | Ga0495657_0000042 | 3300046675 | Bacteria | 114669 |
| 1017 | Ga0495657_0001942 | 3300046675 | Bacteria | 17644 |
| 1018 | Ga0495657_0031508 | 3300046675 | Bacteria | 3706 |
| 1019 | Ga0495657_0107094 | 3300046675 | Bacteria | 1774 |
| 1020 | Ga0495599_0000013 | 3300046678 | Bacteria | 179828 |
| 1021 | Ga0495599_0008880 | 3300046678 | Bacteria | 6119 |
| 1022 | Ga0495599_0042108 | 3300046678 | Bacteria | 2866 |
| 1023 | Ga0495623_0000050 | 3300046679 | Bacteria | 72959 |
| 1024 | Ga0495623_0006342 | 3300046679 | Bacteria | 7687 |
| 1025 | Ga0495623_0028043 | 3300046679 | Bacteria | 3625 |
| 1026 | Ga0495623_0035033 | 3300046679 | Bacteria | 3217 |
| 1027 | Ga0495623_0088991 | 3300046679 | Bacteria | 1899 |
| 1028 | Ga0495646_0000009 | 3300046680 | Bacteria | 200698 |
| 1029 | Ga0495646_0021007 | 3300046680 | Bacteria | 4127 |
| 1030 | Ga0495646_0090311 | 3300046680 | Bacteria | 1770 |
| 1031 | Ga0495646_0096072 | 3300046680 | Bacteria | 1704 |
| 1032 | Ga0495647_0013620 | 3300046681 | Bacteria | 2821 |
| 1033 | Ga0495647_0057352 | 3300046681 | Bacteria | 1529 |
| 1034 | Ga0495658_0000065 | 3300046683 | Bacteria | 52835 |
| 1035 | Ga0495658_0003665 | 3300046683 | Bacteria | 7602 |
| 1036 | Ga0495658_0086163 | 3300046683 | Bacteria | 1852 |
| 1037 | Ga0495669_0038062 | 3300046684 | Bacteria | 2130 |
| 1038 | Ga0495613_0006292 | 3300046689 | Bacteria | 8882 |
| 1039 | Ga0495613_0009544 | 3300046689 | Bacteria | 7205 |
| 1040 | Ga0495624_0001118 | 3300046690 | Bacteria | 21215 |
| 1041 | Ga0495624_0001463 | 3300046690 | Bacteria | 18374 |
| 1042 | Ga0495624_0011107 | 3300046690 | Bacteria | 6196 |
| 1043 | Ga0495624_0062489 | 3300046690 | Bacteria | 2329 |
| 1044 | Ga0495624_0082189 | 3300046690 | Bacteria | 1994 |
| 1045 | Ga0495670_0000506 | 3300046691 | Bacteria | 18484 |
| 1046 | Ga0495671_0068569 | 3300046692 | Bacteria | 1744 |
| 1047 | Ga0495671_0101024 | 3300046692 | Bacteria | 1410 |
| 1048 | Ga0495649_0095725 | 3300046694 | Bacteria | 1580 |
| 1049 | Ga0495600_0001478 | 3300046809 | Bacteria | 13016 |
| 1050 | Ga0495600_0008371 | 3300046809 | Bacteria | 6351 |
| 1051 | Ga0495600_0016518 | 3300046809 | Bacteria | 4686 |
| 1052 | Ga0495600_0038130 | 3300046809 | Bacteria | 3126 |
| 1053 | Ga0495600_0141975 | 3300046809 | Bacteria | 1558 |
| 1054 | Ga0495660_0100064 | 3300046810 | Bacteria | 1494 |
| 1055 | Ga0495581_0002630 | 3300047315 | Bacteria | 10219 |
| 1056 | Ga0495581_0007122 | 3300047315 | Bacteria | 6478 |
| 1057 | Ga0495581_0008727 | 3300047315 | Bacteria | 5870 |
| 1058 | Ga0495581_0036712 | 3300047315 | Bacteria | 2835 |
| 1059 | Ga0495581_0044466 | 3300047315 | Bacteria | 2568 |
| 1060 | Ga0495581_0073821 | 3300047315 | Bacteria | 1974 |
| 1061 | Ga0495581_0084489 | 3300047315 | Bacteria | 1839 |
| 1062 | Ga0495604_0000069 | 3300047317 | Bacteria | 89935 |
| 1063 | Ga0495604_0014602 | 3300047317 | Bacteria | 6259 |
| 1064 | Ga0495604_0029121 | 3300047317 | Bacteria | 4394 |
| 1065 | Ga0495604_0073607 | 3300047317 | Bacteria | 2578 |
| 1066 | Ga0495604_0183139 | 3300047317 | Bacteria | 1464 |
| 1067 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 1068 | Ga0495674_0002892 | 3300047319 | Bacteria | 16713 |
| 1069 | Ga0495674_0033064 | 3300047319 | Bacteria | 4687 |
| 1070 | Ga0495674_0036782 | 3300047319 | Bacteria | 4403 |
| 1071 | Ga0495674_0066059 | 3300047319 | Bacteria | 3140 |
| 1072 | Ga0495674_0100049 | 3300047319 | Bacteria | 2468 |
| 1073 | Ga0495674_0126427 | 3300047319 | Bacteria | 2156 |
| 1074 | Ga0495674_0243184 | 3300047319 | Bacteria | 1482 |
| 1075 | Ga0495672_0011413 | 3300047320 | Bacteria | 6273 |
| 1076 | Ga0495672_0033677 | 3300047320 | Bacteria | 3173 |
| 1077 | Ga0495676_0015401 | 3300047321 | Bacteria | 6811 |
| 1078 | Ga0495676_0046916 | 3300047321 | Bacteria | 3501 |
| 1079 | Ga0495680_0000313 | 3300047322 | Bacteria | 54486 |
| 1080 | Ga0495680_0000328 | 3300047322 | Bacteria | 53287 |
| 1081 | Ga0495680_0009069 | 3300047322 | Bacteria | 8981 |
| 1082 | Ga0495680_0014330 | 3300047322 | Bacteria | 6872 |
| 1083 | Ga0495680_0025994 | 3300047322 | Bacteria | 4835 |
| 1084 | Ga0495680_0026513 | 3300047322 | Bacteria | 4775 |
| 1085 | Ga0495680_0049430 | 3300047322 | Bacteria | 3293 |
| 1086 | Ga0495680_0069978 | 3300047322 | Bacteria | 2676 |
| 1087 | Ga0495680_0179285 | 3300047322 | Bacteria | 1530 |
| 1088 | Ga0495675_0000245 | 3300047444 | Bacteria | 39142 |
| 1089 | Ga0495677_0094565 | 3300047445 | Bacteria | 1128 |
| 1090 | Ga0495679_027413 | 3300047446 | Bacteria | 1879 |
| 1091 | Ga0495679_033413 | 3300047446 | Bacteria | 1644 |
| 1092 | Ga0495673_0075718 | 3300047469 | Bacteria | 1405 |
| 1093 | Ga0495684_0000016 | 3300047471 | Bacteria | 169338 |
| 1094 | Ga0495684_0000928 | 3300047471 | Bacteria | 23791 |
| 1095 | Ga0495684_0001073 | 3300047471 | Bacteria | 22129 |
| 1096 | Ga0495684_0001824 | 3300047471 | Bacteria | 17119 |
| 1097 | Ga0495684_0056185 | 3300047471 | Bacteria | 3001 |
| 1098 | Ga0495684_0175543 | 3300047471 | Bacteria | 1591 |
| 1099 | Ga0495684_0364734 | 3300047471 | Bacteria | 1022 |
| 1100 | Ga0495686_0001995 | 3300047472 | Bacteria | 20251 |
| 1101 | Ga0495593_0000809 | 3300047673 | Bacteria | 18103 |
| 1102 | Ga0495593_0001500 | 3300047673 | Bacteria | 13713 |
| 1103 | Ga0495593_0004700 | 3300047673 | Bacteria | 8121 |
| 1104 | Ga0495593_0033052 | 3300047673 | Bacteria | 2818 |
| 1105 | Ga0495593_0061049 | 3300047673 | Bacteria | 1972 |
| 1106 | Ga0495593_0082694 | 3300047673 | Bacteria | 1659 |
| 1107 | Ga0495602_0000024 | 3300048088 | Bacteria | 151162 |
| 1108 | Ga0495602_0005919 | 3300048088 | Bacteria | 12839 |
| 1109 | Ga0495602_0021956 | 3300048088 | Bacteria | 6260 |
| 1110 | Ga0495614_0003207 | 3300048089 | Bacteria | 7303 |
| 1111 | Ga0496100_0002405 | 3300048903 | Bacteria | 9481 |
| 1112 | Ga0496100_0003039 | 3300048903 | Bacteria | 8659 |
| 1113 | Ga0496100_0016920 | 3300048903 | Bacteria | 4291 |
| 1114 | Ga0496100_0050540 | 3300048903 | Bacteria | 2694 |
| 1115 | Ga0496100_0200898 | 3300048903 | Bacteria | 1453 |
| 1116 | Ga0496100_0384940 | 3300048903 | Bacteria | 1066 |
| 1117 | Ga0496101_0001763 | 3300048904 | Bacteria | 12984 |
| 1118 | Ga0496101_0003783 | 3300048904 | Bacteria | 9451 |
| 1119 | Ga0496101_0015757 | 3300048904 | Bacteria | 5102 |
| 1120 | Ga0496101_0044395 | 3300048904 | Bacteria | 3180 |
| 1121 | Ga0496101_0060405 | 3300048904 | Bacteria | 2750 |
| 1122 | Ga0496101_0134347 | 3300048904 | Bacteria | 1881 |
| 1123 | Ga0496101_0178331 | 3300048904 | Bacteria | 1635 |
| 1124 | Ga0496101_0235241 | 3300048904 | Bacteria | 1425 |
| 1125 | Ga0496101_0321250 | 3300048904 | Bacteria | 1214 |
| 1126 | Ga0496101_0413151 | 3300048904 | Bacteria | 1063 |
| 1127 | Ga0496102_0001184 | 3300048905 | Bacteria | 23693 |
| 1128 | Ga0496102_0005532 | 3300048905 | Bacteria | 10730 |
| 1129 | Ga0496102_0011515 | 3300048905 | Bacteria | 7628 |
| 1130 | Ga0496102_0112166 | 3300048905 | Bacteria | 2543 |
| 1131 | Ga0496102_0129686 | 3300048905 | Bacteria | 2359 |
| 1132 | Ga0496103_0003142 | 3300048906 | Bacteria | 10157 |
| 1133 | Ga0496103_0005741 | 3300048906 | Bacteria | 7414 |
| 1134 | Ga0496103_0009796 | 3300048906 | Bacteria | 5674 |
| 1135 | Ga0496103_0010831 | 3300048906 | Bacteria | 5397 |
| 1136 | Ga0496103_0022961 | 3300048906 | Bacteria | 3760 |
| 1137 | Ga0496103_0051842 | 3300048906 | Bacteria | 2540 |
| 1138 | Ga0496104_0000217 | 3300048907 | Bacteria | 50667 |
| 1139 | Ga0496104_0001112 | 3300048907 | Bacteria | 22984 |
| 1140 | Ga0496104_0001920 | 3300048907 | Bacteria | 18014 |
| 1141 | Ga0496104_0002202 | 3300048907 | Bacteria | 16864 |
| 1142 | Ga0496104_0010108 | 3300048907 | Bacteria | 8424 |
| 1143 | Ga0496104_0041321 | 3300048907 | Bacteria | 4324 |
| 1144 | Ga0496104_0043848 | 3300048907 | Bacteria | 4201 |
| 1145 | Ga0496104_0107613 | 3300048907 | Bacteria | 2672 |
| 1146 | Ga0496104_0111996 | 3300048907 | Bacteria | 2617 |
| 1147 | Ga0496104_0140324 | 3300048907 | Bacteria | 2321 |
| 1148 | Ga0496104_0292062 | 3300048907 | Bacteria | 1543 |
| 1149 | Ga0496105_0000424 | 3300048908 | Bacteria | 27799 |
| 1150 | Ga0496105_0008853 | 3300048908 | Bacteria | 7842 |
| 1151 | Ga0496105_0010753 | 3300048908 | Bacteria | 7205 |
| 1152 | Ga0496105_0020488 | 3300048908 | Bacteria | 5344 |
| 1153 | Ga0496105_0066987 | 3300048908 | Bacteria | 2965 |
| 1154 | Ga0496105_0090307 | 3300048908 | Bacteria | 2530 |
| 1155 | Ga0496105_0250926 | 3300048908 | Bacteria | 1433 |
| 1156 | Ga0496106_0001028 | 3300048909 | Bacteria | 20530 |
| 1157 | Ga0496106_0005882 | 3300048909 | Bacteria | 9068 |
| 1158 | Ga0496106_0007383 | 3300048909 | Bacteria | 8123 |
| 1159 | Ga0496106_0008421 | 3300048909 | Bacteria | 7629 |
| 1160 | Ga0496106_0017304 | 3300048909 | Bacteria | 5336 |
| 1161 | Ga0496106_0026339 | 3300048909 | Bacteria | 4329 |
| 1162 | Ga0496106_0026733 | 3300048909 | Bacteria | 4297 |
| 1163 | Ga0496106_0253802 | 3300048909 | Bacteria | 1406 |
| 1164 | Ga0496107_0000509 | 3300048910 | Bacteria | 21565 |
| 1165 | Ga0496107_0003427 | 3300048910 | Bacteria | 10601 |
| 1166 | Ga0496107_0014192 | 3300048910 | Bacteria | 5578 |
| 1167 | Ga0496107_0019213 | 3300048910 | Bacteria | 4821 |
| 1168 | Ga0496107_0040165 | 3300048910 | Bacteria | 3357 |
| 1169 | Ga0496107_0099576 | 3300048910 | Bacteria | 2130 |
| 1170 | Ga0496107_0222569 | 3300048910 | Bacteria | 1404 |
| 1171 | Ga0496107_0229736 | 3300048910 | Bacteria | 1380 |
| 1172 | Ga0496107_0371454 | 3300048910 | Bacteria | 1064 |
| 1173 | Ga0496108_0010986 | 3300048911 | Bacteria | 7354 |
| 1174 | Ga0496108_0012311 | 3300048911 | Bacteria | 6958 |
| 1175 | Ga0496108_0062932 | 3300048911 | Bacteria | 3124 |
| 1176 | Ga0496108_0080066 | 3300048911 | Bacteria | 2766 |
| 1177 | Ga0496108_0154080 | 3300048911 | Bacteria | 1984 |
| 1178 | Ga0496108_0253034 | 3300048911 | Bacteria | 1532 |
| 1179 | Ga0496108_0319159 | 3300048911 | Bacteria | 1354 |
| 1180 | Ga0496109_0001304 | 3300048912 | Bacteria | 20607 |
| 1181 | Ga0496109_0006308 | 3300048912 | Bacteria | 9983 |
| 1182 | Ga0496109_0013194 | 3300048912 | Bacteria | 7151 |
| 1183 | Ga0496109_0016348 | 3300048912 | Bacteria | 6484 |
| 1184 | Ga0496109_0017528 | 3300048912 | Bacteria | 6278 |
| 1185 | Ga0496109_0066202 | 3300048912 | Bacteria | 3307 |
| 1186 | Ga0496109_0119756 | 3300048912 | Bacteria | 2451 |
| 1187 | Ga0496109_0122629 | 3300048912 | Bacteria | 2421 |
| 1188 | Ga0496110_0000973 | 3300048913 | Bacteria | 20082 |
| 1189 | Ga0496110_0002430 | 3300048913 | Bacteria | 13955 |
