F494579

General Info

Members Datasets Scaffolds Average Seq Length
1528 1053 3056 212

Family's Representative Sequence

Representative Sequence 2124908027|MRS2a_Contig_34|MRS2a_00237370
Length 240
Sequence VSXCXXXXSVSXSNSNDPVRAGRXXIAPXKVXLTMNYQLNFAAVWRXFDTLLAGLCVIGLLMAFALLSKHRALRXLASVYVTVIRNTPILVLILLIYFALPSLGIRLDKIPSFIITLSLYAGAXXTEVXRGGXLSIPKGXREAGLAIGXGEWQVKAYXTVPVMLRNVLPAXSNNFISLFKDTSLAAAIAVPELTYYARKINVESYRVXETWLVTTALYVAACYLIAMMLRYLXQRLAIRR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
99 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
100 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
117 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
118 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
123 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
124 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
125 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
201 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
202 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
203 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
215 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
224 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
225 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
226 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
229 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
230 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
231 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
232 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
233 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
234 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
235 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
236 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
237 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
240 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
241 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
242 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
243 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
244 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
245 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
246 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
247 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
258 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
322 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
323 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
360 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
361 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
378 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
379 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
380 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
381 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
382 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
383 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
384 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
385 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
386 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
387 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
388 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
391 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
394 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
400 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
401 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
402 2509276019 Ensifer aridi TW10 Isolate Nodule
403 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
404 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
405 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
406 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
407 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
408 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
409 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
410 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
411 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
412 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
413 2511231004 Pseudomonas sp. GM102 Isolate Nodule
414 2511231007 Pseudomonas sp. GM18 Isolate Nodule
415 2511231010 Pseudomonas sp. GM25 Isolate Nodule
416 2511231011 Pseudomonas sp. GM30 Isolate Nodule
417 2511231012 Pseudomonas sp. GM33 Isolate Nodule
418 2511231014 Pseudomonas sp. GM48 Isolate Nodule
419 2511231015 Pseudomonas sp. GM49 Isolate Nodule
420 2511231016 Pseudomonas sp. GM50 Isolate Nodule
421 2511231017 Pseudomonas sp. GM55 Isolate Nodule
422 2511231018 Pseudomonas sp. GM60 Isolate Nodule
423 2511231019 Pseudomonas sp. GM67 Isolate Nodule
424 2511231020 Pseudomonas sp. GM74 Isolate Nodule
425 2511231022 Pseudomonas sp. GM79 Isolate Nodule
426 2511231023 Pseudomonas sp. GM80 Isolate Nodule
427 2511231031 Pseudomonas sp. GM16 Isolate Nodule
428 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
429 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
430 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
431 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
432 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
433 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
434 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
435 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
436 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
437 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
438 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
439 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
440 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
441 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
442 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
443 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
444 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
445 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
446 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
447 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
448 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
449 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
450 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
451 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
452 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
453 2516143018 Ensifer sp. BR816 Isolate Nodule
454 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
455 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
456 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
457 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
458 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
459 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
460 2519899620 Rhizobium sp. Pop5 Isolate Nodule
461 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
462 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
463 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
464 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
465 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
466 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
467 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
468 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
469 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
470 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
471 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
472 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
473 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
474 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
475 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
476 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
477 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
478 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
479 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
480 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
481 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
482 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
483 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
484 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
485 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
486 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
487 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
488 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
489 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
490 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
491 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
492 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
493 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
494 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
495 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
496 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
497 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
498 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
499 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
500 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
501 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
502 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
503 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
504 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
505 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
506 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
507 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
508 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
509 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
510 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
511 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
512 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
513 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
514 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
515 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
516 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
517 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
518 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
519 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
520 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
521 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
522 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
523 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
524 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
525 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
526 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
527 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
528 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
529 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
530 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
531 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
532 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
533 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
534 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
535 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
536 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
537 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
538 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
539 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
540 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
541 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
542 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
543 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
544 2643221557 Ensifer sp. Root558 Isolate Unclassified
545 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
546 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
547 2643221610 Ensifer sp. Root74 Isolate Unclassified
548 2643221618 Ensifer sp. Root231 Isolate Unclassified
549 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
550 2643221626 Ensifer sp. Root31 Isolate Unclassified
551 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
552 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
553 2643221655 Ensifer sp. Root1252 Isolate Unclassified
554 2643221659 Ensifer sp. Root127 Isolate Unclassified
555 2643221668 Ensifer sp. Root423 Isolate Unclassified
556 2643221675 Ensifer sp. Root1298 Isolate Unclassified
557 2643221680 Ensifer sp. Root1312 Isolate Unclassified
558 2643221688 Rhizobium sp. Root482 Isolate Unclassified
559 2643221698 Ensifer sp. Root142 Isolate Unclassified
560 2643221712 Ensifer sp. Root258 Isolate Unclassified
561 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
562 2643221726 Ensifer sp. Root954 Isolate Unclassified
563 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
564 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
565 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
566 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
567 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
568 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
569 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
570 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
571 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
572 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
573 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
574 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
575 2718217882 Rhizobium sp. N741 Isolate Nodule
576 2718217927 Rhizobium sp. N324 Isolate Nodule
577 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
578 2718218009 Rhizobium sp. N561 Isolate Nodule
579 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
580 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
581 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
582 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
583 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
584 2718218363 Rhizobium sp. N113 Isolate Nodule
585 2718218365 Rhizobium sp. N731 Isolate Nodule
586 2718218366 Rhizobium sp. N621 Isolate Nodule
587 2718218423 Rhizobium sp. N941 Isolate Nodule
588 2721755514 Rhizobium sp. N6212 Isolate Nodule
589 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
590 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
591 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
592 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
593 2721755809 Rhizobium sp. N541 Isolate Nodule
594 2721755810 Rhizobium sp. N871 Isolate Nodule
595 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
596 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
597 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
598 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
599 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
600 2728369365 Rhizobium sp. N1341 Isolate Nodule
601 2728369397 Rhizobium sp. N1314 Isolate Nodule
602 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
603 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
604 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
