F494577

General Info

Members Datasets Scaffolds Average Seq Length
1527 461 3054 132

Family's Representative Sequence

Representative Sequence 3300049686|Ga0501257_117118|Ga0501257_117118_53_469
Length 138
Sequence MNKKRVALIAHDHKKDELIEWALYNKFRLAECELFATGTTGGLLEKALDLKITKLNSGPFGGDQQIGALIAEGRTDVLIFFWDPLHPLPHDQDIKALLRIAVLFNIPVACNRTTADYIFSSPLFFGDYERKMPELKIG

Samples

Sample ID Description Type Environment
1 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
200 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
201 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
208 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
209 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
210 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
230 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
231 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
232 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
233 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
237 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
240 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
244 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
340 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
341 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
342 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
343 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
344 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
345 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
346 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
347 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
348 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
349 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
384 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
385 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
387 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
388 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
389 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
390 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
391 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
392 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
393 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
394 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
395 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
402 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
403 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
406 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
407 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
408 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
409 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
410 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
411 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
412 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
413 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
414 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
415 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
416 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
417 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
418 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
419 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
420 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
421 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
422 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
423 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
424 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
425 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
426 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
427 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
428 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
429 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
440 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
441 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
442 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
443 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
444 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
445 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
446 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
447 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
448 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
449 2643221638 Duganella sp. Root336D2 Isolate Unclassified
450 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
451 2831864461 Roseateles noduli HZ7 Isolate Nodule
452 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
453 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
454 2885266251 Ralstonia sp. SET104 Isolate Nodule
455 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
456 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
457 2928058823 Ralstonia sp. 1138 Isolate Unclassified
458 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
459 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
460 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
461 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 1.38
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.22
Nodule 0.79
Rhizoplane 3.8
Rhizosphere 70.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501257_117118 3300049686 Bacteria 711
2 JGI24741J21665_1000529 3300001915 Bacteria 11654
3 JGI24740J21852_10000034 3300001979 Bacteria 45131
4 JGI24740J21852_10000042 3300001979 Bacteria 41281
5 JGI24739J22299_10032067 3300001989 Bacteria 1811
6 JGI24735J21928_10029795 3300002067 Bacteria 1623
7 JGI24735J21928_10096415 3300002067 Bacteria 849
8 JGI25156J39149_1000118 3300002705 Bacteria 57694
9 JGI25156J39149_1001760 3300002705 Bacteria 8615
10 JGI25156J39149_1002065 3300002705 Bacteria 7629
11 JGI25156J39149_1004678 3300002705 Bacteria 4111
12 JGI25156J39149_1006191 3300002705 Bacteria 3308
13 JGI25154J39366_1000173 3300002738 Bacteria 49972
14 JGI25154J39366_1001563 3300002738 Bacteria 7870
15 JGI25154J39366_1007713 3300002738 Bacteria 1445
16 JGI25157J39369_1000278 3300002741 Bacteria 37495
17 JGI25164J39214_1007076 3300002772 Bacteria 1152
18 JGI25152J39213_1005248 3300002773 Bacteria 3847
19 JGI25152J39213_1015897 3300002773 Bacteria 1470
20 JGI25150J39212_1000663 3300002774 Bacteria 12696
21 JGI25150J39212_1005413 3300002774 Bacteria 2726
22 JGI25159J45721_1011880 3300002987 Bacteria 2107
23 JGI25151J46595_10004349 3300003187 Bacteria 7512
24 JGI25151J46595_10004358 3300003187 Bacteria 7506
25 JGI25153J46596_10000223 3300003215 Bacteria 49001
26 JGI25153J46596_10008753 3300003215 Bacteria 4793
27 JGI25153J46596_10023282 3300003215 Bacteria 2262
28 JGI25153J46596_10056852 3300003215 Bacteria 1085
29 rootH1_10006452 3300003316 Bacteria 3214
30 rootH2_10178406 3300003320 Bacteria 1274
31 rootL2_10006362 3300003322 Bacteria 20083
32 JGI25160J50197_1001196 3300003354 Bacteria 13190
33 JGI25160J50197_1001762 3300003354 Bacteria 10489
34 JGI25161J50226_1000889 3300003374 Bacteria 10855
35 JGI25161J50226_1006488 3300003374 Bacteria 2107
36 Ga0055538_1003912 3300003751 Bacteria 1788
37 Ga0055538_1005093 3300003751 Bacteria 1396
38 Ga0055539_1000110 3300003752 Bacteria 90594
39 Ga0055539_1000301 3300003752 Bacteria 26747
40 Ga0055539_1000528 3300003752 Bacteria 11661
41 Ga0055533_1000048 3300003756 Bacteria 212106
42 Ga0055533_1000068 3300003756 Bacteria 155215
43 Ga0055533_1000549 3300003756 Bacteria 13357
44 Ga0055533_1000935 3300003756 Bacteria 8657
45 Ga0055533_1011506 3300003756 Bacteria 961
46 Ga0055532_1000028 3300003758 Bacteria 234512
47 Ga0055532_1000063 3300003758 Bacteria 147140
48 Ga0055525_1000162 3300003759 Bacteria 87273
49 Ga0055525_1000919 3300003759 Bacteria 8338
50 Ga0055525_1009842 3300003759 Bacteria 806
51 Ga0055527_1000049 3300003760 Bacteria 105168
52 Ga0055535_1000022 3300003761 Bacteria 234512
53 Ga0055535_1000042 3300003761 Bacteria 147140
54 Ga0055535_1000306 3300003761 Bacteria 49813
55 Ga0055535_1009484 3300003761 Bacteria 1674
56 Ga0055542_1000071 3300003762 Bacteria 147140
57 Ga0055542_1003046 3300003762 Bacteria 4843
58 Ga0055529_1000063 3300003763 Bacteria 181573
59 Ga0055529_1000081 3300003763 Bacteria 147140
60 Ga0055529_1000528 3300003763 Bacteria 33027
61 Ga0055529_1000835 3300003763 Bacteria 18141
62 Ga0055526_1000031 3300003771 Bacteria 143136
63 Ga0055526_1000353 3300003771 Bacteria 37277
64 Ga0055526_1000997 3300003771 Bacteria 20775
65 Ga0055526_1001617 3300003771 Bacteria 15820
66 Ga0055526_1001701 3300003771 Bacteria 15369
67 Ga0055526_1003228 3300003771 Bacteria 10511
68 Ga0055526_1005979 3300003771 Bacteria 6764
69 Ga0055526_1018981 3300003771 Bacteria 2529
70 Ga0055526_1054019 3300003771 Bacteria 895
71 Ga0055537_1000811 3300003773 Bacteria 15474
72 Ga0055537_1002741 3300003773 Bacteria 5715
73 Ga0055537_1002947 3300003773 Bacteria 5408
74 Ga0055524_1000015 3300003775 Bacteria 246493
75 Ga0055524_1000799 3300003775 Bacteria 20886
76 Ga0055524_1001270 3300003775 Bacteria 14786
77 Ga0055524_1001439 3300003775 Bacteria 13661
78 Ga0055524_1002162 3300003775 Bacteria 10345
79 Ga0055524_1003734 3300003775 Bacteria 7280
80 Ga0055524_1013102 3300003775 Bacteria 3146
81 Ga0055536_1000020 3300003781 Bacteria 199649
82 Ga0055534_1000869 3300003784 Bacteria 13813
83 Ga0055534_1004871 3300003784 Bacteria 3755
84 Ga0055534_1006755 3300003784 Bacteria 2840
85 Ga0055534_1007333 3300003784 Bacteria 2641
86 Ga0055528_1024020 3300003790 Bacteria 1841
87 Ga0055530_10002241 3300003791 Bacteria 12731
88 Ga0055530_10023199 3300003791 Bacteria 1788
89 Ga0055540_1016842 3300003792 Bacteria 2060
90 Ga0055531_10004238 3300003794 Bacteria 8822
91 Ga0055531_10006724 3300003794 Bacteria 6437
92 Ga0055531_10015458 3300003794 Bacteria 3361
93 Ga0055541_1001709 3300003841 Bacteria 4622
94 Ga0055543_1004056 3300004625 Bacteria 4103
95 Ga0055543_1011085 3300004625 Bacteria 1861
96 Ga0065165_1000356 3300005262 Bacteria 75078
97 Ga0065165_1000573 3300005262 Bacteria 54490
98 Ga0065165_1001568 3300005262 Bacteria 23601
99 Ga0065165_1002807 3300005262 Bacteria 13663
100 Ga0065714_10294036 3300005288 Bacteria 682
101 Ga0070658_10006262 3300005327 Bacteria 9640
102 Ga0070658_10011253 3300005327 Bacteria 7173
103 Ga0070658_10035948 3300005327 Bacteria 3991
104 Ga0070658_10052616 3300005327 Bacteria 3303
105 Ga0070658_10069908 3300005327 Bacteria 2873
106 Ga0070676_10406287 3300005328 Bacteria 949
107 Ga0070690_100355803 3300005330 Bacteria 1064
108 Ga0070670_100768436 3300005331 Bacteria 869
109 Ga0068869_100003320 3300005334 Bacteria 9828
110 Ga0070680_100256157 3300005336 Bacteria 1480
111 Ga0068868_100339507 3300005338 Bacteria 1284
112 Ga0070660_100000404 3300005339 Bacteria 28766
113 Ga0070660_100076854 3300005339 Bacteria 2615
114 Ga0070660_100145775 3300005339 Bacteria 1902
115 Ga0070660_100155725 3300005339 Bacteria 1839
116 Ga0070660_100254339 3300005339 Bacteria 1433
117 Ga0070660_101102826 3300005339 Bacteria 672
118 Ga0070661_100000074 3300005344 Bacteria 80780
119 Ga0070661_100004953 3300005344 Bacteria 9170
120 Ga0070661_100080467 3300005344 Bacteria 2405
121 Ga0070661_100206178 3300005344 Bacteria 1503
122 Ga0070661_101916040 3300005344 Bacteria 504
123 Ga0070669_100366841 3300005353 Bacteria 1172
124 Ga0070671_100690631 3300005355 Bacteria 885
125 Ga0070673_100001939 3300005364 Bacteria 12457
126 Ga0070659_100017972 3300005366 Bacteria 5329
127 Ga0070659_100090976 3300005366 Bacteria 2445
128 Ga0070659_100103946 3300005366 Bacteria 2288
129 Ga0070659_100449652 3300005366 Bacteria 1093
130 Ga0070659_100524099 3300005366 Bacteria 1012
131 Ga0070659_100945611 3300005366 Bacteria 755
132 Ga0070663_100000005 3300005455 Bacteria 251758
133 Ga0070663_100239347 3300005455 Bacteria 1432
134 Ga0070663_100284811 3300005455 Bacteria 1318
135 Ga0070663_100316916 3300005455 Bacteria 1253
136 Ga0070678_100018668 3300005456 Bacteria 4500
137 Ga0070662_100034505 3300005457 Bacteria 3568
138 Ga0070662_100652030 3300005457 Bacteria 888
139 Ga0070707_100207551 3300005468 Bacteria 1909
140 Ga0070698_100297198 3300005471 Bacteria 1546
141 Ga0070679_100372878 3300005530 Bacteria 1374
142 Ga0068853_100284928 3300005539 Bacteria 1523
143 Ga0070672_100551079 3300005543 Bacteria 1001
144 Ga0070672_101712645 3300005543 Bacteria 565
145 Ga0070686_100210901 3300005544 Bacteria 1398
146 Ga0068855_100003718 3300005563 Bacteria 18653
147 Ga0068855_100012359 3300005563 Bacteria 10313
148 Ga0068855_100090319 3300005563 Bacteria 3535
149 Ga0068855_100183645 3300005563 Bacteria 2364
150 Ga0070664_100000001 3300005564 Bacteria 551832
151 Ga0070664_100003539 3300005564 Bacteria 12612
152 Ga0068857_100003843 3300005577 Bacteria 12632
153 Ga0068857_100005647 3300005577 Bacteria 10698
154 Ga0068857_100039882 3300005577 Bacteria 4162
155 Ga0068854_100000053 3300005578 Bacteria 85260
156 Ga0068854_100021985 3300005578 Bacteria 4337
157 Ga0068856_100000231 3300005614 Bacteria 60650
158 Ga0068856_100007831 3300005614 Bacteria 10433
159 Ga0068856_100217023 3300005614 Bacteria 1928
160 Ga0070702_101711763 3300005615 Bacteria 523
161 Ga0068852_100182808 3300005616 Bacteria 1973
162 Ga0068852_100413799 3300005616 Bacteria 1329
163 Ga0068861_100031177 3300005719 Bacteria 3914
164 Ga0068851_10708831 3300005834 Bacteria 620
165 Ga0075368_10071612 3300006042 Bacteria 1401
166 Ga0075368_10129957 3300006042 Bacteria 1046
167 Ga0075363_100061412 3300006048 Bacteria 2025
168 Ga0075363_100479258 3300006048 Bacteria 737
169 Ga0075364_10061472 3300006051 Bacteria 2464
170 Ga0070712_101907684 3300006175 Bacteria 520
171 Ga0075362_10035105 3300006177 Bacteria 2188
172 Ga0075362_10093475 3300006177 Bacteria 1398
173 Ga0075362_10110439 3300006177 Bacteria 1294
174 Ga0075367_10217457 3300006178 Bacteria 1195
175 Ga0075369_10120710 3300006186 Bacteria 1186
176 Ga0075369_10292300 3300006186 Bacteria 760
177 Ga0075366_10021260 3300006195 Bacteria 3771
178 Ga0075366_10176954 3300006195 Bacteria 1295
179 Ga0075366_10248260 3300006195 Bacteria 1085
180 Ga0075366_10547446 3300006195 Bacteria 716
181 Ga0075370_10058074 3300006353 Bacteria 2200
182 Ga0075370_10153835 3300006353 Bacteria 1348
183 Ga0068871_100233789 3300006358 Bacteria 1596
184 Ga0068871_100920198 3300006358 Bacteria 811
185 Ga0099823_1000025 3300006944 Bacteria 73278
186 Ga0099826_10000003 3300006948 Bacteria 1067817
187 Ga0099826_10000004 3300006948 Bacteria 802669
188 Ga0105251_10000613 3300009011 Bacteria 32739