| 1190 | Ga0496110_0003313 | 3300048913 | Bacteria | 12303 |
| 1191 | Ga0496110_0005366 | 3300048913 | Bacteria | 10043 |
| 1192 | Ga0496110_0009961 | 3300048913 | Bacteria | 7709 |
| 1193 | Ga0496110_0014024 | 3300048913 | Bacteria | 6642 |
| 1194 | Ga0496110_0034472 | 3300048913 | Bacteria | 4384 |
| 1195 | Ga0496110_0045595 | 3300048913 | Bacteria | 3833 |
| 1196 | Ga0496110_0075530 | 3300048913 | Bacteria | 2994 |
| 1197 | Ga0496110_0097096 | 3300048913 | Bacteria | 2640 |
| 1198 | Ga0496110_0098571 | 3300048913 | Bacteria | 2619 |
| 1199 | Ga0496110_0111838 | 3300048913 | Bacteria | 2455 |
| 1200 | Ga0496110_0127002 | 3300048913 | Bacteria | 2301 |
| 1201 | Ga0496110_0218297 | 3300048913 | Bacteria | 1734 |
| 1202 | Ga0496111_0000315 | 3300048914 | Bacteria | 23917 |
| 1203 | Ga0496111_0002323 | 3300048914 | Bacteria | 11453 |
| 1204 | Ga0496111_0003314 | 3300048914 | Bacteria | 9963 |
| 1205 | Ga0496111_0003533 | 3300048914 | Bacteria | 9672 |
| 1206 | Ga0496111_0011769 | 3300048914 | Bacteria | 5906 |
| 1207 | Ga0496111_0042567 | 3300048914 | Bacteria | 3261 |
| 1208 | Ga0496111_0044287 | 3300048914 | Bacteria | 3199 |
| 1209 | Ga0496111_0047206 | 3300048914 | Bacteria | 3101 |
| 1210 | Ga0496111_0055762 | 3300048914 | Bacteria | 2858 |
| 1211 | Ga0496111_0063460 | 3300048914 | Bacteria | 2679 |
| 1212 | Ga0496111_0063536 | 3300048914 | Bacteria | 2677 |
| 1213 | Ga0496111_0103789 | 3300048914 | Bacteria | 2091 |
| 1214 | Ga0496112_0009043 | 3300048915 | Bacteria | 8947 |
| 1215 | Ga0496112_0013631 | 3300048915 | Bacteria | 7511 |
| 1216 | Ga0496112_0015062 | 3300048915 | Bacteria | 7200 |
| 1217 | Ga0496112_0022357 | 3300048915 | Bacteria | 6026 |
| 1218 | Ga0496112_0054415 | 3300048915 | Bacteria | 3932 |
| 1219 | Ga0496112_0090794 | 3300048915 | Bacteria | 3023 |
| 1220 | Ga0496112_0090957 | 3300048915 | Bacteria | 3020 |
| 1221 | Ga0496112_0121718 | 3300048915 | Bacteria | 2579 |
| 1222 | Ga0496113_0000218 | 3300048916 | Bacteria | 26800 |
| 1223 | Ga0496113_0008621 | 3300048916 | Bacteria | 6650 |
| 1224 | Ga0496113_0011117 | 3300048916 | Bacteria | 5989 |
| 1225 | Ga0496113_0014177 | 3300048916 | Bacteria | 5429 |
| 1226 | Ga0496113_0026670 | 3300048916 | Bacteria | 4134 |
| 1227 | Ga0496113_0055008 | 3300048916 | Bacteria | 2982 |
| 1228 | Ga0496113_0126245 | 3300048916 | Bacteria | 2004 |
| 1229 | Ga0496114_0001306 | 3300048917 | Bacteria | 18867 |
| 1230 | Ga0496114_0011259 | 3300048917 | Bacteria | 7142 |
| 1231 | Ga0496114_0014735 | 3300048917 | Bacteria | 6283 |
| 1232 | Ga0496114_0044883 | 3300048917 | Bacteria | 3669 |
| 1233 | Ga0496114_0076917 | 3300048917 | Bacteria | 2813 |
| 1234 | Ga0496114_0077791 | 3300048917 | Bacteria | 2797 |
| 1235 | Ga0496114_0098426 | 3300048917 | Bacteria | 2494 |
| 1236 | Ga0496114_0210099 | 3300048917 | Bacteria | 1707 |
| 1237 | Ga0496115_0011530 | 3300048918 | Bacteria | 6627 |
| 1238 | Ga0496115_0014069 | 3300048918 | Bacteria | 6057 |
| 1239 | Ga0496115_0039477 | 3300048918 | Bacteria | 3749 |
| 1240 | Ga0496115_0042694 | 3300048918 | Bacteria | 3613 |
| 1241 | Ga0496115_0047308 | 3300048918 | Bacteria | 3439 |
| 1242 | Ga0496115_0063814 | 3300048918 | Bacteria | 2972 |
| 1243 | Ga0496115_0104992 | 3300048918 | Bacteria | 2318 |
| 1244 | Ga0496115_0245420 | 3300048918 | Bacteria | 1475 |
| 1245 | Ga0496115_0271854 | 3300048918 | Bacteria | 1392 |
| 1246 | Ga0496118_0029210 | 3300048921 | Bacteria | 4628 |
| 1247 | Ga0496119_0002669 | 3300048922 | Bacteria | 19295 |
| 1248 | Ga0496121_0007863 | 3300048924 | Bacteria | 12751 |
| 1249 | Ga0496121_0013732 | 3300048924 | Bacteria | 8677 |
| 1250 | Ga0496121_0039594 | 3300048924 | Bacteria | 4149 |
| 1251 | Ga0496122_0002391 | 3300048925 | Bacteria | 26802 |
| 1252 | Ga0496123_0003029 | 3300048926 | Bacteria | 19369 |
| 1253 | Ga0496126_0263095 | 3300048929 | Bacteria | 1434 |
| 1254 | Ga0501032_0289553 | 3300049569 | Bacteria | 1060 |
| 1255 | Ga0501033_0010955 | 3300049570 | Bacteria | 6950 |
| 1256 | Ga0501033_0060740 | 3300049570 | Bacteria | 2787 |
| 1257 | Ga0501033_0077246 | 3300049570 | Bacteria | 2443 |
| 1258 | Ga0501033_0223876 | 3300049570 | Bacteria | 1338 |
| 1259 | Ga0501034_0000593 | 3300049571 | Bacteria | 57233 |
| 1260 | Ga0501034_0003588 | 3300049571 | Bacteria | 17615 |
| 1261 | Ga0501034_0074896 | 3300049571 | Bacteria | 3392 |
| 1262 | Ga0501034_0098547 | 3300049571 | Bacteria | 2918 |
| 1263 | Ga0501034_0116919 | 3300049571 | Bacteria | 2654 |
| 1264 | Ga0501034_0508197 | 3300049571 | Bacteria | 1118 |
| 1265 | Ga0501036_0001313 | 3300049572 | Bacteria | 19069 |
| 1266 | Ga0501036_0042140 | 3300049572 | Bacteria | 3865 |
| 1267 | Ga0501036_0081419 | 3300049572 | Bacteria | 2736 |
| 1268 | Ga0501036_0126272 | 3300049572 | Bacteria | 2160 |
| 1269 | Ga0501036_0178315 | 3300049572 | Bacteria | 1789 |
| 1270 | Ga0501036_0263095 | 3300049572 | Bacteria | 1445 |
| 1271 | Ga0501037_0016752 | 3300049573 | Bacteria | 5392 |
| 1272 | Ga0501037_0021673 | 3300049573 | Bacteria | 4751 |
| 1273 | Ga0501037_0046626 | 3300049573 | Bacteria | 3178 |
| 1274 | Ga0501037_0098724 | 3300049573 | Bacteria | 2109 |
| 1275 | Ga0501038_0007428 | 3300049574 | Bacteria | 10112 |
| 1276 | Ga0501038_0063407 | 3300049574 | Bacteria | 3154 |
| 1277 | Ga0501038_0076825 | 3300049574 | Bacteria | 2821 |
| 1278 | Ga0501038_0264128 | 3300049574 | Bacteria | 1359 |
| 1279 | Ga0501038_0303510 | 3300049574 | Bacteria | 1252 |
| 1280 | Ga0501039_0022541 | 3300049575 | Bacteria | 4834 |
| 1281 | Ga0501039_0069025 | 3300049575 | Bacteria | 2744 |
| 1282 | Ga0501039_0084247 | 3300049575 | Bacteria | 2476 |
| 1283 | Ga0501039_0130674 | 3300049575 | Bacteria | 1971 |
| 1284 | Ga0501039_0314428 | 3300049575 | Bacteria | 1231 |
| 1285 | Ga0501040_0032088 | 3300049576 | Bacteria | 3553 |
| 1286 | Ga0501040_0222102 | 3300049576 | Bacteria | 1344 |
| 1287 | Ga0501041_0058110 | 3300049577 | Bacteria | 2366 |
| 1288 | Ga0501041_0094593 | 3300049577 | Bacteria | 1846 |
| 1289 | Ga0501042_0114506 | 3300049578 | Bacteria | 1942 |
| 1290 | Ga0501042_0195303 | 3300049578 | Bacteria | 1459 |
| 1291 | Ga0501043_0032193 | 3300049579 | Bacteria | 4121 |
| 1292 | Ga0501043_0063574 | 3300049579 | Bacteria | 2898 |
| 1293 | Ga0501043_0083864 | 3300049579 | Bacteria | 2505 |
| 1294 | Ga0501043_0102847 | 3300049579 | Bacteria | 2245 |
| 1295 | Ga0501046_0002900 | 3300049580 | Bacteria | 15897 |
| 1296 | Ga0501046_0005890 | 3300049580 | Bacteria | 10927 |
| 1297 | Ga0501046_0127900 | 3300049580 | Bacteria | 1928 |
| 1298 | Ga0501046_0247967 | 3300049580 | Bacteria | 1312 |
| 1299 | Ga0501047_0001425 | 3300049581 | Bacteria | 23479 |
| 1300 | Ga0501047_0022734 | 3300049581 | Bacteria | 6021 |
| 1301 | Ga0501047_0048449 | 3300049581 | Bacteria | 4103 |
| 1302 | Ga0501047_0097901 | 3300049581 | Bacteria | 2811 |
| 1303 | Ga0501047_0126688 | 3300049581 | Bacteria | 2434 |
| 1304 | Ga0501047_0128295 | 3300049581 | Bacteria | 2416 |
| 1305 | Ga0501047_0131968 | 3300049581 | Bacteria | 2378 |
| 1306 | Ga0501048_0001752 | 3300049582 | Bacteria | 16493 |
| 1307 | Ga0501048_0015643 | 3300049582 | Bacteria | 5599 |
| 1308 | Ga0501048_0047698 | 3300049582 | Bacteria | 3056 |
| 1309 | Ga0501048_0073887 | 3300049582 | Bacteria | 2406 |
| 1310 | Ga0501048_0193556 | 3300049582 | Bacteria | 1441 |
| 1311 | Ga0501048_0281688 | 3300049582 | Bacteria | 1182 |
| 1312 | Ga0501067_0023420 | 3300049583 | Bacteria | 3422 |
| 1313 | Ga0501069_0003119 | 3300049585 | Bacteria | 8495 |
| 1314 | Ga0501070_0020547 | 3300049586 | Bacteria | 5538 |
| 1315 | Ga0501070_0056637 | 3300049586 | Bacteria | 3249 |
| 1316 | Ga0501070_0094072 | 3300049586 | Bacteria | 2479 |
| 1317 | Ga0501070_0114437 | 3300049586 | Bacteria | 2228 |
| 1318 | Ga0501070_0141509 | 3300049586 | Bacteria | 1986 |
| 1319 | Ga0501070_0166139 | 3300049586 | Bacteria | 1819 |
| 1320 | Ga0501071_0050928 | 3300049587 | Bacteria | 2983 |
| 1321 | Ga0501071_0143544 | 3300049587 | Bacteria | 1779 |
| 1322 | Ga0501071_0222903 | 3300049587 | Bacteria | 1419 |
| 1323 | Ga0501072_0040845 | 3300049588 | Bacteria | 3643 |
| 1324 | Ga0501072_0074044 | 3300049588 | Bacteria | 2693 |
| 1325 | Ga0501072_0088508 | 3300049588 | Bacteria | 2457 |
| 1326 | Ga0501072_0111280 | 3300049588 | Bacteria | 2180 |
| 1327 | Ga0501073_0060235 | 3300049589 | Bacteria | 2649 |
| 1328 | Ga0501073_0063745 | 3300049589 | Bacteria | 2570 |
| 1329 | Ga0501074_0003293 | 3300049590 | Bacteria | 11426 |
| 1330 | Ga0501074_0053538 | 3300049590 | Bacteria | 2910 |
| 1331 | Ga0501074_0085454 | 3300049590 | Bacteria | 2261 |
| 1332 | Ga0501075_0135541 | 3300049591 | Bacteria | 1876 |
| 1333 | Ga0501075_0207424 | 3300049591 | Bacteria | 1495 |
| 1334 | Ga0501075_0351370 | 3300049591 | Bacteria | 1123 |
| 1335 | Ga0501076_0050078 | 3300049592 | Bacteria | 3304 |
| 1336 | Ga0501076_0091065 | 3300049592 | Bacteria | 2453 |
| 1337 | Ga0501076_0124978 | 3300049592 | Bacteria | 2084 |
| 1338 | Ga0501076_0308837 | 3300049592 | Bacteria | 1297 |
| 1339 | Ga0501077_0019666 | 3300049593 | Bacteria | 4271 |
| 1340 | Ga0501077_0085097 | 3300049593 | Bacteria | 2004 |
| 1341 | Ga0501077_0090493 | 3300049593 | Bacteria | 1939 |
| 1342 | Ga0501079_0005101 | 3300049741 | Bacteria | 9754 |
| 1343 | Ga0501079_0066375 | 3300049741 | Bacteria | 2784 |
| 1344 | Ga0501079_0085626 | 3300049741 | Bacteria | 2439 |
| 1345 | Ga0501079_0219527 | 3300049741 | Bacteria | 1485 |
| 1346 | Ga0501079_0402719 | 3300049741 | Bacteria | 1073 |
| 1347 | Ga0501079_0578200 | 3300049741 | Bacteria | 884 |
| 1348 | Ga0501080_0002905 | 3300049742 | Bacteria | 15074 |
| 1349 | Ga0501080_0007783 | 3300049742 | Bacteria | 9688 |
| 1350 | Ga0501080_0015270 | 3300049742 | Bacteria | 7079 |
| 1351 | Ga0501080_0025023 | 3300049742 | Bacteria | 5538 |
| 1352 | Ga0501080_0027138 | 3300049742 | Bacteria | 5325 |
| 1353 | Ga0501080_0081094 | 3300049742 | Bacteria | 3015 |
| 1354 | Ga0501080_0092084 | 3300049742 | Bacteria | 2816 |
| 1355 | Ga0501080_0303916 | 3300049742 | Bacteria | 1446 |
| 1356 | Ga0501081_0000115 | 3300049743 | Bacteria | 34620 |
| 1357 | Ga0501081_0041663 | 3300049743 | Bacteria | 3145 |
| 1358 | Ga0501081_0065915 | 3300049743 | Bacteria | 2518 |
| 1359 | Ga0501083_0000907 | 3300049744 | Bacteria | 19630 |
| 1360 | Ga0501083_0051915 | 3300049744 | Bacteria | 2756 |
| 1361 | Ga0501083_0066550 | 3300049744 | Bacteria | 2399 |
| 1362 | Ga0501083_0137240 | 3300049744 | Bacteria | 1602 |
| 1363 | Ga0501035_0000672 | 3300049822 | Bacteria | 37408 |
| 1364 | Ga0501035_0129635 | 3300049822 | Bacteria | 2199 |
