F494575

General Info

Members Datasets Scaffolds Average Seq Length
1527 530 3054 319

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0009196|Ga0373953_0009196_2043_3224
Length 385
Sequence MLDRPTDHAGGFEIHAPSIEKFRWPCEPAQPAAAIFRMDQDEPARHNRRGGARPVYGRGDRTGKQGTMDLKVGKQAIRDASNKLKNWGRWGADDQIGTLNHVTPEDIVQAASLICSGKVFALGIPLDRSGPQNGLFGGRWNPIHTMLATGTDAIAGRQDIVPNLRYADDSINMPVQCATHWDALGHIFYEDKMYNGFDARLVDSNGLGKLGIEHAKSKMVGRGVLLDIARHKGVRHLKDGQGISNDDLDSCAKAQNIQIRRGDFVIVRTGQMERCLEEKQWGGFAGGDAPGVKFENCYWCQDKQIAAICSDTWGVEVRPNETTEANQPWHWVVIPAMGLTMGEMFYLKDLAEDCAADGTYEFFFCGPPLVITGGTGSPINPQAIK

Samples

Sample ID Description Type Environment
1 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
10 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
11 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
15 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
22 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
23 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
24 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
25 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
26 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
38 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
68 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
88 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
117 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
118 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
119 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
120 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
121 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
122 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
123 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
124 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
125 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
126 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
127 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
128 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
131 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
134 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
138 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
157 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
158 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
176 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
177 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
178 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
179 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
180 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
268 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
269 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
270 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
271 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
272 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
273 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
274 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
275 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
276 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
277 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
278 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
279 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
282 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
283 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
284 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
285 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
286 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
287 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
288 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
289 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
290 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
291 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
292 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
293 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
294 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
295 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
296 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
297 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
298 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
300 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
302 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
303 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
304 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
305 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
306 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
307 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
308 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
309 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
310 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
311 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
312 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
313 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
314 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
315 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
316 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
318 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
319 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
331 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
332 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
333 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
334 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
335 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
336 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
337 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
338 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
339 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
340 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
345 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
346 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
347 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
348 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
349 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
350 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
351 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
360 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
365 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
366 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
367 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
373 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
374 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
375 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
376 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
377 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
378 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
379 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
380 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
381 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
382 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
386 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
387 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
388 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
389 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
390 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
391 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
392 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
398 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
401 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
402 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
403 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
404 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
405 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
406 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
407 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
408 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
409 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
410 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
411 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
412 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
413 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
414 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
415 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
416 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
417 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
418 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
419 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
420 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
421 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
422 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
423 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
424 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
425 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
426 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
429 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
430 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
431 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
432 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
433 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
434 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
435 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
450 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
451 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
452 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
453 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
454 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
455 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
456 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
457 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
458 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
459 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
460 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
461 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
462 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
466 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
469 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
470 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
471 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
472 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
473 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
474 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
475 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
476 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
477 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
478 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
479 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
482 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
483 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
484 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
485 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
486 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
487 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
488 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
489 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
490 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
491 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
492 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
493 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
494 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
495 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
496 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
497 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
498 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
499 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
500 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
501 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
502 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
503 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
504 2643221651 Afipia sp. Root123D2 Isolate Unclassified
505 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
506 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
507 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
508 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
509 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
510 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
511 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
512 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
513 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
514 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
515 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
516 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
517 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
518 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
519 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
520 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
521 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
522 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
523 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
524 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
525 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
526 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
527 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
528 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
529 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
530 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.07
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.34
Nodule 1.7
Rhizoplane 8.84
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373953_0009196 3300035117 Bacteria 3387
2 SwRhRL2b_contig_2503292 2162886007 Bacteria 1713
3 2214683826 2209111006 Bacteria 4506
4 ARcpr5oldR_c000037 3300000041 Bacteria 26008
5 ARSoilYngRDRAFT_c00113 3300000042 Bacteria 13805
6 ARcpr5yngRDRAFT_c000014 3300000043 Bacteria 31433
7 ARSoilOldRDRAFT_c000005 3300000044 Bacteria 61735
8 ARCol0oldRDRAFT_c00471 3300000045 Bacteria 3754
9 LJQas_1002035 3300000549 Bacteria 2893
10 ARCol0yngRDRAFT_1000099 3300000652 Bacteria 16028
11 JGI24032J14994_100117 3300001430 Bacteria 3699
12 JGI24736J21556_1006279 3300001904 Bacteria 2002
13 JGI24741J21665_1008107 3300001915 Bacteria 1997
14 JGI24746J21847_1000648 3300001977 Bacteria 5315
15 JGI24747J21853_1001209 3300001978 Bacteria 1888
16 JGI24739J22299_10000871 3300001989 Bacteria 11154
17 JGI24737J22298_10001901 3300001990 Bacteria 7464
18 JGI24737J22298_10009338 3300001990 Bacteria 3266
19 JGI24743J22301_10003516 3300001991 Bacteria 2485
20 JGI24735J21928_10032226 3300002067 Bacteria 1552
21 JGI24750J21931_1000439 3300002070 Bacteria 6761
22 JGI24745J21846_1005235 3300002073 Bacteria 1412
23 JGI24748J21848_1005097 3300002074 Bacteria 1520
24 JGI24738J21930_10000856 3300002075 Bacteria 8728
25 JGI24744J21845_10013124 3300002077 Bacteria 1673
26 JGI24035J26624_1001996 3300002126 Bacteria 1901
27 JGI24033J26618_1001158 3300002155 Bacteria 2569
28 JGI24034J26672_10001465 3300002239 Bacteria 3137
29 JGI24742J22300_10000464 3300002244 Bacteria 6004
30 JGI24751J29686_10004435 3300002459 Bacteria 2850
31 JGI25153J46596_10004386 3300003215 Bacteria 7611
32 JGI25404J52841_10003777 3300003659 Bacteria 3021
33 Ga0055536_1000524 3300003781 Bacteria 26496
34 Ga0055530_10004363 3300003791 Bacteria 7333