189 Ga0105251_10047899 3300009011 Bacteria 2051
190 Ga0105251_10242518 3300009011 Bacteria 812
191 Ga0105244_10021030 3300009036 Bacteria 3616
192 Ga0105250_10098852 3300009092 Bacteria 1190
193 Ga0105250_10166943 3300009092 Bacteria 920
194 Ga0105240_10040516 3300009093 Bacteria 5956
195 Ga0105240_10051776 3300009093 Bacteria 5165
196 Ga0105240_10123664 3300009093 Bacteria 3112
197 Ga0105240_10201255 3300009093 Bacteria 2333
198 Ga0105240_10227436 3300009093 Bacteria 2170
199 Ga0105240_10397680 3300009093 Bacteria 1553
200 Ga0105240_10468027 3300009093 Bacteria 1407
201 Ga0105240_10955340 3300009093 Bacteria 919
202 Ga0105240_11305901 3300009093 Bacteria 765
203 Ga0105240_11500253 3300009093 Bacteria 707
204 Ga0105245_10314668 3300009098 Bacteria 1540
205 Ga0105245_11337632 3300009098 Bacteria 766
206 Ga0105245_11759005 3300009098 Bacteria 672
207 Ga0105247_10212030 3300009101 Bacteria 1307
208 Ga0105243_10251478 3300009148 Bacteria 1578
209 Ga0105241_10031803 3300009174 Bacteria 3952
210 Ga0105241_10438281 3300009174 Bacteria 1153
211 Ga0105241_12438363 3300009174 Bacteria 523
212 Ga0105242_10241626 3300009176 Bacteria 1624
213 Ga0105242_11222900 3300009176 Bacteria 771
214 Ga0105248_10043671 3300009177 Bacteria 5027
215 Ga0105248_11035389 3300009177 Bacteria 927
216 Ga0105237_10031346 3300009545 Bacteria 5392
217 Ga0105237_10068073 3300009545 Bacteria 3554
218 Ga0105237_10137507 3300009545 Bacteria 2437
219 Ga0105237_10664473 3300009545 Bacteria 1049
220 Ga0105237_10720454 3300009545 Bacteria 1004
221 Ga0105238_10012133 3300009551 Bacteria 8684
222 Ga0105238_10099443 3300009551 Bacteria 2892
223 Ga0105238_10934015 3300009551 Bacteria 887
224 Ga0105238_10947024 3300009551 Bacteria 881
225 Ga0105249_10310623 3300009553 Bacteria 1585
226 Ga0105148_109704 3300009978 Bacteria 729
227 Ga0105239_10001236 3300010375 Bacteria 34816
228 Ga0105239_10030565 3300010375 Bacteria 5922
229 Ga0105239_10195402 3300010375 Bacteria 2266
230 Ga0105239_12059585 3300010375 Bacteria 663
231 Ga0105246_10086273 3300011119 Bacteria 2250
232 Ga0157319_1000014 3300012497 Bacteria 139356
233 Ga0157373_10012948 3300013100 Bacteria 6124
234 Ga0157371_10000166 3300013102 Bacteria 96000
235 Ga0157371_10072329 3300013102 Bacteria 2441
236 Ga0157370_10000443 3300013104 Bacteria 51829
237 Ga0157370_10001406 3300013104 Bacteria 29865
238 Ga0157370_10003087 3300013104 Bacteria 19723
239 Ga0157370_10225268 3300013104 Bacteria 1736
240 Ga0157370_11124084 3300013104 Bacteria 710
241 Ga0157369_10000915 3300013105 Bacteria 37650
242 Ga0157369_10001653 3300013105 Bacteria 27194
243 Ga0157369_10004199 3300013105 Bacteria 17053
244 Ga0157369_10004659 3300013105 Bacteria 16120
245 Ga0157369_10038276 3300013105 Bacteria 5245
246 Ga0157369_10079668 3300013105 Bacteria 3508
247 Ga0157369_10347787 3300013105 Bacteria 1540
248 Ga0157369_10429968 3300013105 Bacteria 1368
249 Ga0157369_10897750 3300013105 Bacteria 909
250 Ga0157374_10000318 3300013296 Bacteria 44740
251 Ga0157374_10498629 3300013296 Bacteria 1222
252 Ga0157378_10848557 3300013297 Bacteria 942
253 Ga0157378_11643802 3300013297 Bacteria 689
254 Ga0163162_10007485 3300013306 Bacteria 10625
255 Ga0163162_10175886 3300013306 Bacteria 2266
256 Ga0163162_11197716 3300013306 Bacteria 862
257 Ga0163162_11571375 3300013306 Bacteria 750
258 Ga0157372_10000136 3300013307 Bacteria 81136
259 Ga0157372_10456649 3300013307 Bacteria 1489
260 Ga0157372_10917456 3300013307 Bacteria 1016
261 Ga0157375_10122896 3300013308 Bacteria 2708
262 Ga0157375_10161184 3300013308 Bacteria 2385
263 Ga0157375_12954899 3300013308 Bacteria 568
264 Ga0157380_12108386 3300014326 Bacteria 627
265 Ga0182008_10011833 3300014497 Bacteria 4628
266 Ga0182008_10113786 3300014497 Bacteria 1341
267 Ga0157379_10074489 3300014968 Bacteria 3039
268 Ga0157379_11300804 3300014968 Bacteria 702
269 Ga0157376_10639828 3300014969 Bacteria 1063
270 Ga0157376_10769286 3300014969 Bacteria 973
271 Ga0157376_11138688 3300014969 Bacteria 807
272 Ga0157376_12958383 3300014969 Bacteria 514
273 Ga0182006_1000014 3300015261 Bacteria 340159
274 Ga0182006_1000044 3300015261 Bacteria 197442
275 Ga0182006_1047827 3300015261 Bacteria 1656
276 Ga0182006_1141884 3300015261 Bacteria 820
277 Ga0182006_1285557 3300015261 Bacteria 541
278 Ga0182007_10000011 3300015262 Bacteria 264045
279 Ga0182007_10004988 3300015262 Bacteria 5904
280 Ga0182007_10007471 3300015262 Bacteria 4578
281 Ga0182007_10057280 3300015262 Bacteria 1279
282 Ga0182007_10107671 3300015262 Bacteria 926
283 Ga0182005_1000014 3300015265 Bacteria 389763
284 Ga0182005_1000018 3300015265 Bacteria 324307
285 Ga0182005_1270372 3300015265 Bacteria 531
286 Ga0183361_10010 3300016635 Bacteria 204902
287 Ga0163161_10025614 3300017792 Bacteria 4176
288 Ga0163161_10583198 3300017792 Bacteria 920
289 Ga0206356_10591058 3300020070 Bacteria 599
290 Ga0206356_11543095 3300020070 Bacteria 1059
291 Ga0206351_10664851 3300020077 Bacteria 1911
292 Ga0206350_10140646 3300020080 Bacteria 645
293 Ga0206354_10274888 3300020081 Bacteria 1011
294 Ga0206354_11040010 3300020081 Bacteria 1181
295 Ga0206354_11436006 3300020081 Bacteria 1452
296 Ga0206353_10492142 3300020082 Bacteria 1980
297 Ga0154015_1690951 3300020610 Bacteria 6337
298 Ga0213872_10000002 3300021361 Bacteria 554092
299 Ga0213872_10001750 3300021361 Bacteria 13616
300 Ga0213872_10016189 3300021361 Bacteria 3462
301 Ga0213872_10023996 3300021361 Bacteria 2805
302 Ga0213872_10097361 3300021361 Bacteria 1313
303 Ga0224712_10000188 3300022467 Bacteria 10883
304 Ga0209435_103067 3300025206 Bacteria 1919
305 Ga0209436_100115 3300025208 Bacteria 39587
306 Ga0209436_100800 3300025208 Bacteria 12930
307 Ga0209784_100014 3300025224 Bacteria 496182
308 Ga0209784_100477 3300025224 Bacteria 16368
309 Ga0209566_100011 3300025225 Bacteria 496182
310 Ga0209566_100265 3300025225 Bacteria 49043
311 Ga0209566_101038 3300025225 Bacteria 11577
312 Ga0209674_100013 3300025226 Bacteria 813140
313 Ga0209674_100024 3300025226 Bacteria 535481
314 Ga0209674_100032 3300025226 Bacteria 426888
315 Ga0209674_100174 3300025226 Bacteria 80149
316 Ga0209674_100178 3300025226 Bacteria 77795
317 Ga0209674_112437 3300025226 Bacteria 829
318 Ga0209672_100010 3300025228 Bacteria 873151
319 Ga0209672_100224 3300025228 Bacteria 43765
320 Ga0209672_100790 3300025228 Bacteria 15103
321 Ga0209147_100002 3300025229 Bacteria 2158988
322 Ga0209147_100006 3300025229 Bacteria 873276
323 Ga0209563_100029 3300025230 Bacteria 496182
324 Ga0209563_100101 3300025230 Bacteria 152297
325 Ga0209563_100112 3300025230 Bacteria 136524
326 Ga0209563_100759 3300025230 Bacteria 9862
327 Ga0207427_100988 3300025231 Bacteria 11997
328 Ga0207427_101051 3300025231 Bacteria 11472
329 Ga0209258_100002 3300025242 Bacteria 2158988
330 Ga0209258_100010 3300025242 Bacteria 873276
331 Ga0209258_100180 3300025242 Bacteria 137306
332 Ga0207425_1000006 3300025245 Bacteria 808854
333 Ga0207425_1000060 3300025245 Bacteria 139031
334 Ga0207425_1000121 3300025245 Bacteria 73749
335 Ga0207425_1000643 3300025245 Bacteria 19543
336 Ga0207425_1068932 3300025245 Bacteria 610
337 Ga0209646_1000012 3300025246 Bacteria 573300
338 Ga0209646_1000058 3300025246 Bacteria 259999
339 Ga0209646_1000117 3300025246 Bacteria 150025
340 Ga0209026_1000004 3300025250 Bacteria 949012
341 Ga0209026_1004499 3300025250 Bacteria 4111
342 Ga0209026_1016869 3300025250 Bacteria 1176
343 Ga0209677_100042 3300025253 Bacteria 225037
344 Ga0209677_100091 3300025253 Bacteria 106743
345 Ga0209677_100444 3300025253 Bacteria 24026
346 Ga0209148_1000018 3300025254 Bacteria 756247
347 Ga0209148_1000043 3300025254 Bacteria 461531
348 Ga0209148_1007495 3300025254 Bacteria 2264
349 Ga0209148_1014570 3300025254 Bacteria 1388
350 Ga0209759_1000003 3300025256 Bacteria 792130
351 Ga0209759_1000067 3300025256 Bacteria 183764
352 Ga0209759_1000250 3300025256 Bacteria 80232
353 Ga0209759_1000690 3300025256 Bacteria 30331
354 Ga0209759_1001659 3300025256 Bacteria 11681
355 Ga0209759_1001680 3300025256 Bacteria 11537
356 Ga0209759_1001753 3300025256 Bacteria 11123
357 Ga0209759_1004352 3300025256 Bacteria 5320
358 Ga0209759_1007040 3300025256 Bacteria 3681
359 Ga0209759_1010465 3300025256 Bacteria 2715
360 Ga0209759_1012740 3300025256 Bacteria 2313
361 Ga0209759_1013020 3300025256 Bacteria 2271
362 Ga0209759_1013514 3300025256 Bacteria 2204
363 Ga0209759_1018672 3300025256 Bacteria 1671
364 Ga0209759_1020484 3300025256 Bacteria 1532
365 Ga0209759_1049688 3300025256 Bacteria 655
366 Ga0209129_1000012 3300025258 Bacteria 541516
367 Ga0209129_1000090 3300025258 Bacteria 175755
368 Ga0209129_1012454 3300025258 Bacteria 1949
369 Ga0209233_1000171 3300025261 Bacteria 146605
370 Ga0209565_1000136 3300025263 Bacteria 103019
371 Ga0209565_1000701 3300025263 Bacteria 20606
372 Ga0209565_1001948 3300025263 Bacteria 8102
373 Ga0209565_1003331 3300025263 Bacteria 5254
374 Ga0209565_1010449 3300025263 Bacteria 2301
375 Ga0209565_1023551 3300025263 Bacteria 1264
376 Ga0209565_1025585 3300025263 Bacteria 1192
377 Ga0209455_1000009 3300025272 Bacteria 1042273
378 Ga0209455_1000015 3300025272 Bacteria 756128
379 Ga0209455_1000144 3300025272 Bacteria 137313
380 Ga0209455_1023527 3300025272 Bacteria 1153
381 Ga0209673_1006814 3300025273 Bacteria 5423
382 Ga0209673_1015062 3300025273 Bacteria 2957
383 Ga0209673_1017937 3300025273 Bacteria 2593
384 Ga0209673_1018153 3300025273 Bacteria 2569
385 Ga0209673_1054987 3300025273 Bacteria 1028
386 Ga0209130_1000549 3300025284 Bacteria 37476
387 Ga0209130_1001125 3300025284 Bacteria 19650
388 Ga0209130_1004098 3300025284 Bacteria 5743
389 Ga0209675_1000109 3300025291 Bacteria 117127
390 Ga0209675_1000543 3300025291 Bacteria 27555
391 Ga0209675_1000696 3300025291 Bacteria 23334
392 Ga0209675_1002362 3300025291 Bacteria 9742
393 Ga0209675_1012457 3300025291 Bacteria 2737
394 Ga0209675_1013226 3300025291 Bacteria 2599
395 Ga0209676_1000066 3300025292 Bacteria 317897
396 Ga0209025_1000297 3300025294 Bacteria 111389
397 Ga0209025_1000471 3300025294 Bacteria 78395
398 Ga0209025_1002549 3300025294 Bacteria 19005
399 Ga0209025_1004566 3300025294 Bacteria 11905
400 Ga0209025_1021606 3300025294 Bacteria 3458
401 Ga0209025_1084242 3300025294 Bacteria 1066
402 Ga0209564_1000006 3300025295 Bacteria 1100927
403 Ga0209564_1000022 3300025295 Bacteria 555109
404 Ga0209564_1000038 3300025295 Bacteria 414357
405 Ga0209564_1000120 3300025295 Bacteria 204226
406 Ga0209564_1000134 3300025295 Bacteria 188346
407 Ga0209564_1000930 3300025295 Bacteria 38022
408 Ga0209564_1001068 3300025295 Bacteria 33146
409 Ga0209564_1001159 3300025295 Bacteria 30683
410 Ga0209564_1002583 3300025295 Bacteria 13917
411 Ga0209564_1008285 3300025295 Bacteria 5157
412 Ga0209564_1014011 3300025295 Bacteria 3364
413 Ga0209758_1000047 3300025297 Bacteria 360971
414 Ga0209758_1000099 3300025297 Bacteria 230054
415 Ga0209758_1002119 3300025297 Bacteria 20944
416 Ga0209758_1006257 3300025297 Bacteria 8664
417 Ga0209758_1011730 3300025297 Bacteria 5028
418 Ga0209050_1000085 3300025298 Bacteria 263219
419 Ga0209050_1000092 3300025298 Bacteria 252702
420 Ga0209050_1000607 3300025298 Bacteria 56864
421 Ga0209256_1000005 3300025299 Bacteria 1315082
422 Ga0209256_1000080 3300025299 Bacteria 224592
423 Ga0209256_1000391 3300025299 Bacteria 69634
424 Ga0209256_1000423 3300025299 Bacteria 66412
425 Ga0209256_1000514 3300025299 Bacteria 56840
426 Ga0209256_1000891 3300025299 Bacteria 36748
427 Ga0209256_1001821 3300025299 Bacteria 19995
428 Ga0209256_1011835 3300025299 Bacteria 3431
429 Ga0209256_1048015 3300025299 Bacteria 1047
430 Ga0207426_1000168 3300025302 Bacteria 165214
431 Ga0207426_1000939 3300025302 Bacteria 28944
432 Ga0209051_1001805 3300025303 Bacteria 16970
433 Ga0209051_1002739 3300025303 Bacteria 12221
434 Ga0209051_1003564 3300025303 Bacteria 10121
435 Ga0209051_1007535 3300025303 Bacteria 5930
436 Ga0209051_1031913 3300025303 Bacteria 2019
437 Ga0209051_1048662 3300025303 Bacteria 1435
438 Ga0209257_1000010 3300025304 Bacteria 1158682
439 Ga0209257_1001646 3300025304 Bacteria 25494
440 Ga0209257_1007880 3300025304 Bacteria 6269
441 Ga0209257_1036550 3300025304 Bacteria 1507
442 Ga0209257_1058425 3300025304 Bacteria 1057
443 Ga0209257_1140409 3300025304 Bacteria 543
444 Ga0207655_1050768 3300025728 Bacteria 1682
445 Ga0207713_1000221 3300025735 Bacteria 76659
446 Ga0207713_1138306 3300025735 Bacteria 797
447 Ga0207710_10162178 3300025900 Bacteria 1089
448 Ga0207647_10000235 3300025904 Bacteria 45337
449 Ga0207647_10027219 3300025904 Bacteria 3730
450 Ga0207647_10068714 3300025904 Bacteria 2144
451 Ga0207647_10069774 3300025904 Bacteria 2124
452 Ga0207647_10094535 3300025904 Bacteria 1780
453 Ga0207705_10000877 3300025909 Bacteria 24646
454 Ga0207705_10019684 3300025909 Bacteria 4826
455 Ga0207705_10027646 3300025909 Bacteria 4046
456 Ga0207705_10042750 3300025909 Bacteria 3254
457 Ga0207705_10164607 3300025909 Bacteria 1667
458 Ga0207705_10198259 3300025909 Bacteria 1520
459 Ga0207684_10003400 3300025910 Bacteria 15575
460 Ga0207654_10036128 3300025911 Bacteria 2758
461 Ga0207707_10313565 3300025912 Bacteria 1355
462 Ga0207695_10002424 3300025913 Bacteria 27623
463 Ga0207695_10021377 3300025913 Bacteria 7383
464 Ga0207695_10237409 3300025913 Bacteria 1725
465 Ga0207695_10384423 3300025913 Bacteria 1289
466 Ga0207695_10729247 3300025913 Bacteria 871
467 Ga0207695_10993195 3300025913 Bacteria 719
468 Ga0207695_11091809 3300025913 Bacteria 678
469 Ga0207671_10017995 3300025914 Bacteria 5436
470 Ga0207671_10142513 3300025914 Bacteria 1847
471 Ga0207657_10004545 3300025919 Bacteria 14660
472 Ga0207657_10024983 3300025919 Bacteria 5520
473 Ga0207657_10102896 3300025919 Bacteria 2368
474 Ga0207657_10108209 3300025919 Bacteria 2298
475 Ga0207657_10113488 3300025919 Bacteria 2235
476 Ga0207649_10000767 3300025920 Bacteria 20871
477 Ga0207649_10051414 3300025920 Bacteria 2552
478 Ga0207649_10357548 3300025920 Bacteria 1083
479 Ga0207646_10270899 3300025922 Bacteria 1535
480 Ga0207694_10018099 3300025924 Bacteria 5326
481 Ga0207694_10088375 3300025924 Bacteria 2443
482 Ga0207694_10628954 3300025924 Bacteria 904
483 Ga0207694_10756364 3300025924 Bacteria 820
484 Ga0207650_10503362 3300025925 Bacteria 1012
485 Ga0207687_10337819 3300025927 Bacteria 1224
486 Ga0207690_10002010 3300025932 Bacteria 12457
487 Ga0207690_10005506 3300025932 Bacteria 7472
488 Ga0207690_10047000 3300025932 Bacteria 2862
489 Ga0207706_10613780 3300025933 Bacteria 933
490 Ga0207686_10149793 3300025934 Bacteria 1623