605 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
606 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
607 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
608 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
609 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
610 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
611 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
612 2738543024 Aminobacter sp. AP02 Isolate Unclassified
613 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
614 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
615 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
616 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
617 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
618 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
619 2773857670 Pseudomonas sp. 478 Isolate Unclassified
620 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
621 2773857673 Pseudomonas sp. 443 Isolate Unclassified
622 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
623 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
624 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
625 2784132063 Pseudomonas sp. 424 Isolate Unclassified
626 2784132072 Pseudomonas sp. 460 Isolate Unclassified
627 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
628 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
629 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
630 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
631 2791355256 Rhizobium sp. M10 Isolate Nodule
632 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
633 2791355260 Rhizobium sp. L9 Isolate Nodule
634 2791355261 Rhizobium sp. J15 Isolate Nodule
635 2791355262 Rhizobium sp. M1 Isolate Nodule
636 2791355263 Rhizobium chutanense C5 Isolate Nodule
637 2791355264 Rhizobium sp. S9 Isolate Nodule
638 2791355265 Rhizobium sp. H4 Isolate Nodule
639 2791355266 Rhizobium sp. L43 Isolate Nodule
640 2791355267 Rhizobium sp. L18 Isolate Nodule
641 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
642 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
643 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
644 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
645 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
646 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
647 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
648 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
649 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
650 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
651 2802429633 Rhizobium anhuiense J3 Isolate Nodule
652 2802429634 Rhizobium anhuiense S10 Isolate Nodule
653 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
654 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
655 2802429637 Rhizobium anhuiense C15 Isolate Nodule
656 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
657 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
658 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
659 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
660 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
661 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
662 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
663 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
664 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
665 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
666 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
667 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
668 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
669 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
670 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
671 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
672 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
673 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
674 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
675 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
676 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
677 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
678 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
679 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
680 2838048938 Rhizobium pisi 27/80 Isolate Nodule
681 2838061910 Rhizobium phaseoli L15 Isolate Nodule
682 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
683 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
684 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
685 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
686 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
687 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
688 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
689 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
690 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
691 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
692 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
693 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
694 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
695 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
696 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
697 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
698 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
699 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
700 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
701 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
702 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
703 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
704 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
705 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
706 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
707 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
708 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
709 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
710 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
711 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
712 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
713 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
714 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
715 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
716 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
717 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
718 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
719 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
720 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
721 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
722 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
723 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
724 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
725 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
726 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
727 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
728 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
729 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
730 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
731 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
732 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
733 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
734 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
735 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
736 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
737 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
738 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
739 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
740 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
741 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
742 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
743 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
744 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
745 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
746 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
747 2844163670 Ensifer sp. 1H6 Isolate Unclassified
748 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
749 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
750 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
751 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
752 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
753 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
754 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
755 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
756 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
757 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
758 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
759 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
760 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
761 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
762 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
763 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
764 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
765 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
766 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
767 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
768 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
769 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
770 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
771 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
772 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
773 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
774 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
775 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
776 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
777 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
778 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
779 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
780 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
781 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
782 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
783 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
784 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
785 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
786 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
787 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
788 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
789 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
790 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
791 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
792 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
793 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
794 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
795 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
796 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
797 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
798 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
799 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
800 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
801 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
802 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
803 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
804 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
805 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
806 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
807 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
808 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
809 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
810 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
811 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
812 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
813 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
814 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
815 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
816 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
817 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
818 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
819 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
820 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
821 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
822 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
823 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
824 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
825 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
826 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
827 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
828 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
829 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
830 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
831 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
832 2933599457 Rhizobium phaseoli M3 Isolate Nodule
833 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
834 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
835 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
836 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
837 2936381700 Rhizobium chutanense C16 Isolate Unclassified
838 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
839 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
840 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
841 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
842 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
843 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
844 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
845 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
846 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
847 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
848 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
849 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
850 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
851 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
852 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
853 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
854 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
855 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
856 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
857 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
858 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
859 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
860 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
861 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
862 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
863 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
864 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