35 Ga0055540_1000054 3300003792 Bacteria 142505
36 Ga0055531_10000037 3300003794 Bacteria 144244
37 JGI25405J52794_10006055 3300003911 Bacteria 2202
38 Ga0065717_1002123 3300005276 Bacteria 2843
39 Ga0065716_1002073 3300005277 Bacteria 2333
40 Ga0065704_10092942 3300005289 Bacteria 2611
41 Ga0065712_10074695 3300005290 Bacteria 4031
42 Ga0065715_10012983 3300005293 Bacteria 3599
43 Ga0065715_10026218 3300005293 Bacteria 2017
44 Ga0065707_10105725 3300005295 Bacteria 2631
45 Ga0065707_10112520 3300005295 Bacteria 2358
46 Ga0070658_10084650 3300005327 Bacteria 2607
47 Ga0070658_10096229 3300005327 Bacteria 2444
48 Ga0070676_10061936 3300005328 Bacteria 2225
49 Ga0070683_100013405 3300005329 Bacteria 7149
50 Ga0070683_100085340 3300005329 Bacteria 2959
51 Ga0070690_100003948 3300005330 Bacteria 8189
52 Ga0070690_100015657 3300005330 Bacteria 4530
53 Ga0070690_100024575 3300005330 Bacteria 3706
54 Ga0070690_100177059 3300005330 Bacteria 1472
55 Ga0070670_100025087 3300005331 Bacteria 5129
56 Ga0070670_100099329 3300005331 Bacteria 2504
57 Ga0070670_100246105 3300005331 Bacteria 1557
58 Ga0070677_10002031 3300005333 Bacteria 6438
59 Ga0070677_10102370 3300005333 Bacteria 1265
60 Ga0068869_100035291 3300005334 Bacteria 3543
61 Ga0068869_100046878 3300005334 Bacteria 3119
62 Ga0068869_100224938 3300005334 Bacteria 1489
63 Ga0070666_10006171 3300005335 Bacteria 7371
64 Ga0070666_10023242 3300005335 Bacteria 4035
65 Ga0070666_10103024 3300005335 Bacteria 1969
66 Ga0070680_100003647 3300005336 Bacteria 11501
67 Ga0070680_100019478 3300005336 Bacteria 5376
68 Ga0070680_100168978 3300005336 Bacteria 1839
69 Ga0070680_100367024 3300005336 Bacteria 1225
70 Ga0070682_100002015 3300005337 Bacteria 11351
71 Ga0070682_100171895 3300005337 Bacteria 1507
72 Ga0068868_100017327 3300005338 Bacteria 5364
73 Ga0068868_100051217 3300005338 Bacteria 3246
74 Ga0068868_100083566 3300005338 Bacteria 2563
75 Ga0070660_100003870 3300005339 Bacteria 10336
76 Ga0070660_100050132 3300005339 Bacteria 3211
77 Ga0070660_100075994 3300005339 Bacteria 2630
78 Ga0070660_100186912 3300005339 Bacteria 1677
79 Ga0070689_100006859 3300005340 Bacteria 7922
80 Ga0070689_100067079 3300005340 Bacteria 2796
81 Ga0070689_100167813 3300005340 Bacteria 1777
82 Ga0070689_100185900 3300005340 Bacteria 1690
83 Ga0070691_10004357 3300005341 Bacteria 6432
84 Ga0070691_10016445 3300005341 Bacteria 3398
85 Ga0070691_10044926 3300005341 Bacteria 2096
86 Ga0070687_100009855 3300005343 Bacteria 4103
87 Ga0070687_100032499 3300005343 Bacteria 2568
88 Ga0070687_100093310 3300005343 Bacteria 1669
89 Ga0070687_100175903 3300005343 Bacteria 1278
90 Ga0070692_10007167 3300005345 Bacteria 4895
91 Ga0070692_10040235 3300005345 Bacteria 2390
92 Ga0070692_10176558 3300005345 Bacteria 1235
93 Ga0070668_100004252 3300005347 Bacteria 10629
94 Ga0070668_100045512 3300005347 Bacteria 3367
95 Ga0070668_100098468 3300005347 Bacteria 2314
96 Ga0070669_100008306 3300005353 Bacteria 7414
97 Ga0070669_100035049 3300005353 Bacteria 3635
98 Ga0070669_100202959 3300005353 Bacteria 1561
99 Ga0070675_100044149 3300005354 Bacteria 3645
100 Ga0070675_100055315 3300005354 Bacteria 3266
101 Ga0070671_100006278 3300005355 Bacteria 9471
102 Ga0070671_100009728 3300005355 Bacteria 7722
103 Ga0070671_100015968 3300005355 Bacteria 6067
104 Ga0070671_100033397 3300005355 Bacteria 4254
105 Ga0070673_100012672 3300005364 Bacteria 5798
106 Ga0070673_100024715 3300005364 Bacteria 4409
107 Ga0070673_100118258 3300005364 Bacteria 2206
108 Ga0070673_100373958 3300005364 Bacteria 1269
109 Ga0070688_100039413 3300005365 Bacteria 2891
110 Ga0070688_100071559 3300005365 Bacteria 2220
111 Ga0070659_100026221 3300005366 Bacteria 4482
112 Ga0070659_100232167 3300005366 Bacteria 1525
113 Ga0070659_100295491 3300005366 Bacteria 1349
114 Ga0070667_100002235 3300005367 Bacteria 17041
115 Ga0070667_100013854 3300005367 Bacteria 6665
116 Ga0070667_100122035 3300005367 Bacteria 2267
117 Ga0070667_100140030 3300005367 Bacteria 2118
118 Ga0070667_100158721 3300005367 Bacteria 1991
119 Ga0070703_10004958 3300005406 Bacteria 3714
120 Ga0070703_10007397 3300005406 Bacteria 3084
121 Ga0070709_10011016 3300005434 Bacteria 5024
122 Ga0070709_10047697 3300005434 Bacteria 2669
123 Ga0070709_10067778 3300005434 Bacteria 2293
124 Ga0070714_100015917 3300005435 Bacteria 6063
125 Ga0070714_100053843 3300005435 Bacteria 3437
126 Ga0070713_100037939 3300005436 Bacteria 3899
127 Ga0070713_100064751 3300005436 Bacteria 3069
128 Ga0070713_100383500 3300005436 Bacteria 1310
129 Ga0070710_10002325 3300005437 Bacteria 8998
130 Ga0070710_10050700 3300005437 Bacteria 2328
131 Ga0070710_10067770 3300005437 Bacteria 2048
132 Ga0070710_10085486 3300005437 Bacteria 1850
133 Ga0070701_10002068 3300005438 Bacteria 7625
134 Ga0070701_10043327 3300005438 Bacteria 2302
135 Ga0070701_10108305 3300005438 Bacteria 1549
136 Ga0070711_100032612 3300005439 Bacteria 3464
137 Ga0070711_100154160 3300005439 Bacteria 1735
138 Ga0070711_100196272 3300005439 Bacteria 1555
139 Ga0070705_100000528 3300005440 Bacteria 22027
140 Ga0070705_100010364 3300005440 Bacteria 4663
141 Ga0070705_100031013 3300005440 Bacteria 2956
142 Ga0070705_100347503 3300005440 Bacteria 1080
143 Ga0070700_100024158 3300005441 Bacteria 3565
144 Ga0070700_100034214 3300005441 Bacteria 3067
145 Ga0070700_100277436 3300005441 Bacteria 1214
146 Ga0070694_100006551 3300005444 Bacteria 7073
147 Ga0070694_100011702 3300005444 Bacteria 5436
148 Ga0070694_100032984 3300005444 Bacteria 3403
149 Ga0070694_100368662 3300005444 Bacteria 1117
150 Ga0070708_100001688 3300005445 Bacteria 16974
151 Ga0070708_100055433 3300005445 Bacteria 3525
152 Ga0070708_100080088 3300005445 Bacteria 2955
153 Ga0070663_100009202 3300005455 Bacteria 6109
154 Ga0070663_100159867 3300005455 Bacteria 1733
155 Ga0070678_100034053 3300005456 Bacteria 3544
156 Ga0070678_100079875 3300005456 Bacteria 2475
157 Ga0070678_100213473 3300005456 Bacteria 1600
158 Ga0070678_100235032 3300005456 Bacteria 1530
159 Ga0070662_100011393 3300005457 Bacteria 5868
160 Ga0070662_100035015 3300005457 Bacteria 3543
161 Ga0070662_100127028 3300005457 Bacteria 1961
162 Ga0070681_10018493 3300005458 Bacteria 6965
163 Ga0070681_10040914 3300005458 Bacteria 4643
164 Ga0070681_10065168 3300005458 Bacteria 3612
165 Ga0070681_10075350 3300005458 Bacteria 3334
166 Ga0070681_10204988 3300005458 Bacteria 1889
167 Ga0068867_100005646 3300005459 Bacteria 8867
168 Ga0070685_10017763 3300005466 Bacteria 3814
169 Ga0070706_100104467 3300005467 Bacteria 2635
170 Ga0070707_100317375 3300005468 Bacteria 1514
171 Ga0070698_100221862 3300005471 Bacteria 1824
172 Ga0070698_100251705 3300005471 Bacteria 1699
173 Ga0074259_12010023 3300005507 Bacteria 2242
174 Ga0070699_100000147 3300005518 Bacteria 66774
175 Ga0070699_100099812 3300005518 Bacteria 2544
176 Ga0070699_100271659 3300005518 Bacteria 1517
177 Ga0070679_100016159 3300005530 Bacteria 7192
178 Ga0070679_100072533 3300005530 Bacteria 3435
179 Ga0070679_100139867 3300005530 Bacteria 2401
180 Ga0070679_100299686 3300005530 Bacteria 1558
181 Ga0070679_100299893 3300005530 Bacteria 1557
182 Ga0070679_100369957 3300005530 Bacteria 1380
183 Ga0070684_100020014 3300005535 Bacteria 5547
184 Ga0070684_100079026 3300005535 Bacteria 2907
185 Ga0070684_100082068 3300005535 Bacteria 2854
186 Ga0070684_100095019 3300005535 Bacteria 2655
187 Ga0070697_100006410 3300005536 Bacteria 9109
188 Ga0070697_100023710 3300005536 Bacteria 4882
189 Ga0070697_100225527 3300005536 Bacteria 1597
190 Ga0068853_100003634 3300005539 Bacteria 11828
191 Ga0068853_100188539 3300005539 Bacteria 1873
192 Ga0070672_100044896 3300005543 Bacteria 3415
193 Ga0070672_100245750 3300005543 Bacteria 1506
194 Ga0070686_100007349 3300005544 Bacteria 6142
195 Ga0070686_100055380 3300005544 Bacteria 2540
196 Ga0070686_100124883 3300005544 Bacteria 1772
197 Ga0070686_100208658 3300005544 Bacteria 1405
198 Ga0070695_100002809 3300005545 Bacteria 10113
199 Ga0070695_100016690 3300005545 Bacteria 4446
200 Ga0070695_100121973 3300005545 Bacteria 1784
201 Ga0070695_100264948 3300005545 Bacteria 1256
202 Ga0070696_100002859 3300005546 Bacteria 11479
203 Ga0070696_100010889 3300005546 Bacteria 6095
204 Ga0070696_100013307 3300005546 Bacteria 5520
205 Ga0070693_100004174 3300005547 Bacteria 6817
206 Ga0070693_100025730 3300005547 Bacteria 3169
207 Ga0070693_100157032 3300005547 Bacteria 1446
208 Ga0070665_100004170 3300005548 Bacteria 15207
209 Ga0070665_100006016 3300005548 Bacteria 12404
210 Ga0070665_100195770 3300005548 Bacteria 2022
211 Ga0070704_100022446 3300005549 Bacteria 4107
212 Ga0070704_100034292 3300005549 Bacteria 3440
213 Ga0070704_100177163 3300005549 Bacteria 1702
214 Ga0068855_100026130 3300005563 Bacteria 6985
215 Ga0068855_100275071 3300005563 Bacteria 1871
216 Ga0070664_100114890 3300005564 Bacteria 2352
217 Ga0070664_100135966 3300005564 Bacteria 2161
218 Ga0068857_100019002 3300005577 Bacteria 6029
219 Ga0068857_100110898 3300005577 Bacteria 2466
220 Ga0068857_100126963 3300005577 Bacteria 2299
221 Ga0068854_100002965 3300005578 Bacteria 10527
222 Ga0068854_100039626 3300005578 Bacteria 3321
223 Ga0068856_100005225 3300005614 Bacteria 12811
224 Ga0068856_100058468 3300005614 Bacteria 3807
225 Ga0068856_100125316 3300005614 Bacteria 2572
226 Ga0068852_100047369 3300005616 Bacteria 3667
227 Ga0068852_100071202 3300005616 Bacteria 3052
228 Ga0068852_100123780 3300005616 Bacteria 2371
229 Ga0068859_100008928 3300005617 Bacteria 10125
230 Ga0068859_100039892 3300005617 Bacteria 4712
231 Ga0068864_100013072 3300005618 Bacteria 6875
232 Ga0068864_100030146 3300005618 Bacteria 4597
233 Ga0068864_100079478 3300005618 Bacteria 2871
234 Ga0068864_100175221 3300005618 Bacteria 1958
235 Ga0068866_10017245 3300005718 Bacteria 3244
236 Ga0068861_100016579 3300005719 Bacteria 5215
237 Ga0068861_100038178 3300005719 Bacteria 3574
238 Ga0068861_100038636 3300005719 Bacteria 3557
239 Ga0068861_100119494 3300005719 Bacteria 2124
240 Ga0068851_10058728 3300005834 Bacteria 1966
241 Ga0068870_10008836 3300005840 Bacteria 4547
242 Ga0068870_10023842 3300005840 Bacteria 3023
243 Ga0068870_10031956 3300005840 Bacteria 2671
244 Ga0068863_100053128 3300005841 Bacteria 3839
245 Ga0068863_100099230 3300005841 Bacteria 2767
246 Ga0068863_100135514 3300005841 Bacteria 2352
247 Ga0068863_100230610 3300005841 Bacteria 1786
248 Ga0068858_100026832 3300005842 Bacteria 5350
249 Ga0068858_100031436 3300005842 Bacteria 4930
250 Ga0068858_100121393 3300005842 Bacteria 2444
251 Ga0068858_100198645 3300005842 Bacteria 1896
252 Ga0068860_100003101 3300005843 Bacteria 17176
253 Ga0068860_100023337 3300005843 Bacteria 5979
254 Ga0068860_100052065 3300005843 Bacteria 3894
255 Ga0068860_100060789 3300005843 Bacteria 3590
256 Ga0068860_100073921 3300005843 Bacteria 3240
257 Ga0068860_100125246 3300005843 Bacteria 2462
258 Ga0068860_100172469 3300005843 Bacteria 2090
259 Ga0068862_100001380 3300005844 Bacteria 22519
260 Ga0068862_100010646 3300005844 Bacteria 7598
261 Ga0068862_100078169 3300005844 Bacteria 2866
262 Ga0081455_10000096 3300005937 Bacteria 96503
263 Ga0081455_10000200 3300005937 Bacteria 76013
264 Ga0081455_10000768 3300005937 Bacteria 41613
265 Ga0081455_10045366 3300005937 Bacteria 3825
266 Ga0081455_10174039 3300005937 Bacteria 1636
267 Ga0081538_10007210 3300005981 Bacteria 9653
268 Ga0081538_10008625 3300005981 Bacteria 8621
269 Ga0081538_10016051 3300005981 Bacteria 5761
270 Ga0081538_10094613 3300005981 Bacteria 1529
271 Ga0081540_1000158 3300005983 Bacteria 69951
272 Ga0081540_1006707 3300005983 Bacteria 8324
273 Ga0081540_1025349 3300005983 Bacteria 3414
274 Ga0081540_1057025 3300005983 Bacteria 1892
275 Ga0081540_1086712 3300005983 Bacteria 1390
276 Ga0081539_10020277 3300005985 Bacteria 4502
277 Ga0081539_10027151 3300005985 Bacteria 3632
278 Ga0070717_10086802 3300006028 Bacteria 2634
279 Ga0070717_10147771 3300006028 Bacteria 2031
280 Ga0070717_10157079 3300006028 Bacteria 1971
281 Ga0070717_10309908 3300006028 Bacteria 1404
282 Ga0075365_10044325 3300006038 Bacteria 2914
283 Ga0075365_10079762 3300006038 Bacteria 2215
284 Ga0075368_10045474 3300006042 Bacteria 1734
285 Ga0075363_100054897 3300006048 Bacteria 2132
286 Ga0075432_10010891 3300006058 Bacteria 3087
287 Ga0070715_10038507 3300006163 Bacteria 1986
288 Ga0070716_100004647 3300006173 Bacteria 6580
289 Ga0070716_100066278 3300006173 Bacteria 2106
290 Ga0070716_100199148 3300006173 Bacteria 1330
291 Ga0070712_100000210 3300006175 Bacteria 32927
292 Ga0070712_100161297 3300006175 Bacteria 1732
293 Ga0070712_100409334 3300006175 Bacteria 1122
294 Ga0075362_10084393 3300006177 Bacteria 1467
295 Ga0075367_10021871 3300006178 Bacteria 3581
296 Ga0075367_10098232 3300006178 Bacteria 1787
297 Ga0075367_10135444 3300006178 Bacteria 1523
298 Ga0075369_10070243 3300006186 Bacteria 1540
299 Ga0075366_10013125 3300006195 Bacteria 4711
300 Ga0097621_100029343 3300006237 Bacteria 4343
301 Ga0097621_100039390 3300006237 Bacteria 3796
302 Ga0097621_100088576 3300006237 Bacteria 2586
303 Ga0097621_100208169 3300006237 Bacteria 1700
304 Ga0075370_10028731 3300006353 Bacteria 3093
305 Ga0068871_100003405 3300006358 Bacteria 10932
306 Ga0068871_100012612 3300006358 Bacteria 6240
307 Ga0068871_100044409 3300006358 Bacteria 3574
308 Ga0075428_100003646 3300006844 Bacteria 16887
309 Ga0075428_100058917 3300006844 Bacteria 4205
310 Ga0075428_100065348 3300006844 Bacteria 3984
311 Ga0075428_100153837 3300006844 Bacteria 2499
312 Ga0075428_100155914 3300006844 Bacteria 2481
313 Ga0075428_100326861 3300006844 Bacteria 1647
314 Ga0075430_100000133 3300006846 Bacteria 47377
315 Ga0075430_100001032 3300006846 Bacteria 22005
316 Ga0075430_100022952 3300006846 Bacteria 5307
317 Ga0075431_100000602 3300006847 Bacteria 30370
318 Ga0075431_100001362 3300006847 Bacteria 22408
319 Ga0075431_100057185 3300006847 Bacteria 4023
320 Ga0075431_100074190 3300006847 Bacteria 3510
321 Ga0075431_100120962 3300006847 Bacteria 2702
322 Ga0075433_10000328 3300006852 Bacteria 29209
323 Ga0075433_10028663 3300006852 Bacteria 4736
324 Ga0075433_10136920 3300006852 Bacteria 2177
325 Ga0075434_100001713 3300006871 Bacteria 18786
326 Ga0075434_100006226 3300006871 Bacteria 10934
327 Ga0075434_100018385 3300006871 Bacteria 6752
328 Ga0075434_100289224 3300006871 Bacteria 1659
329 Ga0075429_100000163 3300006880 Bacteria 42270
330 Ga0075429_100137894 3300006880 Bacteria 2135
331 Ga0068865_100001544 3300006881 Bacteria 13429
332 Ga0068865_100003466 3300006881 Bacteria 9451
333 Ga0075436_100025848 3300006914 Bacteria 4040
334 Ga0075436_100271637 3300006914 Bacteria 1211
335 Ga0097620_100008928 3300006931 Bacteria 10125
336 Ga0097620_100039897 3300006931 Bacteria 4712
337 Ga0075435_100001972 3300007076 Bacteria 13386
338 Ga0075435_100024791 3300007076 Bacteria 4661
339 Ga0075435_100081761 3300007076 Bacteria 2654
340 Ga0075435_100175333 3300007076 Bacteria 1810
341 Ga0099794_10132838 3300007265 Bacteria 1258
342 Ga0105244_10059189 3300009036 Bacteria 1932
343 Ga0105244_10136458 3300009036 Bacteria 1182
344 Ga0105240_10378029 3300009093 Bacteria 1600
345 Ga0111539_10000389 3300009094 Bacteria 54333
346 Ga0111539_10000725 3300009094 Bacteria 42875
347 Ga0111539_10001696 3300009094 Bacteria 29343
348 Ga0111539_10001808 3300009094 Bacteria 28479
349 Ga0111539_10018474 3300009094 Bacteria 8635
350 Ga0111539_10047916 3300009094 Bacteria 5105
351 Ga0111539_10065823 3300009094 Bacteria 4281
352 Ga0111539_10103174 3300009094 Bacteria 3347
353 Ga0111539_10122383 3300009094 Bacteria 3049
354 Ga0111539_10146602 3300009094 Bacteria 2763
355 Ga0111539_10186046 3300009094 Bacteria 2425