| 1365 | Ga0501035_0140538 | 3300049822 | Bacteria | 2100 |
| 1366 | Ga0501035_0222623 | 3300049822 | Bacteria | 1610 |
| 1367 | Ga0501035_0385350 | 3300049822 | Bacteria | 1168 |
| 1368 | Ga0501044_0003604 | 3300049823 | Bacteria | 17424 |
| 1369 | Ga0501044_0005514 | 3300049823 | Bacteria | 14047 |
| 1370 | Ga0501044_0011063 | 3300049823 | Bacteria | 9787 |
| 1371 | Ga0501044_0036817 | 3300049823 | Bacteria | 5118 |
| 1372 | Ga0501044_0312533 | 3300049823 | Bacteria | 1497 |
| 1373 | Ga0501045_0036085 | 3300049824 | Bacteria | 3590 |
| 1374 | Ga0501045_0069102 | 3300049824 | Bacteria | 2596 |
| 1375 | nmdc:mga03683_111459_c1 | 3300050489 | Bacteria | 1210 |
| 1376 | nmdc:mga03683_2647_c2 | 3300050489 | Bacteria | 3463 |
| 1377 | nmdc:mga0yw44_103397_c1 | 3300050492 | Bacteria | 1817 |
| 1378 | nmdc:mga0yw44_78820_c1 | 3300050492 | Bacteria | 2060 |
| 1379 | nmdc:mga0k408_17687_c1 | 3300050493 | Bacteria | 3503 |
| 1380 | nmdc:mga0k408_6014_c1 | 3300050493 | Bacteria | 6474 |
| 1381 | nmdc:mga06z11_68606_c1 | 3300050494 | Bacteria | 1869 |
| 1382 | nmdc:mga07m45_14790_c1 | 3300050496 | Bacteria | 4166 |
| 1383 | nmdc:mga07m45_69058_c1 | 3300050496 | Bacteria | 2009 |
| 1384 | nmdc:mga05p37_151_c1 | 3300050507 | Bacteria | 65585 |
| 1385 | nmdc:mga05p37_158006_c1 | 3300050507 | Bacteria | 2770 |
| 1386 | nmdc:mga05p37_19658_c1 | 3300050507 | Bacteria | 8171 |
| 1387 | nmdc:mga05p37_205256_c1 | 3300050507 | Bacteria | 2384 |
| 1388 | nmdc:mga05p37_354005_c1 | 3300050507 | Bacteria | 1728 |
| 1389 | nmdc:mga05p37_486326_c1 | 3300050507 | Bacteria | 1420 |
| 1390 | nmdc:mga05p37_7272_c1 | 3300050507 | Bacteria | 13063 |
| 1391 | nmdc:mga05p37_76_c1 | 3300050507 | Bacteria | 86726 |
| 1392 | nmdc:mga05p37_835274_c1 | 3300050507 | Bacteria | 1003 |
| 1393 | nmdc:mga09592_41035_c1 | 3300050508 | Bacteria | 3890 |
| 1394 | nmdc:mga09592_6099_c1 | 3300050508 | Bacteria | 9821 |
| 1395 | nmdc:mga0qj67_61979_c1 | 3300050509 | Bacteria | 2971 |
| 1396 | nmdc:mga0qj67_842_c1 | 3300050509 | Bacteria | 21012 |
| 1397 | nmdc:mga06r32_114164_c1 | 3300050510 | Bacteria | 2659 |
| 1398 | nmdc:mga06r32_134_c1 | 3300050510 | Bacteria | 54737 |
| 1399 | nmdc:mga06r32_41813_c1 | 3300050510 | Bacteria | 4356 |
| 1400 | nmdc:mga06r32_755_c1 | 3300050510 | Bacteria | 28474 |
| 1401 | nmdc:mga06r32_95862_c1 | 3300050510 | Bacteria | 2904 |
| 1402 | nmdc:mga08y16_108_c1 | 3300050511 | Bacteria | 69804 |
| 1403 | nmdc:mga08y16_11999_c1 | 3300050511 | Bacteria | 9100 |
| 1404 | nmdc:mga08y16_13020_c1 | 3300050511 | Bacteria | 8754 |
| 1405 | nmdc:mga08y16_16965_c1 | 3300050511 | Bacteria | 7667 |
| 1406 | nmdc:mga08y16_178114_c1 | 3300050511 | Bacteria | 2208 |
| 1407 | nmdc:mga08y16_204344_c1 | 3300050511 | Bacteria | 2047 |
| 1408 | nmdc:mga08y16_294692_c1 | 3300050511 | Bacteria | 1672 |
| 1409 | nmdc:mga08y16_376567_c1 | 3300050511 | Bacteria | 1455 |
| 1410 | nmdc:mga08y16_4279_c1 | 3300050511 | Bacteria | 14901 |
| 1411 | nmdc:mga08y16_5583_c1 | 3300050511 | Bacteria | 13179 |
| 1412 | nmdc:mga08y16_88424_c1 | 3300050511 | Bacteria | 3229 |
| 1413 | nmdc:mga0n895_265_c1 | 3300050512 | Bacteria | 34107 |
| 1414 | nmdc:mga0n895_2675_c1 | 3300050512 | Bacteria | 14060 |
| 1415 | nmdc:mga0n895_2995_c1 | 3300050512 | Bacteria | 13410 |
| 1416 | nmdc:mga0n895_30642_c1 | 3300050512 | Bacteria | 5143 |
| 1417 | nmdc:mga0n895_35580_c1 | 3300050512 | Bacteria | 4802 |
| 1418 | nmdc:mga0n895_363615_c1 | 3300050512 | Bacteria | 1465 |
| 1419 | nmdc:mga0rr50_362627_c1 | 3300050513 | Bacteria | 1220 |
| 1420 | nmdc:mga0rr50_60567_c1 | 3300050513 | Bacteria | 2848 |
| 1421 | nmdc:mga0rr50_642_c1 | 3300050513 | Bacteria | 18790 |
| 1422 | nmdc:mga08x19_35_c1 | 3300050514 | Bacteria | 185171 |
| 1423 | nmdc:mga08x19_8004_c1 | 3300050514 | Bacteria | 6281 |
| 1424 | nmdc:mga0a205_1049_c1 | 3300050515 | Bacteria | 23004 |
| 1425 | nmdc:mga0a205_146_c1 | 3300050515 | Bacteria | 45616 |
| 1426 | nmdc:mga0a205_315959_c1 | 3300050515 | Bacteria | 1433 |
| 1427 | nmdc:mga0a205_464753_c1 | 3300050515 | Bacteria | 1125 |
| 1428 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 1429 | Ga0495601_0000355 | 3300053077 | Bacteria | 24059 |
| 1430 | Ga0495601_0000589 | 3300053077 | Bacteria | 19331 |
| 1431 | Ga0495601_0002218 | 3300053077 | Bacteria | 10937 |
| 1432 | Ga0495601_0027567 | 3300053077 | Bacteria | 3512 |
| 1433 | Ga0495601_0041071 | 3300053077 | Bacteria | 2899 |
| 1434 | Ga0495601_0052633 | 3300053077 | Bacteria | 2571 |
| 1435 | Ga0495601_0174202 | 3300053077 | Bacteria | 1406 |
| 1436 | Ga0495612_0000017 | 3300053078 | Bacteria | 152112 |
| 1437 | Ga0495612_0001305 | 3300053078 | Bacteria | 10290 |
| 1438 | Ga0495612_0002281 | 3300053078 | Bacteria | 7892 |
| 1439 | Ga0495612_0002637 | 3300053078 | Bacteria | 7395 |
| 1440 | Ga0495612_0005030 | 3300053078 | Bacteria | 5474 |
| 1441 | Ga0495612_0030943 | 3300053078 | Bacteria | 2157 |
| 1442 | Ga0495595_0000010 | 3300053084 | Bacteria | 178819 |
| 1443 | Ga0495595_0002470 | 3300053084 | Bacteria | 7231 |
| 1444 | Ga0495595_0005994 | 3300053084 | Bacteria | 4935 |
| 1445 | Ga0495595_0010133 | 3300053084 | Bacteria | 3913 |
| 1446 | Ga0495595_0010381 | 3300053084 | Bacteria | 3869 |
| 1447 | Ga0495595_0027953 | 3300053084 | Bacteria | 2515 |
| 1448 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 1449 | Ga0495619_0000048 | 3300053085 | Bacteria | 102117 |
| 1450 | Ga0495619_0000256 | 3300053085 | Bacteria | 38697 |
| 1451 | Ga0495619_0004051 | 3300053085 | Bacteria | 9387 |
| 1452 | Ga0495619_0005443 | 3300053085 | Bacteria | 8068 |
| 1453 | Ga0495619_0007179 | 3300053085 | Bacteria | 7058 |
| 1454 | Ga0495619_0016131 | 3300053085 | Bacteria | 4728 |
| 1455 | Ga0495619_0024473 | 3300053085 | Bacteria | 3872 |
| 1456 | Ga0495619_0027188 | 3300053085 | Bacteria | 3685 |
| 1457 | Ga0495619_0108884 | 3300053085 | Bacteria | 1891 |
| 1458 | Ga0495619_0131097 | 3300053085 | Bacteria | 1723 |
| 1459 | Ga0500644_0000933 | 3300053088 | Bacteria | 9264 |
| 1460 | Ga0500651_0037963 | 3300053093 | Bacteria | 3035 |
| 1461 | Ga0500651_0102768 | 3300053093 | Bacteria | 1751 |
| 1462 | Ga0500641_0019072 | 3300053096 | Bacteria | 2590 |
| 1463 | Ga0500650_0044577 | 3300053098 | Bacteria | 2053 |
| 1464 | Ga0500555_016514 | 3300053103 | Bacteria | 2127 |
| 1465 | Ga0500556_0000068 | 3300053104 | Bacteria | 103123 |
| 1466 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 1467 | Ga0500595_003914 | 3300053119 | Bacteria | 6824 |
| 1468 | Ga0500595_026787 | 3300053119 | Bacteria | 1982 |
| 1469 | Ga0500652_001172 | 3300053131 | Bacteria | 8365 |
| 1470 | Ga0500652_039202 | 3300053131 | Bacteria | 1899 |
| 1471 | Ga0500652_068971 | 3300053131 | Bacteria | 1463 |
| 1472 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1473 | Ga0500616_0004397 | 3300053153 | Bacteria | 10067 |
| 1474 | Ga0500616_0034790 | 3300053153 | Bacteria | 2743 |
| 1475 | Ga0500616_0089834 | 3300053153 | Bacteria | 1524 |
| 1476 | Ga0500622_0138552 | 3300053156 | Bacteria | 1163 |
| 1477 | Ga0500645_000078 | 3300053730 | Bacteria | 76931 |
| 1478 | Ga0500645_008422 | 3300053730 | Bacteria | 3523 |
| 1479 | Ga0501084_0009668 | 3300054114 | Bacteria | 7977 |
| 1480 | Ga0501084_0034716 | 3300054114 | Bacteria | 4217 |
| 1481 | Ga0501084_0128439 | 3300054114 | Bacteria | 2133 |
| 1482 | Ga0501084_0287667 | 3300054114 | Bacteria | 1388 |
| 1483 | Ga0501084_0307775 | 3300054114 | Bacteria | 1338 |
| 1484 | Ga0501084_0332364 | 3300054114 | Bacteria | 1283 |
| 1485 | Ga0501082_0000510 | 3300060353 | Bacteria | 34491 |
| 1486 | Ga0501082_0030402 | 3300060353 | Bacteria | 4654 |
| 1487 | Ga0501082_0038034 | 3300060353 | Bacteria | 4150 |
| 1488 | Ga0501082_0051708 | 3300060353 | Bacteria | 3541 |
| 1489 | Ga0501082_0063448 | 3300060353 | Bacteria | 3181 |
| 1490 | Ga0501082_0095928 | 3300060353 | Bacteria | 2563 |
| 1491 | Ga0501082_0429790 | 3300060353 | Bacteria | 1153 |
| 1492 | Ga0530510_0037742 | 3300061734 | Bacteria | 3486 |
| 1493 | Ga0530510_0114950 | 3300061734 | Bacteria | 1972 |
| 1494 | Ga0530510_0262622 | 3300061734 | Bacteria | 1288 |
| 1495 | 2513635471 | 2513237093 | Bacteria | 7545552 |
| 1496 | 2514014860 | 2513237161 | Bacteria | 8871253 |
| 1497 | 2515628579 | 2515154112 | Bacteria | 8294334 |
| 1498 | 2523382649 | 2523231044 | Bacteria | 6434991 |
| 1499 | 2524465008 | 2524023210 | Bacteria | 9029266 |
| 1500 | 2535520930 | 2534681796 | Bacteria | 7146037 |
| 1501 | 2644291236 | 2643221651 | Bacteria | 4798932 |
| 1502 | 2838685997 | 2838680041 | Bacteria | 6545511 |
| 1503 | 2838687808 | 2838686498 | Bacteria | 7807632 |
| 1504 | 2838699640 | 2838694306 | Bacteria | 6853137 |
| 1505 | 2838713059 | 2838707686 | Bacteria | 6619912 |
| 1506 | 2842082555 | 2842077413 | Bacteria | 6508645 |
| 1507 | 2842123309 | 2842118031 | Bacteria | 7033875 |
| 1508 | 2842242245 | 2842237096 | Bacteria | 6620661 |
| 1509 | 2842272161 | 2842271015 | Bacteria | 7807131 |
| 1510 | 2842296311 | 2842291075 | Bacteria | 7076806 |
| 1511 | 2842375260 | 2842370503 | Bacteria | 7038661 |
| 1512 | 2842382863 | 2842377471 | Bacteria | 7140707 |
| 1513 | 2842389422 | 2842384541 | Bacteria | 7057858 |
| 1514 | 2844462284 | 2844454524 | Bacteria | 7952546 |
| 1515 | 2874594804 | 2874590934 | Bacteria | 8299676 |
| 1516 | 2876774354 | 2876771140 | Bacteria | 8287509 |
| 1517 | 2876822856 | 2876818435 | Bacteria | 8274608 |
| 1518 | 2879078509 | 2879074833 | Bacteria | 8279565 |
| 1519 | 2879129830 | 2879127579 | Bacteria | 8294491 |
| 1520 | 2879146155 | 2879142872 | Bacteria | 8267021 |
| 1521 | 2919453271 | 2919450847 | Bacteria | 5631160 |
| 1522 | 2919717988 | 2919713450 | Bacteria | 7431245 |
| 1523 | 2935899207 | 2935894831 | Bacteria | 6620579 |
| 1524 | 639651250 | 639633055 | Bacteria | 7751309 |
| 1525 | 8001847189 | 8001845381 | Bacteria | 5804942 |
| 1526 | 8005549870 | 8005542996 | Bacteria | 7077758 |
| 1527 | 8056681937 | 8056681323 | Bacteria | 8472857 |
| 1528 | Ga0373953_0009196 | |||
| 1529 | SwRhRL2b_contig_2503292 | |||
| 1530 | 2214683826 | |||
| 1531 | ARcpr5oldR_c000037 | |||
| 1532 | ARSoilYngRDRAFT_c00113 | |||
| 1533 | ARcpr5yngRDRAFT_c000014 | |||
| 1534 | ARSoilOldRDRAFT_c000005 | |||
| 1535 | ARCol0oldRDRAFT_c00471 | |||
| 1536 | LJQas_1002035 | |||
| 1537 | ARCol0yngRDRAFT_1000099 | |||
| 1538 | JGI24032J14994_100117 | |||
| 1539 | JGI24736J21556_1006279 | |||
| 1540 | JGI24741J21665_1008107 | |||
| 1541 | JGI24746J21847_1000648 | |||
| 1542 | JGI24747J21853_1001209 | |||