491 Ga0207709_10015880 3300025935 Bacteria 4180
492 Ga0207709_10093087 3300025935 Bacteria 1975
493 Ga0207669_10269798 3300025937 Bacteria 1277
494 Ga0207669_11184820 3300025937 Bacteria 647
495 Ga0207691_10388758 3300025940 Bacteria 1190
496 Ga0207691_10639137 3300025940 Bacteria 899
497 Ga0207711_10212751 3300025941 Bacteria 1766
498 Ga0207711_10227391 3300025941 Bacteria 1708
499 Ga0207711_10287985 3300025941 Bacteria 1514
500 Ga0207689_10029736 3300025942 Bacteria 4558
501 Ga0207689_10671918 3300025942 Bacteria 873
502 Ga0207679_10000003 3300025945 Bacteria 597553
503 Ga0207679_10769737 3300025945 Bacteria 876
504 Ga0207667_10006855 3300025949 Bacteria 13760
505 Ga0207667_10008611 3300025949 Bacteria 12102
506 Ga0207667_10024020 3300025949 Bacteria 6704
507 Ga0207667_10073351 3300025949 Bacteria 3556
508 Ga0207651_10001113 3300025960 Bacteria 11961
509 Ga0207712_10130986 3300025961 Bacteria 1911
510 Ga0207712_10666536 3300025961 Bacteria 905
511 Ga0207640_10000045 3300025981 Bacteria 100696
512 Ga0207640_10011738 3300025981 Bacteria 4968
513 Ga0207640_11984894 3300025981 Bacteria 527
514 Ga0207658_10087257 3300025986 Bacteria 2409
515 Ga0207658_10515297 3300025986 Bacteria 1067
516 Ga0207703_10478976 3300026035 Bacteria 1166
517 Ga0207678_10000066 3300026067 Bacteria 82641
518 Ga0207678_10047833 3300026067 Bacteria 3698
519 Ga0207678_10083608 3300026067 Bacteria 2731
520 Ga0207678_10186184 3300026067 Bacteria 1773
521 Ga0207702_10000046 3300026078 Bacteria 144265
522 Ga0207702_10000441 3300026078 Bacteria 47113
523 Ga0207641_11968427 3300026088 Bacteria 586
524 Ga0207648_10053939 3300026089 Bacteria 3513
525 Ga0207648_10226779 3300026089 Bacteria 1661
526 Ga0207674_10008487 3300026116 Bacteria 11864
527 Ga0207674_10030387 3300026116 Bacteria 5680
528 Ga0207674_12226323 3300026116 Bacteria 511
529 Ga0207675_100047428 3300026118 Bacteria 4011
530 Ga0207683_10045376 3300026121 Bacteria 3844
531 Ga0207683_10302540 3300026121 Bacteria 1463
532 Ga0207698_10018388 3300026142 Bacteria 4761
533 Ga0207698_10082864 3300026142 Bacteria 2594
534 Ga0207698_10132809 3300026142 Bacteria 2130
535 Ga0207698_10371888 3300026142 Bacteria 1357
536 Ga0209281_1006315 3300027111 Bacteria 3112
537 Ga0209389_1000215 3300027296 Bacteria 40569
538 Ga0209371_1040084 3300027312 Bacteria 955
539 Ga0209282_1000002 3300027666 Bacteria 1067825
540 Ga0209282_1000015 3300027666 Bacteria 206531
541 Ga0209813_10003421 3300027866 Bacteria 3714
542 Ga0209813_10071833 3300027866 Bacteria 1127
543 Ga0265336_10000030 3300028666 Bacteria 169335
544 Ga0307515_10181931 3300028794 Bacteria 2048
545 Ga0307515_10198844 3300028794 Bacteria 1887
546 Ga0265338_10002898 3300028800 Bacteria 24965
547 Ga0265324_10001915 3300029957 Bacteria 11175
548 Ga0268256_1043732 3300030500 Bacteria 986
549 Ga0307511_10074414 3300030521 Bacteria 2448
550 Ga0316181_1194924 3300030744 Bacteria 2316
551 Ga0265332_10009285 3300031238 Bacteria 4394
552 Ga0307513_10014326 3300031456 Bacteria 9688
553 Ga0307513_10097695 3300031456 Bacteria 2971
554 Ga0307513_10184767 3300031456 Bacteria 1943
555 Ga0307513_10458191 3300031456 Bacteria 998
556 Ga0307509_10069059 3300031507 Bacteria 3695
557 Ga0307408_100000094 3300031548 Bacteria 97519
558 Ga0307408_100003675 3300031548 Bacteria 10457
559 Ga0307408_100006659 3300031548 Bacteria 7662
560 Ga0307408_100026247 3300031548 Bacteria 3999
561 Ga0307408_100188298 3300031548 Bacteria 1660
562 Ga0307508_10189752 3300031616 Bacteria 1657
563 Ga0307516_10000243 3300031730 Bacteria 70407
564 Ga0307516_10288354 3300031730 Bacteria 1321
565 Ga0307516_10387529 3300031730 Bacteria 1058
566 Ga0307405_11521394 3300031731 Bacteria 588
567 Ga0307412_10000005 3300031911 Bacteria 526194
568 Ga0307412_10051239 3300031911 Bacteria 2727
569 Ga0307416_101721719 3300032002 Bacteria 731
570 Ga0307416_102194400 3300032002 Bacteria 653
571 Ga0307414_10029054 3300032004 Bacteria 3594
572 Ga0373931_0002323 3300035691 Bacteria 8395
573 Ga0373935_0774597 3300035692 Bacteria 708
574 Ga0395899_0000038 3300037312 Bacteria 272627
575 Ga0395899_0117018 3300037312 Bacteria 1912
576 Ga0395899_0129110 3300037312 Bacteria 1806
577 Ga0395900_0000030 3300037418 Bacteria 272630
578 Ga0395900_0000635 3300037418 Bacteria 47215
579 Ga0395900_0015170 3300037418 Bacteria 7858
580 Ga0395900_0020101 3300037418 Bacteria 6812
581 Ga0395900_0022211 3300037418 Bacteria 6491
582 Ga0395900_0093459 3300037418 Bacteria 3089
583 Ga0395900_0122514 3300037418 Bacteria 2667
584 Ga0395900_0236011 3300037418 Bacteria 1837
585 Ga0395900_0477327 3300037418 Bacteria 1200
586 Ga0395900_0501322 3300037418 Bacteria 1164
587 Ga0395898_0000409 3300037466 Bacteria 92805
588 Ga0395898_0001892 3300037466 Bacteria 26705
589 Ga0395898_0002803 3300037466 Bacteria 19977
590 Ga0395898_0020217 3300037466 Bacteria 6763
591 Ga0395898_0186134 3300037466 Bacteria 1984
592 Ga0395898_0747289 3300037466 Bacteria 919
593 Ga0395905_0127537 3300037471 Bacteria 2392
594 Ga0395905_0340692 3300037471 Bacteria 1390
595 Ga0395905_0372552 3300037471 Bacteria 1321
596 Ga0395905_0560342 3300037471 Bacteria 1044
597 Ga0395905_0895946 3300037471 Bacteria 790
598 Ga0395901_0000002 3300038443 Bacteria 761045
599 Ga0395901_0000079 3300038443 Bacteria 134462
600 Ga0395901_0000417 3300038443 Bacteria 50166
601 Ga0395901_0019482 3300038443 Bacteria 6937
602 Ga0395901_0131340 3300038443 Bacteria 2631
603 Ga0395901_0443625 3300038443 Bacteria 1328
604 Ga0395901_0652458 3300038443 Bacteria 1055
605 Ga0395901_0790673 3300038443 Bacteria 938
606 Ga0395901_0790688 3300038443 Bacteria 938
607 Ga0395901_0804968 3300038443 Bacteria 928
608 Ga0436361_0066851 3300039447 Bacteria 36436
609 Ga0436361_0159514 3300039447 Bacteria 1361
610 Ga0436361_0288163 3300039447 Bacteria 989
611 Ga0436361_0387618 3300039447 Bacteria 1545
612 Ga0436361_0606288 3300039447 Bacteria 5535
613 Ga0436361_0857672 3300039447 Bacteria 2414
614 Ga0436361_1030117 3300039447 Bacteria 534
615 Ga0439447_122734 3300041407 Bacteria 596
616 Ga0451791_1363756 3300041451 Bacteria 1047
617 Ga0451793_1592340 3300041452 Bacteria 840
618 Ga0451795_0900595 3300041456 Bacteria 869
619 Ga0451800_1276591 3300041459 Bacteria 1345
620 Ga0451807_1089216 3300041486 Bacteria 697
621 Ga0439448_0001219 3300042005 Bacteria 6563
622 Ga0439452_037558 3300042010 Bacteria 1154
623 Ga0439454_019529 3300042011 Bacteria 986
624 Ga0439455_0038251 3300042012 Bacteria 1220
625 Ga0450890_002996 3300042127 Bacteria 2269
626 Ga0439459_0018219 3300042438 Bacteria 1317
627 Ga0439459_0207427 3300042438 Bacteria 537
628 Ga0466969_0012490 3300044656 Bacteria 4477
629 Ga0466969_0021179 3300044656 Bacteria 3362
630 Ga0466969_0028576 3300044656 Bacteria 2850
631 Ga0466972_0023444 3300044658 Bacteria 3069
632 Ga0466972_0026700 3300044658 Bacteria 2861
633 Ga0466980_0248756 3300044668 Bacteria 1105
634 Ga0466982_0266780 3300044672 Bacteria 993
635 Ga0466965_0003708 3300044683 Bacteria 6746
636 Ga0466965_0071148 3300044683 Bacteria 1749
637 Ga0466965_0130363 3300044683 Bacteria 1303
638 Ga0466965_0182475 3300044683 Bacteria 1107
639 Ga0466966_0000299 3300044684 Bacteria 32487
640 Ga0466966_0003017 3300044684 Bacteria 11103
641 Ga0466966_0016434 3300044684 Bacteria 4889
642 Ga0466966_0045678 3300044684 Bacteria 2799
643 Ga0466961_0000307 3300044693 Bacteria 32515
644 Ga0466961_0005429 3300044693 Bacteria 8032
645 Ga0466961_0006431 3300044693 Bacteria 7459
646 Ga0466961_0035061 3300044693 Bacteria 3221
647 Ga0466961_0081243 3300044693 Bacteria 2051
648 Ga0466961_0378019 3300044693 Bacteria 860
649 Ga0466963_0001629 3300044694 Bacteria 12224
650 Ga0466963_0027662 3300044694 Bacteria 3633
651 Ga0466963_0094851 3300044694 Bacteria 2036
652 Ga0466963_0220562 3300044694 Bacteria 1328
653 Ga0466963_0315933 3300044694 Bacteria 1099
654 Ga0466963_0610041 3300044694 Bacteria 770
655 Ga0466964_0007830 3300044706 Bacteria 4000
656 Ga0466964_0008034 3300044706 Bacteria 3954
657 Ga0466964_0008396 3300044706 Bacteria 3880
658 Ga0466964_0011635 3300044706 Bacteria 3327
659 Ga0466964_0153798 3300044706 Bacteria 1069
660 Ga0466971_0002920 3300044719 Bacteria 7252
661 Ga0466971_0003619 3300044719 Bacteria 6601
662 Ga0466971_0017138 3300044719 Bacteria 3201
663 Ga0466971_0063794 3300044719 Bacteria 1668
664 Ga0466971_0134845 3300044719 Bacteria 1148
665 Ga0466968_0009944 3300044735 Bacteria 3672
666 Ga0466968_0016591 3300044735 Bacteria 2934
667 Ga0466968_0019407 3300044735 Bacteria 2737
668 Ga0466968_0102083 3300044735 Bacteria 1281
669 Ga0466970_0012005 3300044765 Bacteria 4423
670 Ga0466970_0033852 3300044765 Bacteria 2702
671 Ga0466970_0110280 3300044765 Bacteria 1502
672 Ga0466970_0136256 3300044765 Bacteria 1350
673 Ga0466970_0387416 3300044765 Bacteria 796
674 Ga0466957_0000780 3300044842 Bacteria 16285
675 Ga0466957_0001759 3300044842 Bacteria 11392
676 Ga0466957_0017595 3300044842 Bacteria 4190
677 Ga0466957_0026044 3300044842 Bacteria 3468
678 Ga0466957_0031197 3300044842 Bacteria 3184
679 Ga0466957_0111611 3300044842 Bacteria 1734
680 Ga0466957_0394284 3300044842 Bacteria 946
681 Ga0466957_0526813 3300044842 Bacteria 821
682 Ga0466957_0676686 3300044842 Bacteria 727
683 Ga0466957_0707726 3300044842 Bacteria 711
684 Ga0466960_0028593 3300044901 Bacteria 2552
685 Ga0466960_0041919 3300044901 Bacteria 2171
686 Ga0466960_0110821 3300044901 Bacteria 1426
687 Ga0466960_0197237 3300044901 Bacteria 1098
688 Ga0466960_0449996 3300044901 Bacteria 748
689 Ga0466960_0730939 3300044901 Bacteria 595
690 Ga0466959_0025346 3300045049 Bacteria 4394
691 Ga0466959_0045432 3300045049 Bacteria 3234
692 Ga0466959_0100168 3300045049 Bacteria 2074
693 Ga0466959_0196835 3300045049 Bacteria 1404
694 Ga0466959_0557464 3300045049 Bacteria 772
695 Ga0451576_0022982 3300045051 Bacteria 6757
696 Ga0466958_0033746 3300045836 Bacteria 3050
697 Ga0466958_0074813 3300045836 Bacteria 2076
698 Ga0466958_0183087 3300045836 Bacteria 1330
699 Ga0466958_0279632 3300045836 Bacteria 1069
700 Ga0466958_0305817 3300045836 Bacteria 1021
701 Ga0466958_0412583 3300045836 Bacteria 872
702 Ga0466958_0566230 3300045836 Bacteria 738
703 Ga0466967_0046322 3300045976 Bacteria 3785
704 Ga0466967_0167176 3300045976 Bacteria 2067
705 Ga0466967_0227069 3300045976 Bacteria 1776
706 Ga0466967_0422913 3300045976 Bacteria 1299
707 Ga0466967_0924981 3300045976 Bacteria 867
708 Ga0495617_018791 3300046452 Bacteria 2337
709 Ga0495627_000006 3300046453 Bacteria 581750
710 Ga0495627_009983 3300046453 Bacteria 3470
711 Ga0495592_0122912 3300046454 Bacteria 1824
712 Ga0495603_0004927 3300046455 Bacteria 7990
713 Ga0495603_0008131 3300046455 Bacteria 6339
714 Ga0495603_0040896 3300046455 Bacteria 2773
715 Ga0495603_0084133 3300046455 Bacteria 1863
716 Ga0495603_0103193 3300046455 Bacteria 1664
717 Ga0495603_0155838 3300046455 Bacteria 1326
718 Ga0495603_0298916 3300046455 Bacteria 924
719 Ga0495590_0000004 3300046457 Bacteria 402091
720 Ga0495590_0002438 3300046457 Bacteria 7704
721 Ga0495590_0036518 3300046457 Bacteria 1714
722 Ga0495590_0168948 3300046457 Bacteria 797
723 Ga0495590_0318157 3300046457 Bacteria 587
724 Ga0495591_009391 3300046458 Bacteria 3894
725 Ga0495591_010258 3300046458 Bacteria 3646
726 Ga0495591_035249 3300046458 Bacteria 1466
727 Ga0495629_0000279 3300046459 Bacteria 44358
728 Ga0495629_0000563 3300046459 Bacteria 30235
729 Ga0495629_0006596 3300046459 Bacteria 8594
730 Ga0495629_0009087 3300046459 Bacteria 7280
731 Ga0495629_0013254 3300046459 Bacteria 5951
732 Ga0495629_0025628 3300046459 Bacteria 4190
733 Ga0495629_0078906 3300046459 Bacteria 2298
734 Ga0495629_0092991 3300046459 Bacteria 2105
735 Ga0495638_0000023 3300046460 Bacteria 363063
736 Ga0495638_0005843 3300046460 Bacteria 9049
737 Ga0495638_0011661 3300046460 Bacteria 6053
738 Ga0495638_0053201 3300046460 Bacteria 2520
739 Ga0495638_0085824 3300046460 Bacteria 1903
740 Ga0495638_0123060 3300046460 Bacteria 1531
741 Ga0495641_0015985 3300046461 Bacteria 3973
742 Ga0495641_0019962 3300046461 Bacteria 3414
743 Ga0495651_0074831 3300046462 Bacteria 2569
744 Ga0495651_0083042 3300046462 Bacteria 2416
745 Ga0495651_0245876 3300046462 Bacteria 1224
746 Ga0495651_0288024 3300046462 Bacteria 1107
747 Ga0495651_0526744 3300046462 Bacteria 753
748 Ga0495651_0590644 3300046462 Bacteria 701
749 Ga0495653_0000073 3300046463 Bacteria 84617
750 Ga0495653_0025396 3300046463 Bacteria 4762
751 Ga0495653_0026168 3300046463 Bacteria 4681
752 Ga0495653_0083143 3300046463 Bacteria 2361
753 Ga0495653_0142004 3300046463 Bacteria 1688
754 Ga0495653_0456779 3300046463 Bacteria 802
755 Ga0495653_0458920 3300046463 Bacteria 800
756 Ga0495653_0460557 3300046463 Bacteria 798
757 Ga0495653_0726345 3300046463 Bacteria 601
758 Ga0495650_0002253 3300046471 Bacteria 16122
759 Ga0495650_0003455 3300046471 Bacteria 11514
760 Ga0495650_0005800 3300046471 Bacteria 7881
761 Ga0495650_0006351 3300046471 Bacteria 7386
762 Ga0495650_0008716 3300046471 Bacteria 5872
763 Ga0495650_0011718 3300046471 Bacteria 4774
764 Ga0495650_0045144 3300046471 Bacteria 1857
765 Ga0495650_0045990 3300046471 Bacteria 1834
766 Ga0495580_0006203 3300046472 Bacteria 9774
767 Ga0495580_0008054 3300046472 Bacteria 8410
768 Ga0495580_0008534 3300046472 Bacteria 8132
769 Ga0495580_0010580 3300046472 Bacteria 7179
770 Ga0495580_0030181 3300046472 Bacteria 3927
771 Ga0495580_0055923 3300046472 Bacteria 2779
772 Ga0495580_0093181 3300046472 Bacteria 2096
773 Ga0495580_0216286 3300046472 Bacteria 1317
774 Ga0495580_0302305 3300046472 Bacteria 1089
775 Ga0495580_0382586 3300046472 Bacteria 950
776 Ga0495582_0001146 3300046473 Bacteria 14879
777 Ga0495582_0002688 3300046473 Bacteria 9924
778 Ga0495582_0040435 3300046473 Bacteria 2568
779 Ga0495582_0171505 3300046473 Bacteria 1235
780 Ga0495605_0003732 3300046474 Bacteria 9037
781 Ga0495605_0008524 3300046474 Bacteria 5794
782 Ga0495605_0017979 3300046474 Bacteria 3797
783 Ga0495605_0020324 3300046474 Bacteria 3530
784 Ga0495605_0020489 3300046474 Bacteria 3513
785 Ga0495605_0032049 3300046474 Bacteria 2680
786 Ga0495605_0057473 3300046474 Bacteria 1872
787 Ga0495605_0239400 3300046474 Bacteria 779
788 Ga0495639_0008549 3300046475 Bacteria 4391
789 Ga0495662_0097766 3300046476 Bacteria 1435
790 Ga0495662_0247409 3300046476 Bacteria 878
791 Ga0495662_0307679 3300046476 Bacteria 779
792 Ga0495664_0042180 3300046477 Bacteria 2701
793 Ga0495664_0128938 3300046477 Bacteria 1531
794 Ga0495664_0162940 3300046477 Bacteria 1353
795 Ga0495664_0248564 3300046477 Bacteria 1075