356 Ga0111539_10410216 3300009094 Bacteria 1578
357 Ga0111539_10482939 3300009094 Bacteria 1443
358 Ga0105245_10010250 3300009098 Bacteria 8160
359 Ga0105245_10015250 3300009098 Bacteria 6695
360 Ga0105245_10391633 3300009098 Bacteria 1386
361 Ga0105247_10022803 3300009101 Bacteria 3771
362 Ga0105247_10035997 3300009101 Bacteria 3018
363 Ga0105247_10041832 3300009101 Bacteria 2804
364 Ga0114129_10000227 3300009147 Bacteria 62698
365 Ga0114129_10008509 3300009147 Bacteria 14626
366 Ga0114129_10040105 3300009147 Bacteria 6602
367 Ga0114129_10225242 3300009147 Bacteria 2528
368 Ga0114129_10255373 3300009147 Bacteria 2351
369 Ga0105243_10003521 3300009148 Bacteria 12651
370 Ga0105243_10060998 3300009148 Bacteria 3014
371 Ga0105243_10067549 3300009148 Bacteria 2878
372 Ga0105241_10007067 3300009174 Bacteria 8267
373 Ga0105241_10195297 3300009174 Bacteria 1687
374 Ga0105242_10026334 3300009176 Bacteria 4608
375 Ga0105242_10035954 3300009176 Bacteria 3971
376 Ga0105242_10040216 3300009176 Bacteria 3767
377 Ga0105248_10011072 3300009177 Bacteria 9949
378 Ga0105248_10070147 3300009177 Bacteria 3935
379 Ga0105248_10109495 3300009177 Bacteria 3114
380 Ga0105248_10244342 3300009177 Bacteria 2020
381 Ga0105237_10007432 3300009545 Bacteria 11993
382 Ga0105237_10102994 3300009545 Bacteria 2846
383 Ga0105238_10034621 3300009551 Bacteria 5138
384 Ga0105249_10011087 3300009553 Bacteria 7919
385 Ga0105249_10019349 3300009553 Bacteria 6073
386 Ga0105249_10285547 3300009553 Bacteria 1650
387 Ga0105239_10033880 3300010375 Bacteria 5606
388 Ga0105239_10105997 3300010375 Bacteria 3113
389 Ga0105239_10152129 3300010375 Bacteria 2582
390 Ga0105239_10277133 3300010375 Bacteria 1887
391 Ga0105246_10004169 3300011119 Bacteria 8786
392 Ga0105246_10016137 3300011119 Bacteria 4726
393 Ga0105246_10035014 3300011119 Bacteria 3352
394 Ga0105246_10049515 3300011119 Bacteria 2877
395 Ga0105246_10136956 3300011119 Bacteria 1836
396 Ga0157335_1000780 3300012492 Bacteria 1569
397 Ga0157373_10035983 3300013100 Bacteria 3554
398 Ga0157371_10050774 3300013102 Bacteria 2948
399 Ga0157374_10002692 3300013296 Bacteria 14940
400 Ga0157374_10070776 3300013296 Bacteria 3287
401 Ga0157374_10175996 3300013296 Bacteria 2089
402 Ga0157378_10085517 3300013297 Bacteria 2857
403 Ga0157378_10102635 3300013297 Bacteria 2612
404 Ga0157378_10694426 3300013297 Bacteria 1036
405 Ga0163162_10017826 3300013306 Bacteria 6947
406 Ga0163162_10063021 3300013306 Bacteria 3749
407 Ga0163162_10206806 3300013306 Bacteria 2092
408 Ga0163162_10430330 3300013306 Bacteria 1452
409 Ga0157372_10040791 3300013307 Bacteria 5129
410 Ga0157375_10024786 3300013308 Bacteria 5559
411 Ga0157375_10061773 3300013308 Bacteria 3721
412 Ga0157375_10092850 3300013308 Bacteria 3083
413 Ga0157375_10104406 3300013308 Bacteria 2922
414 Ga0157375_10168893 3300013308 Bacteria 2334
415 Ga0163163_10001273 3300014325 Bacteria 21307
416 Ga0163163_10095739 3300014325 Bacteria 2988
417 Ga0163163_10122477 3300014325 Bacteria 2635
418 Ga0163163_10380939 3300014325 Bacteria 1468
419 Ga0157380_10006550 3300014326 Bacteria 8213
420 Ga0157377_10001621 3300014745 Bacteria 9812
421 Ga0157377_10042979 3300014745 Bacteria 2513
422 Ga0157376_10034213 3300014969 Bacteria 4101
423 Ga0157376_10104691 3300014969 Bacteria 2480
424 Ga0163161_10000266 3300017792 Bacteria 45979
425 Ga0163161_10076015 3300017792 Bacteria 2465
426 Ga0163161_10078274 3300017792 Bacteria 2430
427 Ga0163161_10137337 3300017792 Bacteria 1849
428 Ga0206354_11439474 3300020081 Bacteria 1420
429 Ga0213872_10013367 3300021361 Bacteria 3848
430 Ga0213874_10007563 3300021377 Bacteria 2613
431 Ga0213876_10000603 3300021384 Bacteria 26611
432 Ga0213876_10032997 3300021384 Bacteria 2730
433 Ga0213876_10035830 3300021384 Bacteria 2617
434 Ga0213876_10048232 3300021384 Bacteria 2251
435 Ga0213876_10150269 3300021384 Bacteria 1239
436 Ga0213875_10000918 3300021388 Bacteria 21317
437 Ga0213875_10146050 3300021388 Bacteria 1108
438 Ga0224572_1002050 3300024225 Bacteria 3172
439 Ga0207666_1000534 3300025271 Bacteria 4641
440 Ga0207666_1001132 3300025271 Bacteria 3153
441 Ga0207673_1000597 3300025290 Bacteria 3841
442 Ga0209676_1000105 3300025292 Bacteria 224151
443 Ga0209758_1001548 3300025297 Bacteria 26409
444 Ga0209758_1001765 3300025297 Bacteria 23988
445 Ga0209050_1001283 3300025298 Bacteria 28639
446 Ga0209051_1000064 3300025303 Bacteria 231735
447 Ga0209257_1000109 3300025304 Bacteria 239439
448 Ga0207697_10002026 3300025315 Bacteria 10716
449 Ga0207697_10003146 3300025315 Bacteria 8232
450 Ga0207656_10020871 3300025321 Bacteria 2609
451 Ga0207655_1055096 3300025728 Bacteria 1576
452 Ga0207653_10002185 3300025885 Bacteria 6229
453 Ga0207653_10002726 3300025885 Bacteria 5622
454 Ga0207682_10000009 3300025893 Bacteria 86366
455 Ga0207682_10003948 3300025893 Bacteria 6320
456 Ga0207692_10010088 3300025898 Bacteria 3967
457 Ga0207642_10007417 3300025899 Bacteria 3705
458 Ga0207642_10010905 3300025899 Bacteria 3223
459 Ga0207710_10001303 3300025900 Bacteria 12616
460 Ga0207688_10000892 3300025901 Bacteria 15087
461 Ga0207688_10110652 3300025901 Bacteria 1594
462 Ga0207688_10132250 3300025901 Bacteria 1463
463 Ga0207680_10004104 3300025903 Bacteria 6890
464 Ga0207680_10025243 3300025903 Bacteria 3276
465 Ga0207647_10002160 3300025904 Bacteria 15015
466 Ga0207685_10031650 3300025905 Bacteria 1896
467 Ga0207685_10055893 3300025905 Bacteria 1542
468 Ga0207699_10037062 3300025906 Bacteria 2785
469 Ga0207645_10000999 3300025907 Bacteria 23365
470 Ga0207645_10035204 3300025907 Bacteria 3215
471 Ga0207643_10001172 3300025908 Bacteria 15576
472 Ga0207643_10028428 3300025908 Bacteria 3105
473 Ga0207705_10076146 3300025909 Bacteria 2439
474 Ga0207705_10114279 3300025909 Bacteria 1997
475 Ga0207684_10019788 3300025910 Bacteria 5757
476 Ga0207654_10015486 3300025911 Bacteria 3958
477 Ga0207654_10156190 3300025911 Bacteria 1469
478 Ga0207707_10006761 3300025912 Bacteria 10013
479 Ga0207707_10045583 3300025912 Bacteria 3821
480 Ga0207707_10163271 3300025912 Bacteria 1947
481 Ga0207707_10247057 3300025912 Bacteria 1550
482 Ga0207707_10386783 3300025912 Bacteria 1202
483 Ga0207707_10448620 3300025912 Bacteria 1104
484 Ga0207695_10154802 3300025913 Bacteria 2228
485 Ga0207695_10170648 3300025913 Bacteria 2101
486 Ga0207671_10070082 3300025914 Bacteria 2613
487 Ga0207671_10113096 3300025914 Bacteria 2068
488 Ga0207693_10002396 3300025915 Bacteria 16268
489 Ga0207693_10007042 3300025915 Bacteria 9281
490 Ga0207693_10012580 3300025915 Bacteria 6835
491 Ga0207693_10024070 3300025915 Bacteria 4834
492 Ga0207693_10128480 3300025915 Bacteria 1992
493 Ga0207693_10192406 3300025915 Bacteria 1605
494 Ga0207663_10194477 3300025916 Bacteria 1459
495 Ga0207663_10266655 3300025916 Bacteria 1267
496 Ga0207660_10001283 3300025917 Bacteria 16867
497 Ga0207660_10096292 3300025917 Bacteria 2203
498 Ga0207662_10000025 3300025918 Bacteria 70078
499 Ga0207662_10007904 3300025918 Bacteria 5793
500 Ga0207662_10043635 3300025918 Bacteria 2645
501 Ga0207657_10010579 3300025919 Bacteria 9200
502 Ga0207657_10086122 3300025919 Bacteria 2630
503 Ga0207657_10146148 3300025919 Bacteria 1928
504 Ga0207657_10320484 3300025919 Bacteria 1226
505 Ga0207649_10006638 3300025920 Bacteria 6288
506 Ga0207649_10115293 3300025920 Bacteria 1802
507 Ga0207649_10176922 3300025920 Bacteria 1491
508 Ga0207652_10006125 3300025921 Bacteria 9727
509 Ga0207652_10059120 3300025921 Bacteria 3304
510 Ga0207652_10069453 3300025921 Bacteria 3058
511 Ga0207652_10103214 3300025921 Bacteria 2521
512 Ga0207652_10264514 3300025921 Bacteria 1551
513 Ga0207652_10371714 3300025921 Bacteria 1290
514 Ga0207652_10506786 3300025921 Bacteria 1086
515 Ga0207646_10051439 3300025922 Bacteria 3686
516 Ga0207681_10002039 3300025923 Bacteria 12958
517 Ga0207681_10012199 3300025923 Bacteria 5298
518 Ga0207694_10037333 3300025924 Bacteria 3731
519 Ga0207694_10353411 3300025924 Bacteria 1217
520 Ga0207650_10074985 3300025925 Bacteria 2552
521 Ga0207650_10237350 3300025925 Bacteria 1472
522 Ga0207659_10014716 3300025926 Bacteria 5053
523 Ga0207687_10003202 3300025927 Bacteria 11093
524 Ga0207687_10011809 3300025927 Bacteria 5714
525 Ga0207687_10255936 3300025927 Bacteria 1394
526 Ga0207700_10064877 3300025928 Bacteria 2784
527 Ga0207700_10155337 3300025928 Bacteria 1895
528 Ga0207644_10003326 3300025931 Bacteria 10373
529 Ga0207644_10009497 3300025931 Bacteria 6389
530 Ga0207644_10025426 3300025931 Bacteria 4072
531 Ga0207644_10190507 3300025931 Bacteria 1612
532 Ga0207690_10007239 3300025932 Bacteria 6589
533 Ga0207690_10264505 3300025932 Bacteria 1334
534 Ga0207706_10005363 3300025933 Bacteria 11952
535 Ga0207706_10007588 3300025933 Bacteria 10034
536 Ga0207706_10015532 3300025933 Bacteria 6879
537 Ga0207706_10016523 3300025933 Bacteria 6661
538 Ga0207706_10063677 3300025933 Bacteria 3246
539 Ga0207706_10107599 3300025933 Bacteria 2454
540 Ga0207686_10020623 3300025934 Bacteria 3768
541 Ga0207709_10002970 3300025935 Bacteria 10336
542 Ga0207709_10020213 3300025935 Bacteria 3753
543 Ga0207709_10027140 3300025935 Bacteria 3296
544 Ga0207709_10037377 3300025935 Bacteria 2885
545 Ga0207670_10003489 3300025936 Bacteria 8346
546 Ga0207670_10048850 3300025936 Bacteria 2826
547 Ga0207670_10082490 3300025936 Bacteria 2253
548 Ga0207670_10209815 3300025936 Bacteria 1485
549 Ga0207670_10391355 3300025936 Bacteria 1109
550 Ga0207669_10001324 3300025937 Bacteria 10540
551 Ga0207669_10022747 3300025937 Bacteria 3335
552 Ga0207669_10046762 3300025937 Bacteria 2559
553 Ga0207669_10082786 3300025937 Bacteria 2061
554 Ga0207669_10094727 3300025937 Bacteria 1955
555 Ga0207669_10187070 3300025937 Bacteria 1490
556 Ga0207669_10222069 3300025937 Bacteria 1387
557 Ga0207704_10000130 3300025938 Bacteria 41287
558 Ga0207704_10122991 3300025938 Bacteria 1780
559 Ga0207704_10184642 3300025938 Bacteria 1510
560 Ga0207665_10002113 3300025939 Bacteria 13436
561 Ga0207665_10024373 3300025939 Bacteria 3989
562 Ga0207665_10417650 3300025939 Bacteria 1024
563 Ga0207691_10001422 3300025940 Bacteria 23867
564 Ga0207691_10002604 3300025940 Bacteria 17616
565 Ga0207691_10103504 3300025940 Bacteria 2539
566 Ga0207691_10175920 3300025940 Bacteria 1872
567 Ga0207691_10386682 3300025940 Bacteria 1194
568 Ga0207711_10001071 3300025941 Bacteria 26139
569 Ga0207711_10012903 3300025941 Bacteria 6939
570 Ga0207711_10019431 3300025941 Bacteria 5657
571 Ga0207711_10081889 3300025941 Bacteria 2821
572 Ga0207711_10100479 3300025941 Bacteria 2558
573 Ga0207689_10001156 3300025942 Bacteria 25400
574 Ga0207689_10066148 3300025942 Bacteria 2973
575 Ga0207689_10254733 3300025942 Bacteria 1452
576 Ga0207661_10028696 3300025944 Bacteria 4264
577 Ga0207661_10186261 3300025944 Bacteria 1817
578 Ga0207661_10237224 3300025944 Bacteria 1617
579 Ga0207661_10415447 3300025944 Bacteria 1221
580 Ga0207661_10429362 3300025944 Bacteria 1201
581 Ga0207679_10003209 3300025945 Bacteria 10084
582 Ga0207679_10390710 3300025945 Bacteria 1222
583 Ga0207667_10028359 3300025949 Bacteria 6081
584 Ga0207667_10089076 3300025949 Bacteria 3190
585 Ga0207667_10272091 3300025949 Bacteria 1731
586 Ga0207667_10436413 3300025949 Bacteria 1332
587 Ga0207651_10010192 3300025960 Bacteria 5194
588 Ga0207651_10212060 3300025960 Bacteria 1560
589 Ga0207712_10000579 3300025961 Bacteria 29666
590 Ga0207712_10007061 3300025961 Bacteria 7084
591 Ga0207712_10020831 3300025961 Bacteria 4300
592 Ga0207668_10000815 3300025972 Bacteria 19101
593 Ga0207668_10003465 3300025972 Bacteria 9258
594 Ga0207668_10108641 3300025972 Bacteria 2076
595 Ga0207668_10203378 3300025972 Bacteria 1579
596 Ga0207640_10122108 3300025981 Bacteria 1868
597 Ga0207658_10002475 3300025986 Bacteria 13483
598 Ga0207658_10003151 3300025986 Bacteria 11783
599 Ga0207658_10015729 3300025986 Bacteria 5194
600 Ga0207658_10124397 3300025986 Bacteria 2061
601 Ga0207677_10011181 3300026023 Bacteria 5106
602 Ga0207677_10252437 3300026023 Bacteria 1433
603 Ga0207703_10010308 3300026035 Bacteria 7318
604 Ga0207703_10033374 3300026035 Bacteria 4080
605 Ga0207639_10001866 3300026041 Bacteria 14170
606 Ga0207639_10159860 3300026041 Bacteria 1897
607 Ga0207639_10383618 3300026041 Bacteria 1262
608 Ga0207678_10008348 3300026067 Bacteria 9133
609 Ga0207678_10008633 3300026067 Bacteria 8980
610 Ga0207678_10046782 3300026067 Bacteria 3742
611 Ga0207708_10000402 3300026075 Bacteria 34168
612 Ga0207708_10002738 3300026075 Bacteria 12941
613 Ga0207708_10055684 3300026075 Bacteria 3015
614 Ga0207708_10147325 3300026075 Bacteria 1851
615 Ga0207708_10437374 3300026075 Bacteria 1087
616 Ga0207702_10046199 3300026078 Bacteria 3665
617 Ga0207702_10091417 3300026078 Bacteria 2665
618 Ga0207641_10014704 3300026088 Bacteria 6417
619 Ga0207641_10072572 3300026088 Bacteria 2964
620 Ga0207641_10087180 3300026088 Bacteria 2723
621 Ga0207641_10095692 3300026088 Bacteria 2607
622 Ga0207648_10001500 3300026089 Bacteria 25704
623 Ga0207648_10004627 3300026089 Bacteria 14090
624 Ga0207676_10017931 3300026095 Bacteria 5136
625 Ga0207676_10071930 3300026095 Bacteria 2778
626 Ga0207676_10101902 3300026095 Bacteria 2381
627 Ga0207676_10137857 3300026095 Bacteria 2084
628 Ga0207674_10007131 3300026116 Bacteria 13059
629 Ga0207674_10021894 3300026116 Bacteria 6877
630 Ga0207674_10043375 3300026116 Bacteria 4638
631 Ga0207675_100002311 3300026118 Bacteria 18934
632 Ga0207675_100003859 3300026118 Bacteria 14570
633 Ga0207675_100019447 3300026118 Bacteria 6336
634 Ga0207675_100051796 3300026118 Bacteria 3831
635 Ga0207683_10000850 3300026121 Bacteria 28050
636 Ga0207683_10010051 3300026121 Bacteria 8075
637 Ga0207683_10062694 3300026121 Bacteria 3274
638 Ga0207683_10096310 3300026121 Bacteria 2639
639 Ga0207683_10208074 3300026121 Bacteria 1780
640 Ga0207683_10211505 3300026121 Bacteria 1765
641 Ga0207698_10005963 3300026142 Bacteria 7570
642 Ga0207698_10052400 3300026142 Bacteria 3126
643 Ga0207698_10344543 3300026142 Bacteria 1405
644 Ga0209995_1009515 3300027471 Bacteria 1572
645 Ga0210002_1000490 3300027617 Bacteria 5383
646 Ga0209971_1023345 3300027682 Bacteria 1475
647 Ga0209966_1003846 3300027695 Bacteria 2533
648 Ga0209998_10000759 3300027717 Bacteria 8436
649 Ga0209998_10001051 3300027717 Bacteria 6935
650 Ga0209974_10039214 3300027876 Bacteria 1575
651 Ga0207428_10000164 3300027907 Bacteria 91968
652 Ga0207428_10000391 3300027907 Bacteria 54825
653 Ga0207428_10001108 3300027907 Bacteria 29314
654 Ga0207428_10008433 3300027907 Bacteria 9303
655 Ga0207428_10024777 3300027907 Bacteria 5036
656 Ga0268266_10002016 3300028379 Bacteria 22644
657 Ga0268266_10127443 3300028379 Bacteria 2273
658 Ga0268265_10003240 3300028380 Bacteria 11822
659 Ga0268265_10042298 3300028380 Bacteria 3379
660 Ga0268265_10265390 3300028380 Bacteria 1529
661 Ga0268264_10020827 3300028381 Bacteria 5359
662 Ga0268264_10061652 3300028381 Bacteria 3147
663 Ga0268264_10061975 3300028381 Bacteria 3139
664 Ga0268264_10128256 3300028381 Bacteria 2245
665 Ga0268264_10144215 3300028381 Bacteria 2127
666 Ga0268264_10151718 3300028381 Bacteria 2078
667 Ga0268264_10167044 3300028381 Bacteria 1987
668 Ga0265337_1000284 3300028556 Bacteria 27492
669 Ga0307515_10248642 3300028794 Bacteria 1535
670 Ga0265338_10005223 3300028800 Bacteria 17029
671 Ga0265330_10027948 3300031235 Bacteria 2545
672 Ga0265330_10102093 3300031235 Bacteria 1227
673 Ga0265332_10000508 3300031238 Bacteria 26654
674 Ga0265332_10026267 3300031238 Bacteria 2554
675 Ga0265332_10073934 3300031238 Bacteria 1450
676 Ga0265325_10000019 3300031241 Bacteria 125265
677 Ga0265325_10001329 3300031241 Bacteria 17514
678 Ga0265325_10003017 3300031241 Bacteria 11157
679 Ga0265325_10004090 3300031241 Bacteria 9294
680 Ga0265325_10025995 3300031241 Bacteria 3175