| 1543 | JGI24739J22299_10000871 | |||
| 1544 | JGI24737J22298_10001901 | |||
| 1545 | JGI24737J22298_10009338 | |||
| 1546 | JGI24743J22301_10003516 | |||
| 1547 | JGI24735J21928_10032226 | |||
| 1548 | JGI24750J21931_1000439 | |||
| 1549 | JGI24745J21846_1005235 | |||
| 1550 | JGI24748J21848_1005097 | |||
| 1551 | JGI24738J21930_10000856 | |||
| 1552 | JGI24744J21845_10013124 | |||
| 1553 | JGI24035J26624_1001996 | |||
| 1554 | JGI24033J26618_1001158 | |||
| 1555 | JGI24034J26672_10001465 | |||
| 1556 | JGI24742J22300_10000464 | |||
| 1557 | JGI24751J29686_10004435 | |||
| 1558 | JGI25153J46596_10004386 | |||
| 1559 | JGI25404J52841_10003777 | |||
| 1560 | Ga0055536_1000524 | |||
| 1561 | Ga0055530_10004363 | |||
| 1562 | Ga0055540_1000054 | |||
| 1563 | Ga0055531_10000037 | |||
| 1564 | JGI25405J52794_10006055 | |||
| 1565 | Ga0065717_1002123 | |||
| 1566 | Ga0065716_1002073 | |||
| 1567 | Ga0065704_10092942 | |||
| 1568 | Ga0065712_10074695 | |||
| 1569 | Ga0065715_10012983 | |||
| 1570 | Ga0065715_10026218 | |||
| 1571 | Ga0065707_10105725 | |||
| 1572 | Ga0065707_10112520 | |||
| 1573 | Ga0070658_10084650 | |||
| 1574 | Ga0070658_10096229 | |||
| 1575 | Ga0070676_10061936 | |||
| 1576 | Ga0070683_100013405 | |||
| 1577 | Ga0070683_100085340 | |||
| 1578 | Ga0070690_100003948 | |||
| 1579 | Ga0070690_100015657 | |||
| 1580 | Ga0070690_100024575 | |||
| 1581 | Ga0070690_100177059 | |||
| 1582 | Ga0070670_100025087 | |||
| 1583 | Ga0070670_100099329 | |||
| 1584 | Ga0070670_100246105 | |||
| 1585 | Ga0070677_10002031 | |||
| 1586 | Ga0070677_10102370 | |||
| 1587 | Ga0068869_100035291 | |||
| 1588 | Ga0068869_100046878 | |||
| 1589 | Ga0068869_100224938 | |||
| 1590 | Ga0070666_10006171 | |||
| 1591 | Ga0070666_10023242 | |||
| 1592 | Ga0070666_10103024 | |||
| 1593 | Ga0070680_100003647 | |||
| 1594 | Ga0070680_100019478 | |||
| 1595 | Ga0070680_100168978 | |||
| 1596 | Ga0070680_100367024 | |||
| 1597 | Ga0070682_100002015 | |||
| 1598 | Ga0070682_100171895 | |||
| 1599 | Ga0068868_100017327 | |||
| 1600 | Ga0068868_100051217 | |||
| 1601 | Ga0068868_100083566 | |||
| 1602 | Ga0070660_100003870 | |||
| 1603 | Ga0070660_100050132 | |||
| 1604 | Ga0070660_100075994 | |||
| 1605 | Ga0070660_100186912 | |||
| 1606 | Ga0070689_100006859 | |||
| 1607 | Ga0070689_100067079 | |||
| 1608 | Ga0070689_100167813 | |||
| 1609 | Ga0070689_100185900 | |||
| 1610 | Ga0070691_10004357 | |||
| 1611 | Ga0070691_10016445 | |||
| 1612 | Ga0070691_10044926 | |||
| 1613 | Ga0070687_100009855 | |||
| 1614 | Ga0070687_100032499 | |||
| 1615 | Ga0070687_100093310 | |||
| 1616 | Ga0070687_100175903 | |||
| 1617 | Ga0070692_10007167 | |||
| 1618 | Ga0070692_10040235 | |||
| 1619 | Ga0070692_10176558 | |||
| 1620 | Ga0070668_100004252 | |||
| 1621 | Ga0070668_100045512 | |||
| 1622 | Ga0070668_100098468 | |||
| 1623 | Ga0070669_100008306 | |||
| 1624 | Ga0070669_100035049 | |||
| 1625 | Ga0070669_100202959 | |||
| 1626 | Ga0070675_100044149 | |||
| 1627 | Ga0070675_100055315 | |||
| 1628 | Ga0070671_100006278 | |||
| 1629 | Ga0070671_100009728 | |||
| 1630 | Ga0070671_100015968 | |||
| 1631 | Ga0070671_100033397 | |||
| 1632 | Ga0070673_100012672 | |||
| 1633 | Ga0070673_100024715 | |||
| 1634 | Ga0070673_100118258 | |||
| 1635 | Ga0070673_100373958 | |||
| 1636 | Ga0070688_100039413 | |||
| 1637 | Ga0070688_100071559 | |||
| 1638 | Ga0070659_100026221 | |||
| 1639 | Ga0070659_100232167 | |||
| 1640 | Ga0070659_100295491 | |||
| 1641 | Ga0070667_100002235 | |||
| 1642 | Ga0070667_100013854 | |||
| 1643 | Ga0070667_100122035 | |||
| 1644 | Ga0070667_100140030 | |||
| 1645 | Ga0070667_100158721 | |||
| 1646 | Ga0070703_10004958 | |||
| 1647 | Ga0070703_10007397 | |||
| 1648 | Ga0070709_10011016 | |||
| 1649 | Ga0070709_10047697 | |||
| 1650 | Ga0070709_10067778 | |||
| 1651 | Ga0070714_100015917 | |||
| 1652 | Ga0070714_100053843 | |||
| 1653 | Ga0070713_100037939 | |||
| 1654 | Ga0070713_100064751 | |||
| 1655 | Ga0070713_100383500 | |||
| 1656 | Ga0070710_10002325 | |||
| 1657 | Ga0070710_10050700 | |||
| 1658 | Ga0070710_10067770 | |||
| 1659 | Ga0070710_10085486 | |||
| 1660 | Ga0070701_10002068 | |||
| 1661 | Ga0070701_10043327 | |||
| 1662 | Ga0070701_10108305 | |||
| 1663 | Ga0070711_100032612 | |||
| 1664 | Ga0070711_100154160 | |||
| 1665 | Ga0070711_100196272 | |||
| 1666 | Ga0070705_100000528 | |||
| 1667 | Ga0070705_100010364 | |||
| 1668 | Ga0070705_100031013 | |||
| 1669 | Ga0070705_100347503 | |||
| 1670 | Ga0070700_100024158 | |||
| 1671 | Ga0070700_100034214 | |||
| 1672 | Ga0070700_100277436 | |||
| 1673 | Ga0070694_100006551 | |||
| 1674 | Ga0070694_100011702 | |||
| 1675 | Ga0070694_100032984 | |||
| 1676 | Ga0070694_100368662 | |||
| 1677 | Ga0070708_100001688 | |||
| 1678 | Ga0070708_100055433 | |||
| 1679 | Ga0070708_100080088 | |||
| 1680 | Ga0070663_100009202 | |||
| 1681 | Ga0070663_100159867 | |||
| 1682 | Ga0070678_100034053 | |||
| 1683 | Ga0070678_100079875 | |||
| 1684 | Ga0070678_100213473 | |||
| 1685 | Ga0070678_100235032 | |||
| 1686 | Ga0070662_100011393 | |||
| 1687 | Ga0070662_100035015 | |||
| 1688 | Ga0070662_100127028 | |||
| 1689 | Ga0070681_10018493 | |||
| 1690 | Ga0070681_10040914 | |||
| 1691 | Ga0070681_10065168 | |||
| 1692 | Ga0070681_10075350 | |||
| 1693 | Ga0070681_10204988 | |||
| 1694 | Ga0068867_100005646 | |||
| 1695 | Ga0070685_10017763 | |||
| 1696 | Ga0070706_100104467 | |||
| 1697 | Ga0070707_100317375 | |||
| 1698 | Ga0070698_100221862 | |||
| 1699 | Ga0070698_100251705 | |||
| 1700 | Ga0074259_12010023 | |||
| 1701 | Ga0070699_100000147 | |||
| 1702 | Ga0070699_100099812 | |||
| 1703 | Ga0070699_100271659 | |||
| 1704 | Ga0070679_100016159 | |||
| 1705 | Ga0070679_100072533 | |||
| 1706 | Ga0070679_100139867 | |||
| 1707 | Ga0070679_100299686 | |||
| 1708 | Ga0070679_100299893 | |||
| 1709 | Ga0070679_100369957 | |||
| 1710 | Ga0070684_100020014 | |||
| 1711 | Ga0070684_100079026 | |||
| 1712 | Ga0070684_100082068 | |||
| 1713 | Ga0070684_100095019 | |||
| 1714 | Ga0070697_100006410 | |||
| 1715 | Ga0070697_100023710 | |||
| 1716 | Ga0070697_100225527 | |||
| 1717 | Ga0068853_100003634 | |||
| 1718 | Ga0068853_100188539 | |||
| 1719 | Ga0070672_100044896 | |||
| 1720 | Ga0070672_100245750 | |||
| 1721 | Ga0070686_100007349 | |||
| 1722 | Ga0070686_100055380 | |||
| 1723 | Ga0070686_100124883 | |||
| 1724 | Ga0070686_100208658 | |||
| 1725 | Ga0070695_100002809 | |||
| 1726 | Ga0070695_100016690 | |||
| 1727 | Ga0070695_100121973 | |||
| 1728 | Ga0070695_100264948 | |||
| 1729 | Ga0070696_100002859 | |||
| 1730 | Ga0070696_100010889 | |||
| 1731 | Ga0070696_100013307 | |||
| 1732 | Ga0070693_100004174 | |||
| 1733 | Ga0070693_100025730 | |||
| 1734 | Ga0070693_100157032 | |||
| 1735 | Ga0070665_100004170 | |||
| 1736 | Ga0070665_100006016 | |||
| 1737 | Ga0070665_100195770 | |||
| 1738 | Ga0070704_100022446 | |||
| 1739 | Ga0070704_100034292 | |||
| 1740 | Ga0070704_100177163 | |||
| 1741 | Ga0068855_100026130 | |||
| 1742 | Ga0068855_100275071 | |||
| 1743 | Ga0070664_100114890 | |||
| 1744 | Ga0070664_100135966 | |||
| 1745 | Ga0068857_100019002 | |||
| 1746 | Ga0068857_100110898 | |||
| 1747 | Ga0068857_100126963 | |||
| 1748 | Ga0068854_100002965 | |||
| 1749 | Ga0068854_100039626 | |||
| 1750 | Ga0068856_100005225 | |||
| 1751 | Ga0068856_100058468 | |||
| 1752 | Ga0068856_100125316 | |||
| 1753 | Ga0068852_100047369 | |||
| 1754 | Ga0068852_100071202 | |||
| 1755 | Ga0068852_100123780 | |||
| 1756 | Ga0068859_100008928 | |||
| 1757 | Ga0068859_100039892 | |||
| 1758 | Ga0068864_100013072 | |||
| 1759 | Ga0068864_100030146 | |||
| 1760 | Ga0068864_100079478 | |||
| 1761 | Ga0068864_100175221 | |||
| 1762 | Ga0068866_10017245 | |||
| 1763 | Ga0068861_100016579 | |||
| 1764 | Ga0068861_100038178 | |||
| 1765 | Ga0068861_100038636 | |||
| 1766 | Ga0068861_100119494 | |||
| 1767 | Ga0068851_10058728 | |||
| 1768 | Ga0068870_10008836 | |||
| 1769 | Ga0068870_10023842 | |||
| 1770 | Ga0068870_10031956 | |||
| 1771 | Ga0068863_100053128 | |||
| 1772 | Ga0068863_100099230 | |||
| 1773 | Ga0068863_100135514 | |||
| 1774 | Ga0068863_100230610 | |||
| 1775 | Ga0068858_100026832 | |||
| 1776 | Ga0068858_100031436 | |||
| 1777 | Ga0068858_100121393 | |||
| 1778 | Ga0068858_100198645 | |||
| 1779 | Ga0068860_100003101 | |||
| 1780 | Ga0068860_100023337 | |||
| 1781 | Ga0068860_100052065 | |||
| 1782 | Ga0068860_100060789 | |||
| 1783 | Ga0068860_100073921 | |||
| 1784 | Ga0068860_100125246 | |||
| 1785 | Ga0068860_100172469 | |||
| 1786 | Ga0068862_100001380 | |||
| 1787 | Ga0068862_100010646 | |||
| 1788 | Ga0068862_100078169 | |||
| 1789 | Ga0081455_10000096 | |||
| 1790 | Ga0081455_10000200 | |||
| 1791 | Ga0081455_10000768 | |||
| 1792 | Ga0081455_10045366 | |||
| 1793 | Ga0081455_10174039 | |||
| 1794 | Ga0081538_10007210 | |||
| 1795 | Ga0081538_10008625 | |||
| 1796 | Ga0081538_10016051 | |||
| 1797 | Ga0081538_10094613 | |||
| 1798 | Ga0081540_1000158 | |||
| 1799 | Ga0081540_1006707 | |||
| 1800 | Ga0081540_1025349 | |||
| 1801 | Ga0081540_1057025 | |||
| 1802 | Ga0081540_1086712 | |||
| 1803 | Ga0081539_10020277 | |||
| 1804 | Ga0081539_10027151 | |||
| 1805 | Ga0070717_10086802 | |||
| 1806 | Ga0070717_10147771 | |||
| 1807 | Ga0070717_10157079 | |||
| 1808 | Ga0070717_10309908 | |||
| 1809 | Ga0075365_10044325 | |||
| 1810 | Ga0075365_10079762 | |||
| 1811 | Ga0075368_10045474 | |||
| 1812 | Ga0075363_100054897 | |||
| 1813 | Ga0075432_10010891 | |||
| 1814 | Ga0070715_10038507 | |||
| 1815 | Ga0070716_100004647 | |||
| 1816 | Ga0070716_100066278 | |||
| 1817 | Ga0070716_100199148 | |||
| 1818 | Ga0070712_100000210 | |||
| 1819 | Ga0070712_100161297 | |||
| 1820 | Ga0070712_100409334 | |||
| 1821 | Ga0075362_10084393 | |||
| 1822 | Ga0075367_10021871 | |||
| 1823 | Ga0075367_10098232 | |||
| 1824 | Ga0075367_10135444 | |||
| 1825 | Ga0075369_10070243 | |||
| 1826 | Ga0075366_10013125 | |||
| 1827 | Ga0097621_100029343 | |||
| 1828 | Ga0097621_100039390 | |||
| 1829 | Ga0097621_100088576 | |||
| 1830 | Ga0097621_100208169 | |||
| 1831 | Ga0075370_10028731 | |||
| 1832 | Ga0068871_100003405 | |||
| 1833 | Ga0068871_100012612 | |||
| 1834 | Ga0068871_100044409 | |||
| 1835 | Ga0075428_100003646 | |||
| 1836 | Ga0075428_100058917 | |||
| 1837 | Ga0075428_100065348 | |||
| 1838 | Ga0075428_100153837 | |||
| 1839 | Ga0075428_100155914 | |||
| 1840 | Ga0075428_100326861 | |||
| 1841 | Ga0075430_100000133 | |||
| 1842 | Ga0075430_100001032 | |||
| 1843 | Ga0075430_100022952 | |||