796 Ga0495664_0263307 3300046477 Bacteria 1042
797 Ga0495584_0000010 3300046491 Bacteria 225095
798 Ga0495584_0014014 3300046491 Bacteria 4084
799 Ga0495584_0050495 3300046491 Bacteria 2095
800 Ga0495584_0073366 3300046491 Bacteria 1720
801 Ga0495584_0114116 3300046491 Bacteria 1367
802 Ga0495584_0125358 3300046491 Bacteria 1301
803 Ga0495584_0125651 3300046491 Bacteria 1300
804 Ga0495584_0198491 3300046491 Bacteria 1020
805 Ga0495584_0369805 3300046491 Bacteria 728
806 Ga0495585_0000006 3300046492 Bacteria 320556
807 Ga0495585_0000592 3300046492 Bacteria 33996
808 Ga0495585_0002955 3300046492 Bacteria 11739
809 Ga0495585_0005077 3300046492 Bacteria 8388
810 Ga0495585_0006007 3300046492 Bacteria 7598
811 Ga0495585_0024333 3300046492 Bacteria 3473
812 Ga0495585_0024548 3300046492 Bacteria 3455
813 Ga0495585_0030907 3300046492 Bacteria 3044
814 Ga0495585_0045573 3300046492 Bacteria 2447
815 Ga0495585_0124151 3300046492 Bacteria 1363
816 Ga0495585_0271158 3300046492 Bacteria 841
817 Ga0495594_0022591 3300046499 Bacteria 3365
818 Ga0495594_0071495 3300046499 Bacteria 1929
819 Ga0495594_0145158 3300046499 Bacteria 1346
820 Ga0495594_0167425 3300046499 Bacteria 1250
821 Ga0495596_0000130 3300046500 Bacteria 51970
822 Ga0495596_0000217 3300046500 Bacteria 39881
823 Ga0495596_0003683 3300046500 Bacteria 7667
824 Ga0495596_0010643 3300046500 Bacteria 3997
825 Ga0495596_0013769 3300046500 Bacteria 3421
826 Ga0495596_0022683 3300046500 Bacteria 2554
827 Ga0495596_0026364 3300046500 Bacteria 2343
828 Ga0495596_0059867 3300046500 Bacteria 1484
829 Ga0495596_0068491 3300046500 Bacteria 1379
830 Ga0495596_0168862 3300046500 Bacteria 850
831 Ga0495596_0422808 3300046500 Bacteria 519
832 Ga0495607_0005534 3300046501 Bacteria 9014
833 Ga0495607_0087201 3300046501 Bacteria 1699
834 Ga0495607_0124886 3300046501 Bacteria 1346
835 Ga0495607_0179754 3300046501 Bacteria 1061
836 Ga0495607_0297101 3300046501 Bacteria 761
837 Ga0495583_0000022 3300046506 Bacteria 282544
838 Ga0495583_0000084 3300046506 Bacteria 165375
839 Ga0495583_0001091 3300046506 Bacteria 30075
840 Ga0495583_0006475 3300046506 Bacteria 7648
841 Ga0495583_0006797 3300046506 Bacteria 7390
842 Ga0495583_0026425 3300046506 Bacteria 2878
843 Ga0495583_0052075 3300046506 Bacteria 1864
844 Ga0495583_0055627 3300046506 Bacteria 1787
845 Ga0495583_0306438 3300046506 Bacteria 630
846 Ga0495606_0000146 3300046507 Bacteria 122515
847 Ga0495606_0000481 3300046507 Bacteria 65448
848 Ga0495606_0003434 3300046507 Bacteria 16812
849 Ga0495606_0006469 3300046507 Bacteria 10788
850 Ga0495606_0009349 3300046507 Bacteria 8307
851 Ga0495606_0011574 3300046507 Bacteria 7176
852 Ga0495606_0025138 3300046507 Bacteria 4272
853 Ga0495606_0040833 3300046507 Bacteria 3115
854 Ga0495606_0084648 3300046507 Bacteria 1963
855 Ga0495606_0108621 3300046507 Bacteria 1676
856 Ga0495606_0108962 3300046507 Bacteria 1673
857 Ga0495606_0157058 3300046507 Bacteria 1330
858 Ga0495606_0174082 3300046507 Bacteria 1246
859 Ga0495606_0176477 3300046507 Bacteria 1235
860 Ga0495606_0190639 3300046507 Bacteria 1175
861 Ga0495606_0219485 3300046507 Bacteria 1072
862 Ga0495606_0265264 3300046507 Bacteria 946
863 Ga0495606_0369688 3300046507 Bacteria 755
864 Ga0495608_0003296 3300046511 Bacteria 11540
865 Ga0495608_0030234 3300046511 Bacteria 3669
866 Ga0495608_0186679 3300046511 Bacteria 1310
867 Ga0495610_0001665 3300046512 Bacteria 19541
868 Ga0495610_0009630 3300046512 Bacteria 6087
869 Ga0495610_0235732 3300046512 Bacteria 732
870 Ga0495616_0000081 3300046513 Bacteria 80720
871 Ga0495616_0004477 3300046513 Bacteria 8799
872 Ga0495616_0017067 3300046513 Bacteria 4007
873 Ga0495616_0032792 3300046513 Bacteria 2711
874 Ga0495616_0046172 3300046513 Bacteria 2200
875 Ga0495616_0146898 3300046513 Bacteria 1069
876 Ga0495616_0179091 3300046513 Bacteria 943
877 Ga0495616_0288432 3300046513 Bacteria 696
878 Ga0495618_0002752 3300046514 Bacteria 11183
879 Ga0495618_0017958 3300046514 Bacteria 4340
880 Ga0495618_0044222 3300046514 Bacteria 2809
881 Ga0495618_0437047 3300046514 Bacteria 796
882 Ga0495620_0012489 3300046515 Bacteria 4382
883 Ga0495620_0022595 3300046515 Bacteria 3026
884 Ga0495620_0037749 3300046515 Bacteria 2149
885 Ga0495620_0058502 3300046515 Bacteria 1613
886 Ga0495620_0165228 3300046515 Bacteria 859
887 Ga0495628_0008594 3300046516 Bacteria 8748
888 Ga0495628_0009845 3300046516 Bacteria 8143
889 Ga0495628_0034723 3300046516 Bacteria 4055
890 Ga0495628_0043098 3300046516 Bacteria 3596
891 Ga0495628_0066840 3300046516 Bacteria 2809
892 Ga0495628_0185794 3300046516 Bacteria 1570
893 Ga0495628_0378287 3300046516 Bacteria 1037
894 Ga0495630_0018208 3300046517 Bacteria 5157
895 Ga0495630_0020381 3300046517 Bacteria 4889
896 Ga0495630_0051641 3300046517 Bacteria 3077
897 Ga0495630_0074286 3300046517 Bacteria 2560
898 Ga0495630_0338178 3300046517 Bacteria 1151
899 Ga0495630_0780126 3300046517 Bacteria 730
900 Ga0495631_0000208 3300046518 Bacteria 40242
901 Ga0495631_0124667 3300046518 Bacteria 1107
902 Ga0495631_0131839 3300046518 Bacteria 1074
903 Ga0495631_0212809 3300046518 Bacteria 826
904 Ga0495631_0241001 3300046518 Bacteria 771
905 Ga0495631_0241999 3300046518 Bacteria 769
906 Ga0495631_0360320 3300046518 Bacteria 619
907 Ga0495632_0018729 3300046519 Bacteria 3791
908 Ga0495632_0353997 3300046519 Bacteria 645
909 Ga0495637_0001186 3300046520 Bacteria 15859
910 Ga0495637_0011421 3300046520 Bacteria 4268
911 Ga0495637_0051480 3300046520 Bacteria 1723
912 Ga0495637_0342652 3300046520 Bacteria 525
913 Ga0495643_0000211 3300046522 Bacteria 89358
914 Ga0495643_0000756 3300046522 Bacteria 36370
915 Ga0495643_0021824 3300046522 Bacteria 3665
916 Ga0495643_0022539 3300046522 Bacteria 3593
917 Ga0495643_0071638 3300046522 Bacteria 1819
918 Ga0495643_0106501 3300046522 Bacteria 1430
919 Ga0495643_0161414 3300046522 Bacteria 1102
920 Ga0495644_0016744 3300046523 Bacteria 2805
921 Ga0495648_0000007 3300046524 Bacteria 347305
922 Ga0495648_0000025 3300046524 Bacteria 233415
923 Ga0495648_0021630 3300046524 Bacteria 4450
924 Ga0495648_0043999 3300046524 Bacteria 2791
925 Ga0495648_0052853 3300046524 Bacteria 2464
926 Ga0495648_0067713 3300046524 Bacteria 2087
927 Ga0495648_0114686 3300046524 Bacteria 1459
928 Ga0495648_0130412 3300046524 Bacteria 1337
929 Ga0495648_0159776 3300046524 Bacteria 1166
930 Ga0495663_0111080 3300046525 Bacteria 911
931 Ga0495666_0002705 3300046526 Bacteria 8850
932 Ga0495666_0002913 3300046526 Bacteria 8569
933 Ga0495666_0024903 3300046526 Bacteria 2956
934 Ga0495666_0036993 3300046526 Bacteria 2375
935 Ga0495666_0041441 3300046526 Bacteria 2230
936 Ga0495666_0063106 3300046526 Bacteria 1769
937 Ga0495666_0087931 3300046526 Bacteria 1467
938 Ga0495666_0129885 3300046526 Bacteria 1177
939 Ga0495666_0131273 3300046526 Bacteria 1170
940 Ga0495642_0002601 3300046528 Bacteria 7279
941 Ga0495642_0009199 3300046528 Bacteria 3781
942 Ga0495642_0009287 3300046528 Bacteria 3765
943 Ga0495642_0012265 3300046528 Bacteria 3303
944 Ga0495642_0019027 3300046528 Bacteria 2689
945 Ga0495642_0028204 3300046528 Bacteria 2236
946 Ga0495642_0037685 3300046528 Bacteria 1957
947 Ga0495642_0041872 3300046528 Bacteria 1864
948 Ga0495642_0069420 3300046528 Bacteria 1472
949 Ga0495642_0119897 3300046528 Bacteria 1128
950 Ga0495642_0150959 3300046528 Bacteria 1005
951 Ga0495642_0197584 3300046528 Bacteria 876
952 Ga0495652_0018489 3300046529 Bacteria 6211
953 Ga0495652_0054629 3300046529 Bacteria 3400
954 Ga0495652_0109457 3300046529 Bacteria 2224
955 Ga0495652_0148408 3300046529 Bacteria 1835
956 Ga0495654_0000004 3300046530 Bacteria 515304
957 Ga0495654_0036250 3300046530 Bacteria 2480
958 Ga0495654_0330191 3300046530 Bacteria 617
959 Ga0495665_0002211 3300046531 Bacteria 10538
960 Ga0495665_0003419 3300046531 Bacteria 8621
961 Ga0495665_0043238 3300046531 Bacteria 2396
962 Ga0495665_0061152 3300046531 Bacteria 1988
963 Ga0495665_0170139 3300046531 Bacteria 1134
964 Ga0495640_0028116 3300046533 Bacteria 4050
965 Ga0495640_0031753 3300046533 Bacteria 3767
966 Ga0495586_0032926 3300046535 Bacteria 2780
967 Ga0495586_0123580 3300046535 Bacteria 1446
968 Ga0495586_0135098 3300046535 Bacteria 1382
969 Ga0495587_0005576 3300046536 Bacteria 8215
970 Ga0495587_0016817 3300046536 Bacteria 4548
971 Ga0495609_0010639 3300046538 Bacteria 4405
972 Ga0495609_0011751 3300046538 Bacteria 4163
973 Ga0495609_0012503 3300046538 Bacteria 4026
974 Ga0495609_0020009 3300046538 Bacteria 3094
975 Ga0495609_0020469 3300046538 Bacteria 3058
976 Ga0495609_0030212 3300046538 Bacteria 2466
977 Ga0495609_0030238 3300046538 Bacteria 2465
978 Ga0495621_0184827 3300046539 Bacteria 833
979 Ga0495597_0002183 3300046542 Bacteria 12849
980 Ga0495597_0008764 3300046542 Bacteria 5052
981 Ga0495597_0009805 3300046542 Bacteria 4713
982 Ga0495597_0018818 3300046542 Bacteria 3237
983 Ga0495597_0035987 3300046542 Bacteria 2231
984 Ga0495597_0054091 3300046542 Bacteria 1764
985 Ga0495597_0054422 3300046542 Bacteria 1757
986 Ga0495597_0069182 3300046542 Bacteria 1524
987 Ga0495597_0107813 3300046542 Bacteria 1170
988 Ga0495597_0141266 3300046542 Bacteria 993
989 Ga0495597_0271471 3300046542 Bacteria 662
990 Ga0495597_0318418 3300046542 Bacteria 601
991 Ga0495645_0001779 3300046543 Bacteria 14629
992 Ga0495645_0004217 3300046543 Bacteria 9831
993 Ga0495645_0152633 3300046543 Bacteria 1603
994 Ga0495645_0184074 3300046543 Bacteria 1428
995 Ga0495622_0000003 3300046557 Bacteria 268681
996 Ga0495622_0000432 3300046557 Bacteria 27458
997 Ga0495622_0001785 3300046557 Bacteria 10604
998 Ga0495622_0019441 3300046557 Bacteria 3161
999 Ga0495622_0078147 3300046557 Bacteria 1524
1000 Ga0495622_0115643 3300046557 Bacteria 1226
1001 Ga0495622_0152852 3300046557 Bacteria 1043
1002 Ga0495633_0000045 3300046558 Bacteria 169729
1003 Ga0495633_0000449 3300046558 Bacteria 42373
1004 Ga0495633_0004052 3300046558 Bacteria 9470
1005 Ga0495633_0008175 3300046558 Bacteria 5925
1006 Ga0495633_0016254 3300046558 Bacteria 3843
1007 Ga0495633_0023418 3300046558 Bacteria 3060
1008 Ga0495633_0036019 3300046558 Bacteria 2373
1009 Ga0495633_0047683 3300046558 Bacteria 2024
1010 Ga0495633_0130117 3300046558 Bacteria 1164
1011 Ga0495633_0227990 3300046558 Bacteria 852
1012 Ga0495633_0235739 3300046558 Bacteria 836
1013 Ga0495633_0294382 3300046558 Bacteria 738
1014 Ga0495633_0526631 3300046558 Bacteria 532
1015 Ga0495667_0030516 3300046559 Bacteria 3622
1016 Ga0495667_0057970 3300046559 Bacteria 2544
1017 Ga0495667_0063113 3300046559 Bacteria 2426
1018 Ga0495656_0005184 3300046615 Bacteria 4493
1019 Ga0495656_0101385 3300046615 Bacteria 1332
1020 Ga0495656_0246033 3300046615 Bacteria 902
1021 Ga0495656_0507584 3300046615 Bacteria 640
1022 Ga0495668_0000158 3300046616 Bacteria 103075
1023 Ga0495668_0000205 3300046616 Bacteria 86295
1024 Ga0495668_0008636 3300046616 Bacteria 6335
1025 Ga0495668_0009520 3300046616 Bacteria 5957
1026 Ga0495668_0016793 3300046616 Bacteria 4253
1027 Ga0495668_0018505 3300046616 Bacteria 4025
1028 Ga0495668_0038447 3300046616 Bacteria 2673
1029 Ga0495668_0101815 3300046616 Bacteria 1571
1030 Ga0495634_0026937 3300046642 Bacteria 4006
1031 Ga0495634_0055546 3300046642 Bacteria 2647
1032 Ga0495634_0058400 3300046642 Bacteria 2571
1033 Ga0495634_0086232 3300046642 Bacteria 2045
1034 Ga0495634_0483915 3300046642 Bacteria 727
1035 Ga0495611_0006859 3300046648 Bacteria 4840
1036 Ga0495611_0030690 3300046648 Bacteria 2364
1037 Ga0495611_0053541 3300046648 Bacteria 1821
1038 Ga0495611_0109507 3300046648 Bacteria 1285
1039 Ga0495611_0126832 3300046648 Bacteria 1190
1040 Ga0495611_0151565 3300046648 Bacteria 1082
1041 Ga0495611_0220200 3300046648 Bacteria 883
1042 Ga0495611_0314379 3300046648 Bacteria 721
1043 Ga0495625_0000073 3300046660 Bacteria 165197
1044 Ga0495625_0013883 3300046660 Bacteria 6452
1045 Ga0495625_0026311 3300046660 Bacteria 4398
1046 Ga0495625_0036776 3300046660 Bacteria 3596
1047 Ga0495625_0061508 3300046660 Bacteria 2657
1048 Ga0495625_0089442 3300046660 Bacteria 2131
1049 Ga0495625_0102439 3300046660 Bacteria 1965
1050 Ga0495625_0479119 3300046660 Bacteria 764
1051 Ga0495635_0004239 3300046663 Bacteria 9944
1052 Ga0495635_0030479 3300046663 Bacteria 3748
1053 Ga0495635_0191713 3300046663 Bacteria 1387
1054 Ga0495635_0284179 3300046663 Bacteria 1111
1055 Ga0495635_0401851 3300046663 Bacteria 910
1056 Ga0495659_0000250 3300046664 Bacteria 22228
1057 Ga0495659_0233617 3300046664 Bacteria 762
1058 Ga0495661_0013093 3300046665 Bacteria 5581
1059 Ga0495661_0019974 3300046665 Bacteria 4381
1060 Ga0495661_0033704 3300046665 Bacteria 3228
1061 Ga0495661_0033914 3300046665 Bacteria 3216
1062 Ga0495661_0044040 3300046665 Bacteria 2738
1063 Ga0495661_0046634 3300046665 Bacteria 2644
1064 Ga0495661_0077127 3300046665 Bacteria 1932
1065 Ga0495661_0103770 3300046665 Bacteria 1595
1066 Ga0495661_0120156 3300046665 Bacteria 1452
1067 Ga0495661_0139153 3300046665 Bacteria 1322
1068 Ga0495661_0164413 3300046665 Bacteria 1188
1069 Ga0495661_0324669 3300046665 Bacteria 764
1070 Ga0495661_0599165 3300046665 Bacteria 518
1071 Ga0495588_0027782 3300046674 Bacteria 2829
1072 Ga0495588_0179592 3300046674 Bacteria 1118
1073 Ga0495588_0195636 3300046674 Bacteria 1068
1074 Ga0495588_0232625 3300046674 Bacteria 972
1075 Ga0495588_0391563 3300046674 Bacteria 729
1076 Ga0495657_0011467 3300046675 Bacteria 6626
1077 Ga0495657_0154368 3300046675 Bacteria 1424
1078 Ga0495599_0012590 3300046678 Bacteria 5215
1079 Ga0495599_0015011 3300046678 Bacteria 4801
1080 Ga0495599_0030049 3300046678 Bacteria 3408
1081 Ga0495599_0034887 3300046678 Bacteria 3158
1082 Ga0495599_0249800 3300046678 Bacteria 1080
1083 Ga0495623_0005391 3300046679 Bacteria 8370
1084 Ga0495623_0007426 3300046679 Bacteria 7116
1085 Ga0495623_0027621 3300046679 Bacteria 3653
1086 Ga0495623_0043435 3300046679 Bacteria 2860
1087 Ga0495623_0173658 3300046679 Bacteria 1257
1088 Ga0495623_0690275 3300046679 Bacteria 523
1089 Ga0495646_0003824 3300046680 Bacteria 9407
1090 Ga0495646_0038580 3300046680 Bacteria 2948
1091 Ga0495646_0041384 3300046680 Bacteria 2831
1092 Ga0495646_0064775 3300046680 Bacteria 2165
1093 Ga0495646_0073596 3300046680 Bacteria 2007
1094 Ga0495646_0182203 3300046680 Bacteria 1152
1095 Ga0495646_0338788 3300046680 Bacteria 789
1096 Ga0495646_0393492 3300046680 Bacteria 721
1097 Ga0495669_0004997 3300046684 Bacteria 5512
1098 Ga0495669_0007819 3300046684 Bacteria 4487
1099 Ga0495669_0040783 3300046684 Bacteria 2060
1100 Ga0495669_0062829 3300046684 Bacteria 1683