681 Ga0265325_10034256 3300031241 Bacteria 2703
682 Ga0265325_10063293 3300031241 Bacteria 1872
683 Ga0265325_10067790 3300031241 Bacteria 1797
684 Ga0265340_10009669 3300031247 Bacteria 5168
685 Ga0265340_10024385 3300031247 Bacteria 3073
686 Ga0265340_10024647 3300031247 Bacteria 3053
687 Ga0265340_10037227 3300031247 Bacteria 2411
688 Ga0265339_10000096 3300031249 Bacteria 74964
689 Ga0265339_10001912 3300031249 Bacteria 15282
690 Ga0265339_10006450 3300031249 Bacteria 7694
691 Ga0265339_10008869 3300031249 Bacteria 6368
692 Ga0265339_10015052 3300031249 Bacteria 4648
693 Ga0265331_10042725 3300031250 Bacteria 2198
694 Ga0265327_10000177 3300031251 Bacteria 136559
695 Ga0265313_10000024 3300031595 Bacteria 138587
696 Ga0265313_10004465 3300031595 Bacteria 10721
697 Ga0265313_10006000 3300031595 Bacteria 8776
698 Ga0265313_10025519 3300031595 Bacteria 3129
699 Ga0265313_10028957 3300031595 Bacteria 2871
700 Ga0265313_10047499 3300031595 Bacteria 2077
701 Ga0265313_10100613 3300031595 Bacteria 1284
702 Ga0265314_10001355 3300031711 Bacteria 27657
703 Ga0265342_10000573 3300031712 Bacteria 38852
704 Ga0265342_10001257 3300031712 Bacteria 23945
705 Ga0307516_10054650 3300031730 Bacteria 3901
706 Ga0307407_10177306 3300031903 Bacteria 1409
707 Ga0307414_10063480 3300032004 Bacteria 2625
708 Ga0307415_100147752 3300032126 Bacteria 1805
709 Ga0316583_10001118 3300032133 Bacteria 8745
710 Ga0373930_0000713 3300034816 Bacteria 4686
711 Ga0373948_0000426 3300034817 Bacteria 5204
712 Ga0373948_0001212 3300034817 Bacteria 3513
713 Ga0373950_0004976 3300034818 Bacteria 1968
714 Ga0373958_0000992 3300034819 Bacteria 3699
715 Ga0373958_0005970 3300034819 Bacteria 1876
716 Ga0373959_0000111 3300034820 Bacteria 18330
717 Ga0373938_0000386 3300034957 Bacteria 7080
718 Ga0373938_0000527 3300034957 Bacteria 6207
719 Ga0373938_0004135 3300034957 Bacteria 2406
720 Ga0373926_0000388 3300035083 Bacteria 11245
721 Ga0373926_0012315 3300035083 Bacteria 2889
722 Ga0373928_0000045 3300035084 Bacteria 21176
723 Ga0373929_0000214 3300035085 Bacteria 10508
724 Ga0373934_0073810 3300035086 Bacteria 1366
725 Ga0373940_0003391 3300035088 Bacteria 3249
726 Ga0373940_0008685 3300035088 Bacteria 2341
727 Ga0373940_0016914 3300035088 Bacteria 1812
728 Ga0373944_0000734 3300035089 Bacteria 7963
729 Ga0373944_0013920 3300035089 Bacteria 2238
730 Ga0373944_0019891 3300035089 Bacteria 1930
731 Ga0373949_0002131 3300035090 Bacteria 5202
732 Ga0373949_0002981 3300035090 Bacteria 4164
733 Ga0373951_0000335 3300035091 Bacteria 14582
734 Ga0373951_0005629 3300035091 Bacteria 2901
735 Ga0373951_0013871 3300035091 Bacteria 1812
736 Ga0373952_0000179 3300035092 Bacteria 9804
737 Ga0373952_0004378 3300035092 Bacteria 2562
738 Ga0373923_0000978 3300035111 Bacteria 7693
739 Ga0373932_0000271 3300035112 Bacteria 15633
740 Ga0373932_0002322 3300035112 Bacteria 4835
741 Ga0373932_0023548 3300035112 Bacteria 1648
742 Ga0373936_0001860 3300035113 Bacteria 7784
743 Ga0373936_0011435 3300035113 Bacteria 3358
744 Ga0373936_0036477 3300035113 Bacteria 1961
745 Ga0373939_0008122 3300035114 Bacteria 2567
746 Ga0373939_0011931 3300035114 Bacteria 2205
747 Ga0373941_0000241 3300035115 Bacteria 10507
748 Ga0373941_0033442 3300035115 Bacteria 1545
749 Ga0373945_0016965 3300035116 Bacteria 2463
750 Ga0373945_0018406 3300035116 Bacteria 2376
751 Ga0373945_0028858 3300035116 Bacteria 1946
752 Ga0373954_0000707 3300035118 Bacteria 12831
753 Ga0373954_0025763 3300035118 Bacteria 2692
754 Ga0373954_0045424 3300035118 Bacteria 2052
755 Ga0373954_0077547 3300035118 Bacteria 1585
756 Ga0373956_0023428 3300035119 Bacteria 2650
757 Ga0373956_0029934 3300035119 Bacteria 2377
758 Ga0373957_0002977 3300035120 Bacteria 4915
759 Ga0373957_0036321 3300035120 Bacteria 1835
760 Ga0373957_0047844 3300035120 Bacteria 1628
761 Ga0373960_0003102 3300035121 Bacteria 3752
762 Ga0373960_0024562 3300035121 Bacteria 1631
763 Ga0373943_0000233 3300035170 Bacteria 22738
764 Ga0373943_0000997 3300035170 Bacteria 12584
765 Ga0373943_0007851 3300035170 Bacteria 4791
766 Ga0373943_0047269 3300035170 Bacteria 2103
767 Ga0373946_0007488 3300035171 Bacteria 3991
768 Ga0373946_0011741 3300035171 Bacteria 3274
769 Ga0373946_0026501 3300035171 Bacteria 2287
770 Ga0373955_0001092 3300035172 Bacteria 11522
771 Ga0373955_0002224 3300035172 Bacteria 8418
772 Ga0373955_0005439 3300035172 Bacteria 5722
773 Ga0373955_0014964 3300035172 Bacteria 3788
774 Ga0373942_0008878 3300035207 Bacteria 2347
775 Ga0373961_0000592 3300035241 Bacteria 13503
776 Ga0373961_0003081 3300035241 Bacteria 4192
777 Ga0373961_0005827 3300035241 Bacteria 2960
778 Ga0373961_0011637 3300035241 Bacteria 2186
779 Ga0373962_0000848 3300035242 Bacteria 6984
780 Ga0373962_0002023 3300035242 Bacteria 4831
781 Ga0373962_0020380 3300035242 Bacteria 1741
782 Ga0373924_0070650 3300035410 Bacteria 1472
783 Ga0373924_0145353 3300035410 Bacteria 1036
784 Ga0373931_0001210 3300035691 Bacteria 11038
785 Ga0373931_0003979 3300035691 Bacteria 6696
786 Ga0373931_0004155 3300035691 Bacteria 6578
787 Ga0373931_0004514 3300035691 Bacteria 6366
788 Ga0373931_0018978 3300035691 Bacteria 3426
789 Ga0373931_0174512 3300035691 Bacteria 1269
790 Ga0373931_0275359 3300035691 Bacteria 1032
791 Ga0373935_0000377 3300035692 Bacteria 22883
792 Ga0373935_0001455 3300035692 Bacteria 13125
793 Ga0373935_0003956 3300035692 Bacteria 8651
794 Ga0373935_0084931 3300035692 Bacteria 2062
795 Ga0373935_0188072 3300035692 Bacteria 1421
796 Ga0373927_0000113 3300035695 Bacteria 60608
797 Ga0373927_0013803 3300035695 Bacteria 5362
798 Ga0373927_0017901 3300035695 Bacteria 4660
799 Ga0373927_0021648 3300035695 Bacteria 4214
800 Ga0373927_0035757 3300035695 Bacteria 3230
801 Ga0373927_0041852 3300035695 Bacteria 2970
802 Ga0373927_0060060 3300035695 Bacteria 2459
803 Ga0373927_0067856 3300035695 Bacteria 2307
804 Ga0373927_0080694 3300035695 Bacteria 2108
805 Ga0373933_0000258 3300035724 Bacteria 34845
806 Ga0373933_0010567 3300035724 Bacteria 5062
807 Ga0373933_0017191 3300035724 Bacteria 4055
808 Ga0373933_0034562 3300035724 Bacteria 2946
809 Ga0373933_0043589 3300035724 Bacteria 2655
810 Ga0373933_0129767 3300035724 Bacteria 1584
811 Ga0373947_0000168 3300035725 Bacteria 35315
812 Ga0373947_0000280 3300035725 Bacteria 28900
813 Ga0373947_0012523 3300035725 Bacteria 4865
814 Ga0373947_0013179 3300035725 Bacteria 4738
815 Ga0373947_0019089 3300035725 Bacteria 3951
816 Ga0373947_0020590 3300035725 Bacteria 3809
817 Ga0373937_0000814 3300036401 Bacteria 26684
818 Ga0373937_0001849 3300036401 Bacteria 17776
819 Ga0373937_0005769 3300036401 Bacteria 10643
820 Ga0373937_0008814 3300036401 Bacteria 8750
821 Ga0373937_0011708 3300036401 Bacteria 7693
822 Ga0373937_0017925 3300036401 Bacteria 6315
823 Ga0373937_0059689 3300036401 Bacteria 3505
824 Ga0373937_0191559 3300036401 Bacteria 1921
825 Ga0373925_0000075 3300037068 Bacteria 105395
826 Ga0373925_0001434 3300037068 Bacteria 20657
827 Ga0373925_0003256 3300037068 Bacteria 12656
828 Ga0373925_0013932 3300037068 Bacteria 5820
829 Ga0373925_0115233 3300037068 Bacteria 2081
830 Ga0373925_0136762 3300037068 Bacteria 1915
831 Ga0373925_0198248 3300037068 Bacteria 1596
832 Ga0373925_0313423 3300037068 Bacteria 1268
833 Ga0395899_0005270 3300037312 Bacteria 10041
834 Ga0395899_0083216 3300037312 Bacteria 2327
835 Ga0395900_0004997 3300037418 Bacteria 13928
836 Ga0395900_0334631 3300037418 Bacteria 1491
837 Ga0395898_0005343 3300037466 Bacteria 13890
838 Ga0395898_0109287 3300037466 Bacteria 2651
839 Ga0395898_0211384 3300037466 Bacteria 1850
840 Ga0395898_0252358 3300037466 Bacteria 1682
841 Ga0436364_0266645 3300037853 Bacteria 19395
842 Ga0436364_0611324 3300037853 Bacteria 1556
843 Ga0436364_1284638 3300037853 Bacteria 5477
844 Ga0395901_0009254 3300038443 Bacteria 9986
845 Ga0395901_0114297 3300038443 Bacteria 2835
846 Ga0242420_010110 3300038996 Bacteria 1561
847 Ga0436365_0117548 3300039437 Bacteria 62327
848 Ga0436365_0321935 3300039437 Bacteria 1084
849 Ga0436365_0448461 3300039437 Bacteria 3249
850 Ga0436365_0692136 3300039437 Bacteria 2988
851 Ga0436365_0827365 3300039437 Bacteria 2583
852 Ga0436365_1485216 3300039437 Bacteria 1943
853 Ga0436365_1545760 3300039437 Bacteria 2496
854 Ga0436361_0569994 3300039447 Bacteria 6230
855 Ga0436361_0679413 3300039447 Bacteria 1247
856 Ga0436361_1044250 3300039447 Bacteria 1373
857 Ga0436363_0519487 3300039450 Bacteria 1050
858 Ga0436363_1624569 3300039450 Bacteria 5180
859 Ga0436363_1706863 3300039450 Bacteria 1125
860 Ga0439453_0021580 3300041408 Bacteria 1162
861 Ga0451853_2607190 3300041512 Bacteria 1136
862 Ga0451853_3173075 3300041512 Bacteria 1259
863 Ga0439441_006469 3300042001 Bacteria 1860
864 Ga0439443_005645 3300042003 Bacteria 1681
865 Ga0439450_002586 3300042008 Bacteria 2870
866 Ga0466963_0002455 3300044694 Bacteria 10366
867 Ga0466963_0059496 3300044694 Bacteria 2550
868 Ga0466968_0009361 3300044735 Bacteria 3766
869 Ga0466957_0012658 3300044842 Bacteria 4887
870 Ga0466959_0045768 3300045049 Bacteria 3222
871 Ga0451576_0006479 3300045051 Bacteria 14344
872 Ga0466967_0006697 3300045976 Bacteria 8194
873 Ga0466967_0104801 3300045976 Bacteria 2590
874 Ga0466967_0180663 3300045976 Bacteria 1990
875 Ga0495592_0000060 3300046454 Bacteria 100113
876 Ga0495592_0003878 3300046454 Bacteria 10821
877 Ga0495592_0026131 3300046454 Bacteria 4430
878 Ga0495592_0051488 3300046454 Bacteria 3058
879 Ga0495592_0052855 3300046454 Bacteria 3014
880 Ga0495603_0004025 3300046455 Bacteria 8751
881 Ga0495603_0023263 3300046455 Bacteria 3751
882 Ga0495629_0000118 3300046459 Bacteria 70632
883 Ga0495629_0000139 3300046459 Bacteria 63649
884 Ga0495629_0027523 3300046459 Bacteria 4037
885 Ga0495629_0115745 3300046459 Bacteria 1868
886 Ga0495629_0117691 3300046459 Bacteria 1851
887 Ga0495629_0139108 3300046459 Bacteria 1690
888 Ga0495629_0145651 3300046459 Bacteria 1647
889 Ga0495629_0159256 3300046459 Bacteria 1568
890 Ga0495638_0043216 3300046460 Bacteria 2844
891 Ga0495641_0026615 3300046461 Bacteria 2820
892 Ga0495651_0000181 3300046462 Bacteria 46803
893 Ga0495651_0001419 3300046462 Bacteria 18593
894 Ga0495651_0004794 3300046462 Bacteria 10354
895 Ga0495651_0084089 3300046462 Bacteria 2398
896 Ga0495651_0086259 3300046462 Bacteria 2362
897 Ga0495653_0000141 3300046463 Bacteria 60033
898 Ga0495653_0006362 3300046463 Bacteria 9690
899 Ga0495653_0067003 3300046463 Bacteria 2698
900 Ga0495580_0005444 3300046472 Bacteria 10519
901 Ga0495580_0018852 3300046472 Bacteria 5133
902 Ga0495580_0047339 3300046472 Bacteria 3048
903 Ga0495580_0126130 3300046472 Bacteria 1776
904 Ga0495582_0037925 3300046473 Bacteria 2651
905 Ga0495582_0042876 3300046473 Bacteria 2491
906 Ga0495582_0044124 3300046473 Bacteria 2456
907 Ga0495582_0244600 3300046473 Bacteria 1028
908 Ga0495605_0065887 3300046474 Bacteria 1722
909 Ga0495639_0005719 3300046475 Bacteria 5349
910 Ga0495639_0037816 3300046475 Bacteria 2165
911 Ga0495639_0055354 3300046475 Bacteria 1809
912 Ga0495662_0000223 3300046476 Bacteria 23829
913 Ga0495662_0001139 3300046476 Bacteria 13118
914 Ga0495662_0028741 3300046476 Bacteria 2684
915 Ga0495664_0000003 3300046477 Bacteria 551602
916 Ga0495664_0000800 3300046477 Bacteria 16088
917 Ga0495664_0017877 3300046477 Bacteria 4054
918 Ga0495664_0076038 3300046477 Bacteria 2009
919 Ga0495664_0132456 3300046477 Bacteria 1510
920 Ga0495584_0039361 3300046491 Bacteria 2388
921 Ga0495585_0001030 3300046492 Bacteria 23180
922 Ga0495594_0002129 3300046499 Bacteria 10306
923 Ga0495594_0015379 3300046499 Bacteria 4019
924 Ga0495594_0026453 3300046499 Bacteria 3121
925 Ga0495607_0006002 3300046501 Bacteria 8613
926 Ga0495607_0187944 3300046501 Bacteria 1031
927 Ga0495606_0020594 3300046507 Bacteria 4855
928 Ga0495606_0034704 3300046507 Bacteria 3459
929 Ga0495608_0000011 3300046511 Bacteria 248514
930 Ga0495608_0000398 3300046511 Bacteria 30359
931 Ga0495608_0000911 3300046511 Bacteria 20725
932 Ga0495608_0030340 3300046511 Bacteria 3661
933 Ga0495608_0036267 3300046511 Bacteria 3320
934 Ga0495608_0061262 3300046511 Bacteria 2475
935 Ga0495608_0120492 3300046511 Bacteria 1683
936 Ga0495618_0000044 3300046514 Bacteria 95526
937 Ga0495618_0017292 3300046514 Bacteria 4419
938 Ga0495618_0019414 3300046514 Bacteria 4181
939 Ga0495618_0028428 3300046514 Bacteria 3484
940 Ga0495618_0067596 3300046514 Bacteria 2272
941 Ga0495618_0069530 3300046514 Bacteria 2238
942 Ga0495618_0126539 3300046514 Bacteria 1636
943 Ga0495628_0000001 3300046516 Bacteria 917742
944 Ga0495628_0005139 3300046516 Bacteria 11502
945 Ga0495628_0006666 3300046516 Bacteria 10072
946 Ga0495628_0024922 3300046516 Bacteria 4892
947 Ga0495628_0258755 3300046516 Bacteria 1298
948 Ga0495630_0000574 3300046517 Bacteria 26824
949 Ga0495630_0011656 3300046517 Bacteria 6370
950 Ga0495630_0047151 3300046517 Bacteria 3222
951 Ga0495630_0070201 3300046517 Bacteria 2635
952 Ga0495630_0100159 3300046517 Bacteria 2192
953 Ga0495630_0200181 3300046517 Bacteria 1524
954 Ga0495637_0054463 3300046520 Bacteria 1662
955 Ga0495644_0000513 3300046523 Bacteria 16576
956 Ga0495648_0004446 3300046524 Bacteria 11977
957 Ga0495663_0053960 3300046525 Bacteria 1250
958 Ga0495666_0002030 3300046526 Bacteria 10010
959 Ga0495666_0009646 3300046526 Bacteria 4827
960 Ga0495652_0000002 3300046529 Bacteria 946606
961 Ga0495652_0014420 3300046529 Bacteria 7096
962 Ga0495652_0016128 3300046529 Bacteria 6683
963 Ga0495652_0016289 3300046529 Bacteria 6649
964 Ga0495652_0032084 3300046529 Bacteria 4595
965 Ga0495652_0081927 3300046529 Bacteria 2661
966 Ga0495652_0134264 3300046529 Bacteria 1955
967 Ga0495652_0136862 3300046529 Bacteria 1931
968 Ga0495665_0003032 3300046531 Bacteria 9074
969 Ga0495665_0004686 3300046531 Bacteria 7373
970 Ga0495665_0028599 3300046531 Bacteria 2988
971 Ga0495665_0032349 3300046531 Bacteria 2798
972 Ga0495665_0041588 3300046531 Bacteria 2447
973 Ga0495665_0056169 3300046531 Bacteria 2078
974 Ga0495665_0074346 3300046531 Bacteria 1789
975 Ga0495640_0000002 3300046533 Bacteria 646434
976 Ga0495640_0000544 3300046533 Bacteria 27687
977 Ga0495640_0015185 3300046533 Bacteria 5801
978 Ga0495640_0108952 3300046533 Bacteria 1811
979 Ga0495640_0141892 3300046533 Bacteria 1548
980 Ga0495586_0037924 3300046535 Bacteria 2587
981 Ga0495587_0000001 3300046536 Bacteria 724132
982 Ga0495587_0000599 3300046536 Bacteria 24689
983 Ga0495587_0002174 3300046536 Bacteria 13130
984 Ga0495587_0003798 3300046536 Bacteria 10023
985 Ga0495587_0015799 3300046536 Bacteria 4706
986 Ga0495587_0048234 3300046536 Bacteria 2522
987 Ga0495587_0100622 3300046536 Bacteria 1666
988 Ga0495621_0006662 3300046539 Bacteria 3383
989 Ga0495645_0000002 3300046543 Bacteria 651644
990 Ga0495645_0008747 3300046543 Bacteria 7070
991 Ga0495645_0016750 3300046543 Bacteria 5243
992 Ga0495645_0026193 3300046543 Bacteria 4232
993 Ga0495645_0072642 3300046543 Bacteria 2479
994 Ga0495633_0004113 3300046558 Bacteria 9379
995 Ga0495633_0134210 3300046558 Bacteria 1145
996 Ga0495667_0000039 3300046559 Bacteria 131308
997 Ga0495667_0008770 3300046559 Bacteria 6874
998 Ga0495667_0023899 3300046559 Bacteria 4116
999 Ga0495667_0047251 3300046559 Bacteria 2844
1000 Ga0495667_0056128 3300046559 Bacteria 2590
1001 Ga0495656_0000091 3300046615 Bacteria 38995
1002 Ga0495656_0046837 3300046615 Bacteria 1831
1003 Ga0495634_0000010 3300046642 Bacteria 143792
1004 Ga0495634_0023758 3300046642 Bacteria 4306
1005 Ga0495634_0126332 3300046642 Bacteria 1634
1006 Ga0495634_0182707 3300046642 Bacteria 1312
1007 Ga0495625_0000012 3300046660 Bacteria 363006
1008 Ga0495635_0000001 3300046663 Bacteria 704901
1009 Ga0495635_0004203 3300046663 Bacteria 9986
1010 Ga0495635_0006281 3300046663 Bacteria 8276