865 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
866 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
867 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
868 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
869 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
870 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
871 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
872 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
873 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
874 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
875 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
876 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
877 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
878 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
879 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
880 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
881 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
882 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
883 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
884 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
885 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
886 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
887 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
888 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
889 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
890 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
891 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
892 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
893 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
894 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
895 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
896 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
897 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
898 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
899 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
900 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
901 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
902 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
903 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
904 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
905 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
906 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
907 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
908 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
909 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
910 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
911 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
912 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
913 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
914 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
915 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
916 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
917 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
918 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
919 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
920 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
921 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
922 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
923 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
924 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
925 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
926 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
927 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
928 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
929 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
930 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
931 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
932 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
933 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
934 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
935 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
936 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
937 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
938 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
939 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
940 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
941 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
942 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
943 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
944 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
945 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
946 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
947 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
948 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
949 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
950 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
951 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
952 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
953 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
954 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
955 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
956 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
957 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
958 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
959 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
960 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
961 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
962 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
963 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
964 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
965 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
966 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
967 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
968 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
969 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
970 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
971 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
972 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
973 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
974 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
975 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
976 2996887358 Rhizobium sp. R711 Isolate Nodule
977 2996893221 Rhizobium sp. R635 Isolate Nodule
978 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
979 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
980 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
981 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
982 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
983 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
984 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
985 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
986 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
987 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
988 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
989 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
990 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
991 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
992 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
993 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
994 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
995 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
996 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
997 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
998 8005258706 Rhizobium sp. R693 Isolate Nodule
999 8005275841 Rhizobium sp. N4311 Isolate Nodule
1000 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1001 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1002 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1003 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1004 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1005 8005321885 Rhizobium sp. R72 Isolate Nodule
1006 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1007 8005382845 Rhizobium sp. R634 Isolate Nodule
1008 8005395548 Rhizobium sp. R339 Isolate Nodule
1009 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1010 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1011 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1012 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1013 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1014 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1015 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1016 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1017 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1018 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1019 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1020 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1021 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1022 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1023 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
1024 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1025 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1026 8018176218 Rhizobium sp. N122 Isolate Nodule
1027 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1028 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1029 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1030 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1031 8024501048 Rhizobium sp. H4 Isolate Nodule
1032 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
1033 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1034 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1035 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1036 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
1037 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
1038 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
1039 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1040 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1041 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1042 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
1043 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1044 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1045 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1046 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1047 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1048 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1049 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1050 8056382006 Rhizobium croatiense 13T Isolate Nodule
1051 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1052 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1053 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.2
Metatranscriptomes 0
Isolates 42.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 11.65
Nodule 27.62
Rhizoplane 3.8
Rhizosphere 43.91
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_34 2124908027 Bacteria 17902
2 SwRhRL2b_contig_1025407 2162886007 Bacteria 1590
3 JGI24740J21852_10007416 3300001979 Bacteria 4461
4 JGI25156J39149_1000468 3300002705 Bacteria 24309
5 JGI25162J39368_1000013 3300002737 Bacteria 343384
6 JGI25154J39366_1000486 3300002738 Bacteria 20483
7 JGI25154J39366_1014315 3300002738 Bacteria 836
8 JGI25157J39369_1000494 3300002741 Bacteria 24309
9 JGI25163J39215_1000525 3300002771 Bacteria 11261
10 JGI25164J39214_1000005 3300002772 Bacteria 343384
11 JGI25152J39213_1000197 3300002773 Bacteria 40490
12 JGI25152J39213_1015488 3300002773 Bacteria 1502
13 JGI25151J46595_10000472 3300003187 Bacteria 38112
14 JGI25165J46597_1000340 3300003214 Bacteria 54174
15 JGI25165J46597_1000610 3300003214 Bacteria 30465
16 JGI25165J46597_1008934 3300003214 Bacteria 1536
17 JGI25153J46596_10000948 3300003215 Bacteria 17603
18 JGI25153J46596_10003407 3300003215 Bacteria 8907
19 JGI25153J46596_10011358 3300003215 Bacteria 3941
20 rootH1_10037537 3300003316 Bacteria 9848
21 rootH2_10073684 3300003320 Bacteria 1395
22 rootH2_10087052 3300003320 Bacteria 1272
23 rootL2_10004929 3300003322 Bacteria 14890
24 rootL2_10182883 3300003322 Bacteria 1081
25 JGI25160J50197_1004711 3300003354 Bacteria 5842
26 JGI25161J50226_1003205 3300003374 Bacteria 3846
27 Ga0055538_1000130 3300003751 Bacteria 54976
28 Ga0055539_1000173 3300003752 Bacteria 55011
29 Ga0055533_1000177 3300003756 Bacteria 55011
30 Ga0055532_1000171 3300003758 Bacteria 55011
31 Ga0055525_1000244 3300003759 Bacteria 55011
32 Ga0055535_1003932 3300003761 Bacteria 3892
33 Ga0055542_1014809 3300003762 Bacteria 1269
34 Ga0055526_1009475 3300003771 Bacteria 4674
35 Ga0055524_1001942 3300003775 Bacteria 11130
36 Ga0055524_1011492 3300003775 Bacteria 3460
37 Ga0055524_1019621 3300003775 Bacteria 2304
38 Ga0055528_1000475 3300003790 Bacteria 32037
39 Ga0055528_1001747 3300003790 Bacteria 12542
40 Ga0055530_10000002 3300003791 Bacteria 300466
41 Ga0055530_10001684 3300003791 Bacteria 15662
42 Ga0055530_10005707 3300003791 Bacteria 5804
43 Ga0055540_1000009 3300003792 Bacteria 300466
44 Ga0055540_1000096 3300003792 Bacteria 96969
45 Ga0055540_1000236 3300003792 Bacteria 50444
46 Ga0055540_1006624 3300003792 Bacteria 4551
47 Ga0055531_10002872 3300003794 Bacteria 11230
48 Ga0055541_1000115 3300003841 Bacteria 55011
49 Ga0058692_1007015 3300003856 Bacteria 3030
50 Ga0055543_1001197 3300004625 Bacteria 10928
51 Ga0065714_10000197 3300005288 Bacteria 7599
52 Ga0065714_10002523 3300005288 Bacteria 28497
53 Ga0065714_10002696 3300005288 Bacteria 24840
54 Ga0065714_10012489 3300005288 Bacteria 1801
55 Ga0065714_10068233 3300005288 Bacteria 4870
56 Ga0065714_10068369 3300005288 Bacteria 4770
57 Ga0065714_10086694 3300005288 Bacteria 2090
58 Ga0065704_10012815 3300005289 Bacteria 4497
59 Ga0065704_10070326 3300005289 Bacteria 32542
60 Ga0065704_10083205 3300005289 Bacteria 3495
61 Ga0065712_10011348 3300005290 Bacteria 2353
62 Ga0065712_10067891 3300005290 Bacteria 22597
63 Ga0070676_10023480 3300005328 Bacteria 3466
64 Ga0070676_10057979 3300005328 Bacteria 2293
65 Ga0070670_100000613 3300005331 Bacteria 27965
66 Ga0070670_100097767 3300005331 Bacteria 2526
67 Ga0068869_100105989 3300005334 Bacteria 2133
68 Ga0070666_10089273 3300005335 Bacteria 2115
69 Ga0070680_100158639 3300005336 Bacteria 1901
70 Ga0070660_100065289 3300005339 Bacteria 2832
71 Ga0070661_100000252 3300005344 Bacteria 43976
72 Ga0070668_100034545 3300005347 Bacteria 3854
73 Ga0070668_100181761 3300005347 Bacteria 1718
74 Ga0070668_100331913 3300005347 Bacteria 1283
75 Ga0070669_100001585 3300005353 Bacteria 16454
76 Ga0070669_100089237 3300005353 Bacteria 2309
77 Ga0070669_100113805 3300005353 Bacteria 2056
78 Ga0070675_100052395 3300005354 Bacteria 3355
79 Ga0070671_100206529 3300005355 Bacteria 1666
80 Ga0070674_100046055 3300005356 Bacteria 2982
81 Ga0070674_100145520 3300005356 Bacteria 1783
82 Ga0070674_100650008 3300005356 Bacteria 896