| 1844 | Ga0075431_100000602 | |||
| 1845 | Ga0075431_100001362 | |||
| 1846 | Ga0075431_100057185 | |||
| 1847 | Ga0075431_100074190 | |||
| 1848 | Ga0075431_100120962 | |||
| 1849 | Ga0075433_10000328 | |||
| 1850 | Ga0075433_10028663 | |||
| 1851 | Ga0075433_10136920 | |||
| 1852 | Ga0075434_100001713 | |||
| 1853 | Ga0075434_100006226 | |||
| 1854 | Ga0075434_100018385 | |||
| 1855 | Ga0075434_100289224 | |||
| 1856 | Ga0075429_100000163 | |||
| 1857 | Ga0075429_100137894 | |||
| 1858 | Ga0068865_100001544 | |||
| 1859 | Ga0068865_100003466 | |||
| 1860 | Ga0075436_100025848 | |||
| 1861 | Ga0075436_100271637 | |||
| 1862 | Ga0097620_100008928 | |||
| 1863 | Ga0097620_100039897 | |||
| 1864 | Ga0075435_100001972 | |||
| 1865 | Ga0075435_100024791 | |||
| 1866 | Ga0075435_100081761 | |||
| 1867 | Ga0075435_100175333 | |||
| 1868 | Ga0099794_10132838 | |||
| 1869 | Ga0105244_10059189 | |||
| 1870 | Ga0105244_10136458 | |||
| 1871 | Ga0105240_10378029 | |||
| 1872 | Ga0111539_10000389 | |||
| 1873 | Ga0111539_10000725 | |||
| 1874 | Ga0111539_10001696 | |||
| 1875 | Ga0111539_10001808 | |||
| 1876 | Ga0111539_10018474 | |||
| 1877 | Ga0111539_10047916 | |||
| 1878 | Ga0111539_10065823 | |||
| 1879 | Ga0111539_10103174 | |||
| 1880 | Ga0111539_10122383 | |||
| 1881 | Ga0111539_10146602 | |||
| 1882 | Ga0111539_10186046 | |||
| 1883 | Ga0111539_10410216 | |||
| 1884 | Ga0111539_10482939 | |||
| 1885 | Ga0105245_10010250 | |||
| 1886 | Ga0105245_10015250 | |||
| 1887 | Ga0105245_10391633 | |||
| 1888 | Ga0105247_10022803 | |||
| 1889 | Ga0105247_10035997 | |||
| 1890 | Ga0105247_10041832 | |||
| 1891 | Ga0114129_10000227 | |||
| 1892 | Ga0114129_10008509 | |||
| 1893 | Ga0114129_10040105 | |||
| 1894 | Ga0114129_10225242 | |||
| 1895 | Ga0114129_10255373 | |||
| 1896 | Ga0105243_10003521 | |||
| 1897 | Ga0105243_10060998 | |||
| 1898 | Ga0105243_10067549 | |||
| 1899 | Ga0105241_10007067 | |||
| 1900 | Ga0105241_10195297 | |||
| 1901 | Ga0105242_10026334 | |||
| 1902 | Ga0105242_10035954 | |||
| 1903 | Ga0105242_10040216 | |||
| 1904 | Ga0105248_10011072 | |||
| 1905 | Ga0105248_10070147 | |||
| 1906 | Ga0105248_10109495 | |||
| 1907 | Ga0105248_10244342 | |||
| 1908 | Ga0105237_10007432 | |||
| 1909 | Ga0105237_10102994 | |||
| 1910 | Ga0105238_10034621 | |||
| 1911 | Ga0105249_10011087 | |||
| 1912 | Ga0105249_10019349 | |||
| 1913 | Ga0105249_10285547 | |||
| 1914 | Ga0105239_10033880 | |||
| 1915 | Ga0105239_10105997 | |||
| 1916 | Ga0105239_10152129 | |||
| 1917 | Ga0105239_10277133 | |||
| 1918 | Ga0105246_10004169 | |||
| 1919 | Ga0105246_10016137 | |||
| 1920 | Ga0105246_10035014 | |||
| 1921 | Ga0105246_10049515 | |||
| 1922 | Ga0105246_10136956 | |||
| 1923 | Ga0157335_1000780 | |||
| 1924 | Ga0157373_10035983 | |||
| 1925 | Ga0157371_10050774 | |||
| 1926 | Ga0157374_10002692 | |||
| 1927 | Ga0157374_10070776 | |||
| 1928 | Ga0157374_10175996 | |||
| 1929 | Ga0157378_10085517 | |||
| 1930 | Ga0157378_10102635 | |||
| 1931 | Ga0157378_10694426 | |||
| 1932 | Ga0163162_10017826 | |||
| 1933 | Ga0163162_10063021 | |||
| 1934 | Ga0163162_10206806 | |||
| 1935 | Ga0163162_10430330 | |||
| 1936 | Ga0157372_10040791 | |||
| 1937 | Ga0157375_10024786 | |||
| 1938 | Ga0157375_10061773 | |||
| 1939 | Ga0157375_10092850 | |||
| 1940 | Ga0157375_10104406 | |||
| 1941 | Ga0157375_10168893 | |||
| 1942 | Ga0163163_10001273 | |||
| 1943 | Ga0163163_10095739 | |||
| 1944 | Ga0163163_10122477 | |||
| 1945 | Ga0163163_10380939 | |||
| 1946 | Ga0157380_10006550 | |||
| 1947 | Ga0157377_10001621 | |||
| 1948 | Ga0157377_10042979 | |||
| 1949 | Ga0157376_10034213 | |||
| 1950 | Ga0157376_10104691 | |||
| 1951 | Ga0163161_10000266 | |||
| 1952 | Ga0163161_10076015 | |||
| 1953 | Ga0163161_10078274 | |||
| 1954 | Ga0163161_10137337 | |||
| 1955 | Ga0206354_11439474 | |||
| 1956 | Ga0213872_10013367 | |||
| 1957 | Ga0213874_10007563 | |||
| 1958 | Ga0213876_10000603 | |||
| 1959 | Ga0213876_10032997 | |||
| 1960 | Ga0213876_10035830 | |||
| 1961 | Ga0213876_10048232 | |||
| 1962 | Ga0213876_10150269 | |||
| 1963 | Ga0213875_10000918 | |||
| 1964 | Ga0213875_10146050 | |||
| 1965 | Ga0224572_1002050 | |||
| 1966 | Ga0207666_1000534 | |||
| 1967 | Ga0207666_1001132 | |||
| 1968 | Ga0207673_1000597 | |||
| 1969 | Ga0209676_1000105 | |||
| 1970 | Ga0209758_1001548 | |||
| 1971 | Ga0209758_1001765 | |||
| 1972 | Ga0209050_1001283 | |||
| 1973 | Ga0209051_1000064 | |||
| 1974 | Ga0209257_1000109 | |||
| 1975 | Ga0207697_10002026 | |||
| 1976 | Ga0207697_10003146 | |||
| 1977 | Ga0207656_10020871 | |||
| 1978 | Ga0207655_1055096 | |||
| 1979 | Ga0207653_10002185 | |||
| 1980 | Ga0207653_10002726 | |||
| 1981 | Ga0207682_10000009 | |||
| 1982 | Ga0207682_10003948 | |||
| 1983 | Ga0207692_10010088 | |||
| 1984 | Ga0207642_10007417 | |||
| 1985 | Ga0207642_10010905 | |||
| 1986 | Ga0207710_10001303 | |||
| 1987 | Ga0207688_10000892 | |||
| 1988 | Ga0207688_10110652 | |||
| 1989 | Ga0207688_10132250 | |||
| 1990 | Ga0207680_10004104 | |||
| 1991 | Ga0207680_10025243 | |||
| 1992 | Ga0207647_10002160 | |||
| 1993 | Ga0207685_10031650 | |||
| 1994 | Ga0207685_10055893 | |||
| 1995 | Ga0207699_10037062 | |||
| 1996 | Ga0207645_10000999 | |||
| 1997 | Ga0207645_10035204 | |||
| 1998 | Ga0207643_10001172 | |||
| 1999 | Ga0207643_10028428 | |||
| 2000 | Ga0207705_10076146 | |||
| 2001 | Ga0207705_10114279 | |||
| 2002 | Ga0207684_10019788 | |||
| 2003 | Ga0207654_10015486 | |||
| 2004 | Ga0207654_10156190 | |||
| 2005 | Ga0207707_10006761 | |||
| 2006 | Ga0207707_10045583 | |||
| 2007 | Ga0207707_10163271 | |||
| 2008 | Ga0207707_10247057 | |||
| 2009 | Ga0207707_10386783 | |||
| 2010 | Ga0207707_10448620 | |||
| 2011 | Ga0207695_10154802 | |||
| 2012 | Ga0207695_10170648 | |||
| 2013 | Ga0207671_10070082 | |||
| 2014 | Ga0207671_10113096 | |||
| 2015 | Ga0207693_10002396 | |||
| 2016 | Ga0207693_10007042 | |||
| 2017 | Ga0207693_10012580 | |||
| 2018 | Ga0207693_10024070 | |||
| 2019 | Ga0207693_10128480 | |||
| 2020 | Ga0207693_10192406 | |||
| 2021 | Ga0207663_10194477 | |||
| 2022 | Ga0207663_10266655 | |||
| 2023 | Ga0207660_10001283 | |||
| 2024 | Ga0207660_10096292 | |||
| 2025 | Ga0207662_10000025 | |||
| 2026 | Ga0207662_10007904 | |||
| 2027 | Ga0207662_10043635 | |||
| 2028 | Ga0207657_10010579 | |||
| 2029 | Ga0207657_10086122 | |||
| 2030 | Ga0207657_10146148 | |||
| 2031 | Ga0207657_10320484 | |||
| 2032 | Ga0207649_10006638 | |||
| 2033 | Ga0207649_10115293 | |||
| 2034 | Ga0207649_10176922 | |||
| 2035 | Ga0207652_10006125 | |||
| 2036 | Ga0207652_10059120 | |||
| 2037 | Ga0207652_10069453 | |||
| 2038 | Ga0207652_10103214 | |||
| 2039 | Ga0207652_10264514 | |||
| 2040 | Ga0207652_10371714 | |||
| 2041 | Ga0207652_10506786 | |||
| 2042 | Ga0207646_10051439 | |||
| 2043 | Ga0207681_10002039 | |||
| 2044 | Ga0207681_10012199 | |||
| 2045 | Ga0207694_10037333 | |||
| 2046 | Ga0207694_10353411 | |||
| 2047 | Ga0207650_10074985 | |||
| 2048 | Ga0207650_10237350 | |||
| 2049 | Ga0207659_10014716 | |||
| 2050 | Ga0207687_10003202 | |||
| 2051 | Ga0207687_10011809 | |||
| 2052 | Ga0207687_10255936 | |||
| 2053 | Ga0207700_10064877 | |||
| 2054 | Ga0207700_10155337 | |||
| 2055 | Ga0207644_10003326 | |||
| 2056 | Ga0207644_10009497 | |||
| 2057 | Ga0207644_10025426 | |||
| 2058 | Ga0207644_10190507 | |||
| 2059 | Ga0207690_10007239 | |||
| 2060 | Ga0207690_10264505 | |||
| 2061 | Ga0207706_10005363 | |||
| 2062 | Ga0207706_10007588 | |||
| 2063 | Ga0207706_10015532 | |||
| 2064 | Ga0207706_10016523 | |||
| 2065 | Ga0207706_10063677 | |||
| 2066 | Ga0207706_10107599 | |||
| 2067 | Ga0207686_10020623 | |||
| 2068 | Ga0207709_10002970 | |||
| 2069 | Ga0207709_10020213 | |||
| 2070 | Ga0207709_10027140 | |||
| 2071 | Ga0207709_10037377 | |||
| 2072 | Ga0207670_10003489 | |||
| 2073 | Ga0207670_10048850 | |||
| 2074 | Ga0207670_10082490 | |||
| 2075 | Ga0207670_10209815 | |||
| 2076 | Ga0207670_10391355 | |||
| 2077 | Ga0207669_10001324 | |||
| 2078 | Ga0207669_10022747 | |||
| 2079 | Ga0207669_10046762 | |||
| 2080 | Ga0207669_10082786 | |||
| 2081 | Ga0207669_10094727 | |||
| 2082 | Ga0207669_10187070 | |||
| 2083 | Ga0207669_10222069 | |||
| 2084 | Ga0207704_10000130 | |||
| 2085 | Ga0207704_10122991 | |||
| 2086 | Ga0207704_10184642 | |||
| 2087 | Ga0207665_10002113 | |||
| 2088 | Ga0207665_10024373 | |||
| 2089 | Ga0207665_10417650 | |||
| 2090 | Ga0207691_10001422 | |||
| 2091 | Ga0207691_10002604 | |||
| 2092 | Ga0207691_10103504 | |||
| 2093 | Ga0207691_10175920 | |||
| 2094 | Ga0207691_10386682 | |||
| 2095 | Ga0207711_10001071 | |||
| 2096 | Ga0207711_10012903 | |||
| 2097 | Ga0207711_10019431 | |||
| 2098 | Ga0207711_10081889 | |||
| 2099 | Ga0207711_10100479 | |||
| 2100 | Ga0207689_10001156 | |||
| 2101 | Ga0207689_10066148 | |||
| 2102 | Ga0207689_10254733 | |||
| 2103 | Ga0207661_10028696 | |||
| 2104 | Ga0207661_10186261 | |||
| 2105 | Ga0207661_10237224 | |||
| 2106 | Ga0207661_10415447 | |||
| 2107 | Ga0207661_10429362 | |||
| 2108 | Ga0207679_10003209 | |||
| 2109 | Ga0207679_10390710 | |||
| 2110 | Ga0207667_10028359 | |||
| 2111 | Ga0207667_10089076 | |||
| 2112 | Ga0207667_10272091 | |||
| 2113 | Ga0207667_10436413 | |||
| 2114 | Ga0207651_10010192 | |||
| 2115 | Ga0207651_10212060 | |||
| 2116 | Ga0207712_10000579 | |||
| 2117 | Ga0207712_10007061 | |||
| 2118 | Ga0207712_10020831 | |||
| 2119 | Ga0207668_10000815 | |||
| 2120 | Ga0207668_10003465 | |||
| 2121 | Ga0207668_10108641 | |||
| 2122 | Ga0207668_10203378 | |||
| 2123 | Ga0207640_10122108 | |||
| 2124 | Ga0207658_10002475 | |||
| 2125 | Ga0207658_10003151 | |||
| 2126 | Ga0207658_10015729 | |||
| 2127 | Ga0207658_10124397 | |||
| 2128 | Ga0207677_10011181 | |||
| 2129 | Ga0207677_10252437 | |||
| 2130 | Ga0207703_10010308 | |||
| 2131 | Ga0207703_10033374 | |||
| 2132 | Ga0207639_10001866 | |||
| 2133 | Ga0207639_10159860 | |||
| 2134 | Ga0207639_10383618 | |||
| 2135 | Ga0207678_10008348 | |||
| 2136 | Ga0207678_10008633 | |||
| 2137 | Ga0207678_10046782 | |||
| 2138 | Ga0207708_10000402 | |||
| 2139 | Ga0207708_10002738 | |||
| 2140 | Ga0207708_10055684 | |||
| 2141 | Ga0207708_10147325 | |||
| 2142 | Ga0207708_10437374 | |||
| 2143 | Ga0207702_10046199 | |||
| 2144 | Ga0207702_10091417 | |||
| 2145 | Ga0207641_10014704 | |||
| 2146 | Ga0207641_10072572 | |||
| 2147 | Ga0207641_10087180 | |||
| 2148 | Ga0207641_10095692 | |||
| 2149 | Ga0207648_10001500 | |||
| 2150 | Ga0207648_10004627 | |||
| 2151 | Ga0207676_10017931 | |||