1011 Ga0495635_0018687 3300046663 Bacteria 4834
1012 Ga0495659_0059779 3300046664 Bacteria 1405
1013 Ga0495588_0010028 3300046674 Bacteria 4391
1014 Ga0495588_0033132 3300046674 Bacteria 2608
1015 Ga0495588_0041177 3300046674 Bacteria 2358
1016 Ga0495657_0000042 3300046675 Bacteria 114669
1017 Ga0495657_0001942 3300046675 Bacteria 17644
1018 Ga0495657_0031508 3300046675 Bacteria 3706
1019 Ga0495657_0107094 3300046675 Bacteria 1774
1020 Ga0495599_0000013 3300046678 Bacteria 179828
1021 Ga0495599_0008880 3300046678 Bacteria 6119
1022 Ga0495599_0042108 3300046678 Bacteria 2866
1023 Ga0495623_0000050 3300046679 Bacteria 72959
1024 Ga0495623_0006342 3300046679 Bacteria 7687
1025 Ga0495623_0028043 3300046679 Bacteria 3625
1026 Ga0495623_0035033 3300046679 Bacteria 3217
1027 Ga0495623_0088991 3300046679 Bacteria 1899
1028 Ga0495646_0000009 3300046680 Bacteria 200698
1029 Ga0495646_0021007 3300046680 Bacteria 4127
1030 Ga0495646_0090311 3300046680 Bacteria 1770
1031 Ga0495646_0096072 3300046680 Bacteria 1704
1032 Ga0495647_0013620 3300046681 Bacteria 2821
1033 Ga0495647_0057352 3300046681 Bacteria 1529
1034 Ga0495658_0000065 3300046683 Bacteria 52835
1035 Ga0495658_0003665 3300046683 Bacteria 7602
1036 Ga0495658_0086163 3300046683 Bacteria 1852
1037 Ga0495669_0038062 3300046684 Bacteria 2130
1038 Ga0495613_0006292 3300046689 Bacteria 8882
1039 Ga0495613_0009544 3300046689 Bacteria 7205
1040 Ga0495624_0001118 3300046690 Bacteria 21215
1041 Ga0495624_0001463 3300046690 Bacteria 18374
1042 Ga0495624_0011107 3300046690 Bacteria 6196
1043 Ga0495624_0062489 3300046690 Bacteria 2329
1044 Ga0495624_0082189 3300046690 Bacteria 1994
1045 Ga0495670_0000506 3300046691 Bacteria 18484
1046 Ga0495671_0068569 3300046692 Bacteria 1744
1047 Ga0495671_0101024 3300046692 Bacteria 1410
1048 Ga0495649_0095725 3300046694 Bacteria 1580
1049 Ga0495600_0001478 3300046809 Bacteria 13016
1050 Ga0495600_0008371 3300046809 Bacteria 6351
1051 Ga0495600_0016518 3300046809 Bacteria 4686
1052 Ga0495600_0038130 3300046809 Bacteria 3126
1053 Ga0495600_0141975 3300046809 Bacteria 1558
1054 Ga0495660_0100064 3300046810 Bacteria 1494
1055 Ga0495581_0002630 3300047315 Bacteria 10219
1056 Ga0495581_0007122 3300047315 Bacteria 6478
1057 Ga0495581_0008727 3300047315 Bacteria 5870
1058 Ga0495581_0036712 3300047315 Bacteria 2835
1059 Ga0495581_0044466 3300047315 Bacteria 2568
1060 Ga0495581_0073821 3300047315 Bacteria 1974
1061 Ga0495581_0084489 3300047315 Bacteria 1839
1062 Ga0495604_0000069 3300047317 Bacteria 89935
1063 Ga0495604_0014602 3300047317 Bacteria 6259
1064 Ga0495604_0029121 3300047317 Bacteria 4394
1065 Ga0495604_0073607 3300047317 Bacteria 2578
1066 Ga0495604_0183139 3300047317 Bacteria 1464
1067 Ga0495674_0000002 3300047319 Bacteria 642785
1068 Ga0495674_0002892 3300047319 Bacteria 16713
1069 Ga0495674_0033064 3300047319 Bacteria 4687
1070 Ga0495674_0036782 3300047319 Bacteria 4403
1071 Ga0495674_0066059 3300047319 Bacteria 3140
1072 Ga0495674_0100049 3300047319 Bacteria 2468
1073 Ga0495674_0126427 3300047319 Bacteria 2156
1074 Ga0495674_0243184 3300047319 Bacteria 1482
1075 Ga0495672_0011413 3300047320 Bacteria 6273
1076 Ga0495672_0033677 3300047320 Bacteria 3173
1077 Ga0495676_0015401 3300047321 Bacteria 6811
1078 Ga0495676_0046916 3300047321 Bacteria 3501
1079 Ga0495680_0000313 3300047322 Bacteria 54486
1080 Ga0495680_0000328 3300047322 Bacteria 53287
1081 Ga0495680_0009069 3300047322 Bacteria 8981
1082 Ga0495680_0014330 3300047322 Bacteria 6872
1083 Ga0495680_0025994 3300047322 Bacteria 4835
1084 Ga0495680_0026513 3300047322 Bacteria 4775
1085 Ga0495680_0049430 3300047322 Bacteria 3293
1086 Ga0495680_0069978 3300047322 Bacteria 2676
1087 Ga0495680_0179285 3300047322 Bacteria 1530
1088 Ga0495675_0000245 3300047444 Bacteria 39142
1089 Ga0495677_0094565 3300047445 Bacteria 1128
1090 Ga0495679_027413 3300047446 Bacteria 1879
1091 Ga0495679_033413 3300047446 Bacteria 1644
1092 Ga0495673_0075718 3300047469 Bacteria 1405
1093 Ga0495684_0000016 3300047471 Bacteria 169338
1094 Ga0495684_0000928 3300047471 Bacteria 23791
1095 Ga0495684_0001073 3300047471 Bacteria 22129
1096 Ga0495684_0001824 3300047471 Bacteria 17119
1097 Ga0495684_0056185 3300047471 Bacteria 3001
1098 Ga0495684_0175543 3300047471 Bacteria 1591
1099 Ga0495684_0364734 3300047471 Bacteria 1022
1100 Ga0495686_0001995 3300047472 Bacteria 20251
1101 Ga0495593_0000809 3300047673 Bacteria 18103
1102 Ga0495593_0001500 3300047673 Bacteria 13713
1103 Ga0495593_0004700 3300047673 Bacteria 8121
1104 Ga0495593_0033052 3300047673 Bacteria 2818
1105 Ga0495593_0061049 3300047673 Bacteria 1972
1106 Ga0495593_0082694 3300047673 Bacteria 1659
1107 Ga0495602_0000024 3300048088 Bacteria 151162
1108 Ga0495602_0005919 3300048088 Bacteria 12839
1109 Ga0495602_0021956 3300048088 Bacteria 6260
1110 Ga0495614_0003207 3300048089 Bacteria 7303
1111 Ga0496100_0002405 3300048903 Bacteria 9481
1112 Ga0496100_0003039 3300048903 Bacteria 8659
1113 Ga0496100_0016920 3300048903 Bacteria 4291
1114 Ga0496100_0050540 3300048903 Bacteria 2694
1115 Ga0496100_0200898 3300048903 Bacteria 1453
1116 Ga0496100_0384940 3300048903 Bacteria 1066
1117 Ga0496101_0001763 3300048904 Bacteria 12984
1118 Ga0496101_0003783 3300048904 Bacteria 9451
1119 Ga0496101_0015757 3300048904 Bacteria 5102
1120 Ga0496101_0044395 3300048904 Bacteria 3180
1121 Ga0496101_0060405 3300048904 Bacteria 2750
1122 Ga0496101_0134347 3300048904 Bacteria 1881
1123 Ga0496101_0178331 3300048904 Bacteria 1635
1124 Ga0496101_0235241 3300048904 Bacteria 1425
1125 Ga0496101_0321250 3300048904 Bacteria 1214
1126 Ga0496101_0413151 3300048904 Bacteria 1063
1127 Ga0496102_0001184 3300048905 Bacteria 23693
1128 Ga0496102_0005532 3300048905 Bacteria 10730
1129 Ga0496102_0011515 3300048905 Bacteria 7628
1130 Ga0496102_0112166 3300048905 Bacteria 2543
1131 Ga0496102_0129686 3300048905 Bacteria 2359
1132 Ga0496103_0003142 3300048906 Bacteria 10157
1133 Ga0496103_0005741 3300048906 Bacteria 7414
1134 Ga0496103_0009796 3300048906 Bacteria 5674
1135 Ga0496103_0010831 3300048906 Bacteria 5397
1136 Ga0496103_0022961 3300048906 Bacteria 3760
1137 Ga0496103_0051842 3300048906 Bacteria 2540
1138 Ga0496104_0000217 3300048907 Bacteria 50667
1139 Ga0496104_0001112 3300048907 Bacteria 22984
1140 Ga0496104_0001920 3300048907 Bacteria 18014
1141 Ga0496104_0002202 3300048907 Bacteria 16864
1142 Ga0496104_0010108 3300048907 Bacteria 8424
1143 Ga0496104_0041321 3300048907 Bacteria 4324
1144 Ga0496104_0043848 3300048907 Bacteria 4201
1145 Ga0496104_0107613 3300048907 Bacteria 2672
1146 Ga0496104_0111996 3300048907 Bacteria 2617
1147 Ga0496104_0140324 3300048907 Bacteria 2321
1148 Ga0496104_0292062 3300048907 Bacteria 1543
1149 Ga0496105_0000424 3300048908 Bacteria 27799
1150 Ga0496105_0008853 3300048908 Bacteria 7842
1151 Ga0496105_0010753 3300048908 Bacteria 7205
1152 Ga0496105_0020488 3300048908 Bacteria 5344
1153 Ga0496105_0066987 3300048908 Bacteria 2965
1154 Ga0496105_0090307 3300048908 Bacteria 2530
1155 Ga0496105_0250926 3300048908 Bacteria 1433
1156 Ga0496106_0001028 3300048909 Bacteria 20530
1157 Ga0496106_0005882 3300048909 Bacteria 9068
1158 Ga0496106_0007383 3300048909 Bacteria 8123
1159 Ga0496106_0008421 3300048909 Bacteria 7629
1160 Ga0496106_0017304 3300048909 Bacteria 5336
1161 Ga0496106_0026339 3300048909 Bacteria 4329
1162 Ga0496106_0026733 3300048909 Bacteria 4297
1163 Ga0496106_0253802 3300048909 Bacteria 1406
1164 Ga0496107_0000509 3300048910 Bacteria 21565
1165 Ga0496107_0003427 3300048910 Bacteria 10601
1166 Ga0496107_0014192 3300048910 Bacteria 5578
1167 Ga0496107_0019213 3300048910 Bacteria 4821
1168 Ga0496107_0040165 3300048910 Bacteria 3357
1169 Ga0496107_0099576 3300048910 Bacteria 2130
1170 Ga0496107_0222569 3300048910 Bacteria 1404
1171 Ga0496107_0229736 3300048910 Bacteria 1380
1172 Ga0496107_0371454 3300048910 Bacteria 1064
1173 Ga0496108_0010986 3300048911 Bacteria 7354
1174 Ga0496108_0012311 3300048911 Bacteria 6958
1175 Ga0496108_0062932 3300048911 Bacteria 3124
1176 Ga0496108_0080066 3300048911 Bacteria 2766
1177 Ga0496108_0154080 3300048911 Bacteria 1984
1178 Ga0496108_0253034 3300048911 Bacteria 1532
1179 Ga0496108_0319159 3300048911 Bacteria 1354
1180 Ga0496109_0001304 3300048912 Bacteria 20607
1181 Ga0496109_0006308 3300048912 Bacteria 9983
1182 Ga0496109_0013194 3300048912 Bacteria 7151
1183 Ga0496109_0016348 3300048912 Bacteria 6484
1184 Ga0496109_0017528 3300048912 Bacteria 6278
1185 Ga0496109_0066202 3300048912 Bacteria 3307
1186 Ga0496109_0119756 3300048912 Bacteria 2451
1187 Ga0496109_0122629 3300048912 Bacteria 2421
1188 Ga0496110_0000973 3300048913 Bacteria 20082
1189 Ga0496110_0002430 3300048913 Bacteria 13955
1190 Ga0496110_0003313 3300048913 Bacteria 12303
1191 Ga0496110_0005366 3300048913 Bacteria 10043
1192 Ga0496110_0009961 3300048913 Bacteria 7709
1193 Ga0496110_0014024 3300048913 Bacteria 6642
1194 Ga0496110_0034472 3300048913 Bacteria 4384
1195 Ga0496110_0045595 3300048913 Bacteria 3833
1196 Ga0496110_0075530 3300048913 Bacteria 2994
1197 Ga0496110_0097096 3300048913 Bacteria 2640
1198 Ga0496110_0098571 3300048913 Bacteria 2619
1199 Ga0496110_0111838 3300048913 Bacteria 2455
1200 Ga0496110_0127002 3300048913 Bacteria 2301
1201 Ga0496110_0218297 3300048913 Bacteria 1734
1202 Ga0496111_0000315 3300048914 Bacteria 23917
1203 Ga0496111_0002323 3300048914 Bacteria 11453
1204 Ga0496111_0003314 3300048914 Bacteria 9963
1205 Ga0496111_0003533 3300048914 Bacteria 9672
1206 Ga0496111_0011769 3300048914 Bacteria 5906
1207 Ga0496111_0042567 3300048914 Bacteria 3261
1208 Ga0496111_0044287 3300048914 Bacteria 3199
1209 Ga0496111_0047206 3300048914 Bacteria 3101
1210 Ga0496111_0055762 3300048914 Bacteria 2858
1211 Ga0496111_0063460 3300048914 Bacteria 2679
1212 Ga0496111_0063536 3300048914 Bacteria 2677
1213 Ga0496111_0103789 3300048914 Bacteria 2091
1214 Ga0496112_0009043 3300048915 Bacteria 8947
1215 Ga0496112_0013631 3300048915 Bacteria 7511
1216 Ga0496112_0015062 3300048915 Bacteria 7200
1217 Ga0496112_0022357 3300048915 Bacteria 6026
1218 Ga0496112_0054415 3300048915 Bacteria 3932
1219 Ga0496112_0090794 3300048915 Bacteria 3023
1220 Ga0496112_0090957 3300048915 Bacteria 3020
1221 Ga0496112_0121718 3300048915 Bacteria 2579
1222 Ga0496113_0000218 3300048916 Bacteria 26800
1223 Ga0496113_0008621 3300048916 Bacteria 6650
1224 Ga0496113_0011117 3300048916 Bacteria 5989
1225 Ga0496113_0014177 3300048916 Bacteria 5429
1226 Ga0496113_0026670 3300048916 Bacteria 4134
1227 Ga0496113_0055008 3300048916 Bacteria 2982
1228 Ga0496113_0126245 3300048916 Bacteria 2004
1229 Ga0496114_0001306 3300048917 Bacteria 18867
1230 Ga0496114_0011259 3300048917 Bacteria 7142
1231 Ga0496114_0014735 3300048917 Bacteria 6283
1232 Ga0496114_0044883 3300048917 Bacteria 3669
1233 Ga0496114_0076917 3300048917 Bacteria 2813
1234 Ga0496114_0077791 3300048917 Bacteria 2797
1235 Ga0496114_0098426 3300048917 Bacteria 2494
1236 Ga0496114_0210099 3300048917 Bacteria 1707
1237 Ga0496115_0011530 3300048918 Bacteria 6627
1238 Ga0496115_0014069 3300048918 Bacteria 6057
1239 Ga0496115_0039477 3300048918 Bacteria 3749
1240 Ga0496115_0042694 3300048918 Bacteria 3613
1241 Ga0496115_0047308 3300048918 Bacteria 3439
1242 Ga0496115_0063814 3300048918 Bacteria 2972
1243 Ga0496115_0104992 3300048918 Bacteria 2318
1244 Ga0496115_0245420 3300048918 Bacteria 1475
1245 Ga0496115_0271854 3300048918 Bacteria 1392
1246 Ga0496118_0029210 3300048921 Bacteria 4628
1247 Ga0496119_0002669 3300048922 Bacteria 19295
1248 Ga0496121_0007863 3300048924 Bacteria 12751
1249 Ga0496121_0013732 3300048924 Bacteria 8677
1250 Ga0496121_0039594 3300048924 Bacteria 4149
1251 Ga0496122_0002391 3300048925 Bacteria 26802
1252 Ga0496123_0003029 3300048926 Bacteria 19369
1253 Ga0496126_0263095 3300048929 Bacteria 1434
1254 Ga0501032_0289553 3300049569 Bacteria 1060
1255 Ga0501033_0010955 3300049570 Bacteria 6950
1256 Ga0501033_0060740 3300049570 Bacteria 2787
1257 Ga0501033_0077246 3300049570 Bacteria 2443
1258 Ga0501033_0223876 3300049570 Bacteria 1338
1259 Ga0501034_0000593 3300049571 Bacteria 57233
1260 Ga0501034_0003588 3300049571 Bacteria 17615
1261 Ga0501034_0074896 3300049571 Bacteria 3392
1262 Ga0501034_0098547 3300049571 Bacteria 2918
1263 Ga0501034_0116919 3300049571 Bacteria 2654
1264 Ga0501034_0508197 3300049571 Bacteria 1118
1265 Ga0501036_0001313 3300049572 Bacteria 19069
1266 Ga0501036_0042140 3300049572 Bacteria 3865
1267 Ga0501036_0081419 3300049572 Bacteria 2736
1268 Ga0501036_0126272 3300049572 Bacteria 2160
1269 Ga0501036_0178315 3300049572 Bacteria 1789
1270 Ga0501036_0263095 3300049572 Bacteria 1445
1271 Ga0501037_0016752 3300049573 Bacteria 5392
1272 Ga0501037_0021673 3300049573 Bacteria 4751
1273 Ga0501037_0046626 3300049573 Bacteria 3178
1274 Ga0501037_0098724 3300049573 Bacteria 2109
1275 Ga0501038_0007428 3300049574 Bacteria 10112
1276 Ga0501038_0063407 3300049574 Bacteria 3154
1277 Ga0501038_0076825 3300049574 Bacteria 2821
1278 Ga0501038_0264128 3300049574 Bacteria 1359
1279 Ga0501038_0303510 3300049574 Bacteria 1252
1280 Ga0501039_0022541 3300049575 Bacteria 4834
1281 Ga0501039_0069025 3300049575 Bacteria 2744
1282 Ga0501039_0084247 3300049575 Bacteria 2476
1283 Ga0501039_0130674 3300049575 Bacteria 1971
1284 Ga0501039_0314428 3300049575 Bacteria 1231
1285 Ga0501040_0032088 3300049576 Bacteria 3553
1286 Ga0501040_0222102 3300049576 Bacteria 1344
1287 Ga0501041_0058110 3300049577 Bacteria 2366
1288 Ga0501041_0094593 3300049577 Bacteria 1846
1289 Ga0501042_0114506 3300049578 Bacteria 1942
1290 Ga0501042_0195303 3300049578 Bacteria 1459
1291 Ga0501043_0032193 3300049579 Bacteria 4121
1292 Ga0501043_0063574 3300049579 Bacteria 2898
1293 Ga0501043_0083864 3300049579 Bacteria 2505
1294 Ga0501043_0102847 3300049579 Bacteria 2245
1295 Ga0501046_0002900 3300049580 Bacteria 15897
1296 Ga0501046_0005890 3300049580 Bacteria 10927
1297 Ga0501046_0127900 3300049580 Bacteria 1928
1298 Ga0501046_0247967 3300049580 Bacteria 1312
1299 Ga0501047_0001425 3300049581 Bacteria 23479
1300 Ga0501047_0022734 3300049581 Bacteria 6021
1301 Ga0501047_0048449 3300049581 Bacteria 4103
1302 Ga0501047_0097901 3300049581 Bacteria 2811
1303 Ga0501047_0126688 3300049581 Bacteria 2434
1304 Ga0501047_0128295 3300049581 Bacteria 2416
1305 Ga0501047_0131968 3300049581 Bacteria 2378
1306 Ga0501048_0001752 3300049582 Bacteria 16493
1307 Ga0501048_0015643 3300049582 Bacteria 5599
1308 Ga0501048_0047698 3300049582 Bacteria 3056
1309 Ga0501048_0073887 3300049582 Bacteria 2406
1310 Ga0501048_0193556 3300049582 Bacteria 1441
1311 Ga0501048_0281688 3300049582 Bacteria 1182
1312 Ga0501067_0023420 3300049583 Bacteria 3422
1313 Ga0501069_0003119 3300049585 Bacteria 8495
1314 Ga0501070_0020547 3300049586 Bacteria 5538
1315 Ga0501070_0056637 3300049586 Bacteria 3249
1316 Ga0501070_0094072 3300049586 Bacteria 2479
1317 Ga0501070_0114437 3300049586 Bacteria 2228
1318 Ga0501070_0141509 3300049586 Bacteria 1986
1319 Ga0501070_0166139 3300049586 Bacteria 1819
1320 Ga0501071_0050928 3300049587 Bacteria 2983
1321 Ga0501071_0143544 3300049587 Bacteria 1779
1322 Ga0501071_0222903 3300049587 Bacteria 1419
1323 Ga0501072_0040845 3300049588 Bacteria 3643
1324 Ga0501072_0074044 3300049588 Bacteria 2693
1325 Ga0501072_0088508 3300049588 Bacteria 2457
1326 Ga0501072_0111280 3300049588 Bacteria 2180
1327 Ga0501073_0060235 3300049589 Bacteria 2649
1328 Ga0501073_0063745 3300049589 Bacteria 2570
1329 Ga0501074_0003293 3300049590 Bacteria 11426
1330 Ga0501074_0053538 3300049590 Bacteria 2910
1331 Ga0501074_0085454 3300049590 Bacteria 2261
1332 Ga0501075_0135541 3300049591 Bacteria 1876
1333 Ga0501075_0207424 3300049591 Bacteria 1495
1334 Ga0501075_0351370 3300049591 Bacteria 1123