83 Ga0070673_100097003 3300005364 Bacteria 2420
84 Ga0070673_100107901 3300005364 Bacteria 2304
85 Ga0070673_100536406 3300005364 Bacteria 1062
86 Ga0070667_100230130 3300005367 Bacteria 1652
87 Ga0070663_100114604 3300005455 Bacteria 2029
88 Ga0070678_100504858 3300005456 Bacteria 1067
89 Ga0070662_100000714 3300005457 Bacteria 20379
90 Ga0070662_100152777 3300005457 Bacteria 1799
91 Ga0070681_10013436 3300005458 Bacteria 8135
92 Ga0070706_100006049 3300005467 Bacteria 11436
93 Ga0070707_100155873 3300005468 Bacteria 2224
94 Ga0070679_100205382 3300005530 Bacteria 1934
95 Ga0070672_100287339 3300005543 Bacteria 1392
96 Ga0070665_100022842 3300005548 Bacteria 6298
97 Ga0070665_100250690 3300005548 Bacteria 1771
98 Ga0070665_100433416 3300005548 Bacteria 1324
99 Ga0068855_100170518 3300005563 Bacteria 2465
100 Ga0070664_100000186 3300005564 Bacteria 43976
101 Ga0068857_100063405 3300005577 Bacteria 3285
102 Ga0068856_100019557 3300005614 Bacteria 6574
103 Ga0068852_100711403 3300005616 Bacteria 1015
104 Ga0068859_100457736 3300005617 Bacteria 1372
105 Ga0068864_100844583 3300005618 Bacteria 902
106 Ga0068866_10087678 3300005718 Bacteria 1687
107 Ga0068866_10418444 3300005718 Bacteria 869
108 Ga0068861_100085337 3300005719 Bacteria 2479
109 Ga0068851_10000045 3300005834 Bacteria 80884
110 Ga0068862_100029896 3300005844 Bacteria 4590
111 Ga0075365_10006047 3300006038 Bacteria 6609
112 Ga0075365_10030678 3300006038 Bacteria 3445
113 Ga0075365_10075310 3300006038 Bacteria 2278
114 Ga0075365_10095450 3300006038 Bacteria 2031
115 Ga0075365_10099179 3300006038 Bacteria 1993
116 Ga0075365_10225166 3300006038 Bacteria 1316
117 Ga0075368_10020035 3300006042 Bacteria 2529
118 Ga0075368_10048320 3300006042 Bacteria 1686
119 Ga0075368_10170937 3300006042 Bacteria 913
120 Ga0075363_100051405 3300006048 Bacteria 2198
121 Ga0075363_100089817 3300006048 Bacteria 1689
122 Ga0075364_10009059 3300006051 Bacteria 5962
123 Ga0075364_10019762 3300006051 Bacteria 4231
124 Ga0075364_10041293 3300006051 Bacteria 2995
125 Ga0075364_10222583 3300006051 Bacteria 1281
126 Ga0075364_10392696 3300006051 Bacteria 946
127 Ga0075362_10004078 3300006177 Bacteria 5206
128 Ga0075362_10029894 3300006177 Bacteria 2351
129 Ga0075362_10040780 3300006177 Bacteria 2045
130 Ga0075362_10048102 3300006177 Bacteria 1902
131 Ga0075362_10065743 3300006177 Bacteria 1647
132 Ga0075367_10010717 3300006178 Bacteria 4826
133 Ga0075367_10110330 3300006178 Bacteria 1688
134 Ga0075369_10055904 3300006186 Bacteria 1715
135 Ga0075369_10165369 3300006186 Bacteria 1014
136 Ga0075369_10189409 3300006186 Bacteria 948
137 Ga0075366_10071283 3300006195 Bacteria 2070
138 Ga0075366_10117236 3300006195 Bacteria 1603
139 Ga0075370_10005158 3300006353 Bacteria 6451
140 Ga0075370_10011266 3300006353 Bacteria 4695
141 Ga0075370_10135934 3300006353 Bacteria 1436
142 Ga0075370_10212884 3300006353 Bacteria 1141
143 Ga0075431_100010054 3300006847 Bacteria 9505
144 Ga0068865_100051758 3300006881 Bacteria 2844
145 Ga0068865_100058575 3300006881 Bacteria 2691
146 Ga0068865_100075107 3300006881 Bacteria 2409
147 Ga0097620_100457689 3300006931 Bacteria 1372
148 Ga0079104_1000006 3300006946 Bacteria 396255
149 Ga0079104_1005750 3300006946 Bacteria 4870
150 Ga0079104_1023710 3300006946 Bacteria 1627
151 Ga0099826_10057539 3300006948 Bacteria 2556
152 Ga0105251_10000001 3300009011 Bacteria 466643
153 Ga0105251_10000406 3300009011 Bacteria 41850
154 Ga0105251_10010981 3300009011 Bacteria 5205
155 Ga0105251_10057305 3300009011 Bacteria 1841
156 Ga0105244_10000519 3300009036 Bacteria 34428
157 Ga0105244_10002745 3300009036 Bacteria 13136
158 Ga0105244_10007547 3300009036 Bacteria 6904
159 Ga0105244_10012468 3300009036 Bacteria 5020
160 Ga0105244_10014973 3300009036 Bacteria 4462
161 Ga0105244_10020420 3300009036 Bacteria 3681
162 Ga0105244_10022435 3300009036 Bacteria 3474
163 Ga0105244_10075381 3300009036 Bacteria 1676
164 Ga0105250_10001116 3300009092 Bacteria 15151
165 Ga0105250_10001248 3300009092 Bacteria 14088
166 Ga0105250_10030673 3300009092 Bacteria 2161
167 Ga0105240_10000376 3300009093 Bacteria 83903
168 Ga0105240_10086767 3300009093 Bacteria 3833
169 Ga0105245_10411663 3300009098 Bacteria 1353
170 Ga0105245_10451204 3300009098 Bacteria 1294
171 Ga0114129_10011124 3300009147 Bacteria 12826
172 Ga0105243_10000170 3300009148 Bacteria 74646
173 Ga0105243_10014408 3300009148 Bacteria 5986
174 Ga0105243_10432832 3300009148 Bacteria 1230
175 Ga0105242_10000474 3300009176 Bacteria 31860
176 Ga0105248_10160637 3300009177 Bacteria 2535
177 Ga0105237_10001377 3300009545 Bacteria 32081
178 Ga0105237_10001450 3300009545 Bacteria 31322
179 Ga0105237_10018035 3300009545 Bacteria 7311
180 Ga0105238_10418081 3300009551 Bacteria 1335
181 Ga0105249_10054998 3300009553 Bacteria 3640
182 Ga0105249_10145116 3300009553 Bacteria 2279
183 Ga0123340_1048316 3300009763 Bacteria 1644
184 Ga0123341_1000005 3300009765 Bacteria 150422
185 Ga0123342_1012900 3300009766 Bacteria 8539
186 Ga0105239_10022339 3300010375 Bacteria 6976
187 Ga0105239_10089657 3300010375 Bacteria 3391
188 Ga0105246_10000114 3300011119 Bacteria 36232
189 Ga0105246_10001525 3300011119 Bacteria 13716
190 Ga0105246_10206465 3300011119 Bacteria 1531
191 Ga0157345_1002561 3300012498 Bacteria 1287
192 Ga0157373_10012988 3300013100 Bacteria 6113
193 Ga0157373_10022025 3300013100 Bacteria 4624
194 Ga0157373_10055062 3300013100 Bacteria 2826
195 Ga0157373_10095319 3300013100 Bacteria 2095
196 Ga0157371_10000109 3300013102 Bacteria 124990
197 Ga0157371_10000754 3300013102 Bacteria 37446
198 Ga0157370_10005715 3300013104 Bacteria 13902
199 Ga0157370_10019939 3300013104 Bacteria 6708
200 Ga0157370_10040968 3300013104 Bacteria 4471
201 Ga0157370_10149566 3300013104 Bacteria 2173
202 Ga0157369_10003795 3300013105 Bacteria 17955
203 Ga0157369_10045106 3300013105 Bacteria 4796
204 Ga0157369_10177905 3300013105 Bacteria 2239
205 Ga0157369_10379484 3300013105 Bacteria 1467
206 Ga0157369_10395537 3300013105 Bacteria 1434
207 Ga0157374_10073484 3300013296 Bacteria 3228
208 Ga0157374_10445463 3300013296 Bacteria 1296
209 Ga0163162_10003838 3300013306 Bacteria 14412
210 Ga0163162_10723108 3300013306 Bacteria 1116
211 Ga0163163_10165608 3300014325 Bacteria 2256
212 Ga0157380_10003640 3300014326 Bacteria 10597
213 Ga0157380_10709879 3300014326 Bacteria 1012
214 Ga0182008_10006407 3300014497 Bacteria 6582
215 Ga0182008_10013725 3300014497 Bacteria 4256
216 Ga0182008_10048193 3300014497 Bacteria 2116
217 Ga0182006_1001224 3300015261 Bacteria 16004
218 Ga0182006_1003031 3300015261 Bacteria 8835
219 Ga0182006_1005901 3300015261 Bacteria 5763
220 Ga0182006_1058702 3300015261 Bacteria 1458
221 Ga0182007_10000493 3300015262 Bacteria 23546
222 Ga0182007_10005361 3300015262 Bacteria 5647
223 Ga0182005_1001106 3300015265 Bacteria 11275
224 Ga0182005_1003295 3300015265 Bacteria 5517
225 Ga0182005_1017046 3300015265 Bacteria 2012
226 Ga0182005_1017457 3300015265 Bacteria 1987
227 Ga0182005_1026944 3300015265 Bacteria 1568
228 Ga0214544_1000419 3300021320 Bacteria 76083
229 Ga0214542_1000027 3300021321 Bacteria 175107
230 Ga0214542_1033155 3300021321 Bacteria 1764
231 Ga0214543_1000025 3300021327 Bacteria 225351
232 Ga0214543_1000047 3300021327 Bacteria 150894
233 Ga0213872_10072961 3300021361 Bacteria 1546
234 Ga0213876_10144143 3300021384 Bacteria 1267
235 Ga0213875_10072901 3300021388 Bacteria 1602
236 Ga0228711_1010219 3300022739 Bacteria 12433
237 Ga0228710_1010420 3300022740 Bacteria 12432
238 Ga0209435_100127 3300025206 Bacteria 27151
239 Ga0209435_101270 3300025206 Bacteria 3319
240 Ga0209760_100007 3300025207 Bacteria 211381
241 Ga0209784_100065 3300025224 Bacteria 155963
242 Ga0209566_100081 3300025225 Bacteria 155963
243 Ga0209674_100101 3300025226 Bacteria 155963
244 Ga0209147_100234 3300025229 Bacteria 55130
245 Ga0209563_100098 3300025230 Bacteria 155963
246 Ga0207427_100018 3300025231 Bacteria 530735
247 Ga0209437_100031 3300025233 Bacteria 530871
248 Ga0209437_100475 3300025233 Bacteria 30517
249 Ga0209437_104097 3300025233 Bacteria 2583
250 Ga0209437_105162 3300025233 Bacteria 2239
251 Ga0209258_100752 3300025242 Bacteria 20637
252 Ga0209258_104672 3300025242 Bacteria 2524
253 Ga0207425_1008276 3300025245 Bacteria 2675
254 Ga0209646_1000390 3300025246 Bacteria 27151
255 Ga0209646_1005847 3300025246 Bacteria 2112
256 Ga0209026_1000520 3300025250 Bacteria 27151
257 Ga0209677_100059 3300025253 Bacteria 155963
258 Ga0209677_100218 3300025253 Bacteria 41903
259 Ga0209148_1000420 3300025254 Bacteria 47555
260 Ga0209759_1000769 3300025256 Bacteria 27151
261 Ga0209129_1000997 3300025258 Bacteria 16895
262 Ga0209129_1002487 3300025258 Bacteria 8991
263 Ga0209129_1026470 3300025258 Bacteria 1002
264 Ga0209233_1000012 3300025261 Bacteria 1019519
265 Ga0209233_1000097 3300025261 Bacteria 295452
266 Ga0209233_1000429 3300025261 Bacteria 30517
267 Ga0209455_1000290 3300025272 Bacteria 53526
268 Ga0209455_1016997 3300025272 Bacteria 1543
269 Ga0209673_1000117 3300025273 Bacteria 172081
270 Ga0209673_1000452 3300025273 Bacteria 69726
271 Ga0209673_1002317 3300025273 Bacteria 13498
272 Ga0209130_1025020 3300025284 Bacteria 1297
273 Ga0209675_1003905 3300025291 Bacteria 6852
274 Ga0209675_1023459 3300025291 Bacteria 1598
275 Ga0209676_1000002 3300025292 Bacteria 1732948
276 Ga0209676_1000020 3300025292 Bacteria 617256
277 Ga0209676_1002950 3300025292 Bacteria 11109
278 Ga0209676_1009137 3300025292 Bacteria 4314
279 Ga0209025_1000121 3300025294 Bacteria 208700
280 Ga0209025_1000228 3300025294 Bacteria 132088
281 Ga0209025_1000558 3300025294 Bacteria 68589
282 Ga0209025_1003556 3300025294 Bacteria 14615
283 Ga0209564_1000581 3300025295 Bacteria 57912
284 Ga0209564_1000763 3300025295 Bacteria 45281
285 Ga0209758_1000113 3300025297 Bacteria 202528
286 Ga0209758_1000503 3300025297 Bacteria 63354
287 Ga0209758_1005135 3300025297 Bacteria 10334
288 Ga0209758_1006104 3300025297 Bacteria 8845
289 Ga0209050_1000006 3300025298 Bacteria 1359702
290 Ga0209050_1000009 3300025298 Bacteria 1047265
291 Ga0209050_1000775 3300025298 Bacteria 45682
292 Ga0209050_1005867 3300025298 Bacteria 7516
293 Ga0209256_1000164 3300025299 Bacteria 135612
294 Ga0209256_1002844 3300025299 Bacteria 13202
295 Ga0209256_1003510 3300025299 Bacteria 10924
296 Ga0209256_1012618 3300025299 Bacteria 3209
297 Ga0207426_1000307 3300025302 Bacteria 96085
298 Ga0209051_1000001 3300025303 Bacteria 1732974
299 Ga0209051_1000008 3300025303 Bacteria 706935
300 Ga0209051_1000027 3300025303 Bacteria 412172
301 Ga0209051_1002046 3300025303 Bacteria 15317
302 Ga0209051_1024359 3300025303 Bacteria 2490
303 Ga0209257_1000269 3300025304 Bacteria 119726
304 Ga0209257_1019019 3300025304 Bacteria 2608
305 Ga0207696_1000002 3300025711 Bacteria 1098043
306 Ga0207696_1000115 3300025711 Bacteria 150739
307 Ga0207696_1002575 3300025711 Bacteria 8817
308 Ga0207696_1007412 3300025711 Bacteria 4298
309 Ga0207655_1000022 3300025728 Bacteria 483933
310 Ga0207655_1000167 3300025728 Bacteria 119650
311 Ga0207655_1000270 3300025728 Bacteria 81429
312 Ga0207655_1000419 3300025728 Bacteria 58031
313 Ga0207655_1001481 3300025728 Bacteria 21559
314 Ga0207655_1008041 3300025728 Bacteria 6760
315 Ga0207655_1009048 3300025728 Bacteria 6236
316 Ga0207655_1064092 3300025728 Bacteria 1404
317 Ga0207655_1075769 3300025728 Bacteria 1233
318 Ga0207655_1085486 3300025728 Bacteria 1125
319 Ga0207713_1000117 3300025735 Bacteria 129339
320 Ga0207713_1000455 3300025735 Bacteria 42889
321 Ga0207713_1000827 3300025735 Bacteria 28559
322 Ga0207713_1003174 3300025735 Bacteria 11381
323 Ga0207713_1006126 3300025735 Bacteria 7392
324 Ga0207713_1006127 3300025735 Bacteria 7392
325 Ga0207713_1013462 3300025735 Bacteria 4307
326 Ga0207713_1015971 3300025735 Bacteria 3830
327 Ga0207713_1024116 3300025735 Bacteria 2844
328 Ga0207713_1033940 3300025735 Bacteria 2222
329 Ga0207680_10116281 3300025903 Bacteria 1743
330 Ga0207645_10037406 3300025907 Bacteria 3114
331 Ga0207645_10084606 3300025907 Bacteria 2036
332 Ga0207684_10012548 3300025910 Bacteria 7364
333 Ga0207695_10000495 3300025913 Bacteria 83911
334 Ga0207695_10072809 3300025913 Bacteria 3504
335 Ga0207671_10000568 3300025914 Bacteria 49545
336 Ga0207671_10001314 3300025914 Bacteria 29075
337 Ga0207671_10041667 3300025914 Bacteria 3398
338 Ga0207649_10000217 3300025920 Bacteria 47461
339 Ga0207681_10008201 3300025923 Bacteria 6390
340 Ga0207681_10247613 3300025923 Bacteria 1390
341 Ga0207694_10249301 3300025924 Bacteria 1453
342 Ga0207650_10000205 3300025925 Bacteria 67905
343 Ga0207650_10000942 3300025925 Bacteria 21884
344 Ga0207687_10127911 3300025927 Bacteria 1910
345 Ga0207687_10305706 3300025927 Bacteria 1282
346 Ga0207644_10103475 3300025931 Bacteria 2143
347 Ga0207706_10005103 3300025933 Bacteria 12257
348 Ga0207706_10010353 3300025933 Bacteria 8518
349 Ga0207686_10005559 3300025934 Bacteria 6756
350 Ga0207709_10000004 3300025935 Bacteria 825156
351 Ga0207709_10258890 3300025935 Bacteria 1275
352 Ga0207709_10466144 3300025935 Bacteria 979
353 Ga0207669_10021091 3300025937 Bacteria 3431
354 Ga0207669_10181166 3300025937 Bacteria 1510
355 Ga0207704_10303876 3300025938 Bacteria 1223
356 Ga0207691_10671910 3300025940 Bacteria 874
357 Ga0207689_10023203 3300025942 Bacteria 5209
358 Ga0207679_10000109 3300025945 Bacteria 67430
359 Ga0207667_10139375 3300025949 Bacteria 2497
360 Ga0207651_10284339 3300025960 Bacteria 1368
361 Ga0207651_10646988 3300025960 Bacteria 928
362 Ga0207712_10085813 3300025961 Bacteria 2305
363 Ga0207712_10115856 3300025961 Bacteria 2018
364 Ga0207668_10024637 3300025972 Bacteria 3887
365 Ga0207678_10098511 3300026067 Bacteria 2498
366 Ga0207702_10047716 3300026078 Bacteria 3610
367 Ga0207648_10237869 3300026089 Bacteria 1621
368 Ga0207674_10010723 3300026116 Bacteria 10346
369 Ga0207675_100001039 3300026118 Bacteria 27532
370 Ga0207675_100285137 3300026118 Bacteria 1605
371 Ga0207683_10469601 3300026121 Bacteria 1161
372 Ga0207683_10528422 3300026121 Bacteria 1090
373 Ga0207698_10016450 3300026142 Bacteria 4986
374 Ga0209281_1000011 3300027111 Bacteria 695292
375 Ga0209281_1000314 3300027111 Bacteria 86424
376 Ga0209281_1000463 3300027111 Bacteria 57136
377 Ga0209281_1003764 3300027111 Bacteria 4826
378 Ga0209371_1001425 3300027312 Bacteria 16286
379 Ga0209999_1048711 3300027543 Bacteria 799
380 Ga0209282_1000068 3300027666 Bacteria 85817
381 Ga0209282_1192036 3300027666 Bacteria 948
382 Ga0209813_10069115 3300027866 Bacteria 1144
383 Ga0207428_10000098 3300027907 Bacteria 120181
384 Ga0207428_10045742 3300027907 Bacteria 3523
385 Ga0207428_10200020 3300027907 Bacteria 1504
386 Ga0207428_10204214 3300027907 Bacteria 1486
387 Ga0268266_10468457 3300028379 Bacteria 1199
388 Ga0268265_10058252 3300028380 Bacteria 2948
389 Ga0268264_10300480 3300028381 Bacteria 1511
390 Ga0307515_10006683 3300028794 Bacteria 22971
391 Ga0307515_10097680 3300028794 Bacteria 3586
392 Ga0268256_1001855 3300030500 Bacteria 11750
393 Ga0307511_10084883 3300030521 Bacteria 2194