| 2152 | Ga0207676_10071930 | |||
| 2153 | Ga0207676_10101902 | |||
| 2154 | Ga0207676_10137857 | |||
| 2155 | Ga0207674_10007131 | |||
| 2156 | Ga0207674_10021894 | |||
| 2157 | Ga0207674_10043375 | |||
| 2158 | Ga0207675_100002311 | |||
| 2159 | Ga0207675_100003859 | |||
| 2160 | Ga0207675_100019447 | |||
| 2161 | Ga0207675_100051796 | |||
| 2162 | Ga0207683_10000850 | |||
| 2163 | Ga0207683_10010051 | |||
| 2164 | Ga0207683_10062694 | |||
| 2165 | Ga0207683_10096310 | |||
| 2166 | Ga0207683_10208074 | |||
| 2167 | Ga0207683_10211505 | |||
| 2168 | Ga0207698_10005963 | |||
| 2169 | Ga0207698_10052400 | |||
| 2170 | Ga0207698_10344543 | |||
| 2171 | Ga0209995_1009515 | |||
| 2172 | Ga0210002_1000490 | |||
| 2173 | Ga0209971_1023345 | |||
| 2174 | Ga0209966_1003846 | |||
| 2175 | Ga0209998_10000759 | |||
| 2176 | Ga0209998_10001051 | |||
| 2177 | Ga0209974_10039214 | |||
| 2178 | Ga0207428_10000164 | |||
| 2179 | Ga0207428_10000391 | |||
| 2180 | Ga0207428_10001108 | |||
| 2181 | Ga0207428_10008433 | |||
| 2182 | Ga0207428_10024777 | |||
| 2183 | Ga0268266_10002016 | |||
| 2184 | Ga0268266_10127443 | |||
| 2185 | Ga0268265_10003240 | |||
| 2186 | Ga0268265_10042298 | |||
| 2187 | Ga0268265_10265390 | |||
| 2188 | Ga0268264_10020827 | |||
| 2189 | Ga0268264_10061652 | |||
| 2190 | Ga0268264_10061975 | |||
| 2191 | Ga0268264_10128256 | |||
| 2192 | Ga0268264_10144215 | |||
| 2193 | Ga0268264_10151718 | |||
| 2194 | Ga0268264_10167044 | |||
| 2195 | Ga0265337_1000284 | |||
| 2196 | Ga0307515_10248642 | |||
| 2197 | Ga0265338_10005223 | |||
| 2198 | Ga0265330_10027948 | |||
| 2199 | Ga0265330_10102093 | |||
| 2200 | Ga0265332_10000508 | |||
| 2201 | Ga0265332_10026267 | |||
| 2202 | Ga0265332_10073934 | |||
| 2203 | Ga0265325_10000019 | |||
| 2204 | Ga0265325_10001329 | |||
| 2205 | Ga0265325_10003017 | |||
| 2206 | Ga0265325_10004090 | |||
| 2207 | Ga0265325_10025995 | |||
| 2208 | Ga0265325_10034256 | |||
| 2209 | Ga0265325_10063293 | |||
| 2210 | Ga0265325_10067790 | |||
| 2211 | Ga0265340_10009669 | |||
| 2212 | Ga0265340_10024385 | |||
| 2213 | Ga0265340_10024647 | |||
| 2214 | Ga0265340_10037227 | |||
| 2215 | Ga0265339_10000096 | |||
| 2216 | Ga0265339_10001912 | |||
| 2217 | Ga0265339_10006450 | |||
| 2218 | Ga0265339_10008869 | |||
| 2219 | Ga0265339_10015052 | |||
| 2220 | Ga0265331_10042725 | |||
| 2221 | Ga0265327_10000177 | |||
| 2222 | Ga0265313_10000024 | |||
| 2223 | Ga0265313_10004465 | |||
| 2224 | Ga0265313_10006000 | |||
| 2225 | Ga0265313_10025519 | |||
| 2226 | Ga0265313_10028957 | |||
| 2227 | Ga0265313_10047499 | |||
| 2228 | Ga0265313_10100613 | |||
| 2229 | Ga0265314_10001355 | |||
| 2230 | Ga0265342_10000573 | |||
| 2231 | Ga0265342_10001257 | |||
| 2232 | Ga0307516_10054650 | |||
| 2233 | Ga0307407_10177306 | |||
| 2234 | Ga0307414_10063480 | |||
| 2235 | Ga0307415_100147752 | |||
| 2236 | Ga0316583_10001118 | |||
| 2237 | Ga0373930_0000713 | |||
| 2238 | Ga0373948_0000426 | |||
| 2239 | Ga0373948_0001212 | |||
| 2240 | Ga0373950_0004976 | |||
| 2241 | Ga0373958_0000992 | |||
| 2242 | Ga0373958_0005970 | |||
| 2243 | Ga0373959_0000111 | |||
| 2244 | Ga0373938_0000386 | |||
| 2245 | Ga0373938_0000527 | |||
| 2246 | Ga0373938_0004135 | |||
| 2247 | Ga0373926_0000388 | |||
| 2248 | Ga0373926_0012315 | |||
| 2249 | Ga0373928_0000045 | |||
| 2250 | Ga0373929_0000214 | |||
| 2251 | Ga0373934_0073810 | |||
| 2252 | Ga0373940_0003391 | |||
| 2253 | Ga0373940_0008685 | |||
| 2254 | Ga0373940_0016914 | |||
| 2255 | Ga0373944_0000734 | |||
| 2256 | Ga0373944_0013920 | |||
| 2257 | Ga0373944_0019891 | |||
| 2258 | Ga0373949_0002131 | |||
| 2259 | Ga0373949_0002981 | |||
| 2260 | Ga0373951_0000335 | |||
| 2261 | Ga0373951_0005629 | |||
| 2262 | Ga0373951_0013871 | |||
| 2263 | Ga0373952_0000179 | |||
| 2264 | Ga0373952_0004378 | |||
| 2265 | Ga0373923_0000978 | |||
| 2266 | Ga0373932_0000271 | |||
| 2267 | Ga0373932_0002322 | |||
| 2268 | Ga0373932_0023548 | |||
| 2269 | Ga0373936_0001860 | |||
| 2270 | Ga0373936_0011435 | |||
| 2271 | Ga0373936_0036477 | |||
| 2272 | Ga0373939_0008122 | |||
| 2273 | Ga0373939_0011931 | |||
| 2274 | Ga0373941_0000241 | |||
| 2275 | Ga0373941_0033442 | |||
| 2276 | Ga0373945_0016965 | |||
| 2277 | Ga0373945_0018406 | |||
| 2278 | Ga0373945_0028858 | |||
| 2279 | Ga0373954_0000707 | |||
| 2280 | Ga0373954_0025763 | |||
| 2281 | Ga0373954_0045424 | |||
| 2282 | Ga0373954_0077547 | |||
| 2283 | Ga0373956_0023428 | |||
| 2284 | Ga0373956_0029934 | |||
| 2285 | Ga0373957_0002977 | |||
| 2286 | Ga0373957_0036321 | |||
| 2287 | Ga0373957_0047844 | |||
| 2288 | Ga0373960_0003102 | |||
| 2289 | Ga0373960_0024562 | |||
| 2290 | Ga0373943_0000233 | |||
| 2291 | Ga0373943_0000997 | |||
| 2292 | Ga0373943_0007851 | |||
| 2293 | Ga0373943_0047269 | |||
| 2294 | Ga0373946_0007488 | |||
| 2295 | Ga0373946_0011741 | |||
| 2296 | Ga0373946_0026501 | |||
| 2297 | Ga0373955_0001092 | |||
| 2298 | Ga0373955_0002224 | |||
| 2299 | Ga0373955_0005439 | |||
| 2300 | Ga0373955_0014964 | |||
| 2301 | Ga0373942_0008878 | |||
| 2302 | Ga0373961_0000592 | |||
| 2303 | Ga0373961_0003081 | |||
| 2304 | Ga0373961_0005827 | |||
| 2305 | Ga0373961_0011637 | |||
| 2306 | Ga0373962_0000848 | |||
| 2307 | Ga0373962_0002023 | |||
| 2308 | Ga0373962_0020380 | |||
| 2309 | Ga0373924_0070650 | |||
| 2310 | Ga0373924_0145353 | |||
| 2311 | Ga0373931_0001210 | |||
| 2312 | Ga0373931_0003979 | |||
| 2313 | Ga0373931_0004155 | |||
| 2314 | Ga0373931_0004514 | |||
| 2315 | Ga0373931_0018978 | |||
| 2316 | Ga0373931_0174512 | |||
| 2317 | Ga0373931_0275359 | |||
| 2318 | Ga0373935_0000377 | |||
| 2319 | Ga0373935_0001455 | |||
| 2320 | Ga0373935_0003956 | |||
| 2321 | Ga0373935_0084931 | |||
| 2322 | Ga0373935_0188072 | |||
| 2323 | Ga0373927_0000113 | |||
| 2324 | Ga0373927_0013803 | |||
| 2325 | Ga0373927_0017901 | |||
| 2326 | Ga0373927_0021648 | |||
| 2327 | Ga0373927_0035757 | |||
| 2328 | Ga0373927_0041852 | |||
| 2329 | Ga0373927_0060060 | |||
| 2330 | Ga0373927_0067856 | |||
| 2331 | Ga0373927_0080694 | |||
| 2332 | Ga0373933_0000258 | |||
| 2333 | Ga0373933_0010567 | |||
| 2334 | Ga0373933_0017191 | |||
| 2335 | Ga0373933_0034562 | |||
| 2336 | Ga0373933_0043589 | |||
| 2337 | Ga0373933_0129767 | |||
| 2338 | Ga0373947_0000168 | |||
| 2339 | Ga0373947_0000280 | |||
| 2340 | Ga0373947_0012523 | |||
| 2341 | Ga0373947_0013179 | |||
| 2342 | Ga0373947_0019089 | |||
| 2343 | Ga0373947_0020590 | |||
| 2344 | Ga0373937_0000814 | |||
| 2345 | Ga0373937_0001849 | |||
| 2346 | Ga0373937_0005769 | |||
| 2347 | Ga0373937_0008814 | |||
| 2348 | Ga0373937_0011708 | |||
| 2349 | Ga0373937_0017925 | |||
| 2350 | Ga0373937_0059689 | |||
| 2351 | Ga0373937_0191559 | |||
| 2352 | Ga0373925_0000075 | |||
| 2353 | Ga0373925_0001434 | |||
| 2354 | Ga0373925_0003256 | |||
| 2355 | Ga0373925_0013932 | |||
| 2356 | Ga0373925_0115233 | |||
| 2357 | Ga0373925_0136762 | |||
| 2358 | Ga0373925_0198248 | |||
| 2359 | Ga0373925_0313423 | |||
| 2360 | Ga0395899_0005270 | |||
| 2361 | Ga0395899_0083216 | |||
| 2362 | Ga0395900_0004997 | |||
| 2363 | Ga0395900_0334631 | |||
| 2364 | Ga0395898_0005343 | |||
| 2365 | Ga0395898_0109287 | |||
| 2366 | Ga0395898_0211384 | |||
| 2367 | Ga0395898_0252358 | |||
| 2368 | Ga0436364_0266645 | |||
| 2369 | Ga0436364_0611324 | |||
| 2370 | Ga0436364_1284638 | |||
| 2371 | Ga0395901_0009254 | |||
| 2372 | Ga0395901_0114297 | |||
| 2373 | Ga0242420_010110 | |||
| 2374 | Ga0436365_0117548 | |||
| 2375 | Ga0436365_0321935 | |||
| 2376 | Ga0436365_0448461 | |||
| 2377 | Ga0436365_0692136 | |||
| 2378 | Ga0436365_0827365 | |||
| 2379 | Ga0436365_1485216 | |||
| 2380 | Ga0436365_1545760 | |||
| 2381 | Ga0436361_0569994 | |||
| 2382 | Ga0436361_0679413 | |||
| 2383 | Ga0436361_1044250 | |||
| 2384 | Ga0436363_0519487 | |||
| 2385 | Ga0436363_1624569 | |||
| 2386 | Ga0436363_1706863 | |||
| 2387 | Ga0439453_0021580 | |||
| 2388 | Ga0451853_2607190 | |||
| 2389 | Ga0451853_3173075 | |||
| 2390 | Ga0439441_006469 | |||
| 2391 | Ga0439443_005645 | |||
| 2392 | Ga0439450_002586 | |||
| 2393 | Ga0466963_0002455 | |||
| 2394 | Ga0466963_0059496 | |||
| 2395 | Ga0466968_0009361 | |||
| 2396 | Ga0466957_0012658 | |||
| 2397 | Ga0466959_0045768 | |||
| 2398 | Ga0451576_0006479 | |||
| 2399 | Ga0466967_0006697 | |||
| 2400 | Ga0466967_0104801 | |||
| 2401 | Ga0466967_0180663 | |||
| 2402 | Ga0495592_0000060 | |||
| 2403 | Ga0495592_0003878 | |||
| 2404 | Ga0495592_0026131 | |||
| 2405 | Ga0495592_0051488 | |||
| 2406 | Ga0495592_0052855 | |||
| 2407 | Ga0495603_0004025 | |||
| 2408 | Ga0495603_0023263 | |||
| 2409 | Ga0495629_0000118 | |||
| 2410 | Ga0495629_0000139 | |||
| 2411 | Ga0495629_0027523 | |||
| 2412 | Ga0495629_0115745 | |||
| 2413 | Ga0495629_0117691 | |||
| 2414 | Ga0495629_0139108 | |||
| 2415 | Ga0495629_0145651 | |||
| 2416 | Ga0495629_0159256 | |||
| 2417 | Ga0495638_0043216 | |||
| 2418 | Ga0495641_0026615 | |||
| 2419 | Ga0495651_0000181 | |||
| 2420 | Ga0495651_0001419 | |||
| 2421 | Ga0495651_0004794 | |||
| 2422 | Ga0495651_0084089 | |||
| 2423 | Ga0495651_0086259 | |||
| 2424 | Ga0495653_0000141 | |||
| 2425 | Ga0495653_0006362 | |||
| 2426 | Ga0495653_0067003 | |||
| 2427 | Ga0495580_0005444 | |||
| 2428 | Ga0495580_0018852 | |||
| 2429 | Ga0495580_0047339 | |||
| 2430 | Ga0495580_0126130 | |||
| 2431 | Ga0495582_0037925 | |||
| 2432 | Ga0495582_0042876 | |||
| 2433 | Ga0495582_0044124 | |||
| 2434 | Ga0495582_0244600 | |||
| 2435 | Ga0495605_0065887 | |||
| 2436 | Ga0495639_0005719 | |||
| 2437 | Ga0495639_0037816 | |||
| 2438 | Ga0495639_0055354 | |||
| 2439 | Ga0495662_0000223 | |||
| 2440 | Ga0495662_0001139 | |||
| 2441 | Ga0495662_0028741 | |||
| 2442 | Ga0495664_0000003 | |||
| 2443 | Ga0495664_0000800 | |||
| 2444 | Ga0495664_0017877 | |||
| 2445 | Ga0495664_0076038 | |||
| 2446 | Ga0495664_0132456 | |||
| 2447 | Ga0495584_0039361 | |||
| 2448 | Ga0495585_0001030 | |||
| 2449 | Ga0495594_0002129 | |||
| 2450 | Ga0495594_0015379 | |||
| 2451 | Ga0495594_0026453 | |||
| 2452 | Ga0495607_0006002 | |||
| 2453 | Ga0495607_0187944 | |||
| 2454 | Ga0495606_0020594 | |||
| 2455 | Ga0495606_0034704 | |||
| 2456 | Ga0495608_0000011 | |||
| 2457 | Ga0495608_0000398 | |||
| 2458 | Ga0495608_0000911 | |||
| 2459 | Ga0495608_0030340 | |||
| 2460 | Ga0495608_0036267 | |||
| 2461 | Ga0495608_0061262 | |||
| 2462 | Ga0495608_0120492 | |||
| 2463 | Ga0495618_0000044 | |||
| 2464 | Ga0495618_0017292 | |||
| 2465 | Ga0495618_0019414 | |||
| 2466 | Ga0495618_0028428 | |||
| 2467 | Ga0495618_0067596 | |||