1101 Ga0495669_0084090 3300046684 Bacteria 1463
1102 Ga0495669_0136084 3300046684 Bacteria 1158
1103 Ga0495669_0158745 3300046684 Bacteria 1073
1104 Ga0495669_0167025 3300046684 Bacteria 1046
1105 Ga0495669_0189342 3300046684 Bacteria 982
1106 Ga0495669_0603204 3300046684 Bacteria 534
1107 Ga0495613_0008036 3300046689 Bacteria 7846
1108 Ga0495613_0036856 3300046689 Bacteria 3626
1109 Ga0495613_0078560 3300046689 Bacteria 2400
1110 Ga0495613_0156840 3300046689 Bacteria 1621
1111 Ga0495613_0262704 3300046689 Bacteria 1202
1112 Ga0495624_0007582 3300046690 Bacteria 7615
1113 Ga0495624_0017620 3300046690 Bacteria 4789
1114 Ga0495624_0040236 3300046690 Bacteria 2994
1115 Ga0495624_0092647 3300046690 Bacteria 1864
1116 Ga0495624_0124618 3300046690 Bacteria 1581
1117 Ga0495624_0194622 3300046690 Bacteria 1232
1118 Ga0495624_0236449 3300046690 Bacteria 1106
1119 Ga0495624_0241696 3300046690 Bacteria 1092
1120 Ga0495624_0623162 3300046690 Bacteria 642
1121 Ga0495670_0009539 3300046691 Bacteria 4768
1122 Ga0495670_0011171 3300046691 Bacteria 4414
1123 Ga0495670_0015184 3300046691 Bacteria 3788
1124 Ga0495670_0019038 3300046691 Bacteria 3383
1125 Ga0495670_0071596 3300046691 Bacteria 1755
1126 Ga0495670_0083496 3300046691 Bacteria 1629
1127 Ga0495670_0184302 3300046691 Bacteria 1103
1128 Ga0495670_0195580 3300046691 Bacteria 1070
1129 Ga0495670_0555114 3300046691 Bacteria 625
1130 Ga0495671_0000761 3300046692 Bacteria 23168
1131 Ga0495671_0001979 3300046692 Bacteria 13165
1132 Ga0495671_0007787 3300046692 Bacteria 6067
1133 Ga0495671_0095005 3300046692 Bacteria 1458
1134 Ga0495671_0133949 3300046692 Bacteria 1208
1135 Ga0495671_0145895 3300046692 Bacteria 1153
1136 Ga0495671_0310560 3300046692 Bacteria 758
1137 Ga0495649_0000276 3300046694 Bacteria 45246
1138 Ga0495649_0003671 3300046694 Bacteria 10229
1139 Ga0495649_0025840 3300046694 Bacteria 3269
1140 Ga0495649_0038247 3300046694 Bacteria 2633
1141 Ga0495649_0104497 3300046694 Bacteria 1504
1142 Ga0495649_0129948 3300046694 Bacteria 1329
1143 Ga0495649_0148445 3300046694 Bacteria 1232
1144 Ga0495649_0157038 3300046694 Bacteria 1193
1145 Ga0495649_0160593 3300046694 Bacteria 1178
1146 Ga0495649_0418563 3300046694 Bacteria 671
1147 Ga0495589_0005791 3300046794 Bacteria 6518
1148 Ga0495589_0016119 3300046794 Bacteria 3839
1149 Ga0495589_0029553 3300046794 Bacteria 2763
1150 Ga0495589_0046207 3300046794 Bacteria 2162
1151 Ga0495589_0079649 3300046794 Bacteria 1594
1152 Ga0495589_0086924 3300046794 Bacteria 1518
1153 Ga0495589_0089099 3300046794 Bacteria 1498
1154 Ga0495589_0126772 3300046794 Bacteria 1227
1155 Ga0495589_0130050 3300046794 Bacteria 1209
1156 Ga0495589_0151419 3300046794 Bacteria 1107
1157 Ga0495589_0165503 3300046794 Bacteria 1052
1158 Ga0495589_0216334 3300046794 Bacteria 901
1159 Ga0495600_0014556 3300046809 Bacteria 4958
1160 Ga0495600_0017898 3300046809 Bacteria 4510
1161 Ga0495600_0140189 3300046809 Bacteria 1569
1162 Ga0495600_0232660 3300046809 Bacteria 1176
1163 Ga0495660_0000081 3300046810 Bacteria 101754
1164 Ga0495660_0009328 3300046810 Bacteria 5722
1165 Ga0495660_0054134 3300046810 Bacteria 2175
1166 Ga0495660_0060144 3300046810 Bacteria 2042
1167 Ga0495660_0251339 3300046810 Bacteria 820
1168 Ga0495660_0358665 3300046810 Bacteria 647
1169 Ga0495660_0454069 3300046810 Bacteria 553
1170 Ga0495660_0472186 3300046810 Bacteria 540
1171 Ga0495581_0008018 3300047315 Bacteria 6117
1172 Ga0495581_0010818 3300047315 Bacteria 5275
1173 Ga0495581_0016951 3300047315 Bacteria 4233
1174 Ga0495581_0027086 3300047315 Bacteria 3324
1175 Ga0495581_0142715 3300047315 Bacteria 1397
1176 Ga0495604_0006383 3300047317 Bacteria 9351
1177 Ga0495604_0036919 3300047317 Bacteria 3850
1178 Ga0495604_0069432 3300047317 Bacteria 2670
1179 Ga0495604_0153634 3300047317 Bacteria 1633
1180 Ga0495604_0405199 3300047317 Bacteria 897
1181 Ga0495604_0696021 3300047317 Bacteria 645
1182 Ga0495636_0004977 3300047318 Bacteria 5211
1183 Ga0495636_0005572 3300047318 Bacteria 4946
1184 Ga0495636_0108178 3300047318 Bacteria 1221
1185 Ga0495636_0133101 3300047318 Bacteria 1107
1186 Ga0495674_0004003 3300047319 Bacteria 14272
1187 Ga0495674_0017880 3300047319 Bacteria 6601
1188 Ga0495674_0038225 3300047319 Bacteria 4309
1189 Ga0495674_0083527 3300047319 Bacteria 2737
1190 Ga0495674_0110061 3300047319 Bacteria 2336
1191 Ga0495674_0214426 3300047319 Bacteria 1593
1192 Ga0495674_0456906 3300047319 Bacteria 1025
1193 Ga0495674_0711387 3300047319 Bacteria 787
1194 Ga0495672_0040026 3300047320 Bacteria 2845
1195 Ga0495672_0040280 3300047320 Bacteria 2834
1196 Ga0495672_0113324 3300047320 Bacteria 1452
1197 Ga0495672_0122167 3300047320 Bacteria 1382
1198 Ga0495672_0193423 3300047320 Bacteria 1021
1199 Ga0495672_0221111 3300047320 Bacteria 935
1200 Ga0495676_0006099 3300047321 Bacteria 11085
1201 Ga0495676_0011233 3300047321 Bacteria 8096
1202 Ga0495676_0018695 3300047321 Bacteria 6111
1203 Ga0495676_0071732 3300047321 Bacteria 2662
1204 Ga0495676_0143013 3300047321 Bacteria 1712
1205 Ga0495676_0328624 3300047321 Bacteria 1026
1206 Ga0495676_0371813 3300047321 Bacteria 952
1207 Ga0495680_0010421 3300047322 Bacteria 8293
1208 Ga0495680_0011158 3300047322 Bacteria 7978
1209 Ga0495680_0048393 3300047322 Bacteria 3338
1210 Ga0495680_0132365 3300047322 Bacteria 1831
1211 Ga0495680_0221206 3300047322 Bacteria 1351
1212 Ga0495680_0750764 3300047322 Bacteria 641
1213 Ga0495683_0002992 3300047323 Bacteria 9971
1214 Ga0495683_0005648 3300047323 Bacteria 6924
1215 Ga0495683_0009187 3300047323 Bacteria 5268
1216 Ga0495683_0023474 3300047323 Bacteria 3170
1217 Ga0495683_0023907 3300047323 Bacteria 3138
1218 Ga0495683_0027257 3300047323 Bacteria 2921
1219 Ga0495683_0031015 3300047323 Bacteria 2725
1220 Ga0495683_0035808 3300047323 Bacteria 2522
1221 Ga0495683_0090624 3300047323 Bacteria 1481
1222 Ga0495683_0108002 3300047323 Bacteria 1331
1223 Ga0495683_0147086 3300047323 Bacteria 1100
1224 Ga0495683_0161978 3300047323 Bacteria 1034
1225 Ga0495683_0347693 3300047323 Bacteria 626
1226 Ga0495687_000015 3300047443 Bacteria 365627
1227 Ga0495687_000703 3300047443 Bacteria 37295
1228 Ga0495687_003807 3300047443 Bacteria 10642
1229 Ga0495687_035581 3300047443 Bacteria 2237
1230 Ga0495687_052036 3300047443 Bacteria 1734
1231 Ga0495687_119400 3300047443 Bacteria 954
1232 Ga0495675_0022205 3300047444 Bacteria 4044
1233 Ga0495675_0027518 3300047444 Bacteria 3623
1234 Ga0495675_0033854 3300047444 Bacteria 3261
1235 Ga0495675_0037010 3300047444 Bacteria 3109
1236 Ga0495675_0044172 3300047444 Bacteria 2838
1237 Ga0495675_0116659 3300047444 Bacteria 1664
1238 Ga0495675_0216270 3300047444 Bacteria 1161
1239 Ga0495677_0009102 3300047445 Bacteria 3671
1240 Ga0495677_0018720 3300047445 Bacteria 2510
1241 Ga0495677_0021879 3300047445 Bacteria 2317
1242 Ga0495677_0043716 3300047445 Bacteria 1643
1243 Ga0495677_0197085 3300047445 Bacteria 782
1244 Ga0495679_000058 3300047446 Bacteria 110231
1245 Ga0495679_003493 3300047446 Bacteria 7523
1246 Ga0495679_004506 3300047446 Bacteria 6392
1247 Ga0495679_004663 3300047446 Bacteria 6245
1248 Ga0495679_130564 3300047446 Bacteria 682
1249 Ga0495685_028362 3300047447 Bacteria 1926
1250 Ga0495685_044630 3300047447 Bacteria 1511
1251 Ga0495685_073207 3300047447 Bacteria 1146
1252 Ga0495685_078709 3300047447 Bacteria 1099
1253 Ga0495685_136254 3300047447 Bacteria 801
1254 Ga0495685_161297 3300047447 Bacteria 726
1255 Ga0495673_0000014 3300047469 Bacteria 599202
1256 Ga0495673_0009245 3300047469 Bacteria 5468
1257 Ga0495673_0033923 3300047469 Bacteria 2363
1258 Ga0495673_0056533 3300047469 Bacteria 1697
1259 Ga0495673_0070471 3300047469 Bacteria 1472
1260 Ga0495673_0095351 3300047469 Bacteria 1210
1261 Ga0495673_0367097 3300047469 Bacteria 505
1262 Ga0495681_0014507 3300047470 Bacteria 4511
1263 Ga0495681_0022135 3300047470 Bacteria 3409
1264 Ga0495681_0031277 3300047470 Bacteria 2697
1265 Ga0495681_0045275 3300047470 Bacteria 2107
1266 Ga0495681_0057538 3300047470 Bacteria 1805
1267 Ga0495681_0103220 3300047470 Bacteria 1244
1268 Ga0495681_0225880 3300047470 Bacteria 749
1269 Ga0495681_0346072 3300047470 Bacteria 566
1270 Ga0495684_0014569 3300047471 Bacteria 6051
1271 Ga0495684_0409269 3300047471 Bacteria 950
1272 Ga0495686_0000002 3300047472 Bacteria 1050777
1273 Ga0495686_0002027 3300047472 Bacteria 19979
1274 Ga0495686_0002626 3300047472 Bacteria 16639
1275 Ga0495686_0009213 3300047472 Bacteria 7145
1276 Ga0495686_0015629 3300047472 Bacteria 5176
1277 Ga0495686_0043501 3300047472 Bacteria 2846
1278 Ga0495686_0121146 3300047472 Bacteria 1559
1279 Ga0495686_0351981 3300047472 Bacteria 800
1280 Ga0495593_0007628 3300047673 Bacteria 6318
1281 Ga0495593_0009907 3300047673 Bacteria 5525
1282 Ga0495593_0029339 3300047673 Bacteria 3016
1283 Ga0495593_0032540 3300047673 Bacteria 2842
1284 Ga0495593_0281630 3300047673 Bacteria 831
1285 Ga0495593_0354882 3300047673 Bacteria 733
1286 Ga0495602_0014101 3300048088 Bacteria 8128
1287 Ga0495602_0031078 3300048088 Bacteria 5054
1288 Ga0495602_0075255 3300048088 Bacteria 2866
1289 Ga0495602_0281950 3300048088 Bacteria 1223
1290 Ga0495614_0002618 3300048089 Bacteria 7998
1291 Ga0495614_0026651 3300048089 Bacteria 2492
1292 Ga0495614_0030921 3300048089 Bacteria 2305
1293 Ga0495615_0078428 3300048090 Bacteria 902
1294 Ga0495615_0110410 3300048090 Bacteria 786
1295 Ga0495615_0154636 3300048090 Bacteria 685
1296 Ga0495626_0002629 3300048091 Bacteria 12219
1297 Ga0495626_0003091 3300048091 Bacteria 10913
1298 Ga0495626_0008898 3300048091 Bacteria 5452
1299 Ga0495626_0015071 3300048091 Bacteria 3962
1300 Ga0495626_0015879 3300048091 Bacteria 3842
1301 Ga0495626_0027278 3300048091 Bacteria 2778
1302 Ga0495626_0050646 3300048091 Bacteria 1918
1303 Ga0495626_0066066 3300048091 Bacteria 1636
1304 Ga0495626_0103365 3300048091 Bacteria 1240
1305 Ga0495626_0155835 3300048091 Bacteria 960
1306 Ga0496100_0007315 3300048903 Bacteria 6079
1307 Ga0496100_0057163 3300048903 Bacteria 2554
1308 Ga0496100_0162420 3300048903 Bacteria 1602
1309 Ga0496100_1064934 3300048903 Bacteria 637
1310 Ga0496100_1106222 3300048903 Bacteria 624
1311 Ga0496100_1591260 3300048903 Bacteria 516
1312 Ga0496101_0010991 3300048904 Bacteria 5996
1313 Ga0496102_0003454 3300048905 Bacteria 13395
1314 Ga0496102_0049272 3300048905 Bacteria 3832
1315 Ga0496102_0115338 3300048905 Bacteria 2506
1316 Ga0496102_0228425 3300048905 Bacteria 1754
1317 Ga0496102_0416352 3300048905 Bacteria 1262
1318 Ga0496102_0683960 3300048905 Bacteria 949
1319 Ga0496102_0747976 3300048905 Bacteria 900
1320 Ga0496102_0822354 3300048905 Bacteria 851
1321 Ga0496103_0002443 3300048906 Bacteria 11685
1322 Ga0496103_0002839 3300048906 Bacteria 10776
1323 Ga0496103_0018044 3300048906 Bacteria 4229
1324 Ga0496103_0021805 3300048906 Bacteria 3855
1325 Ga0496103_0290430 3300048906 Bacteria 1052
1326 Ga0496104_0032738 3300048907 Bacteria 4839
1327 Ga0496104_0116476 3300048907 Bacteria 2564
1328 Ga0496104_0723781 3300048907 Bacteria 903
1329 Ga0496105_0171285 3300048908 Bacteria 1779
1330 Ga0496105_0370463 3300048908 Bacteria 1141
1331 Ga0496105_0398045 3300048908 Bacteria 1094
1332 Ga0496105_0401929 3300048908 Bacteria 1087
1333 Ga0496106_0126676 3300048909 Bacteria 2000
1334 Ga0496106_0192405 3300048909 Bacteria 1622
1335 Ga0496106_0263765 3300048909 Bacteria 1379
1336 Ga0496106_1278635 3300048909 Bacteria 570
1337 Ga0496106_1352333 3300048909 Bacteria 551
1338 Ga0496107_0064642 3300048910 Bacteria 2653
1339 Ga0496107_0097055 3300048910 Bacteria 2157
1340 Ga0496109_0360698 3300048912 Bacteria 1373
1341 Ga0496110_0346449 3300048913 Bacteria 1353
1342 Ga0496111_0091034 3300048914 Bacteria 2235
1343 Ga0496111_1251254 3300048914 Bacteria 524
1344 Ga0496112_0064662 3300048915 Bacteria 3610
1345 Ga0496112_0615983 3300048915 Bacteria 1017
1346 Ga0496113_0031452 3300048916 Bacteria 3852
1347 Ga0496113_0267248 3300048916 Bacteria 1367
1348 Ga0496114_0020353 3300048917 Bacteria 5385
1349 Ga0496114_0610460 3300048917 Bacteria 961
1350 Ga0496115_0034299 3300048918 Bacteria 4011
1351 Ga0496115_0058213 3300048918 Bacteria 3109
1352 Ga0496115_0059184 3300048918 Bacteria 3085
1353 Ga0496115_0060856 3300048918 Bacteria 3043
1354 Ga0496115_0165443 3300048918 Bacteria 1829
1355 Ga0496115_0251265 3300048918 Bacteria 1456
1356 Ga0496115_0418831 3300048918 Bacteria 1085
1357 Ga0496115_1046774 3300048918 Bacteria 621
1358 Ga0496116_0014948 3300048919 Bacteria 6160
1359 Ga0496116_0037018 3300048919 Bacteria 3408
1360 Ga0496116_0043566 3300048919 Bacteria 3056
1361 Ga0496116_0048072 3300048919 Bacteria 2866
1362 Ga0496116_0068331 3300048919 Bacteria 2264
1363 Ga0496116_0138692 3300048919 Bacteria 1372
1364 Ga0496116_0242852 3300048919 Bacteria 903
1365 Ga0496117_0000001 3300048920 Bacteria 2526244
1366 Ga0496117_0002599 3300048920 Bacteria 22450
1367 Ga0496117_0009401 3300048920 Bacteria 9102
1368 Ga0496117_0075874 3300048920 Bacteria 2231
1369 Ga0496117_0159991 3300048920 Bacteria 1321
1370 Ga0496117_0162108 3300048920 Bacteria 1308
1371 Ga0496117_0249643 3300048920 Bacteria 968
1372 Ga0496118_0000008 3300048921 Bacteria 644537
1373 Ga0496118_0001593 3300048921 Bacteria 33628
1374 Ga0496118_0003767 3300048921 Bacteria 18742
1375 Ga0496118_0011304 3300048921 Bacteria 8730
1376 Ga0496118_0016240 3300048921 Bacteria 6837
1377 Ga0496118_0060696 3300048921 Bacteria 2806
1378 Ga0496118_0074032 3300048921 Bacteria 2436
1379 Ga0496118_0294397 3300048921 Bacteria 895
1380 Ga0496119_0075109 3300048922 Bacteria 1965
1381 Ga0496119_0176963 3300048922 Bacteria 1122
1382 Ga0496119_0290605 3300048922 Bacteria 809
1383 Ga0496120_0097656 3300048923 Bacteria 1558
1384 Ga0496120_0134704 3300048923 Bacteria 1261
1385 Ga0496121_0000585 3300048924 Bacteria 68389
1386 Ga0496121_0008378 3300048924 Bacteria 12189
1387 Ga0496121_0018225 3300048924 Bacteria 7097
1388 Ga0496121_0041402 3300048924 Bacteria 4025
1389 Ga0496121_0079887 3300048924 Bacteria 2595
1390 Ga0496121_0118836 3300048924 Bacteria 2000
1391 Ga0496121_0155484 3300048924 Bacteria 1678
1392 Ga0496121_0256511 3300048924 Bacteria 1210
1393 Ga0496121_0442979 3300048924 Bacteria 839
1394 Ga0496122_0005391 3300048925 Bacteria 15267
1395 Ga0496122_0054314 3300048925 Bacteria 3010
1396 Ga0496122_0121103 3300048925 Bacteria 1687
1397 Ga0496122_0164614 3300048925 Bacteria 1347
1398 Ga0496122_0310578 3300048925 Bacteria 844
1399 Ga0496122_0368181 3300048925 Bacteria 743
1400 Ga0496123_0004753 3300048926 Bacteria 14057
1401 Ga0496123_0005477 3300048926 Bacteria 12770