394 Ga0307512_10046883 3300030522 Bacteria 3519
395 Ga0314311_1003930 3300030733 Bacteria 3254
396 Ga0316179_1019939 3300030734 Bacteria 2450
397 Ga0316178_1142514 3300030735 Bacteria 13262
398 Ga0265330_10063920 3300031235 Bacteria 1599
399 Ga0265339_10037873 3300031249 Bacteria 2693
400 Ga0307513_10000259 3300031456 Bacteria 76155
401 Ga0307513_10184150 3300031456 Bacteria 1948
402 Ga0307408_100332515 3300031548 Bacteria 1283
403 Ga0307408_100605538 3300031548 Bacteria 974
404 Ga0307516_10274752 3300031730 Bacteria 1369
405 Ga0307405_10042440 3300031731 Bacteria 2769
406 Ga0307412_10700786 3300031911 Bacteria 869
407 Ga0307409_101178847 3300031995 Bacteria 789
408 Ga0307507_10295229 3300033179 Bacteria 999
409 Ga0307510_10000904 3300033180 Bacteria 31347
410 Ga0307510_10140416 3300033180 Bacteria 2061
411 Ga0315913_1002536 3300033430 Bacteria 21509
412 Ga0315915_1000007 3300033464 Bacteria 319225
413 Ga0373943_0219716 3300035170 Bacteria 1058
414 Ga0373935_0306116 3300035692 Bacteria 1124
415 Ga0373925_0000771 3300037068 Bacteria 29425
416 Ga0395905_0022998 3300037471 Bacteria 5891
417 Ga0395905_0037462 3300037471 Bacteria 4553
418 Ga0395905_0241463 3300037471 Bacteria 1688
419 Ga0237819_00367 3300038705 Bacteria 16023
420 Ga0436365_1612465 3300039437 Bacteria 1359
421 Ga0436361_0928105 3300039447 Bacteria 1426
422 Ga0439436_0023912 3300041404 Bacteria 1806
423 Ga0439436_0048333 3300041404 Bacteria 1207
424 Ga0439438_029644 3300041405 Bacteria 1463
425 Ga0439447_000379 3300041407 Bacteria 16202
426 Ga0439447_028651 3300041407 Bacteria 1413
427 Ga0439466_0000125 3300041411 Bacteria 30280
428 Ga0439466_0030986 3300041411 Bacteria 1831
429 Ga0439466_0031687 3300041411 Bacteria 1806
430 Ga0439465_0007366 3300041413 Bacteria 3496
431 Ga0439465_0034550 3300041413 Bacteria 1619
432 Ga0439465_0036768 3300041413 Bacteria 1573
433 Ga0451798_0048890 3300041458 Bacteria 1029
434 Ga0451804_0978079 3300041463 Bacteria 1122
435 Ga0451835_0984855 3300041492 Bacteria 2220
436 Ga0451845_0935886 3300041501 Bacteria 918
437 Ga0451847_0024524 3300041503 Bacteria 1868
438 Ga0451851_0582068 3300041507 Bacteria 769
439 Ga0451855_0354570 3300041511 Bacteria 1140
440 Ga0439432_000588 3300042006 Bacteria 13718
441 Ga0439432_002973 3300042006 Bacteria 6313
442 Ga0439449_0026652 3300042007 Bacteria 2157
443 Ga0439449_0120861 3300042007 Bacteria 972
444 Ga0439451_010453 3300042009 Bacteria 1870
445 Ga0439451_021005 3300042009 Bacteria 1316
446 Ga0439452_000274 3300042010 Bacteria 34135
447 Ga0439452_003833 3300042010 Bacteria 5165
448 Ga0439452_012209 3300042010 Bacteria 2450
449 Ga0439452_016156 3300042010 Bacteria 2031
450 Ga0439456_004086 3300042013 Bacteria 2959
451 Ga0439463_000824 3300042016 Bacteria 8518
452 Ga0439463_004733 3300042016 Bacteria 3398
453 Ga0450911_007211 3300042115 Bacteria 1621
454 Ga0450919_009519 3300042121 Bacteria 1115
455 Ga0450906_000930 3300042145 Bacteria 6406
456 Ga0450907_000043 3300042146 Bacteria 55843
457 Ga0450909_001700 3300042185 Bacteria 3083
458 Ga0439460_0004605 3300042461 Bacteria 3367
459 Ga0439460_0006604 3300042461 Bacteria 2884
460 Ga0439440_0000499 3300042993 Bacteria 6581
461 Ga0466966_0046273 3300044684 Bacteria 2779
462 Ga0466963_0011584 3300044694 Bacteria 5369
463 Ga0466971_0171191 3300044719 Bacteria 1019
464 Ga0466970_0000136 3300044765 Bacteria 33881
465 Ga0466970_0105673 3300044765 Bacteria 1536
466 Ga0466957_0011830 3300044842 Bacteria 5045
467 Ga0466959_0456278 3300045049 Bacteria 866
468 Ga0451576_0008377 3300045051 Bacteria 12141
469 Ga0451576_0290625 3300045051 Bacteria 1709
470 Ga0466958_0093997 3300045836 Bacteria 1857
471 Ga0466967_0065100 3300045976 Bacteria 3244
472 Ga0495617_000121 3300046452 Bacteria 51958
473 Ga0495617_011317 3300046452 Bacteria 3044
474 Ga0495617_070018 3300046452 Bacteria 1154
475 Ga0495627_001717 3300046453 Bacteria 11957
476 Ga0495627_046391 3300046453 Bacteria 1320
477 Ga0495590_0001126 3300046457 Bacteria 11710
478 Ga0495591_000086 3300046458 Bacteria 104667
479 Ga0495591_000125 3300046458 Bacteria 83668
480 Ga0495591_000260 3300046458 Bacteria 50308
481 Ga0495591_001495 3300046458 Bacteria 14432
482 Ga0495591_001994 3300046458 Bacteria 11898
483 Ga0495591_002103 3300046458 Bacteria 11463
484 Ga0495591_014302 3300046458 Bacteria 2859
485 Ga0495591_047982 3300046458 Bacteria 1179
486 Ga0495591_057901 3300046458 Bacteria 1037
487 Ga0495629_0008153 3300046459 Bacteria 7705
488 Ga0495638_0000622 3300046460 Bacteria 39303
489 Ga0495638_0040688 3300046460 Bacteria 2944
490 Ga0495638_0045328 3300046460 Bacteria 2766
491 Ga0495638_0290071 3300046460 Bacteria 886
492 Ga0495651_0243875 3300046462 Bacteria 1231
493 Ga0495650_0000362 3300046471 Bacteria 80025
494 Ga0495650_0002865 3300046471 Bacteria 13168
495 Ga0495650_0019272 3300046471 Bacteria 3366
496 Ga0495650_0019926 3300046471 Bacteria 3284
497 Ga0495650_0045429 3300046471 Bacteria 1849
498 Ga0495582_0269574 3300046473 Bacteria 977
499 Ga0495605_0000001 3300046474 Bacteria 614538
500 Ga0495605_0000025 3300046474 Bacteria 223594
501 Ga0495605_0000346 3300046474 Bacteria 45641
502 Ga0495605_0003188 3300046474 Bacteria 9844
503 Ga0495605_0020734 3300046474 Bacteria 3490
504 Ga0495605_0023315 3300046474 Bacteria 3257
505 Ga0495605_0027855 3300046474 Bacteria 2922
506 Ga0495605_0087023 3300046474 Bacteria 1453
507 Ga0495605_0131386 3300046474 Bacteria 1129
508 Ga0495639_0000996 3300046475 Bacteria 12769
509 Ga0495662_0007315 3300046476 Bacteria 5463
510 Ga0495584_0001257 3300046491 Bacteria 15465
511 Ga0495584_0049354 3300046491 Bacteria 2120
512 Ga0495584_0050165 3300046491 Bacteria 2102
513 Ga0495584_0066940 3300046491 Bacteria 1807
514 Ga0495585_0000149 3300046492 Bacteria 75947
515 Ga0495585_0115687 3300046492 Bacteria 1422
516 Ga0495594_0013205 3300046499 Bacteria 4308
517 Ga0495596_0000027 3300046500 Bacteria 104155
518 Ga0495596_0110877 3300046500 Bacteria 1065
519 Ga0495607_0000036 3300046501 Bacteria 140259
520 Ga0495607_0000167 3300046501 Bacteria 69947
521 Ga0495607_0001042 3300046501 Bacteria 25419
522 Ga0495607_0005883 3300046501 Bacteria 8711
523 Ga0495607_0009965 3300046501 Bacteria 6399
524 Ga0495607_0042895 3300046501 Bacteria 2678
525 Ga0495607_0067349 3300046501 Bacteria 2012
526 Ga0495607_0129440 3300046501 Bacteria 1315
527 Ga0495607_0133662 3300046501 Bacteria 1287
528 Ga0495607_0152662 3300046501 Bacteria 1180
529 Ga0495583_0000070 3300046506 Bacteria 185226
530 Ga0495583_0001762 3300046506 Bacteria 20649
531 Ga0495583_0002032 3300046506 Bacteria 18425
532 Ga0495583_0002891 3300046506 Bacteria 13899
533 Ga0495583_0006127 3300046506 Bacteria 7930
534 Ga0495583_0008378 3300046506 Bacteria 6328
535 Ga0495583_0100447 3300046506 Bacteria 1235
536 Ga0495606_0000079 3300046507 Bacteria 164788
537 Ga0495606_0002580 3300046507 Bacteria 20743
538 Ga0495606_0010880 3300046507 Bacteria 7490
539 Ga0495606_0011881 3300046507 Bacteria 7043
540 Ga0495606_0070130 3300046507 Bacteria 2211
541 Ga0495606_0203403 3300046507 Bacteria 1127
542 Ga0495610_0011337 3300046512 Bacteria 5457
543 Ga0495610_0021168 3300046512 Bacteria 3582
544 Ga0495610_0041249 3300046512 Bacteria 2318
545 Ga0495610_0073016 3300046512 Bacteria 1595
546 Ga0495610_0085546 3300046512 Bacteria 1438
547 Ga0495616_0000079 3300046513 Bacteria 81296
548 Ga0495616_0000425 3300046513 Bacteria 32300
549 Ga0495616_0027250 3300046513 Bacteria 3034
550 Ga0495616_0029472 3300046513 Bacteria 2897
551 Ga0495616_0056248 3300046513 Bacteria 1943
552 Ga0495616_0066638 3300046513 Bacteria 1751
553 Ga0495620_0000009 3300046515 Bacteria 174473
554 Ga0495620_0009058 3300046515 Bacteria 5314
555 Ga0495620_0010750 3300046515 Bacteria 4815
556 Ga0495620_0011527 3300046515 Bacteria 4609
557 Ga0495620_0022194 3300046515 Bacteria 3064
558 Ga0495620_0029113 3300046515 Bacteria 2560
559 Ga0495620_0048012 3300046515 Bacteria 1834
560 Ga0495631_0000126 3300046518 Bacteria 51226
561 Ga0495631_0006438 3300046518 Bacteria 6059
562 Ga0495631_0024815 3300046518 Bacteria 2765
563 Ga0495632_0000802 3300046519 Bacteria 27836
564 Ga0495632_0008573 3300046519 Bacteria 6251
565 Ga0495632_0030503 3300046519 Bacteria 2797
566 Ga0495632_0112330 3300046519 Bacteria 1278
567 Ga0495632_0193809 3300046519 Bacteria 927
568 Ga0495637_0000075 3300046520 Bacteria 79690
569 Ga0495637_0002202 3300046520 Bacteria 10895
570 Ga0495637_0015218 3300046520 Bacteria 3610
571 Ga0495637_0090293 3300046520 Bacteria 1209
572 Ga0495637_0093780 3300046520 Bacteria 1181
573 Ga0495643_0001828 3300046522 Bacteria 18093
574 Ga0495644_0000477 3300046523 Bacteria 17333
575 Ga0495644_0003929 3300046523 Bacteria 5849
576 Ga0495648_0010903 3300046524 Bacteria 6893
577 Ga0495648_0012695 3300046524 Bacteria 6263
578 Ga0495648_0013902 3300046524 Bacteria 5925
579 Ga0495648_0015893 3300046524 Bacteria 5440
580 Ga0495648_0020720 3300046524 Bacteria 4576
581 Ga0495648_0117409 3300046524 Bacteria 1436
582 Ga0495666_0014693 3300046526 Bacteria 3896
583 Ga0495666_0058173 3300046526 Bacteria 1850
584 Ga0495642_0000402 3300046528 Bacteria 23250
585 Ga0495642_0000571 3300046528 Bacteria 18499
586 Ga0495652_0471174 3300046529 Bacteria 876
587 Ga0495654_0000470 3300046530 Bacteria 33575
588 Ga0495654_0001097 3300046530 Bacteria 19609
589 Ga0495654_0008212 3300046530 Bacteria 5779
590 Ga0495654_0011909 3300046530 Bacteria 4690
591 Ga0495654_0014489 3300046530 Bacteria 4196
592 Ga0495654_0047804 3300046530 Bacteria 2101
593 Ga0495654_0076284 3300046530 Bacteria 1579
594 Ga0495654_0098190 3300046530 Bacteria 1351
595 Ga0495654_0191161 3300046530 Bacteria 881
596 Ga0495640_0132830 3300046533 Bacteria 1609
597 Ga0495587_0010225 3300046536 Bacteria 5981
598 Ga0495609_0000014 3300046538 Bacteria 326023
599 Ga0495609_0000016 3300046538 Bacteria 312882
600 Ga0495609_0001549 3300046538 Bacteria 15056
601 Ga0495609_0010463 3300046538 Bacteria 4446
602 Ga0495609_0024324 3300046538 Bacteria 2779
603 Ga0495609_0094174 3300046538 Bacteria 1301
604 Ga0495609_0124205 3300046538 Bacteria 1108
605 Ga0495597_0007901 3300046542 Bacteria 5360
606 Ga0495597_0009335 3300046542 Bacteria 4852
607 Ga0495597_0009540 3300046542 Bacteria 4788
608 Ga0495597_0014559 3300046542 Bacteria 3741
609 Ga0495622_0000708 3300046557 Bacteria 18867
610 Ga0495622_0001279 3300046557 Bacteria 12912
611 Ga0495622_0007393 3300046557 Bacteria 5096
612 Ga0495633_0000010 3300046558 Bacteria 280844
613 Ga0495633_0000525 3300046558 Bacteria 38410
614 Ga0495656_0000902 3300046615 Bacteria 9599
615 Ga0495668_0003496 3300046616 Bacteria 11713
616 Ga0495668_0054619 3300046616 Bacteria 2207
617 Ga0495668_0131197 3300046616 Bacteria 1371
618 Ga0495668_0376538 3300046616 Bacteria 779
619 Ga0495611_0000048 3300046648 Bacteria 85172
620 Ga0495611_0000152 3300046648 Bacteria 49622
621 Ga0495611_0025448 3300046648 Bacteria 2579
622 Ga0495611_0058018 3300046648 Bacteria 1755
623 Ga0495625_0000084 3300046660 Bacteria 151895
624 Ga0495625_0002299 3300046660 Bacteria 20925
625 Ga0495625_0002568 3300046660 Bacteria 19498
626 Ga0495625_0010597 3300046660 Bacteria 7608
627 Ga0495625_0044245 3300046660 Bacteria 3224
628 Ga0495625_0045296 3300046660 Bacteria 3180
629 Ga0495625_0088336 3300046660 Bacteria 2147
630 Ga0495625_0144184 3300046660 Bacteria 1605
631 Ga0495625_0183784 3300046660 Bacteria 1388
632 Ga0495625_0265970 3300046660 Bacteria 1108
633 Ga0495625_0364773 3300046660 Bacteria 910
634 Ga0495635_0000973 3300046663 Bacteria 18853
635 Ga0495635_0240372 3300046663 Bacteria 1222
636 Ga0495659_0000392 3300046664 Bacteria 16750
637 Ga0495661_0000008 3300046665 Bacteria 317971
638 Ga0495661_0000191 3300046665 Bacteria 71123
639 Ga0495661_0001498 3300046665 Bacteria 19446
640 Ga0495661_0003071 3300046665 Bacteria 12557
641 Ga0495661_0017906 3300046665 Bacteria 4669
642 Ga0495661_0062167 3300046665 Bacteria 2213
643 Ga0495657_0020397 3300046675 Bacteria 4764
644 Ga0495623_0091743 3300046679 Bacteria 1863
645 Ga0495658_0211393 3300046683 Bacteria 1212
646 Ga0495669_0016104 3300046684 Bacteria 3201
647 Ga0495670_0001804 3300046691 Bacteria 10525
648 Ga0495670_0012534 3300046691 Bacteria 4171
649 Ga0495670_0175616 3300046691 Bacteria 1129
650 Ga0495670_0184536 3300046691 Bacteria 1102
651 Ga0495670_0204537 3300046691 Bacteria 1046
652 Ga0495671_0000853 3300046692 Bacteria 21807
653 Ga0495671_0008768 3300046692 Bacteria 5680
654 Ga0495671_0012449 3300046692 Bacteria 4646
655 Ga0495671_0054971 3300046692 Bacteria 1972
656 Ga0495671_0065921 3300046692 Bacteria 1782
657 Ga0495649_0000257 3300046694 Bacteria 47325
658 Ga0495649_0019003 3300046694 Bacteria 3861
659 Ga0495649_0020457 3300046694 Bacteria 3712
660 Ga0495649_0066761 3300046694 Bacteria 1930
661 Ga0495649_0265784 3300046694 Bacteria 878
662 Ga0495589_0000415 3300046794 Bacteria 32054
663 Ga0495589_0082046 3300046794 Bacteria 1568
664 Ga0495589_0099905 3300046794 Bacteria 1404
665 Ga0495600_0031896 3300046809 Bacteria 3416
666 Ga0495600_0046755 3300046809 Bacteria 2822
667 Ga0495660_0008599 3300046810 Bacteria 5974
668 Ga0495660_0052407 3300046810 Bacteria 2216
669 Ga0495660_0113146 3300046810 Bacteria 1382
670 Ga0495660_0122406 3300046810 Bacteria 1314
671 Ga0495660_0132940 3300046810 Bacteria 1246
672 Ga0495660_0151824 3300046810 Bacteria 1143
673 Ga0495660_0224643 3300046810 Bacteria 883
674 Ga0495604_0005508 3300047317 Bacteria 10037
675 Ga0495604_0055591 3300047317 Bacteria 3050
676 Ga0495636_0012242 3300047318 Bacteria 3396
677 Ga0495636_0096144 3300047318 Bacteria 1291
678 Ga0495636_0287316 3300047318 Bacteria 767
679 Ga0495674_0308786 3300047319 Bacteria 1291
680 Ga0495672_0002860 3300047320 Bacteria 15334
681 Ga0495672_0013706 3300047320 Bacteria 5578
682 Ga0495672_0027794 3300047320 Bacteria 3589
683 Ga0495672_0029995 3300047320 Bacteria 3418
684 Ga0495672_0063445 3300047320 Bacteria 2120
685 Ga0495672_0169014 3300047320 Bacteria 1117
686 Ga0495676_0000039 3300047321 Bacteria 111011
687 Ga0495680_0009250 3300047322 Bacteria 8877
688 Ga0495683_0000002 3300047323 Bacteria 638279
689 Ga0495683_0000231 3300047323 Bacteria 51177
690 Ga0495683_0000358 3300047323 Bacteria 37677
691 Ga0495683_0033779 3300047323 Bacteria 2601
692 Ga0495683_0057525 3300047323 Bacteria 1933
693 Ga0495683_0179221 3300047323 Bacteria 969
694 Ga0495687_000232 3300047443 Bacteria 77572
695 Ga0495687_002451 3300047443 Bacteria 14881
696 Ga0495687_005527 3300047443 Bacteria 8021
697 Ga0495687_009154 3300047443 Bacteria 5572
698 Ga0495687_015074 3300047443 Bacteria 3944
699 Ga0495675_0065462 3300047444 Bacteria 2298
700 Ga0495679_000086 3300047446 Bacteria 85895
701 Ga0495679_000133 3300047446 Bacteria 66052
702 Ga0495679_025427 3300047446 Bacteria 1979
703 Ga0495673_0000077 3300047469 Bacteria 204403
704 Ga0495673_0000281 3300047469 Bacteria 68886
705 Ga0495673_0000656 3300047469 Bacteria 34029
706 Ga0495673_0000966 3300047469 Bacteria 25951
707 Ga0495673_0001880 3300047469 Bacteria 15759
708 Ga0495673_0005342 3300047469 Bacteria 7789
709 Ga0495673_0009546 3300047469 Bacteria 5366
710 Ga0495673_0012894 3300047469 Bacteria 4408