| 2468 | Ga0495618_0069530 | |||
| 2469 | Ga0495618_0126539 | |||
| 2470 | Ga0495628_0000001 | |||
| 2471 | Ga0495628_0005139 | |||
| 2472 | Ga0495628_0006666 | |||
| 2473 | Ga0495628_0024922 | |||
| 2474 | Ga0495628_0258755 | |||
| 2475 | Ga0495630_0000574 | |||
| 2476 | Ga0495630_0011656 | |||
| 2477 | Ga0495630_0047151 | |||
| 2478 | Ga0495630_0070201 | |||
| 2479 | Ga0495630_0100159 | |||
| 2480 | Ga0495630_0200181 | |||
| 2481 | Ga0495637_0054463 | |||
| 2482 | Ga0495644_0000513 | |||
| 2483 | Ga0495648_0004446 | |||
| 2484 | Ga0495663_0053960 | |||
| 2485 | Ga0495666_0002030 | |||
| 2486 | Ga0495666_0009646 | |||
| 2487 | Ga0495652_0000002 | |||
| 2488 | Ga0495652_0014420 | |||
| 2489 | Ga0495652_0016128 | |||
| 2490 | Ga0495652_0016289 | |||
| 2491 | Ga0495652_0032084 | |||
| 2492 | Ga0495652_0081927 | |||
| 2493 | Ga0495652_0134264 | |||
| 2494 | Ga0495652_0136862 | |||
| 2495 | Ga0495665_0003032 | |||
| 2496 | Ga0495665_0004686 | |||
| 2497 | Ga0495665_0028599 | |||
| 2498 | Ga0495665_0032349 | |||
| 2499 | Ga0495665_0041588 | |||
| 2500 | Ga0495665_0056169 | |||
| 2501 | Ga0495665_0074346 | |||
| 2502 | Ga0495640_0000002 | |||
| 2503 | Ga0495640_0000544 | |||
| 2504 | Ga0495640_0015185 | |||
| 2505 | Ga0495640_0108952 | |||
| 2506 | Ga0495640_0141892 | |||
| 2507 | Ga0495586_0037924 | |||
| 2508 | Ga0495587_0000001 | |||
| 2509 | Ga0495587_0000599 | |||
| 2510 | Ga0495587_0002174 | |||
| 2511 | Ga0495587_0003798 | |||
| 2512 | Ga0495587_0015799 | |||
| 2513 | Ga0495587_0048234 | |||
| 2514 | Ga0495587_0100622 | |||
| 2515 | Ga0495621_0006662 | |||
| 2516 | Ga0495645_0000002 | |||
| 2517 | Ga0495645_0008747 | |||
| 2518 | Ga0495645_0016750 | |||
| 2519 | Ga0495645_0026193 | |||
| 2520 | Ga0495645_0072642 | |||
| 2521 | Ga0495633_0004113 | |||
| 2522 | Ga0495633_0134210 | |||
| 2523 | Ga0495667_0000039 | |||
| 2524 | Ga0495667_0008770 | |||
| 2525 | Ga0495667_0023899 | |||
| 2526 | Ga0495667_0047251 | |||
| 2527 | Ga0495667_0056128 | |||
| 2528 | Ga0495656_0000091 | |||
| 2529 | Ga0495656_0046837 | |||
| 2530 | Ga0495634_0000010 | |||
| 2531 | Ga0495634_0023758 | |||
| 2532 | Ga0495634_0126332 | |||
| 2533 | Ga0495634_0182707 | |||
| 2534 | Ga0495625_0000012 | |||
| 2535 | Ga0495635_0000001 | |||
| 2536 | Ga0495635_0004203 | |||
| 2537 | Ga0495635_0006281 | |||
| 2538 | Ga0495635_0018687 | |||
| 2539 | Ga0495659_0059779 | |||
| 2540 | Ga0495588_0010028 | |||
| 2541 | Ga0495588_0033132 | |||
| 2542 | Ga0495588_0041177 | |||
| 2543 | Ga0495657_0000042 | |||
| 2544 | Ga0495657_0001942 | |||
| 2545 | Ga0495657_0031508 | |||
| 2546 | Ga0495657_0107094 | |||
| 2547 | Ga0495599_0000013 | |||
| 2548 | Ga0495599_0008880 | |||
| 2549 | Ga0495599_0042108 | |||
| 2550 | Ga0495623_0000050 | |||
| 2551 | Ga0495623_0006342 | |||
| 2552 | Ga0495623_0028043 | |||
| 2553 | Ga0495623_0035033 | |||
| 2554 | Ga0495623_0088991 | |||
| 2555 | Ga0495646_0000009 | |||
| 2556 | Ga0495646_0021007 | |||
| 2557 | Ga0495646_0090311 | |||
| 2558 | Ga0495646_0096072 | |||
| 2559 | Ga0495647_0013620 | |||
| 2560 | Ga0495647_0057352 | |||
| 2561 | Ga0495658_0000065 | |||
| 2562 | Ga0495658_0003665 | |||
| 2563 | Ga0495658_0086163 | |||
| 2564 | Ga0495669_0038062 | |||
| 2565 | Ga0495613_0006292 | |||
| 2566 | Ga0495613_0009544 | |||
| 2567 | Ga0495624_0001118 | |||
| 2568 | Ga0495624_0001463 | |||
| 2569 | Ga0495624_0011107 | |||
| 2570 | Ga0495624_0062489 | |||
| 2571 | Ga0495624_0082189 | |||
| 2572 | Ga0495670_0000506 | |||
| 2573 | Ga0495671_0068569 | |||
| 2574 | Ga0495671_0101024 | |||
| 2575 | Ga0495649_0095725 | |||
| 2576 | Ga0495600_0001478 | |||
| 2577 | Ga0495600_0008371 | |||
| 2578 | Ga0495600_0016518 | |||
| 2579 | Ga0495600_0038130 | |||
| 2580 | Ga0495600_0141975 | |||
| 2581 | Ga0495660_0100064 | |||
| 2582 | Ga0495581_0002630 | |||
| 2583 | Ga0495581_0007122 | |||
| 2584 | Ga0495581_0008727 | |||
| 2585 | Ga0495581_0036712 | |||
| 2586 | Ga0495581_0044466 | |||
| 2587 | Ga0495581_0073821 | |||
| 2588 | Ga0495581_0084489 | |||
| 2589 | Ga0495604_0000069 | |||
| 2590 | Ga0495604_0014602 | |||
| 2591 | Ga0495604_0029121 | |||
| 2592 | Ga0495604_0073607 | |||
| 2593 | Ga0495604_0183139 | |||
| 2594 | Ga0495674_0000002 | |||
| 2595 | Ga0495674_0002892 | |||
| 2596 | Ga0495674_0033064 | |||
| 2597 | Ga0495674_0036782 | |||
| 2598 | Ga0495674_0066059 | |||
| 2599 | Ga0495674_0100049 | |||
| 2600 | Ga0495674_0126427 | |||
| 2601 | Ga0495674_0243184 | |||
| 2602 | Ga0495672_0011413 | |||
| 2603 | Ga0495672_0033677 | |||
| 2604 | Ga0495676_0015401 | |||
| 2605 | Ga0495676_0046916 | |||
| 2606 | Ga0495680_0000313 | |||
| 2607 | Ga0495680_0000328 | |||
| 2608 | Ga0495680_0009069 | |||
| 2609 | Ga0495680_0014330 | |||
| 2610 | Ga0495680_0025994 | |||
| 2611 | Ga0495680_0026513 | |||
| 2612 | Ga0495680_0049430 | |||
| 2613 | Ga0495680_0069978 | |||
| 2614 | Ga0495680_0179285 | |||
| 2615 | Ga0495675_0000245 | |||
| 2616 | Ga0495677_0094565 | |||
| 2617 | Ga0495679_027413 | |||
| 2618 | Ga0495679_033413 | |||
| 2619 | Ga0495673_0075718 | |||
| 2620 | Ga0495684_0000016 | |||
| 2621 | Ga0495684_0000928 | |||
| 2622 | Ga0495684_0001073 | |||
| 2623 | Ga0495684_0001824 | |||
| 2624 | Ga0495684_0056185 | |||
| 2625 | Ga0495684_0175543 | |||
| 2626 | Ga0495684_0364734 | |||
| 2627 | Ga0495686_0001995 | |||
| 2628 | Ga0495593_0000809 | |||
| 2629 | Ga0495593_0001500 | |||
| 2630 | Ga0495593_0004700 | |||
| 2631 | Ga0495593_0033052 | |||
| 2632 | Ga0495593_0061049 | |||
| 2633 | Ga0495593_0082694 | |||
| 2634 | Ga0495602_0000024 | |||
| 2635 | Ga0495602_0005919 | |||
| 2636 | Ga0495602_0021956 | |||
| 2637 | Ga0495614_0003207 | |||
| 2638 | Ga0496100_0002405 | |||
| 2639 | Ga0496100_0003039 | |||
| 2640 | Ga0496100_0016920 | |||
| 2641 | Ga0496100_0050540 | |||
| 2642 | Ga0496100_0200898 | |||
| 2643 | Ga0496100_0384940 | |||
| 2644 | Ga0496101_0001763 | |||
| 2645 | Ga0496101_0003783 | |||
| 2646 | Ga0496101_0015757 | |||
| 2647 | Ga0496101_0044395 | |||
| 2648 | Ga0496101_0060405 | |||
| 2649 | Ga0496101_0134347 | |||
| 2650 | Ga0496101_0178331 | |||
| 2651 | Ga0496101_0235241 | |||
| 2652 | Ga0496101_0321250 | |||
| 2653 | Ga0496101_0413151 | |||
| 2654 | Ga0496102_0001184 | |||
| 2655 | Ga0496102_0005532 | |||
| 2656 | Ga0496102_0011515 | |||
| 2657 | Ga0496102_0112166 | |||
| 2658 | Ga0496102_0129686 | |||
| 2659 | Ga0496103_0003142 | |||
| 2660 | Ga0496103_0005741 | |||
| 2661 | Ga0496103_0009796 | |||
| 2662 | Ga0496103_0010831 | |||
| 2663 | Ga0496103_0022961 | |||
| 2664 | Ga0496103_0051842 | |||
| 2665 | Ga0496104_0000217 | |||
| 2666 | Ga0496104_0001112 | |||
| 2667 | Ga0496104_0001920 | |||
| 2668 | Ga0496104_0002202 | |||
| 2669 | Ga0496104_0010108 | |||
| 2670 | Ga0496104_0041321 | |||
| 2671 | Ga0496104_0043848 | |||
| 2672 | Ga0496104_0107613 | |||
| 2673 | Ga0496104_0111996 | |||
| 2674 | Ga0496104_0140324 | |||
| 2675 | Ga0496104_0292062 | |||
| 2676 | Ga0496105_0000424 | |||
| 2677 | Ga0496105_0008853 | |||
| 2678 | Ga0496105_0010753 | |||
| 2679 | Ga0496105_0020488 | |||
| 2680 | Ga0496105_0066987 | |||
| 2681 | Ga0496105_0090307 | |||
| 2682 | Ga0496105_0250926 | |||
| 2683 | Ga0496106_0001028 | |||
| 2684 | Ga0496106_0005882 | |||
| 2685 | Ga0496106_0007383 | |||
| 2686 | Ga0496106_0008421 | |||
| 2687 | Ga0496106_0017304 | |||
| 2688 | Ga0496106_0026339 | |||
| 2689 | Ga0496106_0026733 | |||
| 2690 | Ga0496106_0253802 | |||
| 2691 | Ga0496107_0000509 | |||
| 2692 | Ga0496107_0003427 | |||
| 2693 | Ga0496107_0014192 | |||
| 2694 | Ga0496107_0019213 | |||
| 2695 | Ga0496107_0040165 | |||
| 2696 | Ga0496107_0099576 | |||
| 2697 | Ga0496107_0222569 | |||
| 2698 | Ga0496107_0229736 | |||
| 2699 | Ga0496107_0371454 | |||
| 2700 | Ga0496108_0010986 | |||
| 2701 | Ga0496108_0012311 | |||
| 2702 | Ga0496108_0062932 | |||
| 2703 | Ga0496108_0080066 | |||
| 2704 | Ga0496108_0154080 | |||
| 2705 | Ga0496108_0253034 | |||
| 2706 | Ga0496108_0319159 | |||
| 2707 | Ga0496109_0001304 | |||
| 2708 | Ga0496109_0006308 | |||
| 2709 | Ga0496109_0013194 | |||
| 2710 | Ga0496109_0016348 | |||
| 2711 | Ga0496109_0017528 | |||
| 2712 | Ga0496109_0066202 | |||
| 2713 | Ga0496109_0119756 | |||
| 2714 | Ga0496109_0122629 | |||
| 2715 | Ga0496110_0000973 | |||
| 2716 | Ga0496110_0002430 | |||
| 2717 | Ga0496110_0003313 | |||
| 2718 | Ga0496110_0005366 | |||
| 2719 | Ga0496110_0009961 | |||
| 2720 | Ga0496110_0014024 | |||
| 2721 | Ga0496110_0034472 | |||
| 2722 | Ga0496110_0045595 | |||
| 2723 | Ga0496110_0075530 | |||
| 2724 | Ga0496110_0097096 | |||
| 2725 | Ga0496110_0098571 | |||
| 2726 | Ga0496110_0111838 | |||
| 2727 | Ga0496110_0127002 | |||
| 2728 | Ga0496110_0218297 | |||
| 2729 | Ga0496111_0000315 | |||
| 2730 | Ga0496111_0002323 | |||
| 2731 | Ga0496111_0003314 | |||
| 2732 | Ga0496111_0003533 | |||
| 2733 | Ga0496111_0011769 | |||
| 2734 | Ga0496111_0042567 | |||
| 2735 | Ga0496111_0044287 | |||
| 2736 | Ga0496111_0047206 | |||
| 2737 | Ga0496111_0055762 | |||
| 2738 | Ga0496111_0063460 | |||
| 2739 | Ga0496111_0063536 | |||
| 2740 | Ga0496111_0103789 | |||
| 2741 | Ga0496112_0009043 | |||
| 2742 | Ga0496112_0013631 | |||
| 2743 | Ga0496112_0015062 | |||
| 2744 | Ga0496112_0022357 | |||
| 2745 | Ga0496112_0054415 | |||
| 2746 | Ga0496112_0090794 | |||
| 2747 | Ga0496112_0090957 | |||
| 2748 | Ga0496112_0121718 | |||
| 2749 | Ga0496113_0000218 | |||
| 2750 | Ga0496113_0008621 | |||
| 2751 | Ga0496113_0011117 | |||
| 2752 | Ga0496113_0014177 | |||
| 2753 | Ga0496113_0026670 | |||
| 2754 | Ga0496113_0055008 | |||
| 2755 | Ga0496113_0126245 | |||
| 2756 | Ga0496114_0001306 | |||
| 2757 | Ga0496114_0011259 | |||
| 2758 | Ga0496114_0014735 | |||
| 2759 | Ga0496114_0044883 | |||
| 2760 | Ga0496114_0076917 | |||
| 2761 | Ga0496114_0077791 | |||
| 2762 | Ga0496114_0098426 | |||
| 2763 | Ga0496114_0210099 | |||
| 2764 | Ga0496115_0011530 | |||
| 2765 | Ga0496115_0014069 | |||
| 2766 | Ga0496115_0039477 | |||
| 2767 | Ga0496115_0042694 | |||
| 2768 | Ga0496115_0047308 | |||
| 2769 | Ga0496115_0063814 | |||
| 2770 | Ga0496115_0104992 | |||
| 2771 | Ga0496115_0245420 | |||
| 2772 | Ga0496115_0271854 | |||
| 2773 | Ga0496118_0029210 | |||
| 2774 | Ga0496119_0002669 | |||
| 2775 | Ga0496121_0007863 | |||
| 2776 | Ga0496121_0013732 | |||
| 2777 | Ga0496121_0039594 | |||
| 2778 | Ga0496122_0002391 | |||
| 2779 | Ga0496123_0003029 | |||
| 2780 | Ga0496126_0263095 | |||
| 2781 | Ga0501032_0289553 | |||
| 2782 | Ga0501033_0010955 | |||
| 2783 | Ga0501033_0060740 | |||
| 2784 | Ga0501033_0077246 | |||
| 2785 | Ga0501033_0223876 | |||