1402 Ga0496124_0021582 3300048927 Bacteria 5931
1403 Ga0496124_0075917 3300048927 Bacteria 2776
1404 Ga0496124_0110597 3300048927 Bacteria 2212
1405 Ga0496124_0272731 3300048927 Bacteria 1238
1406 Ga0496124_0375266 3300048927 Bacteria 997
1407 Ga0496124_0592543 3300048927 Bacteria 723
1408 Ga0496124_0639459 3300048927 Bacteria 685
1409 Ga0496125_0017813 3300048928 Bacteria 6759
1410 Ga0496125_0041997 3300048928 Bacteria 3902
1411 Ga0496125_0295843 3300048928 Bacteria 994
1412 Ga0496126_0000031 3300048929 Bacteria 373371
1413 Ga0496126_0001253 3300048929 Bacteria 41064
1414 Ga0496126_0004550 3300048929 Bacteria 16486
1415 Ga0496126_0009676 3300048929 Bacteria 10214
1416 Ga0496126_0042466 3300048929 Bacteria 4199
1417 Ga0496126_0107576 3300048929 Bacteria 2432
1418 Ga0496126_0327178 3300048929 Bacteria 1259
1419 Ga0496126_0341788 3300048929 Bacteria 1226
1420 Ga0496126_0534695 3300048929 Bacteria 932
1421 Ga0496126_0647774 3300048929 Bacteria 827
1422 Ga0496126_0783948 3300048929 Bacteria 733
1423 Ga0495678_001532 3300049459 Bacteria 17853
1424 Ga0495678_003399 3300049459 Bacteria 9895
1425 Ga0495678_008710 3300049459 Bacteria 5090
1426 Ga0495678_107475 3300049459 Bacteria 957
1427 Ga0495682_0008546 3300049460 Bacteria 4030
1428 Ga0495682_0010397 3300049460 Bacteria 3605
1429 Ga0495682_0303781 3300049460 Bacteria 563
1430 Ga0501034_0000411 3300049571 Bacteria 72008
1431 Ga0501227_092717 3300049665 Bacteria 798
1432 Ga0501238_014275 3300049671 Bacteria 1088
1433 Ga0501248_002963 3300049678 Bacteria 1194
1434 Ga0501225_0166208 3300049705 Bacteria 681
1435 Ga0501234_010403 3300049707 Bacteria 1450
1436 Ga0501241_046813 3300049758 Bacteria 848
1437 Ga0501268_048110 3300049765 Bacteria 819
1438 Ga0501269_000660 3300049766 Bacteria 5930
1439 Ga0501272_033103 3300049769 Bacteria 664
1440 Ga0501279_002073 3300049775 Bacteria 2658
1441 Ga0501044_0534293 3300049823 Bacteria 1071
1442 nmdc:mga03683_240006_c1 3300050489 Bacteria 840
1443 nmdc:mga03n38_495539_c1 3300050490 Bacteria 685
1444 nmdc:mga00v17_84950_c1 3300050491 Bacteria 1982
1445 nmdc:mga0yw44_21351_c1 3300050492 Bacteria 3610
1446 nmdc:mga0k408_19506_c1 3300050493 Bacteria 3791
1447 nmdc:mga0k408_209721_c1 3300050493 Bacteria 1163
1448 nmdc:mga0k408_211582_c1 3300050493 Bacteria 1158
1449 nmdc:mga0k408_306213_c1 3300050493 Bacteria 948
1450 nmdc:mga0k408_50565_c1 3300050493 Bacteria 2406
1451 nmdc:mga06z11_85483_c1 3300050494 Bacteria 1702
1452 nmdc:mga04h51_82074_c1 3300050495 Bacteria 1146
1453 nmdc:mga04h51_89050_c1 3300050495 Bacteria 1108
1454 nmdc:mga07m45_130657_c1 3300050496 Bacteria 1453
1455 nmdc:mga07m45_4565_c2 3300050496 Bacteria 5691
1456 nmdc:mga07m45_4733_c1 3300050496 Bacteria 6685
1457 nmdc:mga07m45_492937_c1 3300050496 Bacteria 710
1458 nmdc:mga0sz30_29771_c1 3300050516 Bacteria 2253
1459 Ga0500635_0000226 3300053080 Bacteria 25414
1460 Ga0500635_0025833 3300053080 Bacteria 1854
1461 Ga0495655_0078790 3300053083 Bacteria 937
1462 Ga0500643_129867 3300053087 Bacteria 678
1463 Ga0500644_0007404 3300053088 Bacteria 2858
1464 Ga0500646_0030749 3300053090 Bacteria 1474
1465 Ga0500583_0019904 3300053092 Bacteria 2761
1466 Ga0500651_0017576 3300053093 Bacteria 4414
1467 Ga0500651_0122078 3300053093 Bacteria 1581
1468 Ga0500651_0136325 3300053093 Bacteria 1482
1469 Ga0500650_0113017 3300053098 Bacteria 1267
1470 Ga0500593_245263 3300053117 Bacteria 611
1471 Ga0500594_0004662 3300053118 Bacteria 3027
1472 Ga0500594_0044662 3300053118 Bacteria 1226
1473 Ga0500594_0139058 3300053118 Bacteria 774
1474 Ga0500618_008239 3300053125 Bacteria 2924
1475 Ga0500628_000758 3300053129 Bacteria 5771
1476 Ga0500642_0032387 3300053130 Bacteria 2193
1477 Ga0500652_000261 3300053131 Bacteria 19709
1478 Ga0500655_001572 3300053133 Bacteria 4319
1479 Ga0500655_010906 3300053133 Bacteria 1643
1480 Ga0500559_0001032 3300053136 Bacteria 17050
1481 Ga0500559_0016104 3300053136 Bacteria 3157
1482 Ga0500577_0229260 3300053142 Bacteria 805
1483 Ga0500622_0000147 3300053156 Bacteria 74375
1484 Ga0500622_0003765 3300053156 Bacteria 9905
1485 Ga0500622_0022982 3300053156 Bacteria 3302
1486 Ga0500636_0004666 3300053177 Bacteria 7778
1487 Ga0500570_098024 3300053724 Bacteria 1246
1488 Ga0500587_001379 3300053739 Bacteria 3429
1489 Ga0500661_002129 3300055283 Bacteria 3735
1490 Ga0590075_026028 3300059424 Bacteria 1472
1491 Ga0587066_031683 3300059490 Bacteria 946
1492 Ga0587077_013631 3300059493 Bacteria 1323
1493 Ga0587083_0023675 3300059505 Bacteria 1161
1494 Ga0587101_020361 3300059623 Bacteria 949
1495 Ga0587101_139221 3300059623 Bacteria 517
1496 Ga0587067_003295 3300059640 Bacteria 2007
1497 Ga0587069_046067 3300059642 Bacteria 761
1498 Ga0587072_004105 3300059643 Bacteria 2092
1499 Ga0587076_009975 3300059645 Bacteria 1360
1500 Ga0587102_011261 3300059649 Bacteria 896
1501 Ga0587111_0014886 3300060346 Bacteria 1413
1502 Ga0466962_0004008 3300061719 Bacteria 7053
1503 Ga0466962_0007729 3300061719 Bacteria 5151
1504 Ga0466962_0053857 3300061719 Bacteria 1922
1505 Ga0466962_0082501 3300061719 Bacteria 1538
1506 2513953143 2513237150 Bacteria 6553639
1507 2514042108 2513237165 Bacteria 6771773
1508 2587725161 2585428057 Bacteria 6737412
1509 2587731478 2585428058 Bacteria 6853932
1510 2588293775 2588253510 Bacteria 6901809
1511 2597029925 2596583598 Bacteria 5251611
1512 2599443785 2599185178 Bacteria 5365746
1513 2643787613 2643221554 Bacteria 6603920
1514 2644144017 2643221625 Bacteria 6512927
1515 2644213504 2643221638 Bacteria 6579467
1516 2644275780 2643221648 Bacteria 6521465
1517 2831868986 2831864461 Bacteria 6502356
1518 2834641593 2834641062 Bacteria 5559922
1519 2881103813 2881101125 Bacteria 4590519
1520 2885267333 2885266251 Bacteria 4796748
1521 2886853422 2886848708 Bacteria 5632523
1522 2900579622 2900577576 Bacteria 5438534
1523 2928062050 2928058823 Bacteria 5520022
1524 2932412500 2932410948 Bacteria 6312192
1525 2932420015 2932416698 Bacteria 6315112
1526 644747189 644736347 Bacteria 6476522
1527 8003401723 8003400568 Bacteria 5535898
1528 Ga0501257_117118
1529 JGI24741J21665_1000529
1530 JGI24740J21852_10000034
1531 JGI24740J21852_10000042
1532 JGI24739J22299_10032067
1533 JGI24735J21928_10029795
1534 JGI24735J21928_10096415
1535 JGI25156J39149_1000118
1536 JGI25156J39149_1001760
1537 JGI25156J39149_1002065
1538 JGI25156J39149_1004678
1539 JGI25156J39149_1006191
1540 JGI25154J39366_1000173
1541 JGI25154J39366_1001563
1542 JGI25154J39366_1007713
1543 JGI25157J39369_1000278
1544 JGI25164J39214_1007076
1545 JGI25152J39213_1005248
1546 JGI25152J39213_1015897
1547 JGI25150J39212_1000663
1548 JGI25150J39212_1005413
1549 JGI25159J45721_1011880
1550 JGI25151J46595_10004349
1551 JGI25151J46595_10004358
1552 JGI25153J46596_10000223
1553 JGI25153J46596_10008753
1554 JGI25153J46596_10023282
1555 JGI25153J46596_10056852
1556 rootH1_10006452
1557 rootH2_10178406
1558 rootL2_10006362
1559 JGI25160J50197_1001196
1560 JGI25160J50197_1001762
1561 JGI25161J50226_1000889
1562 JGI25161J50226_1006488
1563 Ga0055538_1003912
1564 Ga0055538_1005093
1565 Ga0055539_1000110
1566 Ga0055539_1000301
1567 Ga0055539_1000528
1568 Ga0055533_1000048
1569 Ga0055533_1000068
1570 Ga0055533_1000549
1571 Ga0055533_1000935
1572 Ga0055533_1011506
1573 Ga0055532_1000028
1574 Ga0055532_1000063
1575 Ga0055525_1000162
1576 Ga0055525_1000919
1577 Ga0055525_1009842
1578 Ga0055527_1000049
1579 Ga0055535_1000022
1580 Ga0055535_1000042
1581 Ga0055535_1000306
1582 Ga0055535_1009484
1583 Ga0055542_1000071
1584 Ga0055542_1003046
1585 Ga0055529_1000063
1586 Ga0055529_1000081
1587 Ga0055529_1000528
1588 Ga0055529_1000835
1589 Ga0055526_1000031
1590 Ga0055526_1000353
1591 Ga0055526_1000997
1592 Ga0055526_1001617
1593 Ga0055526_1001701
1594 Ga0055526_1003228
1595 Ga0055526_1005979
1596 Ga0055526_1018981
1597 Ga0055526_1054019
1598 Ga0055537_1000811
1599 Ga0055537_1002741
1600 Ga0055537_1002947
1601 Ga0055524_1000015
1602 Ga0055524_1000799
1603 Ga0055524_1001270
1604 Ga0055524_1001439
1605 Ga0055524_1002162
1606 Ga0055524_1003734
1607 Ga0055524_1013102
1608 Ga0055536_1000020
1609 Ga0055534_1000869
1610 Ga0055534_1004871
1611 Ga0055534_1006755
1612 Ga0055534_1007333
1613 Ga0055528_1024020
1614 Ga0055530_10002241
1615 Ga0055530_10023199
1616 Ga0055540_1016842
1617 Ga0055531_10004238
1618 Ga0055531_10006724
1619 Ga0055531_10015458
1620 Ga0055541_1001709
1621 Ga0055543_1004056
1622 Ga0055543_1011085
1623 Ga0065165_1000356
1624 Ga0065165_1000573
1625 Ga0065165_1001568
1626 Ga0065165_1002807
1627 Ga0065714_10294036
1628 Ga0070658_10006262
1629 Ga0070658_10011253
1630 Ga0070658_10035948
1631 Ga0070658_10052616
1632 Ga0070658_10069908
1633 Ga0070676_10406287
1634 Ga0070690_100355803
1635 Ga0070670_100768436
1636 Ga0068869_100003320
1637 Ga0070680_100256157
1638 Ga0068868_100339507
1639 Ga0070660_100000404
1640 Ga0070660_100076854
1641 Ga0070660_100145775
1642 Ga0070660_100155725
1643 Ga0070660_100254339
1644 Ga0070660_101102826
1645 Ga0070661_100000074
1646 Ga0070661_100004953
1647 Ga0070661_100080467
1648 Ga0070661_100206178
1649 Ga0070661_101916040
1650 Ga0070669_100366841
1651 Ga0070671_100690631
1652 Ga0070673_100001939
1653 Ga0070659_100017972
1654 Ga0070659_100090976
1655 Ga0070659_100103946
1656 Ga0070659_100449652
1657 Ga0070659_100524099
1658 Ga0070659_100945611
1659 Ga0070663_100000005
1660 Ga0070663_100239347
1661 Ga0070663_100284811
1662 Ga0070663_100316916
1663 Ga0070678_100018668
1664 Ga0070662_100034505
1665 Ga0070662_100652030
1666 Ga0070707_100207551
1667 Ga0070698_100297198
1668 Ga0070679_100372878
1669 Ga0068853_100284928
1670 Ga0070672_100551079
1671 Ga0070672_101712645
1672 Ga0070686_100210901
1673 Ga0068855_100003718
1674 Ga0068855_100012359
1675 Ga0068855_100090319
1676 Ga0068855_100183645
1677 Ga0070664_100000001
1678 Ga0070664_100003539
1679 Ga0068857_100003843
1680 Ga0068857_100005647
1681 Ga0068857_100039882
1682 Ga0068854_100000053
1683 Ga0068854_100021985
1684 Ga0068856_100000231
1685 Ga0068856_100007831
1686 Ga0068856_100217023
1687 Ga0070702_101711763
1688 Ga0068852_100182808
1689 Ga0068852_100413799
1690 Ga0068861_100031177
1691 Ga0068851_10708831
1692 Ga0075368_10071612
1693 Ga0075368_10129957
1694 Ga0075363_100061412
1695 Ga0075363_100479258
1696 Ga0075364_10061472
1697 Ga0070712_101907684
1698 Ga0075362_10035105
1699 Ga0075362_10093475
1700 Ga0075362_10110439
1701 Ga0075367_10217457
1702 Ga0075369_10120710
1703 Ga0075369_10292300
1704 Ga0075366_10021260
1705 Ga0075366_10176954
1706 Ga0075366_10248260
1707 Ga0075366_10547446
1708 Ga0075370_10058074
1709 Ga0075370_10153835
1710 Ga0068871_100233789
1711 Ga0068871_100920198
1712 Ga0099823_1000025
1713 Ga0099826_10000003
1714 Ga0099826_10000004
1715 Ga0105251_10000613
1716 Ga0105251_10047899
1717 Ga0105251_10242518
1718 Ga0105244_10021030
1719 Ga0105250_10098852
1720 Ga0105250_10166943
1721 Ga0105240_10040516
1722 Ga0105240_10051776
1723 Ga0105240_10123664
1724 Ga0105240_10201255
1725 Ga0105240_10227436
1726 Ga0105240_10397680
1727 Ga0105240_10468027
1728 Ga0105240_10955340
1729 Ga0105240_11305901
1730 Ga0105240_11500253
1731 Ga0105245_10314668
1732 Ga0105245_11337632
1733 Ga0105245_11759005
1734 Ga0105247_10212030
1735 Ga0105243_10251478
1736 Ga0105241_10031803
1737 Ga0105241_10438281
1738 Ga0105241_12438363
1739 Ga0105242_10241626
1740 Ga0105242_11222900
1741 Ga0105248_10043671
1742 Ga0105248_11035389
1743 Ga0105237_10031346
1744 Ga0105237_10068073
1745 Ga0105237_10137507
1746 Ga0105237_10664473
1747 Ga0105237_10720454
1748 Ga0105238_10012133
1749 Ga0105238_10099443
1750 Ga0105238_10934015
1751 Ga0105238_10947024
1752 Ga0105249_10310623
1753 Ga0105148_109704
1754 Ga0105239_10001236
1755 Ga0105239_10030565
1756 Ga0105239_10195402
1757 Ga0105239_12059585
1758 Ga0105246_10086273
1759 Ga0157319_1000014
1760 Ga0157373_10012948
1761 Ga0157371_10000166
1762 Ga0157371_10072329
1763 Ga0157370_10000443
1764 Ga0157370_10001406
1765 Ga0157370_10003087
1766 Ga0157370_10225268
1767 Ga0157370_11124084
1768 Ga0157369_10000915
1769 Ga0157369_10001653
1770 Ga0157369_10004199
1771 Ga0157369_10004659
1772 Ga0157369_10038276
1773 Ga0157369_10079668
1774 Ga0157369_10347787
1775 Ga0157369_10429968
1776 Ga0157369_10897750
1777 Ga0157374_10000318
1778 Ga0157374_10498629
1779 Ga0157378_10848557
1780 Ga0157378_11643802
1781 Ga0163162_10007485
1782 Ga0163162_10175886
1783 Ga0163162_11197716
1784 Ga0163162_11571375
1785 Ga0157372_10000136
1786 Ga0157372_10456649
1787 Ga0157372_10917456
1788 Ga0157375_10122896
1789 Ga0157375_10161184
1790 Ga0157375_12954899
1791 Ga0157380_12108386
1792 Ga0182008_10011833
1793 Ga0182008_10113786
1794 Ga0157379_10074489
1795 Ga0157379_11300804
1796 Ga0157376_10639828
1797 Ga0157376_10769286
1798 Ga0157376_11138688
1799 Ga0157376_12958383
1800 Ga0182006_1000014
1801 Ga0182006_1000044
1802 Ga0182006_1047827
1803 Ga0182006_1141884
1804 Ga0182006_1285557
1805 Ga0182007_10000011
1806 Ga0182007_10004988
1807 Ga0182007_10007471
1808 Ga0182007_10057280
1809 Ga0182007_10107671
1810 Ga0182005_1000014
1811 Ga0182005_1000018
1812 Ga0182005_1270372
1813 Ga0183361_10010
1814 Ga0163161_10025614
1815 Ga0163161_10583198
1816 Ga0206356_10591058
1817 Ga0206356_11543095
1818 Ga0206351_10664851
1819 Ga0206350_10140646
1820 Ga0206354_10274888
1821 Ga0206354_11040010
1822 Ga0206354_11436006
1823 Ga0206353_10492142
1824 Ga0154015_1690951
1825 Ga0213872_10000002
1826 Ga0213872_10001750
1827 Ga0213872_10016189
1828 Ga0213872_10023996
1829 Ga0213872_10097361
1830 Ga0224712_10000188
1831 Ga0209435_103067
1832 Ga0209436_100115
1833 Ga0209436_100800
1834 Ga0209784_100014
1835 Ga0209784_100477
1836 Ga0209566_100011
1837 Ga0209566_100265
1838 Ga0209566_101038
1839 Ga0209674_100013
1840 Ga0209674_100024
1841 Ga0209674_100032
1842 Ga0209674_100174
1843 Ga0209674_100178
1844 Ga0209674_112437
1845 Ga0209672_100010
1846 Ga0209672_100224
1847 Ga0209672_100790
1848 Ga0209147_100002
1849 Ga0209147_100006
1850 Ga0209563_100029
1851 Ga0209563_100101
1852 Ga0209563_100112
1853 Ga0209563_100759
1854 Ga0207427_100988
1855 Ga0207427_101051
1856 Ga0209258_100002
1857 Ga0209258_100010
1858 Ga0209258_100180
1859 Ga0207425_1000006
1860 Ga0207425_1000060
1861 Ga0207425_1000121
1862 Ga0207425_1000643
1863 Ga0207425_1068932
1864 Ga0209646_1000012
1865 Ga0209646_1000058
1866 Ga0209646_1000117
1867 Ga0209026_1000004
1868 Ga0209026_1004499
1869 Ga0209026_1016869
1870 Ga0209677_100042
1871 Ga0209677_100091
1872 Ga0209677_100444
1873 Ga0209148_1000018
1874 Ga0209148_1000043
1875 Ga0209148_1007495
1876 Ga0209148_1014570