711 Ga0495673_0027832 3300047469 Bacteria 2684
712 Ga0495673_0076687 3300047469 Bacteria 1393
713 Ga0495681_0000031 3300047470 Bacteria 128177
714 Ga0495681_0008454 3300047470 Bacteria 6457
715 Ga0495681_0017000 3300047470 Bacteria 4054
716 Ga0495681_0018044 3300047470 Bacteria 3898
717 Ga0495686_0000418 3300047472 Bacteria 67274
718 Ga0495686_0032054 3300047472 Bacteria 3403
719 Ga0495686_0103431 3300047472 Bacteria 1716
720 Ga0495686_0224665 3300047472 Bacteria 1066
721 Ga0495686_0387828 3300047472 Bacteria 752
722 Ga0495602_0084832 3300048088 Bacteria 2649
723 Ga0495626_0000002 3300048091 Bacteria 436012
724 Ga0495626_0000451 3300048091 Bacteria 41891
725 Ga0495626_0000748 3300048091 Bacteria 29994
726 Ga0495626_0001395 3300048091 Bacteria 19359
727 Ga0495626_0002100 3300048091 Bacteria 14488
728 Ga0495626_0059482 3300048091 Bacteria 1743
729 Ga0495626_0078118 3300048091 Bacteria 1474
730 Ga0496101_0076974 3300048904 Bacteria 2458
731 Ga0496102_0000475 3300048905 Bacteria 44485
732 Ga0496102_0051450 3300048905 Bacteria 3752
733 Ga0496103_0018945 3300048906 Bacteria 4132
734 Ga0496106_0329371 3300048909 Bacteria 1226
735 Ga0496113_0017486 3300048916 Bacteria 4978
736 Ga0496114_0383799 3300048917 Bacteria 1244
737 Ga0496115_0113582 3300048918 Bacteria 2226
738 Ga0496116_0003732 3300048919 Bacteria 14894
739 Ga0496116_0028731 3300048919 Bacteria 4022
740 Ga0496116_0191739 3300048919 Bacteria 1081
741 Ga0496117_0000246 3300048920 Bacteria 102783
742 Ga0496117_0002266 3300048920 Bacteria 24847
743 Ga0496117_0015728 3300048920 Bacteria 6426
744 Ga0496117_0116632 3300048920 Bacteria 1650
745 Ga0496117_0207220 3300048920 Bacteria 1102
746 Ga0496118_0004214 3300048921 Bacteria 17265
747 Ga0496118_0015631 3300048921 Bacteria 7013
748 Ga0496118_0146221 3300048921 Bacteria 1488
749 Ga0496118_0194586 3300048921 Bacteria 1208
750 Ga0496119_0004102 3300048922 Bacteria 14685
751 Ga0496119_0029831 3300048922 Bacteria 3687
752 Ga0496119_0056253 3300048922 Bacteria 2384
753 Ga0496120_0043574 3300048923 Bacteria 2613
754 Ga0496120_0049134 3300048923 Bacteria 2423
755 Ga0496121_0000005 3300048924 Bacteria 1034486
756 Ga0496121_0003531 3300048924 Bacteria 22194
757 Ga0496121_0003988 3300048924 Bacteria 20364
758 Ga0496121_0008277 3300048924 Bacteria 12302
759 Ga0496121_0009440 3300048924 Bacteria 11214
760 Ga0496121_0014636 3300048924 Bacteria 8298
761 Ga0496121_0228514 3300048924 Bacteria 1305
762 Ga0496122_0000565 3300048925 Bacteria 75875
763 Ga0496122_0001036 3300048925 Bacteria 48813
764 Ga0496122_0005625 3300048925 Bacteria 14821
765 Ga0496122_0007679 3300048925 Bacteria 11888
766 Ga0496122_0023009 3300048925 Bacteria 5514
767 Ga0496122_0048469 3300048925 Bacteria 3266
768 Ga0496122_0075317 3300048925 Bacteria 2381
769 Ga0496122_0282790 3300048925 Bacteria 905
770 Ga0496123_0000055 3300048926 Bacteria 233626
771 Ga0496123_0000247 3300048926 Bacteria 109186
772 Ga0496123_0002102 3300048926 Bacteria 25606
773 Ga0496123_0008936 3300048926 Bacteria 9111
774 Ga0496123_0040314 3300048926 Bacteria 3255
775 Ga0496123_0054773 3300048926 Bacteria 2622
776 Ga0496123_0061406 3300048926 Bacteria 2415
777 Ga0496124_0000035 3300048927 Bacteria 318099
778 Ga0496124_0008204 3300048927 Bacteria 10957
779 Ga0496124_0009778 3300048927 Bacteria 9814
780 Ga0496124_0017485 3300048927 Bacteria 6754
781 Ga0496124_0052504 3300048927 Bacteria 3462
782 Ga0496124_0120840 3300048927 Bacteria 2093
783 Ga0496124_0233405 3300048927 Bacteria 1373
784 Ga0496125_0000034 3300048928 Bacteria 348231
785 Ga0496125_0000161 3300048928 Bacteria 150707
786 Ga0496125_0000266 3300048928 Bacteria 107204
787 Ga0496125_0008970 3300048928 Bacteria 10372
788 Ga0496126_0013447 3300048929 Bacteria 8321
789 Ga0496126_0022221 3300048929 Bacteria 6176
790 Ga0496126_0058087 3300048929 Bacteria 3488
791 Ga0496126_0086223 3300048929 Bacteria 2767
792 Ga0495678_000005 3300049459 Bacteria 522958
793 Ga0495678_001061 3300049459 Bacteria 23289
794 Ga0495678_003876 3300049459 Bacteria 8979
795 Ga0495678_005542 3300049459 Bacteria 6934
796 Ga0495678_093102 3300049459 Bacteria 1057
797 Ga0495682_0000393 3300049460 Bacteria 31581
798 Ga0495682_0001543 3300049460 Bacteria 12094
799 Ga0495682_0030792 3300049460 Bacteria 1984
800 Ga0495682_0031766 3300049460 Bacteria 1951
801 Ga0495682_0053446 3300049460 Bacteria 1466
802 Ga0495682_0079108 3300049460 Bacteria 1183
803 Ga0501031_0213518 3300049568 Unclassified 1257
804 Ga0501033_0188868 3300049570 Bacteria 1475
805 Ga0501034_0040564 3300049571 Bacteria 4712
806 Ga0501036_0209961 3300049572 Bacteria 1636
807 Ga0501037_0209353 3300049573 Bacteria 1376
808 Ga0501038_0090129 3300049574 Bacteria 2571
809 Ga0501040_0029490 3300049576 Bacteria 3704
810 Ga0501043_0186491 3300049579 Bacteria 1615
811 Ga0501046_0064317 3300049580 Bacteria 2864
812 Ga0501071_0065219 3300049587 Bacteria 2644
813 Ga0501072_0037498 3300049588 Bacteria 3802
814 Ga0501074_0212353 3300049590 Unclassified 1378
815 Ga0501075_0034514 3300049591 Bacteria 3767
816 Ga0501076_0051094 3300049592 Bacteria 3271
817 Ga0501077_0019800 3300049593 Bacteria 4256
818 Ga0501079_0094277 3300049741 Bacteria 2319
819 Ga0501080_0064762 3300049742 Bacteria 3400
820 Ga0501081_0020717 3300049743 Bacteria 4385
821 Ga0501045_0002223 3300049824 Bacteria 13178
822 nmdc:mga03683_126274_c1 3300050489 Bacteria 1141
823 nmdc:mga03683_41700_c1 3300050489 Bacteria 1886
824 nmdc:mga03683_50458_c1 3300050489 Bacteria 1735
825 nmdc:mga03683_5053_c1 3300050489 Bacteria 4422
826 nmdc:mga03n38_62468_c1 3300050490 Bacteria 1699
827 nmdc:mga00v17_22877_c1 3300050491 Bacteria 3612
828 nmdc:mga00v17_245805_c1 3300050491 Bacteria 1160
829 nmdc:mga0yw44_34560_c1 3300050492 Bacteria 2963
830 nmdc:mga0yw44_45400_c1 3300050492 Bacteria 2634
831 nmdc:mga0k408_153059_c1 3300050493 Bacteria 1374
832 nmdc:mga0k408_193476_c1 3300050493 Bacteria 1214
833 nmdc:mga0k408_290201_c1 3300050493 Bacteria 976
834 nmdc:mga0k408_43645_c1 3300050493 Bacteria 2584
835 nmdc:mga0k408_55925_c1 3300050493 Bacteria 2289
836 nmdc:mga0k408_6388_c1 3300050493 Bacteria 6292
837 nmdc:mga06z11_22523_c1 3300050494 Bacteria 2944
838 nmdc:mga06z11_9219_c1 3300050494 Bacteria 4150
839 nmdc:mga04h51_52650_c1 3300050495 Bacteria 1371
840 nmdc:mga07m45_1812_c1 3300050496 Bacteria 9847
841 nmdc:mga07m45_20536_c1 3300050496 Bacteria 3588
842 nmdc:mga07m45_6130_c1 3300050496 Bacteria 6061
843 nmdc:mga07m45_70564_c1 3300050496 Bacteria 1517
844 nmdc:mga0qj67_169175_c1 3300050509 Bacteria 1774
845 nmdc:mga06r32_40858_c1 3300050510 Bacteria 4405
846 nmdc:mga08y16_71_c1 3300050511 Bacteria 84502
847 nmdc:mga0sz30_12176_c1 3300050516 Bacteria 3340
848 nmdc:mga0sz30_297_c1 3300050516 Bacteria 12453
849 Ga0500610_0004448 3300053079 Bacteria 5570
850 Ga0500578_0129235 3300053086 Bacteria 1585
851 Ga0500578_0164099 3300053086 Bacteria 1376
852 Ga0500644_0009483 3300053088 Bacteria 2605
853 Ga0500651_0065608 3300053093 Bacteria 2262
854 Ga0500651_0176470 3300053093 Bacteria 1271
855 Ga0500650_0089569 3300053098 Bacteria 1440
856 Ga0500555_001653 3300053103 Bacteria 6737
857 Ga0500556_0000200 3300053104 Bacteria 49207
858 Ga0500556_0081647 3300053104 Bacteria 1223
859 Ga0500557_011251 3300053105 Bacteria 2273
860 Ga0500569_003341 3300053109 Bacteria 3268
861 Ga0500594_0000551 3300053118 Bacteria 8097
862 Ga0500658_0007852 3300053134 Bacteria 3942
863 Ga0500568_0000612 3300053139 Bacteria 25826
864 Ga0500588_0054248 3300053146 Bacteria 1262
865 Ga0500590_000323 3300053148 Bacteria 15356
866 Ga0500616_0001106 3300053153 Bacteria 27889
867 Ga0500616_0035069 3300053153 Bacteria 2729
868 Ga0500622_0145694 3300053156 Bacteria 1125
869 Ga0500627_0068506 3300053158 Bacteria 1569
870 Ga0500636_0169942 3300053177 Bacteria 1180
871 Ga0500611_158100 3300053727 Bacteria 626
872 Ga0501084_0004231 3300054114 Bacteria 11692
873 Ga0501082_0007932 3300060353 Bacteria 9172
874 Ga0530510_0149257 3300061734 Bacteria 1725
875 2509074650 2508501114 Bacteria 7082538
876 2509112287 2508501122 Bacteria 6292184
877 2509379412 2509276019 Bacteria 6802256
878 2509390760 2509276021 Bacteria 7634384
879 2509441805 2509276033 Bacteria 7180565
880 2510136360 2510065019 Bacteria 6903379
881 2510284821 2510065053 Bacteria 5005518
882 2510295131 2510065055 Bacteria 5037935
883 2510308676 2510065057 Bacteria 6649661
884 2510312199 2510065058 Bacteria 5005894
885 2510892615 2510461076 Bacteria 8618824
886 2511132834 2510917022 Bacteria 6504556
887 2511186029 2510917028 Bacteria 6185411
888 2511254271 2511231004 Bacteria 6669789
889 2511274521 2511231007 Bacteria 6306603
890 2511293059 2511231010 Bacteria 6373152
891 2511296145 2511231011 Bacteria 6149768
892 2511301727 2511231012 Bacteria 6738011
893 2511312832 2511231014 Bacteria 6462302
894 2511321204 2511231015 Bacteria 6598026
895 2511327176 2511231016 Bacteria 6704427
896 2511330064 2511231017 Bacteria 6503007
897 2511340405 2511231018 Bacteria 6436256
898 2511342475 2511231019 Bacteria 6520662
899 2511351634 2511231020 Bacteria 6115223
900 2511360283 2511231022 Bacteria 6719296
901 2511367051 2511231023 Bacteria 6808468
902 2511412691 2511231031 Bacteria 6558529
903 2511498209 2511231052 Bacteria 6974333
904 2511825242 2511231156 Bacteria 6845832
905 2512529365 2512047086 Bacteria 6850303
906 2512969522 2512875026 Bacteria 6861065
907 2513568656 2513237084 Bacteria 7231967
908 2513579865 2513237085 Bacteria 7695351
909 2513587912 2513237086 Bacteria 7265287
910 2513606254 2513237089 Bacteria 6553624
911 2513619677 2513237091 Bacteria 6900273
912 2513630481 2513237093 Bacteria 7545552
913 2513711234 2513237103 Bacteria 7647401
914 2513885170 2513237140 Bacteria 7076289
915 2513906241 2513237143 Bacteria 6664116
916 2513909472 2513237144 Bacteria 7530820
917 2513923787 2513237146 Bacteria 7166346
918 2513985038 2513237156 Bacteria 6402557
919 2513999040 2513237159 Bacteria 6810126
920 2514007969 2513237160 Bacteria 6650282
921 2514018513 2513237162 Bacteria 7468464
922 2515108696 2515075009 Bacteria 7288508
923 2515610782 2515154107 Bacteria 6795637
924 2515632552 2515154113 Bacteria 7807172
925 2515640483 2515154114 Bacteria 7848616
926 2515656597 2515154116 Bacteria 7552979
927 2515738169 2515154134 Bacteria 7220242
928 2516207527 2516143018 Bacteria 6951533
929 2516896148 2516653046 Bacteria 6989037
930 2517040618 2516653077 Bacteria 7555578
931 2517080231 2516653085 Bacteria 7346596
932 2517098249 2517093000 Bacteria 7412387
933 2517409754 2517287029 Bacteria 6905599
934 2517565600 2517487022 Bacteria 7227575
935 2520380544 2519899620 Bacteria 6499161
936 2523469309 2523231067 Bacteria 5230452
937 2524449582 2524023207 Bacteria 6813453
938 2530648528 2529292951 Bacteria 6916614
939 2551674951 2551306084 Bacteria 8942552
940 2551687267 2551306085 Bacteria 7347181
941 2551692443 2551306086 Bacteria 6843938
942 2551697821 2551306087 Bacteria 7351905
943 2551708279 2551306089 Bacteria 7162724
944 2551721584 2551306090 Bacteria 7953713
945 2551728197 2551306091 Bacteria 7086830
946 2551734443 2551306092 Bacteria 6992595
947 2551743254 2551306093 Bacteria 7064773
948 2558861459 2558860100 Bacteria 8458965
949 2585255578 2582581304 Bacteria 5831370
950 2585272450 2582581307 Bacteria 6597605
951 2585277716 2582581308 Bacteria 7413247
952 2585389412 2582581865 Bacteria 6644329
953 2585397666 2582581866 Bacteria 6859583
954 2585403117 2582581867 Bacteria 7184437
955 2585530023 2585427526 Bacteria 7258840
956 2585533416 2585427527 Bacteria 7273426
957 2585537366 2585427528 Bacteria 6842387
958 2585557250 2585427530 Bacteria 7383882
959 2585561486 2585427531 Bacteria 6992870
960 2585823939 2585427590 Bacteria 6824633
961 2585840228 2585427593 Bacteria 7141551
962 2585901901 2585427608 Bacteria 6544331
963 2585906714 2585427609 Bacteria 6667127
964 2587982135 2585428125 Bacteria 6662905
965 2597864357 2597489888 Bacteria 6179543
966 2597870178 2597489889 Bacteria 6297495
967 2599329875 2599185155 Bacteria 5827168
968 2599398686 2599185167 Bacteria 6353609
969 2599415819 2599185170 Bacteria 7295545
970 2599450741 2599185179 Bacteria 6611171
971 2599504745 2599185188 Bacteria 6164180
972 2599509049 2599185189 Bacteria 5862825
973 2599513175 2599185190 Bacteria 6285678
974 2599520863 2599185191 Bacteria 6297582
975 2599612150 2599185212 Bacteria 6765997
976 2599771708 2599185248 Bacteria 6696816
977 2599880176 2599185288 Bacteria 6666191
978 2599884245 2599185289 Bacteria 6778765
979 2599891851 2599185290 Bacteria 6289611
980 2599899250 2599185291 Bacteria 6775623
981 2599931168 2599185300 Bacteria 6062622
982 2599941420 2599185302 Bacteria 5954930
983 2599947114 2599185303 Bacteria 6512725
984 2599953060 2599185304 Bacteria 5951361
985 2599958615 2599185305 Bacteria 6748700
986 2599968290 2599185306 Bacteria 6637356
987 2599970178 2599185307 Bacteria 6194719
988 2599979476 2599185308 Bacteria 6621546
989 2599982686 2599185309 Bacteria 5969593
990 2599989713 2599185310 Bacteria 6014457
991 2599993064 2599185311 Bacteria 6354990
992 2599998610 2599185312 Bacteria 5912071
993 2600003522 2599185313 Bacteria 6658188
994 2600010015 2599185314 Bacteria 6621749
995 2600018099 2599185315 Bacteria 6771107
996 2600022947 2599185316 Bacteria 6320029
997 2600028913 2599185317 Bacteria 6435722
998 2600036777 2599185318 Bacteria 6961590
999 2600042999 2599185319 Bacteria 6637840
1000 2600047288 2599185320 Bacteria 5963263
1001 2600052618 2599185321 Bacteria 6764560
1002 2600058040 2599185322 Bacteria 6763055
1003 2600066285 2599185323 Bacteria 6688755
1004 2600069455 2599185324 Bacteria 6590677
1005 2600076315 2599185325 Bacteria 6324919
1006 2600358080 2600254930 Bacteria 6431253
1007 2601624505 2600255283 Bacteria 6061572
1008 2601691579 2600255296 Bacteria 5784754
1009 2601798804 2600255318 Bacteria 6383414
1010 2606077699 2603880185 Bacteria 6379190
1011 2606130126 2603880199 Bacteria 6377649
1012 2616297834 2615840624 Bacteria 6557588
1013 2616310605 2615840626 Bacteria 7921970
1014 2616553139 2615840698 Bacteria 7319877
1015 2617384460 2617270742 Bacteria 6808054
1016 2621299255 2619619299 Bacteria 6649820
1017 2624481041 2623620443 Bacteria 6427864
1018 2624491621 2623620446 Bacteria 6500345
1019 2643808956 2643221557 Bacteria 7184309
1020 2643841558 2643221565 Bacteria 6216018
1021 2643870538 2643221571 Bacteria 6228673
1022 2644069199 2643221610 Bacteria 7480339
1023 2644104848 2643221618 Bacteria 7717186
1024 2644129972 2643221623 Bacteria 5239945
1025 2644151279 2643221626 Bacteria 8069654
1026 2644186503 2643221633 Bacteria 6733554
1027 2644280837 2643221650 Bacteria 7029547
1028 2644313267 2643221655 Bacteria 7722067
1029 2644336353 2643221659 Bacteria 7890716
1030 2644378548 2643221668 Bacteria 7306521
1031 2644420270 2643221675 Bacteria 7473456
1032 2644453677 2643221680 Bacteria 7473610
1033 2644494919 2643221688 Bacteria 5260751
1034 2644547189 2643221698 Bacteria 7756764
1035 2644612890 2643221712 Bacteria 7729434
1036 2644622861 2643221713 Bacteria 6554480
1037 2644692376 2643221726 Bacteria 7455827
1038 2652547715 2651869719 Bacteria 6047974