1335 Ga0501076_0050078 3300049592 Bacteria 3304
1336 Ga0501076_0091065 3300049592 Bacteria 2453
1337 Ga0501076_0124978 3300049592 Bacteria 2084
1338 Ga0501076_0308837 3300049592 Bacteria 1297
1339 Ga0501077_0019666 3300049593 Bacteria 4271
1340 Ga0501077_0085097 3300049593 Bacteria 2004
1341 Ga0501077_0090493 3300049593 Bacteria 1939
1342 Ga0501079_0005101 3300049741 Bacteria 9754
1343 Ga0501079_0066375 3300049741 Bacteria 2784
1344 Ga0501079_0085626 3300049741 Bacteria 2439
1345 Ga0501079_0219527 3300049741 Bacteria 1485
1346 Ga0501079_0402719 3300049741 Bacteria 1073
1347 Ga0501079_0578200 3300049741 Bacteria 884
1348 Ga0501080_0002905 3300049742 Bacteria 15074
1349 Ga0501080_0007783 3300049742 Bacteria 9688
1350 Ga0501080_0015270 3300049742 Bacteria 7079
1351 Ga0501080_0025023 3300049742 Bacteria 5538
1352 Ga0501080_0027138 3300049742 Bacteria 5325
1353 Ga0501080_0081094 3300049742 Bacteria 3015
1354 Ga0501080_0092084 3300049742 Bacteria 2816
1355 Ga0501080_0303916 3300049742 Bacteria 1446
1356 Ga0501081_0000115 3300049743 Bacteria 34620
1357 Ga0501081_0041663 3300049743 Bacteria 3145
1358 Ga0501081_0065915 3300049743 Bacteria 2518
1359 Ga0501083_0000907 3300049744 Bacteria 19630
1360 Ga0501083_0051915 3300049744 Bacteria 2756
1361 Ga0501083_0066550 3300049744 Bacteria 2399
1362 Ga0501083_0137240 3300049744 Bacteria 1602
1363 Ga0501035_0000672 3300049822 Bacteria 37408
1364 Ga0501035_0129635 3300049822 Bacteria 2199
1365 Ga0501035_0140538 3300049822 Bacteria 2100
1366 Ga0501035_0222623 3300049822 Bacteria 1610
1367 Ga0501035_0385350 3300049822 Bacteria 1168
1368 Ga0501044_0003604 3300049823 Bacteria 17424
1369 Ga0501044_0005514 3300049823 Bacteria 14047
1370 Ga0501044_0011063 3300049823 Bacteria 9787
1371 Ga0501044_0036817 3300049823 Bacteria 5118
1372 Ga0501044_0312533 3300049823 Bacteria 1497
1373 Ga0501045_0036085 3300049824 Bacteria 3590
1374 Ga0501045_0069102 3300049824 Bacteria 2596
1375 nmdc:mga03683_111459_c1 3300050489 Bacteria 1210
1376 nmdc:mga03683_2647_c2 3300050489 Bacteria 3463
1377 nmdc:mga0yw44_103397_c1 3300050492 Bacteria 1817
1378 nmdc:mga0yw44_78820_c1 3300050492 Bacteria 2060
1379 nmdc:mga0k408_17687_c1 3300050493 Bacteria 3503
1380 nmdc:mga0k408_6014_c1 3300050493 Bacteria 6474
1381 nmdc:mga06z11_68606_c1 3300050494 Bacteria 1869
1382 nmdc:mga07m45_14790_c1 3300050496 Bacteria 4166
1383 nmdc:mga07m45_69058_c1 3300050496 Bacteria 2009
1384 nmdc:mga05p37_151_c1 3300050507 Bacteria 65585
1385 nmdc:mga05p37_158006_c1 3300050507 Bacteria 2770
1386 nmdc:mga05p37_19658_c1 3300050507 Bacteria 8171
1387 nmdc:mga05p37_205256_c1 3300050507 Bacteria 2384
1388 nmdc:mga05p37_354005_c1 3300050507 Bacteria 1728
1389 nmdc:mga05p37_486326_c1 3300050507 Bacteria 1420
1390 nmdc:mga05p37_7272_c1 3300050507 Bacteria 13063
1391 nmdc:mga05p37_76_c1 3300050507 Bacteria 86726
1392 nmdc:mga05p37_835274_c1 3300050507 Bacteria 1003
1393 nmdc:mga09592_41035_c1 3300050508 Bacteria 3890
1394 nmdc:mga09592_6099_c1 3300050508 Bacteria 9821
1395 nmdc:mga0qj67_61979_c1 3300050509 Bacteria 2971
1396 nmdc:mga0qj67_842_c1 3300050509 Bacteria 21012
1397 nmdc:mga06r32_114164_c1 3300050510 Bacteria 2659
1398 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
1399 nmdc:mga06r32_41813_c1 3300050510 Bacteria 4356
1400 nmdc:mga06r32_755_c1 3300050510 Bacteria 28474
1401 nmdc:mga06r32_95862_c1 3300050510 Bacteria 2904
1402 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
1403 nmdc:mga08y16_11999_c1 3300050511 Bacteria 9100
1404 nmdc:mga08y16_13020_c1 3300050511 Bacteria 8754
1405 nmdc:mga08y16_16965_c1 3300050511 Bacteria 7667
1406 nmdc:mga08y16_178114_c1 3300050511 Bacteria 2208
1407 nmdc:mga08y16_204344_c1 3300050511 Bacteria 2047
1408 nmdc:mga08y16_294692_c1 3300050511 Bacteria 1672
1409 nmdc:mga08y16_376567_c1 3300050511 Bacteria 1455
1410 nmdc:mga08y16_4279_c1 3300050511 Bacteria 14901
1411 nmdc:mga08y16_5583_c1 3300050511 Bacteria 13179
1412 nmdc:mga08y16_88424_c1 3300050511 Bacteria 3229
1413 nmdc:mga0n895_265_c1 3300050512 Bacteria 34107
1414 nmdc:mga0n895_2675_c1 3300050512 Bacteria 14060
1415 nmdc:mga0n895_2995_c1 3300050512 Bacteria 13410
1416 nmdc:mga0n895_30642_c1 3300050512 Bacteria 5143
1417 nmdc:mga0n895_35580_c1 3300050512 Bacteria 4802
1418 nmdc:mga0n895_363615_c1 3300050512 Bacteria 1465
1419 nmdc:mga0rr50_362627_c1 3300050513 Bacteria 1220
1420 nmdc:mga0rr50_60567_c1 3300050513 Bacteria 2848
1421 nmdc:mga0rr50_642_c1 3300050513 Bacteria 18790
1422 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
1423 nmdc:mga08x19_8004_c1 3300050514 Bacteria 6281
1424 nmdc:mga0a205_1049_c1 3300050515 Bacteria 23004
1425 nmdc:mga0a205_146_c1 3300050515 Bacteria 45616
1426 nmdc:mga0a205_315959_c1 3300050515 Bacteria 1433
1427 nmdc:mga0a205_464753_c1 3300050515 Bacteria 1125
1428 Ga0495601_0000001 3300053077 Bacteria 549454
1429 Ga0495601_0000355 3300053077 Bacteria 24059
1430 Ga0495601_0000589 3300053077 Bacteria 19331
1431 Ga0495601_0002218 3300053077 Bacteria 10937
1432 Ga0495601_0027567 3300053077 Bacteria 3512
1433 Ga0495601_0041071 3300053077 Bacteria 2899
1434 Ga0495601_0052633 3300053077 Bacteria 2571
1435 Ga0495601_0174202 3300053077 Bacteria 1406
1436 Ga0495612_0000017 3300053078 Bacteria 152112
1437 Ga0495612_0001305 3300053078 Bacteria 10290
1438 Ga0495612_0002281 3300053078 Bacteria 7892
1439 Ga0495612_0002637 3300053078 Bacteria 7395
1440 Ga0495612_0005030 3300053078 Bacteria 5474
1441 Ga0495612_0030943 3300053078 Bacteria 2157
1442 Ga0495595_0000010 3300053084 Bacteria 178819
1443 Ga0495595_0002470 3300053084 Bacteria 7231
1444 Ga0495595_0005994 3300053084 Bacteria 4935
1445 Ga0495595_0010133 3300053084 Bacteria 3913
1446 Ga0495595_0010381 3300053084 Bacteria 3869
1447 Ga0495595_0027953 3300053084 Bacteria 2515
1448 Ga0495619_0000004 3300053085 Bacteria 500068
1449 Ga0495619_0000048 3300053085 Bacteria 102117
1450 Ga0495619_0000256 3300053085 Bacteria 38697
1451 Ga0495619_0004051 3300053085 Bacteria 9387
1452 Ga0495619_0005443 3300053085 Bacteria 8068
1453 Ga0495619_0007179 3300053085 Bacteria 7058
1454 Ga0495619_0016131 3300053085 Bacteria 4728
1455 Ga0495619_0024473 3300053085 Bacteria 3872
1456 Ga0495619_0027188 3300053085 Bacteria 3685
1457 Ga0495619_0108884 3300053085 Bacteria 1891
1458 Ga0495619_0131097 3300053085 Bacteria 1723
1459 Ga0500644_0000933 3300053088 Bacteria 9264
1460 Ga0500651_0037963 3300053093 Bacteria 3035
1461 Ga0500651_0102768 3300053093 Bacteria 1751
1462 Ga0500641_0019072 3300053096 Bacteria 2590
1463 Ga0500650_0044577 3300053098 Bacteria 2053
1464 Ga0500555_016514 3300053103 Bacteria 2127
1465 Ga0500556_0000068 3300053104 Bacteria 103123
1466 Ga0500595_000003 3300053119 Bacteria 419332
1467 Ga0500595_003914 3300053119 Bacteria 6824
1468 Ga0500595_026787 3300053119 Bacteria 1982
1469 Ga0500652_001172 3300053131 Bacteria 8365
1470 Ga0500652_039202 3300053131 Bacteria 1899
1471 Ga0500652_068971 3300053131 Bacteria 1463
1472 Ga0500616_0000002 3300053153 Bacteria 1611257
1473 Ga0500616_0004397 3300053153 Bacteria 10067
1474 Ga0500616_0034790 3300053153 Bacteria 2743
1475 Ga0500616_0089834 3300053153 Bacteria 1524
1476 Ga0500622_0138552 3300053156 Bacteria 1163
1477 Ga0500645_000078 3300053730 Bacteria 76931
1478 Ga0500645_008422 3300053730 Bacteria 3523
1479 Ga0501084_0009668 3300054114 Bacteria 7977
1480 Ga0501084_0034716 3300054114 Bacteria 4217
1481 Ga0501084_0128439 3300054114 Bacteria 2133
1482 Ga0501084_0287667 3300054114 Bacteria 1388
1483 Ga0501084_0307775 3300054114 Bacteria 1338
1484 Ga0501084_0332364 3300054114 Bacteria 1283
1485 Ga0501082_0000510 3300060353 Bacteria 34491
1486 Ga0501082_0030402 3300060353 Bacteria 4654
1487 Ga0501082_0038034 3300060353 Bacteria 4150
1488 Ga0501082_0051708 3300060353 Bacteria 3541
1489 Ga0501082_0063448 3300060353 Bacteria 3181
1490 Ga0501082_0095928 3300060353 Bacteria 2563
1491 Ga0501082_0429790 3300060353 Bacteria 1153
1492 Ga0530510_0037742 3300061734 Bacteria 3486
1493 Ga0530510_0114950 3300061734 Bacteria 1972
1494 Ga0530510_0262622 3300061734 Bacteria 1288
1495 2513635471 2513237093 Bacteria 7545552
1496 2514014860 2513237161 Bacteria 8871253
1497 2515628579 2515154112 Bacteria 8294334
1498 2523382649 2523231044 Bacteria 6434991
1499 2524465008 2524023210 Bacteria 9029266
1500 2535520930 2534681796 Bacteria 7146037
1501 2644291236 2643221651 Bacteria 4798932
1502 2838685997 2838680041 Bacteria 6545511
1503 2838687808 2838686498 Bacteria 7807632
1504 2838699640 2838694306 Bacteria 6853137
1505 2838713059 2838707686 Bacteria 6619912
1506 2842082555 2842077413 Bacteria 6508645
1507 2842123309 2842118031 Bacteria 7033875
1508 2842242245 2842237096 Bacteria 6620661
1509 2842272161 2842271015 Bacteria 7807131
1510 2842296311 2842291075 Bacteria 7076806
1511 2842375260 2842370503 Bacteria 7038661
1512 2842382863 2842377471 Bacteria 7140707
1513 2842389422 2842384541 Bacteria 7057858
1514 2844462284 2844454524 Bacteria 7952546
1515 2874594804 2874590934 Bacteria 8299676
1516 2876774354 2876771140 Bacteria 8287509
1517 2876822856 2876818435 Bacteria 8274608
1518 2879078509 2879074833 Bacteria 8279565
1519 2879129830 2879127579 Bacteria 8294491
1520 2879146155 2879142872 Bacteria 8267021
1521 2919453271 2919450847 Bacteria 5631160
1522 2919717988 2919713450 Bacteria 7431245
1523 2935899207 2935894831 Bacteria 6620579
1524 639651250 639633055 Bacteria 7751309
1525 8001847189 8001845381 Bacteria 5804942
1526 8005549870 8005542996 Bacteria 7077758
1527 8056681937 8056681323 Bacteria 8472857
1528 Ga0373953_0009196
1529 SwRhRL2b_contig_2503292
1530 2214683826
1531 ARcpr5oldR_c000037
1532 ARSoilYngRDRAFT_c00113
1533 ARcpr5yngRDRAFT_c000014
1534 ARSoilOldRDRAFT_c000005
1535 ARCol0oldRDRAFT_c00471
1536 LJQas_1002035
1537 ARCol0yngRDRAFT_1000099
1538 JGI24032J14994_100117
1539 JGI24736J21556_1006279
1540 JGI24741J21665_1008107
1541 JGI24746J21847_1000648
1542 JGI24747J21853_1001209
1543 JGI24739J22299_10000871
1544 JGI24737J22298_10001901
1545 JGI24737J22298_10009338
1546 JGI24743J22301_10003516
1547 JGI24735J21928_10032226
1548 JGI24750J21931_1000439
1549 JGI24745J21846_1005235
1550 JGI24748J21848_1005097
1551 JGI24738J21930_10000856
1552 JGI24744J21845_10013124
1553 JGI24035J26624_1001996
1554 JGI24033J26618_1001158
1555 JGI24034J26672_10001465
1556 JGI24742J22300_10000464
1557 JGI24751J29686_10004435
1558 JGI25153J46596_10004386
1559 JGI25404J52841_10003777
1560 Ga0055536_1000524
1561 Ga0055530_10004363
1562 Ga0055540_1000054
1563 Ga0055531_10000037
1564 JGI25405J52794_10006055
1565 Ga0065717_1002123
1566 Ga0065716_1002073
1567 Ga0065704_10092942
1568 Ga0065712_10074695
1569 Ga0065715_10012983
1570 Ga0065715_10026218
1571 Ga0065707_10105725
1572 Ga0065707_10112520
1573 Ga0070658_10084650
1574 Ga0070658_10096229
1575 Ga0070676_10061936
1576 Ga0070683_100013405
1577 Ga0070683_100085340
1578 Ga0070690_100003948
1579 Ga0070690_100015657
1580 Ga0070690_100024575
1581 Ga0070690_100177059
1582 Ga0070670_100025087
1583 Ga0070670_100099329
1584 Ga0070670_100246105
1585 Ga0070677_10002031
1586 Ga0070677_10102370
1587 Ga0068869_100035291
1588 Ga0068869_100046878
1589 Ga0068869_100224938
1590 Ga0070666_10006171
1591 Ga0070666_10023242
1592 Ga0070666_10103024
1593 Ga0070680_100003647
1594 Ga0070680_100019478
1595 Ga0070680_100168978
1596 Ga0070680_100367024
1597 Ga0070682_100002015
1598 Ga0070682_100171895
1599 Ga0068868_100017327
1600 Ga0068868_100051217
1601 Ga0068868_100083566
1602 Ga0070660_100003870
1603 Ga0070660_100050132
1604 Ga0070660_100075994
1605 Ga0070660_100186912
1606 Ga0070689_100006859
1607 Ga0070689_100067079
1608 Ga0070689_100167813
1609 Ga0070689_100185900
1610 Ga0070691_10004357
1611 Ga0070691_10016445
1612 Ga0070691_10044926
1613 Ga0070687_100009855
1614 Ga0070687_100032499
1615 Ga0070687_100093310
1616 Ga0070687_100175903
1617 Ga0070692_10007167
1618 Ga0070692_10040235
1619 Ga0070692_10176558
1620 Ga0070668_100004252
1621 Ga0070668_100045512
1622 Ga0070668_100098468
1623 Ga0070669_100008306
1624 Ga0070669_100035049
1625 Ga0070669_100202959
1626 Ga0070675_100044149
1627 Ga0070675_100055315
1628 Ga0070671_100006278
1629 Ga0070671_100009728
1630 Ga0070671_100015968
1631 Ga0070671_100033397
1632 Ga0070673_100012672
1633 Ga0070673_100024715
1634 Ga0070673_100118258
1635 Ga0070673_100373958
1636 Ga0070688_100039413
1637 Ga0070688_100071559
1638 Ga0070659_100026221
1639 Ga0070659_100232167
1640 Ga0070659_100295491
1641 Ga0070667_100002235
1642 Ga0070667_100013854
1643 Ga0070667_100122035
1644 Ga0070667_100140030
1645 Ga0070667_100158721
1646 Ga0070703_10004958
1647 Ga0070703_10007397
1648 Ga0070709_10011016
1649 Ga0070709_10047697
1650 Ga0070709_10067778
1651 Ga0070714_100015917
1652 Ga0070714_100053843
1653 Ga0070713_100037939
1654 Ga0070713_100064751
1655 Ga0070713_100383500
1656 Ga0070710_10002325
1657 Ga0070710_10050700
1658 Ga0070710_10067770
1659 Ga0070710_10085486
1660 Ga0070701_10002068
1661 Ga0070701_10043327
1662 Ga0070701_10108305
1663 Ga0070711_100032612
1664 Ga0070711_100154160
1665 Ga0070711_100196272
1666 Ga0070705_100000528
1667 Ga0070705_100010364
1668 Ga0070705_100031013
1669 Ga0070705_100347503
1670 Ga0070700_100024158
1671 Ga0070700_100034214
1672 Ga0070700_100277436
1673 Ga0070694_100006551
1674 Ga0070694_100011702
1675 Ga0070694_100032984
1676 Ga0070694_100368662
1677 Ga0070708_100001688
1678 Ga0070708_100055433
1679 Ga0070708_100080088
1680 Ga0070663_100009202
1681 Ga0070663_100159867
1682 Ga0070678_100034053
1683 Ga0070678_100079875
1684 Ga0070678_100213473
1685 Ga0070678_100235032
1686 Ga0070662_100011393
1687 Ga0070662_100035015
1688 Ga0070662_100127028
1689 Ga0070681_10018493
1690 Ga0070681_10040914
1691 Ga0070681_10065168
1692 Ga0070681_10075350
1693 Ga0070681_10204988
1694 Ga0068867_100005646
1695 Ga0070685_10017763
1696 Ga0070706_100104467
1697 Ga0070707_100317375
1698 Ga0070698_100221862
1699 Ga0070698_100251705
1700 Ga0074259_12010023
1701 Ga0070699_100000147
1702 Ga0070699_100099812
1703 Ga0070699_100271659
1704 Ga0070679_100016159
1705 Ga0070679_100072533
1706 Ga0070679_100139867
1707 Ga0070679_100299686
1708 Ga0070679_100299893
1709 Ga0070679_100369957
1710 Ga0070684_100020014
1711 Ga0070684_100079026
1712 Ga0070684_100082068
1713 Ga0070684_100095019
1714 Ga0070697_100006410
1715 Ga0070697_100023710
1716 Ga0070697_100225527
1717 Ga0068853_100003634
1718 Ga0068853_100188539
1719 Ga0070672_100044896
1720 Ga0070672_100245750
1721 Ga0070686_100007349
1722 Ga0070686_100055380
1723 Ga0070686_100124883
1724 Ga0070686_100208658
1725 Ga0070695_100002809
1726 Ga0070695_100016690
1727 Ga0070695_100121973
1728 Ga0070695_100264948
1729 Ga0070696_100002859
1730 Ga0070696_100010889
1731 Ga0070696_100013307
1732 Ga0070693_100004174
1733 Ga0070693_100025730
1734 Ga0070693_100157032
1735 Ga0070665_100004170
1736 Ga0070665_100006016
1737 Ga0070665_100195770
1738 Ga0070704_100022446
1739 Ga0070704_100034292
1740 Ga0070704_100177163
1741 Ga0068855_100026130
1742 Ga0068855_100275071
1743 Ga0070664_100114890
1744 Ga0070664_100135966
1745 Ga0068857_100019002
1746 Ga0068857_100110898
1747 Ga0068857_100126963
1748 Ga0068854_100002965
1749 Ga0068854_100039626
1750 Ga0068856_100005225
1751 Ga0068856_100058468
1752 Ga0068856_100125316
1753 Ga0068852_100047369
1754 Ga0068852_100071202
1755 Ga0068852_100123780
1756 Ga0068859_100008928
1757 Ga0068859_100039892
1758 Ga0068864_100013072
1759 Ga0068864_100030146
1760 Ga0068864_100079478
1761 Ga0068864_100175221
1762 Ga0068866_10017245
1763 Ga0068861_100016579
1764 Ga0068861_100038178
1765 Ga0068861_100038636
1766 Ga0068861_100119494
1767 Ga0068851_10058728
1768 Ga0068870_10008836
1769 Ga0068870_10023842
1770 Ga0068870_10031956
1771 Ga0068863_100053128
1772 Ga0068863_100099230
1773 Ga0068863_100135514