1877 Ga0209759_1000003
1878 Ga0209759_1000067
1879 Ga0209759_1000250
1880 Ga0209759_1000690
1881 Ga0209759_1001659
1882 Ga0209759_1001680
1883 Ga0209759_1001753
1884 Ga0209759_1004352
1885 Ga0209759_1007040
1886 Ga0209759_1010465
1887 Ga0209759_1012740
1888 Ga0209759_1013020
1889 Ga0209759_1013514
1890 Ga0209759_1018672
1891 Ga0209759_1020484
1892 Ga0209759_1049688
1893 Ga0209129_1000012
1894 Ga0209129_1000090
1895 Ga0209129_1012454
1896 Ga0209233_1000171
1897 Ga0209565_1000136
1898 Ga0209565_1000701
1899 Ga0209565_1001948
1900 Ga0209565_1003331
1901 Ga0209565_1010449
1902 Ga0209565_1023551
1903 Ga0209565_1025585
1904 Ga0209455_1000009
1905 Ga0209455_1000015
1906 Ga0209455_1000144
1907 Ga0209455_1023527
1908 Ga0209673_1006814
1909 Ga0209673_1015062
1910 Ga0209673_1017937
1911 Ga0209673_1018153
1912 Ga0209673_1054987
1913 Ga0209130_1000549
1914 Ga0209130_1001125
1915 Ga0209130_1004098
1916 Ga0209675_1000109
1917 Ga0209675_1000543
1918 Ga0209675_1000696
1919 Ga0209675_1002362
1920 Ga0209675_1012457
1921 Ga0209675_1013226
1922 Ga0209676_1000066
1923 Ga0209025_1000297
1924 Ga0209025_1000471
1925 Ga0209025_1002549
1926 Ga0209025_1004566
1927 Ga0209025_1021606
1928 Ga0209025_1084242
1929 Ga0209564_1000006
1930 Ga0209564_1000022
1931 Ga0209564_1000038
1932 Ga0209564_1000120
1933 Ga0209564_1000134
1934 Ga0209564_1000930
1935 Ga0209564_1001068
1936 Ga0209564_1001159
1937 Ga0209564_1002583
1938 Ga0209564_1008285
1939 Ga0209564_1014011
1940 Ga0209758_1000047
1941 Ga0209758_1000099
1942 Ga0209758_1002119
1943 Ga0209758_1006257
1944 Ga0209758_1011730
1945 Ga0209050_1000085
1946 Ga0209050_1000092
1947 Ga0209050_1000607
1948 Ga0209256_1000005
1949 Ga0209256_1000080
1950 Ga0209256_1000391
1951 Ga0209256_1000423
1952 Ga0209256_1000514
1953 Ga0209256_1000891
1954 Ga0209256_1001821
1955 Ga0209256_1011835
1956 Ga0209256_1048015
1957 Ga0207426_1000168
1958 Ga0207426_1000939
1959 Ga0209051_1001805
1960 Ga0209051_1002739
1961 Ga0209051_1003564
1962 Ga0209051_1007535
1963 Ga0209051_1031913
1964 Ga0209051_1048662
1965 Ga0209257_1000010
1966 Ga0209257_1001646
1967 Ga0209257_1007880
1968 Ga0209257_1036550
1969 Ga0209257_1058425
1970 Ga0209257_1140409
1971 Ga0207655_1050768
1972 Ga0207713_1000221
1973 Ga0207713_1138306
1974 Ga0207710_10162178
1975 Ga0207647_10000235
1976 Ga0207647_10027219
1977 Ga0207647_10068714
1978 Ga0207647_10069774
1979 Ga0207647_10094535
1980 Ga0207705_10000877
1981 Ga0207705_10019684
1982 Ga0207705_10027646
1983 Ga0207705_10042750
1984 Ga0207705_10164607
1985 Ga0207705_10198259
1986 Ga0207684_10003400
1987 Ga0207654_10036128
1988 Ga0207707_10313565
1989 Ga0207695_10002424
1990 Ga0207695_10021377
1991 Ga0207695_10237409
1992 Ga0207695_10384423
1993 Ga0207695_10729247
1994 Ga0207695_10993195
1995 Ga0207695_11091809
1996 Ga0207671_10017995
1997 Ga0207671_10142513
1998 Ga0207657_10004545
1999 Ga0207657_10024983
2000 Ga0207657_10102896
2001 Ga0207657_10108209
2002 Ga0207657_10113488
2003 Ga0207649_10000767
2004 Ga0207649_10051414
2005 Ga0207649_10357548
2006 Ga0207646_10270899
2007 Ga0207694_10018099
2008 Ga0207694_10088375
2009 Ga0207694_10628954
2010 Ga0207694_10756364
2011 Ga0207650_10503362
2012 Ga0207687_10337819
2013 Ga0207690_10002010
2014 Ga0207690_10005506
2015 Ga0207690_10047000
2016 Ga0207706_10613780
2017 Ga0207686_10149793
2018 Ga0207709_10015880
2019 Ga0207709_10093087
2020 Ga0207669_10269798
2021 Ga0207669_11184820
2022 Ga0207691_10388758
2023 Ga0207691_10639137
2024 Ga0207711_10212751
2025 Ga0207711_10227391
2026 Ga0207711_10287985
2027 Ga0207689_10029736
2028 Ga0207689_10671918
2029 Ga0207679_10000003
2030 Ga0207679_10769737
2031 Ga0207667_10006855
2032 Ga0207667_10008611
2033 Ga0207667_10024020
2034 Ga0207667_10073351
2035 Ga0207651_10001113
2036 Ga0207712_10130986
2037 Ga0207712_10666536
2038 Ga0207640_10000045
2039 Ga0207640_10011738
2040 Ga0207640_11984894
2041 Ga0207658_10087257
2042 Ga0207658_10515297
2043 Ga0207703_10478976
2044 Ga0207678_10000066
2045 Ga0207678_10047833
2046 Ga0207678_10083608
2047 Ga0207678_10186184
2048 Ga0207702_10000046
2049 Ga0207702_10000441
2050 Ga0207641_11968427
2051 Ga0207648_10053939
2052 Ga0207648_10226779
2053 Ga0207674_10008487
2054 Ga0207674_10030387
2055 Ga0207674_12226323
2056 Ga0207675_100047428
2057 Ga0207683_10045376
2058 Ga0207683_10302540
2059 Ga0207698_10018388
2060 Ga0207698_10082864
2061 Ga0207698_10132809
2062 Ga0207698_10371888
2063 Ga0209281_1006315
2064 Ga0209389_1000215
2065 Ga0209371_1040084
2066 Ga0209282_1000002
2067 Ga0209282_1000015
2068 Ga0209813_10003421
2069 Ga0209813_10071833
2070 Ga0265336_10000030
2071 Ga0307515_10181931
2072 Ga0307515_10198844
2073 Ga0265338_10002898
2074 Ga0265324_10001915
2075 Ga0268256_1043732
2076 Ga0307511_10074414
2077 Ga0316181_1194924
2078 Ga0265332_10009285
2079 Ga0307513_10014326
2080 Ga0307513_10097695
2081 Ga0307513_10184767
2082 Ga0307513_10458191
2083 Ga0307509_10069059
2084 Ga0307408_100000094
2085 Ga0307408_100003675
2086 Ga0307408_100006659
2087 Ga0307408_100026247
2088 Ga0307408_100188298
2089 Ga0307508_10189752
2090 Ga0307516_10000243
2091 Ga0307516_10288354
2092 Ga0307516_10387529
2093 Ga0307405_11521394
2094 Ga0307412_10000005
2095 Ga0307412_10051239
2096 Ga0307416_101721719
2097 Ga0307416_102194400
2098 Ga0307414_10029054
2099 Ga0373931_0002323
2100 Ga0373935_0774597
2101 Ga0395899_0000038
2102 Ga0395899_0117018
2103 Ga0395899_0129110
2104 Ga0395900_0000030
2105 Ga0395900_0000635
2106 Ga0395900_0015170
2107 Ga0395900_0020101
2108 Ga0395900_0022211
2109 Ga0395900_0093459
2110 Ga0395900_0122514
2111 Ga0395900_0236011
2112 Ga0395900_0477327
2113 Ga0395900_0501322
2114 Ga0395898_0000409
2115 Ga0395898_0001892
2116 Ga0395898_0002803
2117 Ga0395898_0020217
2118 Ga0395898_0186134
2119 Ga0395898_0747289
2120 Ga0395905_0127537
2121 Ga0395905_0340692
2122 Ga0395905_0372552
2123 Ga0395905_0560342
2124 Ga0395905_0895946
2125 Ga0395901_0000002
2126 Ga0395901_0000079
2127 Ga0395901_0000417
2128 Ga0395901_0019482
2129 Ga0395901_0131340
2130 Ga0395901_0443625
2131 Ga0395901_0652458
2132 Ga0395901_0790673
2133 Ga0395901_0790688
2134 Ga0395901_0804968
2135 Ga0436361_0066851
2136 Ga0436361_0159514
2137 Ga0436361_0288163
2138 Ga0436361_0387618
2139 Ga0436361_0606288
2140 Ga0436361_0857672
2141 Ga0436361_1030117
2142 Ga0439447_122734
2143 Ga0451791_1363756
2144 Ga0451793_1592340
2145 Ga0451795_0900595
2146 Ga0451800_1276591
2147 Ga0451807_1089216
2148 Ga0439448_0001219
2149 Ga0439452_037558
2150 Ga0439454_019529
2151 Ga0439455_0038251
2152 Ga0450890_002996
2153 Ga0439459_0018219
2154 Ga0439459_0207427
2155 Ga0466969_0012490
2156 Ga0466969_0021179
2157 Ga0466969_0028576
2158 Ga0466972_0023444
2159 Ga0466972_0026700
2160 Ga0466980_0248756
2161 Ga0466982_0266780
2162 Ga0466965_0003708
2163 Ga0466965_0071148
2164 Ga0466965_0130363
2165 Ga0466965_0182475
2166 Ga0466966_0000299
2167 Ga0466966_0003017
2168 Ga0466966_0016434
2169 Ga0466966_0045678
2170 Ga0466961_0000307
2171 Ga0466961_0005429
2172 Ga0466961_0006431
2173 Ga0466961_0035061
2174 Ga0466961_0081243
2175 Ga0466961_0378019
2176 Ga0466963_0001629
2177 Ga0466963_0027662
2178 Ga0466963_0094851
2179 Ga0466963_0220562
2180 Ga0466963_0315933
2181 Ga0466963_0610041
2182 Ga0466964_0007830
2183 Ga0466964_0008034
2184 Ga0466964_0008396
2185 Ga0466964_0011635
2186 Ga0466964_0153798
2187 Ga0466971_0002920
2188 Ga0466971_0003619
2189 Ga0466971_0017138
2190 Ga0466971_0063794
2191 Ga0466971_0134845
2192 Ga0466968_0009944
2193 Ga0466968_0016591
2194 Ga0466968_0019407
2195 Ga0466968_0102083
2196 Ga0466970_0012005
2197 Ga0466970_0033852
2198 Ga0466970_0110280
2199 Ga0466970_0136256
2200 Ga0466970_0387416
2201 Ga0466957_0000780
2202 Ga0466957_0001759
2203 Ga0466957_0017595
2204 Ga0466957_0026044
2205 Ga0466957_0031197
2206 Ga0466957_0111611
2207 Ga0466957_0394284
2208 Ga0466957_0526813
2209 Ga0466957_0676686
2210 Ga0466957_0707726
2211 Ga0466960_0028593
2212 Ga0466960_0041919
2213 Ga0466960_0110821
2214 Ga0466960_0197237
2215 Ga0466960_0449996
2216 Ga0466960_0730939
2217 Ga0466959_0025346
2218 Ga0466959_0045432
2219 Ga0466959_0100168
2220 Ga0466959_0196835
2221 Ga0466959_0557464
2222 Ga0451576_0022982
2223 Ga0466958_0033746
2224 Ga0466958_0074813
2225 Ga0466958_0183087
2226 Ga0466958_0279632
2227 Ga0466958_0305817
2228 Ga0466958_0412583
2229 Ga0466958_0566230
2230 Ga0466967_0046322
2231 Ga0466967_0167176
2232 Ga0466967_0227069
2233 Ga0466967_0422913
2234 Ga0466967_0924981
2235 Ga0495617_018791
2236 Ga0495627_000006
2237 Ga0495627_009983
2238 Ga0495592_0122912
2239 Ga0495603_0004927
2240 Ga0495603_0008131
2241 Ga0495603_0040896
2242 Ga0495603_0084133
2243 Ga0495603_0103193
2244 Ga0495603_0155838
2245 Ga0495603_0298916
2246 Ga0495590_0000004
2247 Ga0495590_0002438
2248 Ga0495590_0036518
2249 Ga0495590_0168948
2250 Ga0495590_0318157
2251 Ga0495591_009391
2252 Ga0495591_010258
2253 Ga0495591_035249
2254 Ga0495629_0000279
2255 Ga0495629_0000563
2256 Ga0495629_0006596
2257 Ga0495629_0009087
2258 Ga0495629_0013254
2259 Ga0495629_0025628
2260 Ga0495629_0078906
2261 Ga0495629_0092991
2262 Ga0495638_0000023
2263 Ga0495638_0005843
2264 Ga0495638_0011661
2265 Ga0495638_0053201
2266 Ga0495638_0085824
2267 Ga0495638_0123060
2268 Ga0495641_0015985
2269 Ga0495641_0019962
2270 Ga0495651_0074831
2271 Ga0495651_0083042
2272 Ga0495651_0245876
2273 Ga0495651_0288024
2274 Ga0495651_0526744
2275 Ga0495651_0590644
2276 Ga0495653_0000073
2277 Ga0495653_0025396
2278 Ga0495653_0026168
2279 Ga0495653_0083143
2280 Ga0495653_0142004
2281 Ga0495653_0456779
2282 Ga0495653_0458920
2283 Ga0495653_0460557
2284 Ga0495653_0726345
2285 Ga0495650_0002253
2286 Ga0495650_0003455
2287 Ga0495650_0005800
2288 Ga0495650_0006351
2289 Ga0495650_0008716
2290 Ga0495650_0011718
2291 Ga0495650_0045144
2292 Ga0495650_0045990
2293 Ga0495580_0006203
2294 Ga0495580_0008054
2295 Ga0495580_0008534
2296 Ga0495580_0010580
2297 Ga0495580_0030181
2298 Ga0495580_0055923
2299 Ga0495580_0093181
2300 Ga0495580_0216286
2301 Ga0495580_0302305
2302 Ga0495580_0382586
2303 Ga0495582_0001146
2304 Ga0495582_0002688
2305 Ga0495582_0040435
2306 Ga0495582_0171505
2307 Ga0495605_0003732
2308 Ga0495605_0008524
2309 Ga0495605_0017979
2310 Ga0495605_0020324
2311 Ga0495605_0020489
2312 Ga0495605_0032049
2313 Ga0495605_0057473
2314 Ga0495605_0239400
2315 Ga0495639_0008549
2316 Ga0495662_0097766
2317 Ga0495662_0247409
2318 Ga0495662_0307679
2319 Ga0495664_0042180
2320 Ga0495664_0128938
2321 Ga0495664_0162940
2322 Ga0495664_0248564
2323 Ga0495664_0263307
2324 Ga0495584_0000010
2325 Ga0495584_0014014
2326 Ga0495584_0050495
2327 Ga0495584_0073366
2328 Ga0495584_0114116
2329 Ga0495584_0125358
2330 Ga0495584_0125651
2331 Ga0495584_0198491
2332 Ga0495584_0369805
2333 Ga0495585_0000006
2334 Ga0495585_0000592
2335 Ga0495585_0002955
2336 Ga0495585_0005077
2337 Ga0495585_0006007
2338 Ga0495585_0024333
2339 Ga0495585_0024548
2340 Ga0495585_0030907
2341 Ga0495585_0045573
2342 Ga0495585_0124151
2343 Ga0495585_0271158
2344 Ga0495594_0022591
2345 Ga0495594_0071495
2346 Ga0495594_0145158
2347 Ga0495594_0167425
2348 Ga0495596_0000130
2349 Ga0495596_0000217
2350 Ga0495596_0003683
2351 Ga0495596_0010643
2352 Ga0495596_0013769
2353 Ga0495596_0022683
2354 Ga0495596_0026364
2355 Ga0495596_0059867
2356 Ga0495596_0068491
2357 Ga0495596_0168862
2358 Ga0495596_0422808
2359 Ga0495607_0005534
2360 Ga0495607_0087201
2361 Ga0495607_0124886
2362 Ga0495607_0179754
2363 Ga0495607_0297101
2364 Ga0495583_0000022
2365 Ga0495583_0000084
2366 Ga0495583_0001091
2367 Ga0495583_0006475
2368 Ga0495583_0006797
2369 Ga0495583_0026425
2370 Ga0495583_0052075
2371 Ga0495583_0055627
2372 Ga0495583_0306438
2373 Ga0495606_0000146
2374 Ga0495606_0000481
2375 Ga0495606_0003434
2376 Ga0495606_0006469
2377 Ga0495606_0009349
2378 Ga0495606_0011574
2379 Ga0495606_0025138
2380 Ga0495606_0040833
2381 Ga0495606_0084648
2382 Ga0495606_0108621
2383 Ga0495606_0108962
2384 Ga0495606_0157058
2385 Ga0495606_0174082
2386 Ga0495606_0176477
2387 Ga0495606_0190639
2388 Ga0495606_0219485
2389 Ga0495606_0265264
2390 Ga0495606_0369688
2391 Ga0495608_0003296
2392 Ga0495608_0030234
2393 Ga0495608_0186679
2394 Ga0495610_0001665
2395 Ga0495610_0009630
2396 Ga0495610_0235732
2397 Ga0495616_0000081
2398 Ga0495616_0004477
2399 Ga0495616_0017067
2400 Ga0495616_0032792
2401 Ga0495616_0046172
2402 Ga0495616_0146898
2403 Ga0495616_0179091
2404 Ga0495616_0288432
2405 Ga0495618_0002752
2406 Ga0495618_0017958
2407 Ga0495618_0044222
2408 Ga0495618_0437047
2409 Ga0495620_0012489
2410 Ga0495620_0022595
2411 Ga0495620_0037749
2412 Ga0495620_0058502
2413 Ga0495620_0165228
2414 Ga0495628_0008594
2415 Ga0495628_0009845
2416 Ga0495628_0034723
2417 Ga0495628_0043098
2418 Ga0495628_0066840
2419 Ga0495628_0185794
2420 Ga0495628_0378287
2421 Ga0495630_0018208
2422 Ga0495630_0020381
2423 Ga0495630_0051641
2424 Ga0495630_0074286
2425 Ga0495630_0338178
2426 Ga0495630_0780126
2427 Ga0495631_0000208
2428 Ga0495631_0124667
2429 Ga0495631_0131839
2430 Ga0495631_0212809
2431 Ga0495631_0241001
2432 Ga0495631_0241999
2433 Ga0495631_0360320
2434 Ga0495632_0018729
2435 Ga0495632_0353997
2436 Ga0495637_0001186
2437 Ga0495637_0011421
2438 Ga0495637_0051480
2439 Ga0495637_0342652
2440 Ga0495643_0000211
2441 Ga0495643_0000756
2442 Ga0495643_0021824
2443 Ga0495643_0022539
2444 Ga0495643_0071638
2445 Ga0495643_0106501
2446 Ga0495643_0161414
2447 Ga0495644_0016744
2448 Ga0495648_0000007
2449 Ga0495648_0000025
2450 Ga0495648_0021630
2451 Ga0495648_0043999
2452 Ga0495648_0052853
2453 Ga0495648_0067713
2454 Ga0495648_0114686
2455 Ga0495648_0130412
2456 Ga0495648_0159776
2457 Ga0495663_0111080
2458 Ga0495666_0002705
2459 Ga0495666_0002913
2460 Ga0495666_0024903
2461 Ga0495666_0036993
2462 Ga0495666_0041441
2463 Ga0495666_0063106
2464 Ga0495666_0087931
2465 Ga0495666_0129885
2466 Ga0495666_0131273
2467 Ga0495642_0002601
2468 Ga0495642_0009199
2469 Ga0495642_0009287
2470 Ga0495642_0012265
2471 Ga0495642_0019027
2472 Ga0495642_0028204
2473 Ga0495642_0037685
2474 Ga0495642_0041872
2475 Ga0495642_0069420
2476 Ga0495642_0119897
2477 Ga0495642_0150959
2478 Ga0495642_0197584
2479 Ga0495652_0018489
2480 Ga0495652_0054629
2481 Ga0495652_0109457
2482 Ga0495652_0148408
2483 Ga0495654_0000004
2484 Ga0495654_0036250
2485 Ga0495654_0330191
2486 Ga0495665_0002211
2487 Ga0495665_0003419
2488 Ga0495665_0043238
2489 Ga0495665_0061152
2490 Ga0495665_0170139
2491 Ga0495640_0028116
2492 Ga0495640_0031753
2493 Ga0495586_0032926
2494 Ga0495586_0123580
2495 Ga0495586_0135098
2496 Ga0495587_0005576
2497 Ga0495587_0016817
2498 Ga0495609_0010639