1039 2657684296 2657244999 Bacteria 5946535
1040 2671091319 2667528170 Bacteria 6786960
1041 2671116991 2667528174 Bacteria 6435400
1042 2671129372 2667528176 Bacteria 6724917
1043 2677896066 2675903420 Bacteria 6247433
1044 2678263191 2675903515 Bacteria 6580491
1045 2687579157 2687453129 Bacteria 4387428
1046 2692318428 2690316117 Bacteria 6800650
1047 2715750579 2713897148 Bacteria 5883533
1048 2715757084 2713897149 Bacteria 6506249
1049 2718633938 2718217725 Bacteria 5758958
1050 2719184670 2718217882 Bacteria 6556348
1051 2719389294 2718217927 Bacteria 6972593
1052 2719668650 2718217997 Bacteria 6740740
1053 2719728690 2718218009 Bacteria 6478651
1054 2720489343 2718218199 Bacteria 6740745
1055 2720610025 2718218232 Bacteria 6720332
1056 2720617448 2718218233 Bacteria 6662049
1057 2720628594 2718218235 Bacteria 6630699
1058 2720772544 2718218269 Bacteria 6906114
1059 2721144381 2718218363 Bacteria 6524337
1060 2721156325 2718218365 Bacteria 6274507
1061 2721161751 2718218366 Bacteria 6425255
1062 2721402060 2718218423 Bacteria 6438183
1063 2722842896 2721755514 Bacteria 6424414
1064 2723029983 2721755556 Bacteria 6745503
1065 2723248400 2721755607 Bacteria 5841722
1066 2723564388 2721755684 Bacteria 6859907
1067 2723569970 2721755685 Bacteria 6704835
1068 2724035893 2721755809 Bacteria 6438790
1069 2724041715 2721755810 Bacteria 6479005
1070 2724092573 2721755819 Bacteria 6906405
1071 2724101517 2721755822 Bacteria 6726041
1072 2724112949 2721755823 Bacteria 6752556
1073 2725949625 2724679232 Bacteria 7646494
1074 2730110516 2728369352 Bacteria 6745171
1075 2730160785 2728369365 Bacteria 6555560
1076 2730295858 2728369397 Bacteria 6274511
1077 2738674797 2738541265 Bacteria 6594665
1078 2738687997 2738541271 Bacteria 5657310
1079 2738753190 2738541282 Bacteria 6593925
1080 2738806396 2738541294 Bacteria 6925949
1081 2738862101 2738541303 Bacteria 6591772
1082 2738893756 2738541309 Bacteria 6926455
1083 2739036151 2738541333 Bacteria 7106503
1084 2739199236 2738543004 Bacteria 6381073
1085 2739257081 2738543015 Bacteria 6750701
1086 2739263568 2738543016 Bacteria 5657564
1087 2739309963 2738543024 Bacteria 5603683
1088 2739314620 2738543025 Bacteria 6600348
1089 2739349593 2738543031 Bacteria 5769731
1090 2745009523 2744054620 Bacteria 6551379
1091 2753463552 2751185821 Bacteria 6189929
1092 2765467273 2765235802 Bacteria 5618596
1093 2766069125 2765235942 Bacteria 7445910
1094 2774120154 2773857670 Bacteria 6407454
1095 2774131323 2773857672 Bacteria 4993178
1096 2774134008 2773857673 Bacteria 6513460
1097 2776273061 2775506902 Bacteria 6208009
1098 2776282096 2775506904 Bacteria 5954060
1099 2778177884 2775507266 Bacteria 7392367
1100 2784264224 2784132063 Bacteria 6262788
1101 2784311915 2784132072 Bacteria 6596533
1102 2792580481 2791355082 Bacteria 5973319
1103 2792619488 2791355091 Bacteria 6135441
1104 2792627259 2791355092 Bacteria 6248105
1105 2792639844 2791355094 Bacteria 7011481
1106 2793297810 2791355256 Bacteria 6798008
1107 2793312862 2791355259 Bacteria 7254731
1108 2793322468 2791355260 Bacteria 6598818
1109 2793331904 2791355261 Bacteria 6661293
1110 2793337540 2791355262 Bacteria 6774204
1111 2793344412 2791355263 Bacteria 6872478
1112 2793345560 2791355264 Bacteria 6429314
1113 2793354968 2791355265 Bacteria 6539969
1114 2793363699 2791355266 Bacteria 7116587
1115 2793370366 2791355267 Bacteria 7222458
1116 2794597644 2791355520 Bacteria 5948615
1117 2802722043 2802428858 Bacteria 6636079
1118 2802723024 2802428859 Bacteria 6667919
1119 2802728843 2802428860 Bacteria 6525526
1120 2802735210 2802428861 Bacteria 6534206
1121 2802742186 2802428862 Bacteria 6633353
1122 2802748633 2802428863 Bacteria 6410669
1123 2804754702 2802429268 Bacteria 6094027
1124 2805927229 2802429605 Bacteria 6875453
1125 2805934343 2802429606 Bacteria 6346811
1126 2806046273 2802429633 Bacteria 7341974
1127 2806053193 2802429634 Bacteria 7083200
1128 2806059599 2802429635 Bacteria 7650140
1129 2806068661 2802429636 Bacteria 7597525
1130 2806075083 2802429637 Bacteria 7067217
1131 2808855302 2808606361 Bacteria 6136259
1132 2808923024 2808606376 Bacteria 6248667
1133 2808932921 2808606377 Bacteria 6646337
1134 2808935122 2808606378 Bacteria 6177535
1135 2808945102 2808606380 Bacteria 6248705
1136 2808955010 2808606381 Bacteria 6646461
1137 2808956378 2808606382 Bacteria 6841132
1138 2808963807 2808606383 Bacteria 6138645
1139 2808978732 2808606385 Bacteria 6711065
1140 2808994464 2808606388 Bacteria 6706662
1141 2808998695 2808606389 Bacteria 6138126
1142 2809214633 2808606445 Bacteria 6057339
1143 2817491643 2816332298 Bacteria 6852809
1144 2819613728 2818991448 Bacteria 6772224
1145 2819643091 2818991453 Bacteria 7181617
1146 2819659453 2818991456 Bacteria 6123676
1147 2825652579 2825651385 Bacteria 6715909
1148 2826583813 2826581358 Bacteria 5963467
1149 2834030196 2834028612 Bacteria 6354979
1150 2838016144 2838016132 Bacteria 6577831
1151 2838025327 2838022645 Bacteria 6494267
1152 2838032842 2838029111 Bacteria 6603031
1153 2838035936 2838035591 Bacteria 7166484
1154 2838044263 2838042994 Bacteria 6046894
1155 2838049766 2838048938 Bacteria 6044578
1156 2838062033 2838061910 Bacteria 6794874
1157 2838068676 2838068647 Bacteria 6208656
1158 2838077728 2838074704 Bacteria 6785777
1159 2838665054 2838661181 Bacteria 7385261
1160 2838669456 2838668709 Bacteria 6671819
1161 2838684543 2838680041 Bacteria 6545511
1162 2838690754 2838686498 Bacteria 7807632
1163 2838698704 2838694306 Bacteria 6853137
1164 2838701827 2838701080 Bacteria 6669771
1165 2838712415 2838707686 Bacteria 6619912
1166 2838735800 2838729681 Bacteria 7400765
1167 2838748704 2838742623 Bacteria 7396178
1168 2839996473 2839993093 Bacteria 5512535
1169 2840770414 2840764183 Bacteria 6358399
1170 2841858325 2841851746 Bacteria 7532261
1171 2841865926 2841864319 Bacteria 6742987
1172 2842116801 2842110456 Bacteria 7656360
1173 2842122814 2842118031 Bacteria 7033875
1174 2842160620 2842156927 Bacteria 6894975
1175 2842164115 2842163707 Bacteria 6916235
1176 2842184236 2842180545 Bacteria 6888678
1177 2842196096 2842192696 Bacteria 6147454
1178 2842200893 2842198810 Bacteria 6608673
1179 2842209735 2842205361 Bacteria 6340321
1180 2842219921 2842217011 Bacteria 7497767
1181 2842231818 2842229732 Bacteria 7475766
1182 2842241827 2842237096 Bacteria 6620661
1183 2842249506 2842243621 Bacteria 7421798
1184 2842251749 2842250916 Bacteria 6579627
1185 2842263614 2842257432 Bacteria 7401195
1186 2842265014 2842264693 Bacteria 6472963
1187 2842274931 2842271015 Bacteria 7807131
1188 2842283189 2842278818 Bacteria 6340002
1189 2842295662 2842291075 Bacteria 7076806
1190 2842307621 2842304105 Bacteria 7023636
1191 2842315633 2842311132 Bacteria 6616990
1192 2842320149 2842317721 Bacteria 6793725
1193 2842347710 2842341865 Bacteria 7003929
1194 2842364171 2842363717 Bacteria 6844742
1195 2842374456 2842370503 Bacteria 7038661
1196 2842382066 2842377471 Bacteria 7140707
1197 2842389362 2842384541 Bacteria 7057858
1198 2842397204 2842395702 Bacteria 6780583
1199 2842405768 2842402390 Bacteria 6681310
1200 2842412352 2842409023 Bacteria 6687331
1201 2842418998 2842415677 Bacteria 6596907
1202 2842422822 2842422224 Bacteria 6239196
1203 2842428932 2842428310 Bacteria 6767288
1204 2842435545 2842434925 Bacteria 6502746
1205 2842441592 2842441272 Bacteria 6769273
1206 2842448366 2842447887 Bacteria 6754142
1207 2842463356 2842462802 Bacteria 6588055
1208 2842469876 2842469257 Bacteria 6752936
1209 2842479575 2842475841 Bacteria 6603183
1210 2842486648 2842482326 Bacteria 7212537
1211 2842489725 2842489311 Bacteria 6620893
1212 2842498231 2842495871 Bacteria 6820686
1213 2842506760 2842502639 Bacteria 6604161
1214 2842524784 2842521101 Bacteria 6569494
1215 2842816073 2842815866 Bacteria 5947510
1216 2842830847 2842826826 Bacteria 5974129
1217 2842835017 2842832357 Bacteria 5959113
1218 2842840265 2842837860 Bacteria 6066181
1219 2842846754 2842843487 Bacteria 6004777
1220 2842851120 2842849001 Bacteria 5924277
1221 2842855121 2842854478 Bacteria 6143501
1222 2844169599 2844163670 Bacteria 7266046
1223 2844460408 2844454524 Bacteria 7952546
1224 2847423070 2847417321 Bacteria 6913799
1225 2848997537 2848992105 Bacteria 6810864
1226 2850084573 2850079185 Bacteria 6848280
1227 2852614119 2852612431 Bacteria 6885235
1228 2852657691 2852657418 Bacteria 6472974
1229 2852668144 2852667396 Bacteria 6885555
1230 2855829027 2855825444 Bacteria 6785811
1231 2855844145 2855839649 Bacteria 7135830
1232 2855874057 2855872281 Bacteria 6964271
1233 2857517953 2857516855 Bacteria 7787325
1234 2858806605 2858800743 Bacteria 6603254
1235 2860342949 2860339153 Bacteria 6846989
1236 2860870276 2860867994 Bacteria 5645326
1237 2878032966 2878029506 Bacteria 6418441
1238 2880233697 2880230671 Bacteria 6140320
1239 2891374313 2891373044 Bacteria 5202277
1240 2894656881 2894652903 Bacteria 4587256
1241 2896391841 2896384573 Bacteria 7700774
1242 2899806986 2899803654 Bacteria 5577784
1243 2904519890 2904518522 Bacteria 6068986
1244 2904554442 2904550169 Bacteria 6221258
1245 2904582606 2904578770 Bacteria 5302906
1246 2908450309 2908446538 Bacteria 6829095
1247 2913038966 2913036834 Bacteria 6704877
1248 2913296783 2913295892 Bacteria 6333755
1249 2915983617 2915980308 Bacteria 6624279
1250 2915992193 2915986958 Bacteria 6739310
1251 2915999267 2915993759 Bacteria 7016183
1252 2916001352 2916000859 Bacteria 6865702
1253 2916011596 2916007675 Bacteria 6898660
1254 2916018871 2916014648 Bacteria 6946486
1255 2916026078 2916021584 Bacteria 6854472
1256 2916032095 2916028427 Bacteria 6748433
1257 2916039041 2916035215 Bacteria 6755766
1258 2916046168 2916041962 Bacteria 6820487
1259 2916051903 2916048683 Bacteria 6543552
1260 2916060892 2916055098 Bacteria 6758838
1261 2916065315 2916061851 Bacteria 6737736
1262 2916070117 2916068649 Bacteria 6943657
1263 2916077900 2916076590 Bacteria 6596108
1264 2917834192 2917832318 Bacteria 5346010
1265 2919064722 2919063839 Bacteria 6302690
1266 2919124086 2919119836 Bacteria 5208557
1267 2919127746 2919125081 Bacteria 5385106
1268 2919390237 2919385768 Bacteria 5897293
1269 2919451764 2919450847 Bacteria 5631160
1270 2919460530 2919456309 Bacteria 6586567
1271 2919483978 2919481497 Bacteria 6907839
1272 2919489268 2919487758 Bacteria 5929766
1273 2919703384 2919697872 Bacteria 6553725
1274 2920765018 2920760137 Bacteria 7427611
1275 2921203572 2921201388 Bacteria 6926299
1276 2921209968 2921208531 Bacteria 6745326
1277 2921237772 2921237296 Bacteria 6876710
1278 2921248305 2921244191 Bacteria 6568419
1279 2921256856 2921250672 Bacteria 6677771
1280 2921260996 2921257292 Bacteria 6808382
1281 2921267911 2921263974 Bacteria 6864552
1282 2921283710 2921282425 Bacteria 6826397
1283 2921289715 2921289301 Bacteria 7316391
1284 2921297832 2921296804 Bacteria 7176999
1285 2923586825 2923586266 Bacteria 6565975
1286 2924145728 2924144063 Bacteria 6883928
1287 2924155830 2924150972 Bacteria 7169444
1288 2924162431 2924158325 Bacteria 7188855
1289 2924166684 2924165586 Bacteria 7260590
1290 2924179581 2924172951 Bacteria 6749356
1291 2924183384 2924179722 Bacteria 6843264
1292 2924186849 2924186466 Bacteria 6876637
1293 2924204577 2924200457 Bacteria 6757188
1294 2924213692 2924207177 Bacteria 6917007
1295 2924217236 2924214083 Bacteria 7080103
1296 2924222615 2924221636 Bacteria 7113495
1297 2924233890 2924228884 Bacteria 6633132
1298 2929142571 2929138655 Bacteria 5810547
1299 2929147912 2929144301 Bacteria 6622272
1300 2929192963 2929189879 Bacteria 5930554
1301 2931370180 2931369376 Bacteria 6847892
1302 2931393572 2931390751 Bacteria 6273349
1303 2931401563 2931396565 Bacteria 7251677
1304 2933020129 2933016740 Bacteria 6355406
1305 2933573724 2933570622 Bacteria 7023390
1306 2933593017 2933586486 Bacteria 7667493
1307 2933600294 2933599457 Bacteria 5858799
1308 2935898622 2935894831 Bacteria 6620579
1309 2935903216 2935901341 Bacteria 7341747
1310 2936374455 2936367885 Bacteria 7324495
1311 2936378703 2936375103 Bacteria 6652732
1312 2936384427 2936381700 Bacteria 7006523
1313 2937002249 2936996657 Bacteria 6298727
1314 2937007241 2937002841 Bacteria 6934057
1315 2937016035 2937009748 Bacteria 6746052
1316 2937020762 2937016420 Bacteria 6782579
1317 2937026934 2937023124 Bacteria 6815156
1318 2937034969 2937029754 Bacteria 6424026
1319 2937039200 2937036028 Bacteria 6846469
1320 2937048046 2937042894 Bacteria 6741576
1321 2937054141 2937049772 Bacteria 6757901
1322 2937060596 2937056579 Bacteria 7107896
1323 2937068030 2937063883 Bacteria 7199456
1324 2937071598 2937071275 Bacteria 6984483
1325 2937084387 2937078374 Bacteria 6610289
1326 2937091408 2937084907 Bacteria 6618516
1327 2937095319 2937091812 Bacteria 6979387
1328 2937103584 2937098957 Bacteria 7249374
1329 2937110317 2937106411 Bacteria 6947143
1330 2937117176 2937113482 Bacteria 6505872
1331 2937123603 2937119839 Bacteria 6597547
1332 2937130538 2937126314 Bacteria 6771275
1333 2941504485 2941499720 Bacteria 7599444
1334 2945933110 2945928738 Bacteria 6053221
1335 2945964335 2945961074 Bacteria 7342064
1336 2946010410 2946006987 Bacteria 6705746
1337 2946030511 2946027586 Bacteria 6049274
1338 2947238164 2947233263 Bacteria 6439278
1339 2957379116 2957375807 Bacteria 6425588
1340 2957386350 2957382221 Bacteria 6737050
1341 2957392771 2957388812 Bacteria 6778072
1342 2957401463 2957395598 Bacteria 6822399
1343 2957406662 2957402308 Bacteria 6741770
1344 2957414649 2957408893 Bacteria 6558585
1345 2957415719 2957415311 Bacteria 6991633
1346 2957427370 2957422303 Bacteria 7172205
1347 2957437915 2957437181 Bacteria 6568994
1348 2957450482 2957443900 Bacteria 6869977
1349 2957457521 2957450854 Bacteria 6765715
1350 2957461459 2957457609 Bacteria 6967680
1351 2957468597 2957464669 Bacteria 6568877
1352 2957471586 2957471148 Bacteria 6797643
1353 2957484254 2957478035 Bacteria 6756658
1354 2957488621 2957484790 Bacteria 6703082
1355 2957497262 2957491536 Bacteria 6695180
1356 2957505329 2957498199 Bacteria 7126688
1357 2957509676 2957505466 Bacteria 7253085
1358 2960585878 2960584000 Bacteria 6864594
1359 2960596432 2960591022 Bacteria 6622873
1360 2960601095 2960597568 Bacteria 6550735
1361 2960608829 2960603979 Bacteria 6898737
1362 2960617139 2960610863 Bacteria 6691244
1363 2960623588 2960617483 Bacteria 6727748
1364 2960625719 2960624210 Bacteria 6875384
1365 2960634336 2960631154 Bacteria 6732508
1366 2960645317 2960637947 Bacteria 7296468
1367 2960649769 2960645483 Bacteria 7211087
1368 2960654722 2960652885 Bacteria 7083688
1369 2960667286 2960660292 Bacteria 7041660
1370 2960671626 2960667422 Bacteria 6763020
1371 2960679881 2960674078 Bacteria 6609048
1372 2960683435 2960680706 Bacteria 6624464
1373 2960693832 2960687367 Bacteria 6535474
1374 2960695287 2960693952 Bacteria 6749742
1375 2964611951 2964607997 Bacteria 7101408
1376 2964619642 2964615318 Bacteria 6809089
1377 2964623583 2964621998 Bacteria 6834995
1378 2964636007 2964628898 Bacteria 7083044