1774 Ga0068863_100230610
1775 Ga0068858_100026832
1776 Ga0068858_100031436
1777 Ga0068858_100121393
1778 Ga0068858_100198645
1779 Ga0068860_100003101
1780 Ga0068860_100023337
1781 Ga0068860_100052065
1782 Ga0068860_100060789
1783 Ga0068860_100073921
1784 Ga0068860_100125246
1785 Ga0068860_100172469
1786 Ga0068862_100001380
1787 Ga0068862_100010646
1788 Ga0068862_100078169
1789 Ga0081455_10000096
1790 Ga0081455_10000200
1791 Ga0081455_10000768
1792 Ga0081455_10045366
1793 Ga0081455_10174039
1794 Ga0081538_10007210
1795 Ga0081538_10008625
1796 Ga0081538_10016051
1797 Ga0081538_10094613
1798 Ga0081540_1000158
1799 Ga0081540_1006707
1800 Ga0081540_1025349
1801 Ga0081540_1057025
1802 Ga0081540_1086712
1803 Ga0081539_10020277
1804 Ga0081539_10027151
1805 Ga0070717_10086802
1806 Ga0070717_10147771
1807 Ga0070717_10157079
1808 Ga0070717_10309908
1809 Ga0075365_10044325
1810 Ga0075365_10079762
1811 Ga0075368_10045474
1812 Ga0075363_100054897
1813 Ga0075432_10010891
1814 Ga0070715_10038507
1815 Ga0070716_100004647
1816 Ga0070716_100066278
1817 Ga0070716_100199148
1818 Ga0070712_100000210
1819 Ga0070712_100161297
1820 Ga0070712_100409334
1821 Ga0075362_10084393
1822 Ga0075367_10021871
1823 Ga0075367_10098232
1824 Ga0075367_10135444
1825 Ga0075369_10070243
1826 Ga0075366_10013125
1827 Ga0097621_100029343
1828 Ga0097621_100039390
1829 Ga0097621_100088576
1830 Ga0097621_100208169
1831 Ga0075370_10028731
1832 Ga0068871_100003405
1833 Ga0068871_100012612
1834 Ga0068871_100044409
1835 Ga0075428_100003646
1836 Ga0075428_100058917
1837 Ga0075428_100065348
1838 Ga0075428_100153837
1839 Ga0075428_100155914
1840 Ga0075428_100326861
1841 Ga0075430_100000133
1842 Ga0075430_100001032
1843 Ga0075430_100022952
1844 Ga0075431_100000602
1845 Ga0075431_100001362
1846 Ga0075431_100057185
1847 Ga0075431_100074190
1848 Ga0075431_100120962
1849 Ga0075433_10000328
1850 Ga0075433_10028663
1851 Ga0075433_10136920
1852 Ga0075434_100001713
1853 Ga0075434_100006226
1854 Ga0075434_100018385
1855 Ga0075434_100289224
1856 Ga0075429_100000163
1857 Ga0075429_100137894
1858 Ga0068865_100001544
1859 Ga0068865_100003466
1860 Ga0075436_100025848
1861 Ga0075436_100271637
1862 Ga0097620_100008928
1863 Ga0097620_100039897
1864 Ga0075435_100001972
1865 Ga0075435_100024791
1866 Ga0075435_100081761
1867 Ga0075435_100175333
1868 Ga0099794_10132838
1869 Ga0105244_10059189
1870 Ga0105244_10136458
1871 Ga0105240_10378029
1872 Ga0111539_10000389
1873 Ga0111539_10000725
1874 Ga0111539_10001696
1875 Ga0111539_10001808
1876 Ga0111539_10018474
1877 Ga0111539_10047916
1878 Ga0111539_10065823
1879 Ga0111539_10103174
1880 Ga0111539_10122383
1881 Ga0111539_10146602
1882 Ga0111539_10186046
1883 Ga0111539_10410216
1884 Ga0111539_10482939
1885 Ga0105245_10010250
1886 Ga0105245_10015250
1887 Ga0105245_10391633
1888 Ga0105247_10022803
1889 Ga0105247_10035997
1890 Ga0105247_10041832
1891 Ga0114129_10000227
1892 Ga0114129_10008509
1893 Ga0114129_10040105
1894 Ga0114129_10225242
1895 Ga0114129_10255373
1896 Ga0105243_10003521
1897 Ga0105243_10060998
1898 Ga0105243_10067549
1899 Ga0105241_10007067
1900 Ga0105241_10195297
1901 Ga0105242_10026334
1902 Ga0105242_10035954
1903 Ga0105242_10040216
1904 Ga0105248_10011072
1905 Ga0105248_10070147
1906 Ga0105248_10109495
1907 Ga0105248_10244342
1908 Ga0105237_10007432
1909 Ga0105237_10102994
1910 Ga0105238_10034621
1911 Ga0105249_10011087
1912 Ga0105249_10019349
1913 Ga0105249_10285547
1914 Ga0105239_10033880
1915 Ga0105239_10105997
1916 Ga0105239_10152129
1917 Ga0105239_10277133
1918 Ga0105246_10004169
1919 Ga0105246_10016137
1920 Ga0105246_10035014
1921 Ga0105246_10049515
1922 Ga0105246_10136956
1923 Ga0157335_1000780
1924 Ga0157373_10035983
1925 Ga0157371_10050774
1926 Ga0157374_10002692
1927 Ga0157374_10070776
1928 Ga0157374_10175996
1929 Ga0157378_10085517
1930 Ga0157378_10102635
1931 Ga0157378_10694426
1932 Ga0163162_10017826
1933 Ga0163162_10063021
1934 Ga0163162_10206806
1935 Ga0163162_10430330
1936 Ga0157372_10040791
1937 Ga0157375_10024786
1938 Ga0157375_10061773
1939 Ga0157375_10092850
1940 Ga0157375_10104406
1941 Ga0157375_10168893
1942 Ga0163163_10001273
1943 Ga0163163_10095739
1944 Ga0163163_10122477
1945 Ga0163163_10380939
1946 Ga0157380_10006550
1947 Ga0157377_10001621
1948 Ga0157377_10042979
1949 Ga0157376_10034213
1950 Ga0157376_10104691
1951 Ga0163161_10000266
1952 Ga0163161_10076015
1953 Ga0163161_10078274
1954 Ga0163161_10137337
1955 Ga0206354_11439474
1956 Ga0213872_10013367
1957 Ga0213874_10007563
1958 Ga0213876_10000603
1959 Ga0213876_10032997
1960 Ga0213876_10035830
1961 Ga0213876_10048232
1962 Ga0213876_10150269
1963 Ga0213875_10000918
1964 Ga0213875_10146050
1965 Ga0224572_1002050
1966 Ga0207666_1000534
1967 Ga0207666_1001132
1968 Ga0207673_1000597
1969 Ga0209676_1000105
1970 Ga0209758_1001548
1971 Ga0209758_1001765
1972 Ga0209050_1001283
1973 Ga0209051_1000064
1974 Ga0209257_1000109
1975 Ga0207697_10002026
1976 Ga0207697_10003146
1977 Ga0207656_10020871
1978 Ga0207655_1055096
1979 Ga0207653_10002185
1980 Ga0207653_10002726
1981 Ga0207682_10000009
1982 Ga0207682_10003948
1983 Ga0207692_10010088
1984 Ga0207642_10007417
1985 Ga0207642_10010905
1986 Ga0207710_10001303
1987 Ga0207688_10000892
1988 Ga0207688_10110652
1989 Ga0207688_10132250
1990 Ga0207680_10004104
1991 Ga0207680_10025243
1992 Ga0207647_10002160
1993 Ga0207685_10031650
1994 Ga0207685_10055893
1995 Ga0207699_10037062
1996 Ga0207645_10000999
1997 Ga0207645_10035204
1998 Ga0207643_10001172
1999 Ga0207643_10028428
2000 Ga0207705_10076146
2001 Ga0207705_10114279
2002 Ga0207684_10019788
2003 Ga0207654_10015486
2004 Ga0207654_10156190
2005 Ga0207707_10006761
2006 Ga0207707_10045583
2007 Ga0207707_10163271
2008 Ga0207707_10247057
2009 Ga0207707_10386783
2010 Ga0207707_10448620
2011 Ga0207695_10154802
2012 Ga0207695_10170648
2013 Ga0207671_10070082
2014 Ga0207671_10113096
2015 Ga0207693_10002396
2016 Ga0207693_10007042
2017 Ga0207693_10012580
2018 Ga0207693_10024070
2019 Ga0207693_10128480
2020 Ga0207693_10192406
2021 Ga0207663_10194477
2022 Ga0207663_10266655
2023 Ga0207660_10001283
2024 Ga0207660_10096292
2025 Ga0207662_10000025
2026 Ga0207662_10007904
2027 Ga0207662_10043635
2028 Ga0207657_10010579
2029 Ga0207657_10086122
2030 Ga0207657_10146148
2031 Ga0207657_10320484
2032 Ga0207649_10006638
2033 Ga0207649_10115293
2034 Ga0207649_10176922
2035 Ga0207652_10006125
2036 Ga0207652_10059120
2037 Ga0207652_10069453
2038 Ga0207652_10103214
2039 Ga0207652_10264514
2040 Ga0207652_10371714
2041 Ga0207652_10506786
2042 Ga0207646_10051439
2043 Ga0207681_10002039
2044 Ga0207681_10012199
2045 Ga0207694_10037333
2046 Ga0207694_10353411
2047 Ga0207650_10074985
2048 Ga0207650_10237350
2049 Ga0207659_10014716
2050 Ga0207687_10003202
2051 Ga0207687_10011809
2052 Ga0207687_10255936
2053 Ga0207700_10064877
2054 Ga0207700_10155337
2055 Ga0207644_10003326
2056 Ga0207644_10009497
2057 Ga0207644_10025426
2058 Ga0207644_10190507
2059 Ga0207690_10007239
2060 Ga0207690_10264505
2061 Ga0207706_10005363
2062 Ga0207706_10007588
2063 Ga0207706_10015532
2064 Ga0207706_10016523
2065 Ga0207706_10063677
2066 Ga0207706_10107599
2067 Ga0207686_10020623
2068 Ga0207709_10002970
2069 Ga0207709_10020213
2070 Ga0207709_10027140
2071 Ga0207709_10037377
2072 Ga0207670_10003489
2073 Ga0207670_10048850
2074 Ga0207670_10082490
2075 Ga0207670_10209815
2076 Ga0207670_10391355
2077 Ga0207669_10001324
2078 Ga0207669_10022747
2079 Ga0207669_10046762
2080 Ga0207669_10082786
2081 Ga0207669_10094727
2082 Ga0207669_10187070
2083 Ga0207669_10222069
2084 Ga0207704_10000130
2085 Ga0207704_10122991
2086 Ga0207704_10184642
2087 Ga0207665_10002113
2088 Ga0207665_10024373
2089 Ga0207665_10417650
2090 Ga0207691_10001422
2091 Ga0207691_10002604
2092 Ga0207691_10103504
2093 Ga0207691_10175920
2094 Ga0207691_10386682
2095 Ga0207711_10001071
2096 Ga0207711_10012903
2097 Ga0207711_10019431
2098 Ga0207711_10081889
2099 Ga0207711_10100479
2100 Ga0207689_10001156
2101 Ga0207689_10066148
2102 Ga0207689_10254733
2103 Ga0207661_10028696
2104 Ga0207661_10186261
2105 Ga0207661_10237224
2106 Ga0207661_10415447
2107 Ga0207661_10429362
2108 Ga0207679_10003209
2109 Ga0207679_10390710
2110 Ga0207667_10028359
2111 Ga0207667_10089076
2112 Ga0207667_10272091
2113 Ga0207667_10436413
2114 Ga0207651_10010192
2115 Ga0207651_10212060
2116 Ga0207712_10000579
2117 Ga0207712_10007061
2118 Ga0207712_10020831
2119 Ga0207668_10000815
2120 Ga0207668_10003465
2121 Ga0207668_10108641
2122 Ga0207668_10203378
2123 Ga0207640_10122108
2124 Ga0207658_10002475
2125 Ga0207658_10003151
2126 Ga0207658_10015729
2127 Ga0207658_10124397
2128 Ga0207677_10011181
2129 Ga0207677_10252437
2130 Ga0207703_10010308
2131 Ga0207703_10033374
2132 Ga0207639_10001866
2133 Ga0207639_10159860
2134 Ga0207639_10383618
2135 Ga0207678_10008348
2136 Ga0207678_10008633
2137 Ga0207678_10046782
2138 Ga0207708_10000402
2139 Ga0207708_10002738
2140 Ga0207708_10055684
2141 Ga0207708_10147325
2142 Ga0207708_10437374
2143 Ga0207702_10046199
2144 Ga0207702_10091417
2145 Ga0207641_10014704
2146 Ga0207641_10072572
2147 Ga0207641_10087180
2148 Ga0207641_10095692
2149 Ga0207648_10001500
2150 Ga0207648_10004627
2151 Ga0207676_10017931
2152 Ga0207676_10071930
2153 Ga0207676_10101902
2154 Ga0207676_10137857
2155 Ga0207674_10007131
2156 Ga0207674_10021894
2157 Ga0207674_10043375
2158 Ga0207675_100002311
2159 Ga0207675_100003859
2160 Ga0207675_100019447
2161 Ga0207675_100051796
2162 Ga0207683_10000850
2163 Ga0207683_10010051
2164 Ga0207683_10062694
2165 Ga0207683_10096310
2166 Ga0207683_10208074
2167 Ga0207683_10211505
2168 Ga0207698_10005963
2169 Ga0207698_10052400
2170 Ga0207698_10344543
2171 Ga0209995_1009515
2172 Ga0210002_1000490
2173 Ga0209971_1023345
2174 Ga0209966_1003846
2175 Ga0209998_10000759
2176 Ga0209998_10001051
2177 Ga0209974_10039214
2178 Ga0207428_10000164
2179 Ga0207428_10000391
2180 Ga0207428_10001108
2181 Ga0207428_10008433
2182 Ga0207428_10024777
2183 Ga0268266_10002016
2184 Ga0268266_10127443
2185 Ga0268265_10003240
2186 Ga0268265_10042298
2187 Ga0268265_10265390
2188 Ga0268264_10020827
2189 Ga0268264_10061652
2190 Ga0268264_10061975
2191 Ga0268264_10128256
2192 Ga0268264_10144215
2193 Ga0268264_10151718
2194 Ga0268264_10167044
2195 Ga0265337_1000284
2196 Ga0307515_10248642
2197 Ga0265338_10005223
2198 Ga0265330_10027948
2199 Ga0265330_10102093
2200 Ga0265332_10000508
2201 Ga0265332_10026267
2202 Ga0265332_10073934
2203 Ga0265325_10000019
2204 Ga0265325_10001329
2205 Ga0265325_10003017
2206 Ga0265325_10004090
2207 Ga0265325_10025995
2208 Ga0265325_10034256
2209 Ga0265325_10063293
2210 Ga0265325_10067790
2211 Ga0265340_10009669
2212 Ga0265340_10024385
2213 Ga0265340_10024647
2214 Ga0265340_10037227
2215 Ga0265339_10000096
2216 Ga0265339_10001912
2217 Ga0265339_10006450
2218 Ga0265339_10008869
2219 Ga0265339_10015052
2220 Ga0265331_10042725
2221 Ga0265327_10000177
2222 Ga0265313_10000024
2223 Ga0265313_10004465
2224 Ga0265313_10006000
2225 Ga0265313_10025519
2226 Ga0265313_10028957
2227 Ga0265313_10047499
2228 Ga0265313_10100613
2229 Ga0265314_10001355
2230 Ga0265342_10000573
2231 Ga0265342_10001257
2232 Ga0307516_10054650
2233 Ga0307407_10177306
2234 Ga0307414_10063480
2235 Ga0307415_100147752
2236 Ga0316583_10001118
2237 Ga0373930_0000713
2238 Ga0373948_0000426
2239 Ga0373948_0001212
2240 Ga0373950_0004976
2241 Ga0373958_0000992
2242 Ga0373958_0005970
2243 Ga0373959_0000111
2244 Ga0373938_0000386
2245 Ga0373938_0000527
2246 Ga0373938_0004135
2247 Ga0373926_0000388
2248 Ga0373926_0012315
2249 Ga0373928_0000045
2250 Ga0373929_0000214
2251 Ga0373934_0073810
2252 Ga0373940_0003391
2253 Ga0373940_0008685
2254 Ga0373940_0016914
2255 Ga0373944_0000734
2256 Ga0373944_0013920
2257 Ga0373944_0019891
2258 Ga0373949_0002131
2259 Ga0373949_0002981
2260 Ga0373951_0000335
2261 Ga0373951_0005629
2262 Ga0373951_0013871
2263 Ga0373952_0000179
2264 Ga0373952_0004378
2265 Ga0373923_0000978
2266 Ga0373932_0000271
2267 Ga0373932_0002322
2268 Ga0373932_0023548
2269 Ga0373936_0001860
2270 Ga0373936_0011435
2271 Ga0373936_0036477
2272 Ga0373939_0008122
2273 Ga0373939_0011931
2274 Ga0373941_0000241
2275 Ga0373941_0033442
2276 Ga0373945_0016965
2277 Ga0373945_0018406
2278 Ga0373945_0028858
2279 Ga0373954_0000707
2280 Ga0373954_0025763
2281 Ga0373954_0045424
2282 Ga0373954_0077547
2283 Ga0373956_0023428
2284 Ga0373956_0029934
2285 Ga0373957_0002977
2286 Ga0373957_0036321
2287 Ga0373957_0047844
2288 Ga0373960_0003102
2289 Ga0373960_0024562
2290 Ga0373943_0000233
2291 Ga0373943_0000997
2292 Ga0373943_0007851
2293 Ga0373943_0047269
2294 Ga0373946_0007488
2295 Ga0373946_0011741
2296 Ga0373946_0026501
2297 Ga0373955_0001092
2298 Ga0373955_0002224
2299 Ga0373955_0005439
2300 Ga0373955_0014964
2301 Ga0373942_0008878
2302 Ga0373961_0000592
2303 Ga0373961_0003081
2304 Ga0373961_0005827
2305 Ga0373961_0011637
2306 Ga0373962_0000848
2307 Ga0373962_0002023
2308 Ga0373962_0020380
2309 Ga0373924_0070650
2310 Ga0373924_0145353
2311 Ga0373931_0001210
2312 Ga0373931_0003979
2313 Ga0373931_0004155
2314 Ga0373931_0004514
2315 Ga0373931_0018978
2316 Ga0373931_0174512
2317 Ga0373931_0275359
2318 Ga0373935_0000377
2319 Ga0373935_0001455
2320 Ga0373935_0003956
2321 Ga0373935_0084931
2322 Ga0373935_0188072
2323 Ga0373927_0000113
2324 Ga0373927_0013803
2325 Ga0373927_0017901
2326 Ga0373927_0021648
2327 Ga0373927_0035757
2328 Ga0373927_0041852
2329 Ga0373927_0060060
2330 Ga0373927_0067856
2331 Ga0373927_0080694
2332 Ga0373933_0000258
2333 Ga0373933_0010567
2334 Ga0373933_0017191
2335 Ga0373933_0034562
2336 Ga0373933_0043589
2337 Ga0373933_0129767
2338 Ga0373947_0000168
2339 Ga0373947_0000280
2340 Ga0373947_0012523
2341 Ga0373947_0013179
2342 Ga0373947_0019089
2343 Ga0373947_0020590
2344 Ga0373937_0000814
2345 Ga0373937_0001849
2346 Ga0373937_0005769
2347 Ga0373937_0008814
2348 Ga0373937_0011708
2349 Ga0373937_0017925
2350 Ga0373937_0059689
2351 Ga0373937_0191559
2352 Ga0373925_0000075
2353 Ga0373925_0001434
2354 Ga0373925_0003256
2355 Ga0373925_0013932
2356 Ga0373925_0115233
2357 Ga0373925_0136762
2358 Ga0373925_0198248
2359 Ga0373925_0313423
2360 Ga0395899_0005270
2361 Ga0395899_0083216
2362 Ga0395900_0004997
2363 Ga0395900_0334631
2364 Ga0395898_0005343
2365 Ga0395898_0109287
2366 Ga0395898_0211384
2367 Ga0395898_0252358
2368 Ga0436364_0266645
2369 Ga0436364_0611324
2370 Ga0436364_1284638
2371 Ga0395901_0009254
2372 Ga0395901_0114297
2373 Ga0242420_010110
2374 Ga0436365_0117548
2375 Ga0436365_0321935
2376 Ga0436365_0448461
2377 Ga0436365_0692136
2378 Ga0436365_0827365
2379 Ga0436365_1485216
2380 Ga0436365_1545760
2381 Ga0436361_0569994
2382 Ga0436361_0679413
2383 Ga0436361_1044250
2384 Ga0436363_0519487
2385 Ga0436363_1624569
2386 Ga0436363_1706863
2387 Ga0439453_0021580
2388 Ga0451853_2607190
2389 Ga0451853_3173075
2390 Ga0439441_006469
2391 Ga0439443_005645
2392 Ga0439450_002586
2393 Ga0466963_0002455
2394 Ga0466963_0059496
2395 Ga0466968_0009361
2396 Ga0466957_0012658
2397 Ga0466959_0045768
2398 Ga0451576_0006479
2399 Ga0466967_0006697
2400 Ga0466967_0104801
2401 Ga0466967_0180663
2402 Ga0495592_0000060
2403 Ga0495592_0003878
2404 Ga0495592_0026131
2405 Ga0495592_0051488
2406 Ga0495592_0052855
2407 Ga0495603_0004025
2408 Ga0495603_0023263
2409 Ga0495629_0000118
2410 Ga0495629_0000139
2411 Ga0495629_0027523
2412 Ga0495629_0115745
2413 Ga0495629_0117691
2414 Ga0495629_0139108
2415 Ga0495629_0145651
2416 Ga0495629_0159256
2417 Ga0495638_0043216
2418 Ga0495641_0026615
2419 Ga0495651_0000181
2420 Ga0495651_0001419
2421 Ga0495651_0004794
2422 Ga0495651_0084089
2423 Ga0495651_0086259
2424 Ga0495653_0000141
2425 Ga0495653_0006362
2426 Ga0495653_0067003
2427 Ga0495580_0005444
2428 Ga0495580_0018852
2429 Ga0495580_0047339
2430 Ga0495580_0126130
2431 Ga0495582_0037925