2499 Ga0495609_0011751
2500 Ga0495609_0012503
2501 Ga0495609_0020009
2502 Ga0495609_0020469
2503 Ga0495609_0030212
2504 Ga0495609_0030238
2505 Ga0495621_0184827
2506 Ga0495597_0002183
2507 Ga0495597_0008764
2508 Ga0495597_0009805
2509 Ga0495597_0018818
2510 Ga0495597_0035987
2511 Ga0495597_0054091
2512 Ga0495597_0054422
2513 Ga0495597_0069182
2514 Ga0495597_0107813
2515 Ga0495597_0141266
2516 Ga0495597_0271471
2517 Ga0495597_0318418
2518 Ga0495645_0001779
2519 Ga0495645_0004217
2520 Ga0495645_0152633
2521 Ga0495645_0184074
2522 Ga0495622_0000003
2523 Ga0495622_0000432
2524 Ga0495622_0001785
2525 Ga0495622_0019441
2526 Ga0495622_0078147
2527 Ga0495622_0115643
2528 Ga0495622_0152852
2529 Ga0495633_0000045
2530 Ga0495633_0000449
2531 Ga0495633_0004052
2532 Ga0495633_0008175
2533 Ga0495633_0016254
2534 Ga0495633_0023418
2535 Ga0495633_0036019
2536 Ga0495633_0047683
2537 Ga0495633_0130117
2538 Ga0495633_0227990
2539 Ga0495633_0235739
2540 Ga0495633_0294382
2541 Ga0495633_0526631
2542 Ga0495667_0030516
2543 Ga0495667_0057970
2544 Ga0495667_0063113
2545 Ga0495656_0005184
2546 Ga0495656_0101385
2547 Ga0495656_0246033
2548 Ga0495656_0507584
2549 Ga0495668_0000158
2550 Ga0495668_0000205
2551 Ga0495668_0008636
2552 Ga0495668_0009520
2553 Ga0495668_0016793
2554 Ga0495668_0018505
2555 Ga0495668_0038447
2556 Ga0495668_0101815
2557 Ga0495634_0026937
2558 Ga0495634_0055546
2559 Ga0495634_0058400
2560 Ga0495634_0086232
2561 Ga0495634_0483915
2562 Ga0495611_0006859
2563 Ga0495611_0030690
2564 Ga0495611_0053541
2565 Ga0495611_0109507
2566 Ga0495611_0126832
2567 Ga0495611_0151565
2568 Ga0495611_0220200
2569 Ga0495611_0314379
2570 Ga0495625_0000073
2571 Ga0495625_0013883
2572 Ga0495625_0026311
2573 Ga0495625_0036776
2574 Ga0495625_0061508
2575 Ga0495625_0089442
2576 Ga0495625_0102439
2577 Ga0495625_0479119
2578 Ga0495635_0004239
2579 Ga0495635_0030479
2580 Ga0495635_0191713
2581 Ga0495635_0284179
2582 Ga0495635_0401851
2583 Ga0495659_0000250
2584 Ga0495659_0233617
2585 Ga0495661_0013093
2586 Ga0495661_0019974
2587 Ga0495661_0033704
2588 Ga0495661_0033914
2589 Ga0495661_0044040
2590 Ga0495661_0046634
2591 Ga0495661_0077127
2592 Ga0495661_0103770
2593 Ga0495661_0120156
2594 Ga0495661_0139153
2595 Ga0495661_0164413
2596 Ga0495661_0324669
2597 Ga0495661_0599165
2598 Ga0495588_0027782
2599 Ga0495588_0179592
2600 Ga0495588_0195636
2601 Ga0495588_0232625
2602 Ga0495588_0391563
2603 Ga0495657_0011467
2604 Ga0495657_0154368
2605 Ga0495599_0012590
2606 Ga0495599_0015011
2607 Ga0495599_0030049
2608 Ga0495599_0034887
2609 Ga0495599_0249800
2610 Ga0495623_0005391
2611 Ga0495623_0007426
2612 Ga0495623_0027621
2613 Ga0495623_0043435
2614 Ga0495623_0173658
2615 Ga0495623_0690275
2616 Ga0495646_0003824
2617 Ga0495646_0038580
2618 Ga0495646_0041384
2619 Ga0495646_0064775
2620 Ga0495646_0073596
2621 Ga0495646_0182203
2622 Ga0495646_0338788
2623 Ga0495646_0393492
2624 Ga0495669_0004997
2625 Ga0495669_0007819
2626 Ga0495669_0040783
2627 Ga0495669_0062829
2628 Ga0495669_0084090
2629 Ga0495669_0136084
2630 Ga0495669_0158745
2631 Ga0495669_0167025
2632 Ga0495669_0189342
2633 Ga0495669_0603204
2634 Ga0495613_0008036
2635 Ga0495613_0036856
2636 Ga0495613_0078560
2637 Ga0495613_0156840
2638 Ga0495613_0262704
2639 Ga0495624_0007582
2640 Ga0495624_0017620
2641 Ga0495624_0040236
2642 Ga0495624_0092647
2643 Ga0495624_0124618
2644 Ga0495624_0194622
2645 Ga0495624_0236449
2646 Ga0495624_0241696
2647 Ga0495624_0623162
2648 Ga0495670_0009539
2649 Ga0495670_0011171
2650 Ga0495670_0015184
2651 Ga0495670_0019038
2652 Ga0495670_0071596
2653 Ga0495670_0083496
2654 Ga0495670_0184302
2655 Ga0495670_0195580
2656 Ga0495670_0555114
2657 Ga0495671_0000761
2658 Ga0495671_0001979
2659 Ga0495671_0007787
2660 Ga0495671_0095005
2661 Ga0495671_0133949
2662 Ga0495671_0145895
2663 Ga0495671_0310560
2664 Ga0495649_0000276
2665 Ga0495649_0003671
2666 Ga0495649_0025840
2667 Ga0495649_0038247
2668 Ga0495649_0104497
2669 Ga0495649_0129948
2670 Ga0495649_0148445
2671 Ga0495649_0157038
2672 Ga0495649_0160593
2673 Ga0495649_0418563
2674 Ga0495589_0005791
2675 Ga0495589_0016119
2676 Ga0495589_0029553
2677 Ga0495589_0046207
2678 Ga0495589_0079649
2679 Ga0495589_0086924
2680 Ga0495589_0089099
2681 Ga0495589_0126772
2682 Ga0495589_0130050
2683 Ga0495589_0151419
2684 Ga0495589_0165503
2685 Ga0495589_0216334
2686 Ga0495600_0014556
2687 Ga0495600_0017898
2688 Ga0495600_0140189
2689 Ga0495600_0232660
2690 Ga0495660_0000081
2691 Ga0495660_0009328
2692 Ga0495660_0054134
2693 Ga0495660_0060144
2694 Ga0495660_0251339
2695 Ga0495660_0358665
2696 Ga0495660_0454069
2697 Ga0495660_0472186
2698 Ga0495581_0008018
2699 Ga0495581_0010818
2700 Ga0495581_0016951
2701 Ga0495581_0027086
2702 Ga0495581_0142715
2703 Ga0495604_0006383
2704 Ga0495604_0036919
2705 Ga0495604_0069432
2706 Ga0495604_0153634
2707 Ga0495604_0405199
2708 Ga0495604_0696021
2709 Ga0495636_0004977
2710 Ga0495636_0005572
2711 Ga0495636_0108178
2712 Ga0495636_0133101
2713 Ga0495674_0004003
2714 Ga0495674_0017880
2715 Ga0495674_0038225
2716 Ga0495674_0083527
2717 Ga0495674_0110061
2718 Ga0495674_0214426
2719 Ga0495674_0456906
2720 Ga0495674_0711387
2721 Ga0495672_0040026
2722 Ga0495672_0040280
2723 Ga0495672_0113324
2724 Ga0495672_0122167
2725 Ga0495672_0193423
2726 Ga0495672_0221111
2727 Ga0495676_0006099
2728 Ga0495676_0011233
2729 Ga0495676_0018695
2730 Ga0495676_0071732
2731 Ga0495676_0143013
2732 Ga0495676_0328624
2733 Ga0495676_0371813
2734 Ga0495680_0010421
2735 Ga0495680_0011158
2736 Ga0495680_0048393
2737 Ga0495680_0132365
2738 Ga0495680_0221206
2739 Ga0495680_0750764
2740 Ga0495683_0002992
2741 Ga0495683_0005648
2742 Ga0495683_0009187
2743 Ga0495683_0023474
2744 Ga0495683_0023907
2745 Ga0495683_0027257
2746 Ga0495683_0031015
2747 Ga0495683_0035808
2748 Ga0495683_0090624
2749 Ga0495683_0108002
2750 Ga0495683_0147086
2751 Ga0495683_0161978
2752 Ga0495683_0347693
2753 Ga0495687_000015
2754 Ga0495687_000703
2755 Ga0495687_003807
2756 Ga0495687_035581
2757 Ga0495687_052036
2758 Ga0495687_119400
2759 Ga0495675_0022205
2760 Ga0495675_0027518
2761 Ga0495675_0033854
2762 Ga0495675_0037010
2763 Ga0495675_0044172
2764 Ga0495675_0116659
2765 Ga0495675_0216270
2766 Ga0495677_0009102
2767 Ga0495677_0018720
2768 Ga0495677_0021879
2769 Ga0495677_0043716
2770 Ga0495677_0197085
2771 Ga0495679_000058
2772 Ga0495679_003493
2773 Ga0495679_004506
2774 Ga0495679_004663
2775 Ga0495679_130564
2776 Ga0495685_028362
2777 Ga0495685_044630
2778 Ga0495685_073207
2779 Ga0495685_078709
2780 Ga0495685_136254
2781 Ga0495685_161297
2782 Ga0495673_0000014
2783 Ga0495673_0009245
2784 Ga0495673_0033923
2785 Ga0495673_0056533
2786 Ga0495673_0070471
2787 Ga0495673_0095351
2788 Ga0495673_0367097
2789 Ga0495681_0014507
2790 Ga0495681_0022135
2791 Ga0495681_0031277
2792 Ga0495681_0045275
2793 Ga0495681_0057538
2794 Ga0495681_0103220
2795 Ga0495681_0225880
2796 Ga0495681_0346072
2797 Ga0495684_0014569
2798 Ga0495684_0409269
2799 Ga0495686_0000002
2800 Ga0495686_0002027
2801 Ga0495686_0002626
2802 Ga0495686_0009213
2803 Ga0495686_0015629
2804 Ga0495686_0043501
2805 Ga0495686_0121146
2806 Ga0495686_0351981
2807 Ga0495593_0007628
2808 Ga0495593_0009907
2809 Ga0495593_0029339
2810 Ga0495593_0032540
2811 Ga0495593_0281630
2812 Ga0495593_0354882
2813 Ga0495602_0014101
2814 Ga0495602_0031078
2815 Ga0495602_0075255
2816 Ga0495602_0281950
2817 Ga0495614_0002618
2818 Ga0495614_0026651
2819 Ga0495614_0030921
2820 Ga0495615_0078428
2821 Ga0495615_0110410
2822 Ga0495615_0154636
2823 Ga0495626_0002629
2824 Ga0495626_0003091
2825 Ga0495626_0008898
2826 Ga0495626_0015071
2827 Ga0495626_0015879
2828 Ga0495626_0027278
2829 Ga0495626_0050646
2830 Ga0495626_0066066
2831 Ga0495626_0103365
2832 Ga0495626_0155835
2833 Ga0496100_0007315
2834 Ga0496100_0057163
2835 Ga0496100_0162420
2836 Ga0496100_1064934
2837 Ga0496100_1106222
2838 Ga0496100_1591260
2839 Ga0496101_0010991
2840 Ga0496102_0003454
2841 Ga0496102_0049272
2842 Ga0496102_0115338
2843 Ga0496102_0228425
2844 Ga0496102_0416352
2845 Ga0496102_0683960
2846 Ga0496102_0747976
2847 Ga0496102_0822354
2848 Ga0496103_0002443
2849 Ga0496103_0002839
2850 Ga0496103_0018044
2851 Ga0496103_0021805
2852 Ga0496103_0290430
2853 Ga0496104_0032738
2854 Ga0496104_0116476
2855 Ga0496104_0723781
2856 Ga0496105_0171285
2857 Ga0496105_0370463
2858 Ga0496105_0398045
2859 Ga0496105_0401929
2860 Ga0496106_0126676
2861 Ga0496106_0192405
2862 Ga0496106_0263765
2863 Ga0496106_1278635
2864 Ga0496106_1352333
2865 Ga0496107_0064642
2866 Ga0496107_0097055
2867 Ga0496109_0360698
2868 Ga0496110_0346449
2869 Ga0496111_0091034
2870 Ga0496111_1251254
2871 Ga0496112_0064662
2872 Ga0496112_0615983
2873 Ga0496113_0031452
2874 Ga0496113_0267248
2875 Ga0496114_0020353
2876 Ga0496114_0610460
2877 Ga0496115_0034299
2878 Ga0496115_0058213
2879 Ga0496115_0059184
2880 Ga0496115_0060856
2881 Ga0496115_0165443
2882 Ga0496115_0251265
2883 Ga0496115_0418831
2884 Ga0496115_1046774
2885 Ga0496116_0014948
2886 Ga0496116_0037018
2887 Ga0496116_0043566
2888 Ga0496116_0048072
2889 Ga0496116_0068331
2890 Ga0496116_0138692
2891 Ga0496116_0242852
2892 Ga0496117_0000001
2893 Ga0496117_0002599
2894 Ga0496117_0009401
2895 Ga0496117_0075874
2896 Ga0496117_0159991
2897 Ga0496117_0162108
2898 Ga0496117_0249643
2899 Ga0496118_0000008
2900 Ga0496118_0001593
2901 Ga0496118_0003767
2902 Ga0496118_0011304
2903 Ga0496118_0016240
2904 Ga0496118_0060696
2905 Ga0496118_0074032
2906 Ga0496118_0294397
2907 Ga0496119_0075109
2908 Ga0496119_0176963
2909 Ga0496119_0290605
2910 Ga0496120_0097656
2911 Ga0496120_0134704
2912 Ga0496121_0000585
2913 Ga0496121_0008378
2914 Ga0496121_0018225
2915 Ga0496121_0041402
2916 Ga0496121_0079887
2917 Ga0496121_0118836
2918 Ga0496121_0155484
2919 Ga0496121_0256511
2920 Ga0496121_0442979
2921 Ga0496122_0005391
2922 Ga0496122_0054314
2923 Ga0496122_0121103
2924 Ga0496122_0164614
2925 Ga0496122_0310578
2926 Ga0496122_0368181
2927 Ga0496123_0004753
2928 Ga0496123_0005477
2929 Ga0496124_0021582
2930 Ga0496124_0075917
2931 Ga0496124_0110597
2932 Ga0496124_0272731
2933 Ga0496124_0375266
2934 Ga0496124_0592543
2935 Ga0496124_0639459
2936 Ga0496125_0017813
2937 Ga0496125_0041997
2938 Ga0496125_0295843
2939 Ga0496126_0000031
2940 Ga0496126_0001253
2941 Ga0496126_0004550
2942 Ga0496126_0009676
2943 Ga0496126_0042466
2944 Ga0496126_0107576
2945 Ga0496126_0327178
2946 Ga0496126_0341788
2947 Ga0496126_0534695
2948 Ga0496126_0647774
2949 Ga0496126_0783948
2950 Ga0495678_001532
2951 Ga0495678_003399
2952 Ga0495678_008710
2953 Ga0495678_107475
2954 Ga0495682_0008546
2955 Ga0495682_0010397
2956 Ga0495682_0303781
2957 Ga0501034_0000411
2958 Ga0501227_092717
2959 Ga0501238_014275
2960 Ga0501248_002963
2961 Ga0501225_0166208
2962 Ga0501234_010403
2963 Ga0501241_046813
2964 Ga0501268_048110
2965 Ga0501269_000660
2966 Ga0501272_033103
2967 Ga0501279_002073
2968 Ga0501044_0534293
2969 nmdc:mga03683_240006_c1
2970 nmdc:mga03n38_495539_c1
2971 nmdc:mga00v17_84950_c1
2972 nmdc:mga0yw44_21351_c1
2973 nmdc:mga0k408_19506_c1
2974 nmdc:mga0k408_209721_c1
2975 nmdc:mga0k408_211582_c1
2976 nmdc:mga0k408_306213_c1
2977 nmdc:mga0k408_50565_c1
2978 nmdc:mga06z11_85483_c1
2979 nmdc:mga04h51_82074_c1
2980 nmdc:mga04h51_89050_c1
2981 nmdc:mga07m45_130657_c1
2982 nmdc:mga07m45_4565_c2
2983 nmdc:mga07m45_4733_c1
2984 nmdc:mga07m45_492937_c1
2985 nmdc:mga0sz30_29771_c1
2986 Ga0500635_0000226
2987 Ga0500635_0025833
2988 Ga0495655_0078790
2989 Ga0500643_129867
2990 Ga0500644_0007404
2991 Ga0500646_0030749
2992 Ga0500583_0019904
2993 Ga0500651_0017576
2994 Ga0500651_0122078
2995 Ga0500651_0136325
2996 Ga0500650_0113017
2997 Ga0500593_245263
2998 Ga0500594_0004662
2999 Ga0500594_0044662
3000 Ga0500594_0139058
3001 Ga0500618_008239
3002 Ga0500628_000758
3003 Ga0500642_0032387
3004 Ga0500652_000261
3005 Ga0500655_001572
3006 Ga0500655_010906
3007 Ga0500559_0001032
3008 Ga0500559_0016104
3009 Ga0500577_0229260
3010 Ga0500622_0000147
3011 Ga0500622_0003765
3012 Ga0500622_0022982
3013 Ga0500636_0004666
3014 Ga0500570_098024
3015 Ga0500587_001379
3016 Ga0500661_002129
3017 Ga0590075_026028
3018 Ga0587066_031683
3019 Ga0587077_013631
3020 Ga0587083_0023675
3021 Ga0587101_020361
3022 Ga0587101_139221
3023 Ga0587067_003295
3024 Ga0587069_046067
3025 Ga0587072_004105
3026 Ga0587076_009975
3027 Ga0587102_011261
3028 Ga0587111_0014886
3029 Ga0466962_0004008
3030 Ga0466962_0007729
3031 Ga0466962_0053857
3032 Ga0466962_0082501
3033 2513953143
3034 2514042108
3035 2587725161
3036 2587731478
3037 2588293775
3038 2597029925
3039 2599443785
3040 2643787613
3041 2644144017
3042 2644213504
3043 2644275780
3044 2831868986
3045 2834641593
3046 2881103813
3047 2885267333
3048 2886853422
3049 2900579622
3050 2928062050
3051 2932412500
3052 2932420015
3053 644747189
3054 8003401723

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02142

MGS

MGS-like domain

17

110

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s8a-assembly1.cif.gz_E h98q mutant of methylglyoxal synthase from e. coli complexed with phosphoglycolic acid 0.9842 12 129
1s89-assembly1.cif.gz_F h98n mutant of methylglyoxal synthase from e. coli complexed with phosphoglycolic acid 0.9831 12 129
6f2c-assembly2.cif.gz_G methylglyoxal synthase mgsa from bacillus subtilis 0.9803 11 132
8u2v-assembly1.cif.gz_B crystal structure of methylglyoxal synthase from borrelia burgdorferi 0.9767 11 134
1wo8-assembly1.cif.gz_A crystal structure of methylglyoxal synthase from thermus thermophilus hb8 0.9756 13 137
ID Description Score Start End Superfamily
2xw6C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.9482 13 133 3.40.50.1380
2xw6C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.9187 13 133 3.40.50.1380
5h3lB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.9127 12 139 3.40.50.1380
5h3lB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.8193 12 139 3.40.50.1380
af_Q2FZ72_931_1056_3.40.50.1380 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.8164 12 133 3.40.50.1380
ID Description Score Start End GO Terms
AF-A0A536V772-F1-model_v4 Methylglyoxal synthase (EC 4.2.3.3) 1.003 13 87 GO:0005829
GO:0008929
GO:0019242
AF-R7XRB7-F1-model_v4 Methylglyoxal synthase (MGS) (EC 4.2.3.3) 0.9989 11 133 GO:0005829
GO:0008929
GO:0019242
AF-T1A7T8-F1-model_v4 Methylglyoxal synthase 0.9986 11 78 GO:0005829
GO:0008929
GO:0019242
AF-A0A354CKF6-F1-model_v4 Methylglyoxal synthase 0.9963 14 71 GO:0005829
GO:0008929
GO:0019242
AF-A0A7V1XIV1-F1-model_v4 Methylglyoxal synthase (MGS) (EC 4.2.3.3) 0.9961 13 131 GO:0005829
GO:0008929
GO:0019242

Map