| 2786 | Ga0501034_0000593 | |||
| 2787 | Ga0501034_0003588 | |||
| 2788 | Ga0501034_0074896 | |||
| 2789 | Ga0501034_0098547 | |||
| 2790 | Ga0501034_0116919 | |||
| 2791 | Ga0501034_0508197 | |||
| 2792 | Ga0501036_0001313 | |||
| 2793 | Ga0501036_0042140 | |||
| 2794 | Ga0501036_0081419 | |||
| 2795 | Ga0501036_0126272 | |||
| 2796 | Ga0501036_0178315 | |||
| 2797 | Ga0501036_0263095 | |||
| 2798 | Ga0501037_0016752 | |||
| 2799 | Ga0501037_0021673 | |||
| 2800 | Ga0501037_0046626 | |||
| 2801 | Ga0501037_0098724 | |||
| 2802 | Ga0501038_0007428 | |||
| 2803 | Ga0501038_0063407 | |||
| 2804 | Ga0501038_0076825 | |||
| 2805 | Ga0501038_0264128 | |||
| 2806 | Ga0501038_0303510 | |||
| 2807 | Ga0501039_0022541 | |||
| 2808 | Ga0501039_0069025 | |||
| 2809 | Ga0501039_0084247 | |||
| 2810 | Ga0501039_0130674 | |||
| 2811 | Ga0501039_0314428 | |||
| 2812 | Ga0501040_0032088 | |||
| 2813 | Ga0501040_0222102 | |||
| 2814 | Ga0501041_0058110 | |||
| 2815 | Ga0501041_0094593 | |||
| 2816 | Ga0501042_0114506 | |||
| 2817 | Ga0501042_0195303 | |||
| 2818 | Ga0501043_0032193 | |||
| 2819 | Ga0501043_0063574 | |||
| 2820 | Ga0501043_0083864 | |||
| 2821 | Ga0501043_0102847 | |||
| 2822 | Ga0501046_0002900 | |||
| 2823 | Ga0501046_0005890 | |||
| 2824 | Ga0501046_0127900 | |||
| 2825 | Ga0501046_0247967 | |||
| 2826 | Ga0501047_0001425 | |||
| 2827 | Ga0501047_0022734 | |||
| 2828 | Ga0501047_0048449 | |||
| 2829 | Ga0501047_0097901 | |||
| 2830 | Ga0501047_0126688 | |||
| 2831 | Ga0501047_0128295 | |||
| 2832 | Ga0501047_0131968 | |||
| 2833 | Ga0501048_0001752 | |||
| 2834 | Ga0501048_0015643 | |||
| 2835 | Ga0501048_0047698 | |||
| 2836 | Ga0501048_0073887 | |||
| 2837 | Ga0501048_0193556 | |||
| 2838 | Ga0501048_0281688 | |||
| 2839 | Ga0501067_0023420 | |||
| 2840 | Ga0501069_0003119 | |||
| 2841 | Ga0501070_0020547 | |||
| 2842 | Ga0501070_0056637 | |||
| 2843 | Ga0501070_0094072 | |||
| 2844 | Ga0501070_0114437 | |||
| 2845 | Ga0501070_0141509 | |||
| 2846 | Ga0501070_0166139 | |||
| 2847 | Ga0501071_0050928 | |||
| 2848 | Ga0501071_0143544 | |||
| 2849 | Ga0501071_0222903 | |||
| 2850 | Ga0501072_0040845 | |||
| 2851 | Ga0501072_0074044 | |||
| 2852 | Ga0501072_0088508 | |||
| 2853 | Ga0501072_0111280 | |||
| 2854 | Ga0501073_0060235 | |||
| 2855 | Ga0501073_0063745 | |||
| 2856 | Ga0501074_0003293 | |||
| 2857 | Ga0501074_0053538 | |||
| 2858 | Ga0501074_0085454 | |||
| 2859 | Ga0501075_0135541 | |||
| 2860 | Ga0501075_0207424 | |||
| 2861 | Ga0501075_0351370 | |||
| 2862 | Ga0501076_0050078 | |||
| 2863 | Ga0501076_0091065 | |||
| 2864 | Ga0501076_0124978 | |||
| 2865 | Ga0501076_0308837 | |||
| 2866 | Ga0501077_0019666 | |||
| 2867 | Ga0501077_0085097 | |||
| 2868 | Ga0501077_0090493 | |||
| 2869 | Ga0501079_0005101 | |||
| 2870 | Ga0501079_0066375 | |||
| 2871 | Ga0501079_0085626 | |||
| 2872 | Ga0501079_0219527 | |||
| 2873 | Ga0501079_0402719 | |||
| 2874 | Ga0501079_0578200 | |||
| 2875 | Ga0501080_0002905 | |||
| 2876 | Ga0501080_0007783 | |||
| 2877 | Ga0501080_0015270 | |||
| 2878 | Ga0501080_0025023 | |||
| 2879 | Ga0501080_0027138 | |||
| 2880 | Ga0501080_0081094 | |||
| 2881 | Ga0501080_0092084 | |||
| 2882 | Ga0501080_0303916 | |||
| 2883 | Ga0501081_0000115 | |||
| 2884 | Ga0501081_0041663 | |||
| 2885 | Ga0501081_0065915 | |||
| 2886 | Ga0501083_0000907 | |||
| 2887 | Ga0501083_0051915 | |||
| 2888 | Ga0501083_0066550 | |||
| 2889 | Ga0501083_0137240 | |||
| 2890 | Ga0501035_0000672 | |||
| 2891 | Ga0501035_0129635 | |||
| 2892 | Ga0501035_0140538 | |||
| 2893 | Ga0501035_0222623 | |||
| 2894 | Ga0501035_0385350 | |||
| 2895 | Ga0501044_0003604 | |||
| 2896 | Ga0501044_0005514 | |||
| 2897 | Ga0501044_0011063 | |||
| 2898 | Ga0501044_0036817 | |||
| 2899 | Ga0501044_0312533 | |||
| 2900 | Ga0501045_0036085 | |||
| 2901 | Ga0501045_0069102 | |||
| 2902 | nmdc:mga03683_111459_c1 | |||
| 2903 | nmdc:mga03683_2647_c2 | |||
| 2904 | nmdc:mga0yw44_103397_c1 | |||
| 2905 | nmdc:mga0yw44_78820_c1 | |||
| 2906 | nmdc:mga0k408_17687_c1 | |||
| 2907 | nmdc:mga0k408_6014_c1 | |||
| 2908 | nmdc:mga06z11_68606_c1 | |||
| 2909 | nmdc:mga07m45_14790_c1 | |||
| 2910 | nmdc:mga07m45_69058_c1 | |||
| 2911 | nmdc:mga05p37_151_c1 | |||
| 2912 | nmdc:mga05p37_158006_c1 | |||
| 2913 | nmdc:mga05p37_19658_c1 | |||
| 2914 | nmdc:mga05p37_205256_c1 | |||
| 2915 | nmdc:mga05p37_354005_c1 | |||
| 2916 | nmdc:mga05p37_486326_c1 | |||
| 2917 | nmdc:mga05p37_7272_c1 | |||
| 2918 | nmdc:mga05p37_76_c1 | |||
| 2919 | nmdc:mga05p37_835274_c1 | |||
| 2920 | nmdc:mga09592_41035_c1 | |||
| 2921 | nmdc:mga09592_6099_c1 | |||
| 2922 | nmdc:mga0qj67_61979_c1 | |||
| 2923 | nmdc:mga0qj67_842_c1 | |||
| 2924 | nmdc:mga06r32_114164_c1 | |||
| 2925 | nmdc:mga06r32_134_c1 | |||
| 2926 | nmdc:mga06r32_41813_c1 | |||
| 2927 | nmdc:mga06r32_755_c1 | |||
| 2928 | nmdc:mga06r32_95862_c1 | |||
| 2929 | nmdc:mga08y16_108_c1 | |||
| 2930 | nmdc:mga08y16_11999_c1 | |||
| 2931 | nmdc:mga08y16_13020_c1 | |||
| 2932 | nmdc:mga08y16_16965_c1 | |||
| 2933 | nmdc:mga08y16_178114_c1 | |||
| 2934 | nmdc:mga08y16_204344_c1 | |||
| 2935 | nmdc:mga08y16_294692_c1 | |||
| 2936 | nmdc:mga08y16_376567_c1 | |||
| 2937 | nmdc:mga08y16_4279_c1 | |||
| 2938 | nmdc:mga08y16_5583_c1 | |||
| 2939 | nmdc:mga08y16_88424_c1 | |||
| 2940 | nmdc:mga0n895_265_c1 | |||
| 2941 | nmdc:mga0n895_2675_c1 | |||
| 2942 | nmdc:mga0n895_2995_c1 | |||
| 2943 | nmdc:mga0n895_30642_c1 | |||
| 2944 | nmdc:mga0n895_35580_c1 | |||
| 2945 | nmdc:mga0n895_363615_c1 | |||
| 2946 | nmdc:mga0rr50_362627_c1 | |||
| 2947 | nmdc:mga0rr50_60567_c1 | |||
| 2948 | nmdc:mga0rr50_642_c1 | |||
| 2949 | nmdc:mga08x19_35_c1 | |||
| 2950 | nmdc:mga08x19_8004_c1 | |||
| 2951 | nmdc:mga0a205_1049_c1 | |||
| 2952 | nmdc:mga0a205_146_c1 | |||
| 2953 | nmdc:mga0a205_315959_c1 | |||
| 2954 | nmdc:mga0a205_464753_c1 | |||
| 2955 | Ga0495601_0000001 | |||
| 2956 | Ga0495601_0000355 | |||
| 2957 | Ga0495601_0000589 | |||
| 2958 | Ga0495601_0002218 | |||
| 2959 | Ga0495601_0027567 | |||
| 2960 | Ga0495601_0041071 | |||
| 2961 | Ga0495601_0052633 | |||
| 2962 | Ga0495601_0174202 | |||
| 2963 | Ga0495612_0000017 | |||
| 2964 | Ga0495612_0001305 | |||
| 2965 | Ga0495612_0002281 | |||
| 2966 | Ga0495612_0002637 | |||
| 2967 | Ga0495612_0005030 | |||
| 2968 | Ga0495612_0030943 | |||
| 2969 | Ga0495595_0000010 | |||
| 2970 | Ga0495595_0002470 | |||
| 2971 | Ga0495595_0005994 | |||
| 2972 | Ga0495595_0010133 | |||
| 2973 | Ga0495595_0010381 | |||
| 2974 | Ga0495595_0027953 | |||
| 2975 | Ga0495619_0000004 | |||
| 2976 | Ga0495619_0000048 | |||
| 2977 | Ga0495619_0000256 | |||
| 2978 | Ga0495619_0004051 | |||
| 2979 | Ga0495619_0005443 | |||
| 2980 | Ga0495619_0007179 | |||
| 2981 | Ga0495619_0016131 | |||
| 2982 | Ga0495619_0024473 | |||
| 2983 | Ga0495619_0027188 | |||
| 2984 | Ga0495619_0108884 | |||
| 2985 | Ga0495619_0131097 | |||
| 2986 | Ga0500644_0000933 | |||
| 2987 | Ga0500651_0037963 | |||
| 2988 | Ga0500651_0102768 | |||
| 2989 | Ga0500641_0019072 | |||
| 2990 | Ga0500650_0044577 | |||
| 2991 | Ga0500555_016514 | |||
| 2992 | Ga0500556_0000068 | |||
| 2993 | Ga0500595_000003 | |||
| 2994 | Ga0500595_003914 | |||
| 2995 | Ga0500595_026787 | |||
| 2996 | Ga0500652_001172 | |||
| 2997 | Ga0500652_039202 | |||
| 2998 | Ga0500652_068971 | |||
| 2999 | Ga0500616_0000002 | |||
| 3000 | Ga0500616_0004397 | |||
| 3001 | Ga0500616_0034790 | |||
| 3002 | Ga0500616_0089834 | |||
| 3003 | Ga0500622_0138552 | |||
| 3004 | Ga0500645_000078 | |||
| 3005 | Ga0500645_008422 | |||
| 3006 | Ga0501084_0009668 | |||
| 3007 | Ga0501084_0034716 | |||
| 3008 | Ga0501084_0128439 | |||
| 3009 | Ga0501084_0287667 | |||
| 3010 | Ga0501084_0307775 | |||
| 3011 | Ga0501084_0332364 | |||
| 3012 | Ga0501082_0000510 | |||
| 3013 | Ga0501082_0030402 | |||
| 3014 | Ga0501082_0038034 | |||
| 3015 | Ga0501082_0051708 | |||
| 3016 | Ga0501082_0063448 | |||
| 3017 | Ga0501082_0095928 | |||
| 3018 | Ga0501082_0429790 | |||
| 3019 | Ga0530510_0037742 | |||
| 3020 | Ga0530510_0114950 | |||
| 3021 | Ga0530510_0262622 | |||
| 3022 | 2513635471 | |||
| 3023 | 2514014860 | |||
| 3024 | 2515628579 | |||
| 3025 | 2523382649 | |||
| 3026 | 2524465008 | |||
| 3027 | 2535520930 | |||
| 3028 | 2644291236 | |||
| 3029 | 2838685997 | |||
| 3030 | 2838687808 | |||
| 3031 | 2838699640 | |||
| 3032 | 2838713059 | |||
| 3033 | 2842082555 | |||
| 3034 | 2842123309 | |||
| 3035 | 2842242245 | |||
| 3036 | 2842272161 | |||
| 3037 | 2842296311 | |||
| 3038 | 2842375260 | |||
| 3039 | 2842382863 | |||
| 3040 | 2842389422 | |||
| 3041 | 2844462284 | |||
| 3042 | 2874594804 | |||
| 3043 | 2876774354 | |||
| 3044 | 2876822856 | |||
| 3045 | 2879078509 | |||
| 3046 | 2879129830 | |||
| 3047 | 2879146155 | |||
| 3048 | 2919453271 | |||
| 3049 | 2919717988 | |||
| 3050 | 2935899207 | |||
| 3051 | 639651250 | |||
| 3052 | 8001847189 | |||
| 3053 | 8005549870 | |||
| 3054 | 8056681937 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ibz-assembly1.cif.gz_D | crystal structure of a novel cyclase (pfam04199). | 0.8966 | 17 | 317 |
| 5ibz-assembly1.cif.gz_D | crystal structure of a novel cyclase (pfam04199). | 0.8908 | 17 | 317 |
| 5ibz-assembly1.cif.gz_A | crystal structure of a novel cyclase (pfam04199). | 0.8906 | 14 | 317 |
| 5ibz-assembly1.cif.gz_B | crystal structure of a novel cyclase (pfam04199). | 0.8872 | 14 | 317 |
| 5ibz-assembly1.cif.gz_C | crystal structure of a novel cyclase (pfam04199). | 0.8785 | 17 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4cobB00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7846 | 51 | 315 | 3.50.30.50 |
| 5nmpC00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7745 | 51 | 315 | 3.50.30.50 |
| 4cobB00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7675 | 51 | 315 | 3.50.30.50 |
| af_Q2G123_4_245_3.50.30.50 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7554 | 51 | 316 | 3.50.30.50 |
| 3krvB00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7486 | 49 | 315 | 3.50.30.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849GSB7-F1-model_v4 | Cyclase family protein | 0.9942 | 118 | 317 |
GO:0004061
GO:0019441 |
| AF-A0A848TGR9-F1-model_v4 | Cyclase family protein | 0.9894 | 196 | 317 |
GO:0004061
GO:0019441 |
| AF-A0A849GSB7-F1-model_v4 | Cyclase family protein | 0.9844 | 118 | 317 |
GO:0004061
GO:0019441 |
| AF-A0A7W5AG36-F1-model_v4 | Kynurenine formamidase | 0.9836 | 157 | 317 |
GO:0004061
GO:0019441 |
| AF-A0A2V6Y4V2-F1-model_v4 | Cyclase | 0.9832 | 180 | 317 |
GO:0004061
GO:0019441 |