2432 Ga0495582_0042876
2433 Ga0495582_0044124
2434 Ga0495582_0244600
2435 Ga0495605_0065887
2436 Ga0495639_0005719
2437 Ga0495639_0037816
2438 Ga0495639_0055354
2439 Ga0495662_0000223
2440 Ga0495662_0001139
2441 Ga0495662_0028741
2442 Ga0495664_0000003
2443 Ga0495664_0000800
2444 Ga0495664_0017877
2445 Ga0495664_0076038
2446 Ga0495664_0132456
2447 Ga0495584_0039361
2448 Ga0495585_0001030
2449 Ga0495594_0002129
2450 Ga0495594_0015379
2451 Ga0495594_0026453
2452 Ga0495607_0006002
2453 Ga0495607_0187944
2454 Ga0495606_0020594
2455 Ga0495606_0034704
2456 Ga0495608_0000011
2457 Ga0495608_0000398
2458 Ga0495608_0000911
2459 Ga0495608_0030340
2460 Ga0495608_0036267
2461 Ga0495608_0061262
2462 Ga0495608_0120492
2463 Ga0495618_0000044
2464 Ga0495618_0017292
2465 Ga0495618_0019414
2466 Ga0495618_0028428
2467 Ga0495618_0067596
2468 Ga0495618_0069530
2469 Ga0495618_0126539
2470 Ga0495628_0000001
2471 Ga0495628_0005139
2472 Ga0495628_0006666
2473 Ga0495628_0024922
2474 Ga0495628_0258755
2475 Ga0495630_0000574
2476 Ga0495630_0011656
2477 Ga0495630_0047151
2478 Ga0495630_0070201
2479 Ga0495630_0100159
2480 Ga0495630_0200181
2481 Ga0495637_0054463
2482 Ga0495644_0000513
2483 Ga0495648_0004446
2484 Ga0495663_0053960
2485 Ga0495666_0002030
2486 Ga0495666_0009646
2487 Ga0495652_0000002
2488 Ga0495652_0014420
2489 Ga0495652_0016128
2490 Ga0495652_0016289
2491 Ga0495652_0032084
2492 Ga0495652_0081927
2493 Ga0495652_0134264
2494 Ga0495652_0136862
2495 Ga0495665_0003032
2496 Ga0495665_0004686
2497 Ga0495665_0028599
2498 Ga0495665_0032349
2499 Ga0495665_0041588
2500 Ga0495665_0056169
2501 Ga0495665_0074346
2502 Ga0495640_0000002
2503 Ga0495640_0000544
2504 Ga0495640_0015185
2505 Ga0495640_0108952
2506 Ga0495640_0141892
2507 Ga0495586_0037924
2508 Ga0495587_0000001
2509 Ga0495587_0000599
2510 Ga0495587_0002174
2511 Ga0495587_0003798
2512 Ga0495587_0015799
2513 Ga0495587_0048234
2514 Ga0495587_0100622
2515 Ga0495621_0006662
2516 Ga0495645_0000002
2517 Ga0495645_0008747
2518 Ga0495645_0016750
2519 Ga0495645_0026193
2520 Ga0495645_0072642
2521 Ga0495633_0004113
2522 Ga0495633_0134210
2523 Ga0495667_0000039
2524 Ga0495667_0008770
2525 Ga0495667_0023899
2526 Ga0495667_0047251
2527 Ga0495667_0056128
2528 Ga0495656_0000091
2529 Ga0495656_0046837
2530 Ga0495634_0000010
2531 Ga0495634_0023758
2532 Ga0495634_0126332
2533 Ga0495634_0182707
2534 Ga0495625_0000012
2535 Ga0495635_0000001
2536 Ga0495635_0004203
2537 Ga0495635_0006281
2538 Ga0495635_0018687
2539 Ga0495659_0059779
2540 Ga0495588_0010028
2541 Ga0495588_0033132
2542 Ga0495588_0041177
2543 Ga0495657_0000042
2544 Ga0495657_0001942
2545 Ga0495657_0031508
2546 Ga0495657_0107094
2547 Ga0495599_0000013
2548 Ga0495599_0008880
2549 Ga0495599_0042108
2550 Ga0495623_0000050
2551 Ga0495623_0006342
2552 Ga0495623_0028043
2553 Ga0495623_0035033
2554 Ga0495623_0088991
2555 Ga0495646_0000009
2556 Ga0495646_0021007
2557 Ga0495646_0090311
2558 Ga0495646_0096072
2559 Ga0495647_0013620
2560 Ga0495647_0057352
2561 Ga0495658_0000065
2562 Ga0495658_0003665
2563 Ga0495658_0086163
2564 Ga0495669_0038062
2565 Ga0495613_0006292
2566 Ga0495613_0009544
2567 Ga0495624_0001118
2568 Ga0495624_0001463
2569 Ga0495624_0011107
2570 Ga0495624_0062489
2571 Ga0495624_0082189
2572 Ga0495670_0000506
2573 Ga0495671_0068569
2574 Ga0495671_0101024
2575 Ga0495649_0095725
2576 Ga0495600_0001478
2577 Ga0495600_0008371
2578 Ga0495600_0016518
2579 Ga0495600_0038130
2580 Ga0495600_0141975
2581 Ga0495660_0100064
2582 Ga0495581_0002630
2583 Ga0495581_0007122
2584 Ga0495581_0008727
2585 Ga0495581_0036712
2586 Ga0495581_0044466
2587 Ga0495581_0073821
2588 Ga0495581_0084489
2589 Ga0495604_0000069
2590 Ga0495604_0014602
2591 Ga0495604_0029121
2592 Ga0495604_0073607
2593 Ga0495604_0183139
2594 Ga0495674_0000002
2595 Ga0495674_0002892
2596 Ga0495674_0033064
2597 Ga0495674_0036782
2598 Ga0495674_0066059
2599 Ga0495674_0100049
2600 Ga0495674_0126427
2601 Ga0495674_0243184
2602 Ga0495672_0011413
2603 Ga0495672_0033677
2604 Ga0495676_0015401
2605 Ga0495676_0046916
2606 Ga0495680_0000313
2607 Ga0495680_0000328
2608 Ga0495680_0009069
2609 Ga0495680_0014330
2610 Ga0495680_0025994
2611 Ga0495680_0026513
2612 Ga0495680_0049430
2613 Ga0495680_0069978
2614 Ga0495680_0179285
2615 Ga0495675_0000245
2616 Ga0495677_0094565
2617 Ga0495679_027413
2618 Ga0495679_033413
2619 Ga0495673_0075718
2620 Ga0495684_0000016
2621 Ga0495684_0000928
2622 Ga0495684_0001073
2623 Ga0495684_0001824
2624 Ga0495684_0056185
2625 Ga0495684_0175543
2626 Ga0495684_0364734
2627 Ga0495686_0001995
2628 Ga0495593_0000809
2629 Ga0495593_0001500
2630 Ga0495593_0004700
2631 Ga0495593_0033052
2632 Ga0495593_0061049
2633 Ga0495593_0082694
2634 Ga0495602_0000024
2635 Ga0495602_0005919
2636 Ga0495602_0021956
2637 Ga0495614_0003207
2638 Ga0496100_0002405
2639 Ga0496100_0003039
2640 Ga0496100_0016920
2641 Ga0496100_0050540
2642 Ga0496100_0200898
2643 Ga0496100_0384940
2644 Ga0496101_0001763
2645 Ga0496101_0003783
2646 Ga0496101_0015757
2647 Ga0496101_0044395
2648 Ga0496101_0060405
2649 Ga0496101_0134347
2650 Ga0496101_0178331
2651 Ga0496101_0235241
2652 Ga0496101_0321250
2653 Ga0496101_0413151
2654 Ga0496102_0001184
2655 Ga0496102_0005532
2656 Ga0496102_0011515
2657 Ga0496102_0112166
2658 Ga0496102_0129686
2659 Ga0496103_0003142
2660 Ga0496103_0005741
2661 Ga0496103_0009796
2662 Ga0496103_0010831
2663 Ga0496103_0022961
2664 Ga0496103_0051842
2665 Ga0496104_0000217
2666 Ga0496104_0001112
2667 Ga0496104_0001920
2668 Ga0496104_0002202
2669 Ga0496104_0010108
2670 Ga0496104_0041321
2671 Ga0496104_0043848
2672 Ga0496104_0107613
2673 Ga0496104_0111996
2674 Ga0496104_0140324
2675 Ga0496104_0292062
2676 Ga0496105_0000424
2677 Ga0496105_0008853
2678 Ga0496105_0010753
2679 Ga0496105_0020488
2680 Ga0496105_0066987
2681 Ga0496105_0090307
2682 Ga0496105_0250926
2683 Ga0496106_0001028
2684 Ga0496106_0005882
2685 Ga0496106_0007383
2686 Ga0496106_0008421
2687 Ga0496106_0017304
2688 Ga0496106_0026339
2689 Ga0496106_0026733
2690 Ga0496106_0253802
2691 Ga0496107_0000509
2692 Ga0496107_0003427
2693 Ga0496107_0014192
2694 Ga0496107_0019213
2695 Ga0496107_0040165
2696 Ga0496107_0099576
2697 Ga0496107_0222569
2698 Ga0496107_0229736
2699 Ga0496107_0371454
2700 Ga0496108_0010986
2701 Ga0496108_0012311
2702 Ga0496108_0062932
2703 Ga0496108_0080066
2704 Ga0496108_0154080
2705 Ga0496108_0253034
2706 Ga0496108_0319159
2707 Ga0496109_0001304
2708 Ga0496109_0006308
2709 Ga0496109_0013194
2710 Ga0496109_0016348
2711 Ga0496109_0017528
2712 Ga0496109_0066202
2713 Ga0496109_0119756
2714 Ga0496109_0122629
2715 Ga0496110_0000973
2716 Ga0496110_0002430
2717 Ga0496110_0003313
2718 Ga0496110_0005366
2719 Ga0496110_0009961
2720 Ga0496110_0014024
2721 Ga0496110_0034472
2722 Ga0496110_0045595
2723 Ga0496110_0075530
2724 Ga0496110_0097096
2725 Ga0496110_0098571
2726 Ga0496110_0111838
2727 Ga0496110_0127002
2728 Ga0496110_0218297
2729 Ga0496111_0000315
2730 Ga0496111_0002323
2731 Ga0496111_0003314
2732 Ga0496111_0003533
2733 Ga0496111_0011769
2734 Ga0496111_0042567
2735 Ga0496111_0044287
2736 Ga0496111_0047206
2737 Ga0496111_0055762
2738 Ga0496111_0063460
2739 Ga0496111_0063536
2740 Ga0496111_0103789
2741 Ga0496112_0009043
2742 Ga0496112_0013631
2743 Ga0496112_0015062
2744 Ga0496112_0022357
2745 Ga0496112_0054415
2746 Ga0496112_0090794
2747 Ga0496112_0090957
2748 Ga0496112_0121718
2749 Ga0496113_0000218
2750 Ga0496113_0008621
2751 Ga0496113_0011117
2752 Ga0496113_0014177
2753 Ga0496113_0026670
2754 Ga0496113_0055008
2755 Ga0496113_0126245
2756 Ga0496114_0001306
2757 Ga0496114_0011259
2758 Ga0496114_0014735
2759 Ga0496114_0044883
2760 Ga0496114_0076917
2761 Ga0496114_0077791
2762 Ga0496114_0098426
2763 Ga0496114_0210099
2764 Ga0496115_0011530
2765 Ga0496115_0014069
2766 Ga0496115_0039477
2767 Ga0496115_0042694
2768 Ga0496115_0047308
2769 Ga0496115_0063814
2770 Ga0496115_0104992
2771 Ga0496115_0245420
2772 Ga0496115_0271854
2773 Ga0496118_0029210
2774 Ga0496119_0002669
2775 Ga0496121_0007863
2776 Ga0496121_0013732
2777 Ga0496121_0039594
2778 Ga0496122_0002391
2779 Ga0496123_0003029
2780 Ga0496126_0263095
2781 Ga0501032_0289553
2782 Ga0501033_0010955
2783 Ga0501033_0060740
2784 Ga0501033_0077246
2785 Ga0501033_0223876
2786 Ga0501034_0000593
2787 Ga0501034_0003588
2788 Ga0501034_0074896
2789 Ga0501034_0098547
2790 Ga0501034_0116919
2791 Ga0501034_0508197
2792 Ga0501036_0001313
2793 Ga0501036_0042140
2794 Ga0501036_0081419
2795 Ga0501036_0126272
2796 Ga0501036_0178315
2797 Ga0501036_0263095
2798 Ga0501037_0016752
2799 Ga0501037_0021673
2800 Ga0501037_0046626
2801 Ga0501037_0098724
2802 Ga0501038_0007428
2803 Ga0501038_0063407
2804 Ga0501038_0076825
2805 Ga0501038_0264128
2806 Ga0501038_0303510
2807 Ga0501039_0022541
2808 Ga0501039_0069025
2809 Ga0501039_0084247
2810 Ga0501039_0130674
2811 Ga0501039_0314428
2812 Ga0501040_0032088
2813 Ga0501040_0222102
2814 Ga0501041_0058110
2815 Ga0501041_0094593
2816 Ga0501042_0114506
2817 Ga0501042_0195303
2818 Ga0501043_0032193
2819 Ga0501043_0063574
2820 Ga0501043_0083864
2821 Ga0501043_0102847
2822 Ga0501046_0002900
2823 Ga0501046_0005890
2824 Ga0501046_0127900
2825 Ga0501046_0247967
2826 Ga0501047_0001425
2827 Ga0501047_0022734
2828 Ga0501047_0048449
2829 Ga0501047_0097901
2830 Ga0501047_0126688
2831 Ga0501047_0128295
2832 Ga0501047_0131968
2833 Ga0501048_0001752
2834 Ga0501048_0015643
2835 Ga0501048_0047698
2836 Ga0501048_0073887
2837 Ga0501048_0193556
2838 Ga0501048_0281688
2839 Ga0501067_0023420
2840 Ga0501069_0003119
2841 Ga0501070_0020547
2842 Ga0501070_0056637
2843 Ga0501070_0094072
2844 Ga0501070_0114437
2845 Ga0501070_0141509
2846 Ga0501070_0166139
2847 Ga0501071_0050928
2848 Ga0501071_0143544
2849 Ga0501071_0222903
2850 Ga0501072_0040845
2851 Ga0501072_0074044
2852 Ga0501072_0088508
2853 Ga0501072_0111280
2854 Ga0501073_0060235
2855 Ga0501073_0063745
2856 Ga0501074_0003293
2857 Ga0501074_0053538
2858 Ga0501074_0085454
2859 Ga0501075_0135541
2860 Ga0501075_0207424
2861 Ga0501075_0351370
2862 Ga0501076_0050078
2863 Ga0501076_0091065
2864 Ga0501076_0124978
2865 Ga0501076_0308837
2866 Ga0501077_0019666
2867 Ga0501077_0085097
2868 Ga0501077_0090493
2869 Ga0501079_0005101
2870 Ga0501079_0066375
2871 Ga0501079_0085626
2872 Ga0501079_0219527
2873 Ga0501079_0402719
2874 Ga0501079_0578200
2875 Ga0501080_0002905
2876 Ga0501080_0007783
2877 Ga0501080_0015270
2878 Ga0501080_0025023
2879 Ga0501080_0027138
2880 Ga0501080_0081094
2881 Ga0501080_0092084
2882 Ga0501080_0303916
2883 Ga0501081_0000115
2884 Ga0501081_0041663
2885 Ga0501081_0065915
2886 Ga0501083_0000907
2887 Ga0501083_0051915
2888 Ga0501083_0066550
2889 Ga0501083_0137240
2890 Ga0501035_0000672
2891 Ga0501035_0129635
2892 Ga0501035_0140538
2893 Ga0501035_0222623
2894 Ga0501035_0385350
2895 Ga0501044_0003604
2896 Ga0501044_0005514
2897 Ga0501044_0011063
2898 Ga0501044_0036817
2899 Ga0501044_0312533
2900 Ga0501045_0036085
2901 Ga0501045_0069102
2902 nmdc:mga03683_111459_c1
2903 nmdc:mga03683_2647_c2
2904 nmdc:mga0yw44_103397_c1
2905 nmdc:mga0yw44_78820_c1
2906 nmdc:mga0k408_17687_c1
2907 nmdc:mga0k408_6014_c1
2908 nmdc:mga06z11_68606_c1
2909 nmdc:mga07m45_14790_c1
2910 nmdc:mga07m45_69058_c1
2911 nmdc:mga05p37_151_c1
2912 nmdc:mga05p37_158006_c1
2913 nmdc:mga05p37_19658_c1
2914 nmdc:mga05p37_205256_c1
2915 nmdc:mga05p37_354005_c1
2916 nmdc:mga05p37_486326_c1
2917 nmdc:mga05p37_7272_c1
2918 nmdc:mga05p37_76_c1
2919 nmdc:mga05p37_835274_c1
2920 nmdc:mga09592_41035_c1
2921 nmdc:mga09592_6099_c1
2922 nmdc:mga0qj67_61979_c1
2923 nmdc:mga0qj67_842_c1
2924 nmdc:mga06r32_114164_c1
2925 nmdc:mga06r32_134_c1
2926 nmdc:mga06r32_41813_c1
2927 nmdc:mga06r32_755_c1
2928 nmdc:mga06r32_95862_c1
2929 nmdc:mga08y16_108_c1
2930 nmdc:mga08y16_11999_c1
2931 nmdc:mga08y16_13020_c1
2932 nmdc:mga08y16_16965_c1
2933 nmdc:mga08y16_178114_c1
2934 nmdc:mga08y16_204344_c1
2935 nmdc:mga08y16_294692_c1
2936 nmdc:mga08y16_376567_c1
2937 nmdc:mga08y16_4279_c1
2938 nmdc:mga08y16_5583_c1
2939 nmdc:mga08y16_88424_c1
2940 nmdc:mga0n895_265_c1
2941 nmdc:mga0n895_2675_c1
2942 nmdc:mga0n895_2995_c1
2943 nmdc:mga0n895_30642_c1
2944 nmdc:mga0n895_35580_c1
2945 nmdc:mga0n895_363615_c1
2946 nmdc:mga0rr50_362627_c1
2947 nmdc:mga0rr50_60567_c1
2948 nmdc:mga0rr50_642_c1
2949 nmdc:mga08x19_35_c1
2950 nmdc:mga08x19_8004_c1
2951 nmdc:mga0a205_1049_c1
2952 nmdc:mga0a205_146_c1
2953 nmdc:mga0a205_315959_c1
2954 nmdc:mga0a205_464753_c1
2955 Ga0495601_0000001
2956 Ga0495601_0000355
2957 Ga0495601_0000589
2958 Ga0495601_0002218
2959 Ga0495601_0027567
2960 Ga0495601_0041071
2961 Ga0495601_0052633
2962 Ga0495601_0174202
2963 Ga0495612_0000017
2964 Ga0495612_0001305
2965 Ga0495612_0002281
2966 Ga0495612_0002637
2967 Ga0495612_0005030
2968 Ga0495612_0030943
2969 Ga0495595_0000010
2970 Ga0495595_0002470
2971 Ga0495595_0005994
2972 Ga0495595_0010133
2973 Ga0495595_0010381
2974 Ga0495595_0027953
2975 Ga0495619_0000004
2976 Ga0495619_0000048
2977 Ga0495619_0000256
2978 Ga0495619_0004051
2979 Ga0495619_0005443
2980 Ga0495619_0007179
2981 Ga0495619_0016131
2982 Ga0495619_0024473
2983 Ga0495619_0027188
2984 Ga0495619_0108884
2985 Ga0495619_0131097
2986 Ga0500644_0000933
2987 Ga0500651_0037963
2988 Ga0500651_0102768
2989 Ga0500641_0019072
2990 Ga0500650_0044577
2991 Ga0500555_016514
2992 Ga0500556_0000068
2993 Ga0500595_000003
2994 Ga0500595_003914
2995 Ga0500595_026787
2996 Ga0500652_001172
2997 Ga0500652_039202
2998 Ga0500652_068971
2999 Ga0500616_0000002
3000 Ga0500616_0004397
3001 Ga0500616_0034790
3002 Ga0500616_0089834
3003 Ga0500622_0138552
3004 Ga0500645_000078
3005 Ga0500645_008422
3006 Ga0501084_0009668
3007 Ga0501084_0034716
3008 Ga0501084_0128439
3009 Ga0501084_0287667
3010 Ga0501084_0307775
3011 Ga0501084_0332364
3012 Ga0501082_0000510
3013 Ga0501082_0030402
3014 Ga0501082_0038034
3015 Ga0501082_0051708
3016 Ga0501082_0063448
3017 Ga0501082_0095928
3018 Ga0501082_0429790
3019 Ga0530510_0037742
3020 Ga0530510_0114950
3021 Ga0530510_0262622
3022 2513635471
3023 2514014860
3024 2515628579
3025 2523382649
3026 2524465008
3027 2535520930
3028 2644291236
3029 2838685997
3030 2838687808
3031 2838699640
3032 2838713059
3033 2842082555
3034 2842123309
3035 2842242245
3036 2842272161
3037 2842296311
3038 2842375260
3039 2842382863
3040 2842389422
3041 2844462284
3042 2874594804
3043 2876774354
3044 2876822856
3045 2879078509
3046 2879129830
3047 2879146155
3048 2919453271
3049 2919717988
3050 2935899207
3051 639651250
3052 8001847189
3053 8005549870
3054 8056681937

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

120

317

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.8966 17 317
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.8908 17 317
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.8906 14 317
5ibz-assembly1.cif.gz_B crystal structure of a novel cyclase (pfam04199). 0.8872 14 317
5ibz-assembly1.cif.gz_C crystal structure of a novel cyclase (pfam04199). 0.8785 17 317
ID Description Score Start End Superfamily
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7846 51 315 3.50.30.50
5nmpC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7745 51 315 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7675 51 315 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7554 51 316 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7486 49 315 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A849GSB7-F1-model_v4 Cyclase family protein 0.9942 118 317 GO:0004061
GO:0019441
AF-A0A848TGR9-F1-model_v4 Cyclase family protein 0.9894 196 317 GO:0004061
GO:0019441
AF-A0A849GSB7-F1-model_v4 Cyclase family protein 0.9844 118 317 GO:0004061
GO:0019441
AF-A0A7W5AG36-F1-model_v4 Kynurenine formamidase 0.9836 157 317 GO:0004061
GO:0019441
AF-A0A2V6Y4V2-F1-model_v4 Cyclase 0.9832 180 317 GO:0004061
GO:0019441

Map