1379 2964640065 2964636051 Bacteria 7091832
1380 2964647444 2964643177 Bacteria 6820887
1381 2964653801 2964649959 Bacteria 6675118
1382 2964663397 2964656573 Bacteria 7100150
1383 2964670540 2964663802 Bacteria 7019362
1384 2964673141 2964670856 Bacteria 6851364
1385 2964682782 2964678106 Bacteria 6792020
1386 2964690168 2964685014 Bacteria 6839111
1387 2964695597 2964691889 Bacteria 6802758
1388 2964703763 2964698721 Bacteria 6765331
1389 2964712625 2964705432 Bacteria 7114648
1390 2964716267 2964712639 Bacteria 6695970
1391 2964720625 2964719344 Bacteria 7286602
1392 2967665763 2967664464 Bacteria 6948836
1393 2967672515 2967671571 Bacteria 7021409
1394 2967683339 2967678726 Bacteria 7264382
1395 2967688008 2967686174 Bacteria 6678622
1396 2967696993 2967693043 Bacteria 6804451
1397 2967703942 2967699805 Bacteria 6854538
1398 2967711173 2967706974 Bacteria 7186053
1399 2967718418 2967714385 Bacteria 7000047
1400 2967727007 2967721400 Bacteria 7073753
1401 2967734056 2967728569 Bacteria 6641507
1402 2967738813 2967735183 Bacteria 6827012
1403 2967747978 2967742019 Bacteria 6794534
1404 2967759418 2967755722 Bacteria 6814706
1405 2967766277 2967762386 Bacteria 6923502
1406 2967773556 2967769361 Bacteria 6587838
1407 2967780797 2967775926 Bacteria 6738189
1408 2969307881 2969304461 Bacteria 6601805
1409 2970020129 2970019648 Bacteria 7072033
1410 2970028930 2970026789 Bacteria 6785236
1411 2970034226 2970033650 Bacteria 7118744
1412 2970042409 2970040964 Bacteria 6731123
1413 2970051672 2970047711 Bacteria 7088379
1414 2970059189 2970054988 Bacteria 6611507
1415 2970065406 2970061556 Bacteria 7099761
1416 2970074089 2970068827 Bacteria 7123112
1417 2970080732 2970076120 Bacteria 6697332
1418 2970087098 2970082768 Bacteria 6183754
1419 2970093138 2970088815 Bacteria 6933825
1420 2970099666 2970095765 Bacteria 6936963
1421 2970106507 2970102677 Bacteria 6812532
1422 2970113698 2970109326 Bacteria 6863976
1423 2970120066 2970116247 Bacteria 6501857
1424 2970128481 2970122695 Bacteria 6625855
1425 2970135708 2970129317 Bacteria 6806560
1426 2970141918 2970136068 Bacteria 7207982
1427 2970147812 2970143518 Bacteria 6446480
1428 2970154086 2970149975 Bacteria 6779706
1429 2970161916 2970156795 Bacteria 7168044
1430 2970168101 2970164137 Bacteria 6861252
1431 2970171607 2970170962 Bacteria 6876229
1432 2970184547 2970177841 Bacteria 6768001
1433 2970190232 2970184632 Bacteria 7054431
1434 2970195935 2970191845 Bacteria 7032787
1435 2974291258 2974289157 Bacteria 6080362
1436 2974298662 2974298342 Bacteria 4840922
1437 2977517617 2977516862 Bacteria 6940108
1438 2977530685 2977523885 Bacteria 6960446
1439 2977533933 2977530762 Bacteria 6951399
1440 2977541596 2977537788 Bacteria 6929320
1441 2977548021 2977544691 Bacteria 6875412
1442 2977556296 2977551784 Bacteria 7125765
1443 2977565764 2977558990 Bacteria 6863948
1444 2977570189 2977565890 Bacteria 6901543
1445 2977576928 2977572785 Bacteria 6763888
1446 2977583429 2977579622 Bacteria 6772100
1447 2980127607 2980125574 Bacteria 5567337
1448 2984500905 2984499530 Bacteria 5020881
1449 2984505653 2984504281 Bacteria 5262371
1450 2988733952 2988728565 Bacteria 6124362
1451 2996891197 2996887358 Bacteria 5795980
1452 2996894397 2996893221 Bacteria 5823108
1453 2998142520 2998139840 Bacteria 6073514
1454 3002142153 3002141150 Bacteria 5254435
1455 3003935637 3003930520 Bacteria 5667563
1456 3005414876 3005409236 Bacteria 7188837
1457 3005419809 3005416602 Bacteria 7064308
1458 3005447474 3005445848 Bacteria 6906074
1459 3007422990 3007419365 Bacteria 7026924
1460 3007514020 3007511990 Bacteria 6481491
1461 3007616164 3007614139 Bacteria 6053559
1462 3007623407 3007619802 Bacteria 6411688
1463 3007722579 3007718800 Bacteria 5971527
1464 3007856672 3007855910 Bacteria 5637581
1465 3007861805 3007861166 Bacteria 6045338
1466 3007868605 3007866637 Bacteria 5899198
1467 639644844 639633055 Bacteria 7751309
1468 643823033 643692032 Bacteria 6891900
1469 648738313 648276728 Bacteria 6968865
1470 8002288445 8002285264 Bacteria 6717907
1471 8003996725 8003992118 Bacteria 7266902
1472 8004004077 8003999396 Bacteria 7063185
1473 8005261860 8005258706 Bacteria 6184835
1474 8005277637 8005275841 Bacteria 6929066
1475 8005288519 8005282627 Bacteria 6675747
1476 8005290500 8005289223 Bacteria 6634003
1477 8005301078 8005301065 Bacteria 6614431
1478 8005307985 8005307578 Bacteria 7395396
1479 8005316375 8005314921 Bacteria 7072929
1480 8005325724 8005321885 Bacteria 5795980
1481 8005379741 8005376324 Bacteria 6590079
1482 8005385257 8005382845 Bacteria 6732062
1483 8005396174 8005395548 Bacteria 6806915
1484 8005431439 8005430974 Bacteria 6689030
1485 8005467129 8005460587 Bacteria 7157962
1486 8005487539 8005484373 Bacteria 6297373
1487 8005502898 8005497431 Bacteria 6477605
1488 8005562426 8005556819 Bacteria 6908598
1489 8005566199 8005563573 Bacteria 7153261
1490 8005572275 8005570704 Bacteria 6957481
1491 8005624048 8005619151 Bacteria 7030230
1492 8005629313 8005626139 Bacteria 6534237
1493 8005651727 8005645114 Bacteria 6950293
1494 8005674328 8005668836 Bacteria 6953162
1495 8005683462 8005682033 Bacteria 6726518
1496 8005689108 8005688590 Bacteria 6610080
1497 8005697832 8005695170 Bacteria 6912330
1498 8016732414 8016728285 Bacteria 5263933
1499 8018132106 8018127388 Bacteria 7351159
1500 8018163473 8018163183 Bacteria 7277977
1501 8018180502 8018176218 Bacteria 6896178
1502 8019778465 8019775933 Bacteria 6858656
1503 8023681850 8023680758 Bacteria 7729763
1504 8024482347 8024479707 Bacteria 6954785
1505 8024488872 8024486573 Bacteria 6540512
1506 8024507252 8024501048 Bacteria 6427847
1507 8029998174 8029995093 Bacteria 5990776
1508 8045868664 8045864390 Bacteria 5043873
1509 8046772864 8046767195 Bacteria 7547379
1510 8049298480 8049293176 Bacteria 6128433
1511 8054289494 8054285046 Bacteria 6919322
1512 8054351453 8054347763 Bacteria 5901107
1513 8054506682 8054503363 Bacteria 6101651
1514 8054561498 8054558443 Bacteria 5204801
1515 8055821469 8055817908 Bacteria 6609162
1516 8056134414 8056131705 Bacteria 6107031
1517 8056146864 8056143049 Bacteria 6307666
1518 8056154953 8056148874 Bacteria 6479865
1519 8056159127 8056155041 Bacteria 6486948
1520 8056165755 8056161164 Bacteria 6106669
1521 8056168564 8056166840 Bacteria 5820959
1522 8056174577 8056172158 Bacteria 6133900
1523 8056177980 8056177738 Bacteria 6748268
1524 8056377859 8056375014 Bacteria 7006639
1525 8056382535 8056382006 Bacteria 6408074
1526 8056571327 8056569372 Bacteria 5997322
1527 8057529717 8057529695 Bacteria 6306553
1528 8057878153 8057874678 Bacteria 7494653
1529 MRS2a_Contig_34
1530 SwRhRL2b_contig_1025407
1531 JGI24740J21852_10007416
1532 JGI25156J39149_1000468
1533 JGI25162J39368_1000013
1534 JGI25154J39366_1000486
1535 JGI25154J39366_1014315
1536 JGI25157J39369_1000494
1537 JGI25163J39215_1000525
1538 JGI25164J39214_1000005
1539 JGI25152J39213_1000197
1540 JGI25152J39213_1015488
1541 JGI25151J46595_10000472
1542 JGI25165J46597_1000340
1543 JGI25165J46597_1000610
1544 JGI25165J46597_1008934
1545 JGI25153J46596_10000948
1546 JGI25153J46596_10003407
1547 JGI25153J46596_10011358
1548 rootH1_10037537
1549 rootH2_10073684
1550 rootH2_10087052
1551 rootL2_10004929
1552 rootL2_10182883
1553 JGI25160J50197_1004711
1554 JGI25161J50226_1003205
1555 Ga0055538_1000130
1556 Ga0055539_1000173
1557 Ga0055533_1000177
1558 Ga0055532_1000171
1559 Ga0055525_1000244
1560 Ga0055535_1003932
1561 Ga0055542_1014809
1562 Ga0055526_1009475
1563 Ga0055524_1001942
1564 Ga0055524_1011492
1565 Ga0055524_1019621
1566 Ga0055528_1000475
1567 Ga0055528_1001747
1568 Ga0055530_10000002
1569 Ga0055530_10001684
1570 Ga0055530_10005707
1571 Ga0055540_1000009
1572 Ga0055540_1000096
1573 Ga0055540_1000236
1574 Ga0055540_1006624
1575 Ga0055531_10002872
1576 Ga0055541_1000115
1577 Ga0058692_1007015
1578 Ga0055543_1001197
1579 Ga0065714_10000197
1580 Ga0065714_10002523
1581 Ga0065714_10002696
1582 Ga0065714_10012489
1583 Ga0065714_10068233
1584 Ga0065714_10068369
1585 Ga0065714_10086694
1586 Ga0065704_10012815
1587 Ga0065704_10070326
1588 Ga0065704_10083205
1589 Ga0065712_10011348
1590 Ga0065712_10067891
1591 Ga0070676_10023480
1592 Ga0070676_10057979
1593 Ga0070670_100000613
1594 Ga0070670_100097767
1595 Ga0068869_100105989
1596 Ga0070666_10089273
1597 Ga0070680_100158639
1598 Ga0070660_100065289
1599 Ga0070661_100000252
1600 Ga0070668_100034545
1601 Ga0070668_100181761
1602 Ga0070668_100331913
1603 Ga0070669_100001585
1604 Ga0070669_100089237
1605 Ga0070669_100113805
1606 Ga0070675_100052395
1607 Ga0070671_100206529
1608 Ga0070674_100046055
1609 Ga0070674_100145520
1610 Ga0070674_100650008
1611 Ga0070673_100097003
1612 Ga0070673_100107901
1613 Ga0070673_100536406
1614 Ga0070667_100230130
1615 Ga0070663_100114604
1616 Ga0070678_100504858
1617 Ga0070662_100000714
1618 Ga0070662_100152777
1619 Ga0070681_10013436
1620 Ga0070706_100006049
1621 Ga0070707_100155873
1622 Ga0070679_100205382
1623 Ga0070672_100287339
1624 Ga0070665_100022842
1625 Ga0070665_100250690
1626 Ga0070665_100433416
1627 Ga0068855_100170518
1628 Ga0070664_100000186
1629 Ga0068857_100063405
1630 Ga0068856_100019557
1631 Ga0068852_100711403
1632 Ga0068859_100457736
1633 Ga0068864_100844583
1634 Ga0068866_10087678
1635 Ga0068866_10418444
1636 Ga0068861_100085337
1637 Ga0068851_10000045
1638 Ga0068862_100029896
1639 Ga0075365_10006047
1640 Ga0075365_10030678
1641 Ga0075365_10075310
1642 Ga0075365_10095450
1643 Ga0075365_10099179
1644 Ga0075365_10225166
1645 Ga0075368_10020035
1646 Ga0075368_10048320
1647 Ga0075368_10170937
1648 Ga0075363_100051405
1649 Ga0075363_100089817
1650 Ga0075364_10009059
1651 Ga0075364_10019762
1652 Ga0075364_10041293
1653 Ga0075364_10222583
1654 Ga0075364_10392696
1655 Ga0075362_10004078
1656 Ga0075362_10029894
1657 Ga0075362_10040780
1658 Ga0075362_10048102
1659 Ga0075362_10065743
1660 Ga0075367_10010717
1661 Ga0075367_10110330
1662 Ga0075369_10055904
1663 Ga0075369_10165369
1664 Ga0075369_10189409
1665 Ga0075366_10071283
1666 Ga0075366_10117236
1667 Ga0075370_10005158
1668 Ga0075370_10011266
1669 Ga0075370_10135934
1670 Ga0075370_10212884
1671 Ga0075431_100010054
1672 Ga0068865_100051758
1673 Ga0068865_100058575
1674 Ga0068865_100075107
1675 Ga0097620_100457689
1676 Ga0079104_1000006
1677 Ga0079104_1005750
1678 Ga0079104_1023710
1679 Ga0099826_10057539
1680 Ga0105251_10000001
1681 Ga0105251_10000406
1682 Ga0105251_10010981
1683 Ga0105251_10057305
1684 Ga0105244_10000519
1685 Ga0105244_10002745
1686 Ga0105244_10007547
1687 Ga0105244_10012468
1688 Ga0105244_10014973
1689 Ga0105244_10020420
1690 Ga0105244_10022435
1691 Ga0105244_10075381
1692 Ga0105250_10001116
1693 Ga0105250_10001248
1694 Ga0105250_10030673
1695 Ga0105240_10000376
1696 Ga0105240_10086767
1697 Ga0105245_10411663
1698 Ga0105245_10451204
1699 Ga0114129_10011124
1700 Ga0105243_10000170
1701 Ga0105243_10014408
1702 Ga0105243_10432832
1703 Ga0105242_10000474
1704 Ga0105248_10160637
1705 Ga0105237_10001377
1706 Ga0105237_10001450
1707 Ga0105237_10018035
1708 Ga0105238_10418081
1709 Ga0105249_10054998
1710 Ga0105249_10145116
1711 Ga0123340_1048316
1712 Ga0123341_1000005
1713 Ga0123342_1012900
1714 Ga0105239_10022339
1715 Ga0105239_10089657
1716 Ga0105246_10000114
1717 Ga0105246_10001525
1718 Ga0105246_10206465
1719 Ga0157345_1002561
1720 Ga0157373_10012988
1721 Ga0157373_10022025
1722 Ga0157373_10055062
1723 Ga0157373_10095319
1724 Ga0157371_10000109
1725 Ga0157371_10000754
1726 Ga0157370_10005715
1727 Ga0157370_10019939
1728 Ga0157370_10040968
1729 Ga0157370_10149566
1730 Ga0157369_10003795
1731 Ga0157369_10045106
1732 Ga0157369_10177905
1733 Ga0157369_10379484
1734 Ga0157369_10395537
1735 Ga0157374_10073484
1736 Ga0157374_10445463
1737 Ga0163162_10003838
1738 Ga0163162_10723108
1739 Ga0163163_10165608
1740 Ga0157380_10003640
1741 Ga0157380_10709879
1742 Ga0182008_10006407
1743 Ga0182008_10013725
1744 Ga0182008_10048193
1745 Ga0182006_1001224
1746 Ga0182006_1003031
1747 Ga0182006_1005901
1748 Ga0182006_1058702
1749 Ga0182007_10000493
1750 Ga0182007_10005361
1751 Ga0182005_1001106
1752 Ga0182005_1003295
1753 Ga0182005_1017046
1754 Ga0182005_1017457
1755 Ga0182005_1026944
1756 Ga0214544_1000419
1757 Ga0214542_1000027
1758 Ga0214542_1033155
1759 Ga0214543_1000025
1760 Ga0214543_1000047
1761 Ga0213872_10072961
1762 Ga0213876_10144143
1763 Ga0213875_10072901
1764 Ga0228711_1010219
1765 Ga0228710_1010420
1766 Ga0209435_100127
1767 Ga0209435_101270
1768 Ga0209760_100007
1769 Ga0209784_100065
1770 Ga0209566_100081
1771 Ga0209674_100101
1772 Ga0209147_100234
1773 Ga0209563_100098
1774 Ga0207427_100018
1775 Ga0209437_100031
1776 Ga0209437_100475
1777 Ga0209437_104097
1778 Ga0209437_105162
1779 Ga0209258_100752
1780 Ga0209258_104672
1781 Ga0207425_1008276
1782 Ga0209646_1000390
1783 Ga0209646_1005847
1784 Ga0209026_1000520
1785 Ga0209677_100059
1786 Ga0209677_100218
1787 Ga0209148_1000420
1788 Ga0209759_1000769
1789 Ga0209129_1000997
1790 Ga0209129_1002487
1791 Ga0209129_1026470
1792 Ga0209233_1000012
1793 Ga0209233_1000097
1794 Ga0209233_1000429
1795 Ga0209455_1000290
1796 Ga0209455_1016997
1797 Ga0209673_1000117
1798 Ga0209673_1000452
1799 Ga0209673_1002317
1800 Ga0209130_1025020
1801 Ga0209675_1003905
1802 Ga0209675_1023459
1803 Ga0209676_1000002
1804 Ga0209676_1000020
1805 Ga0209676_1002950
1806 Ga0209676_1009137
1807 Ga0209025_1000121
1808 Ga0209025_1000228
1809 Ga0209025_1000558
1810 Ga0209025_1003556
1811 Ga0209564_1000581
1812 Ga0209564_1000763
1813 Ga0209758_1000113
1814 Ga0209758_1000503
1815 Ga0209758_1005135
1816 Ga0209758_1006104
1817 Ga0209050_1000006
1818 Ga0209050_1000009
1819 Ga0209050_1000775
1820 Ga0209050_1005867
1821 Ga0209256_1000164
1822 Ga0209256_1002844
1823 Ga0209256_1003510
1824 Ga0209256_1012618
1825 Ga0207426_1000307
1826 Ga0209051_1000001
1827 Ga0209051_1000008
1828 Ga0209051_1000027
1829 Ga0209051_1002046
1830 Ga0209051_1024359
1831 Ga0209257_1000269
1832 Ga0209257_1019019
1833 Ga0207696_1000002
1834 Ga0207696_1000115
1835 Ga0207696_1002575
1836 Ga0207696_1007412
1837 Ga0207655_1000022
1838 Ga0207655_1000167
1839 Ga0207655_1000270
1840 Ga0207655_1000419
1841 Ga0207655_1001481
1842 Ga0207655_1008041
1843 Ga0207655_1009048
1844 Ga0207655_1064092
1845 Ga0207655_1075769
1846 Ga0207655_1085486
1847 Ga0207713_1000117
1848 Ga0207713_1000455
1849 Ga0207713_1000827
1850 Ga0207713_1003174
1851 Ga0207713_1006126
1852 Ga0207713_1006127
1853 Ga0207713_1013462
1854 Ga0207713_1015971
1855 Ga0207713_1024116
1856 Ga0207713_1033940
1857 Ga0207680_10116281
1858 Ga0207645_10037406
1859 Ga0207645_10084606
1860 Ga0207684_10012548
1861 Ga0207695_10000495
1862 Ga0207695_10072809
1863 Ga0207671_10000568
1864 Ga0207671_10001314
1865 Ga0207671_10041667
1866 Ga0207649_10000217
1867 Ga0207681_10008201
1868 Ga0207681_10247613
1869 Ga0207694_10249301
1870 Ga0207650_10000205
1871 Ga0207650_10000942
1872 Ga0207687_10127911
1873 Ga0207687_10305706
1874 Ga0207644_10103475
1875 Ga0207706_10005103
1876 Ga0207706_10010353
1877 Ga0207686_10005559
1878 Ga0207709_10000004
1879 Ga0207709_10258890
1880 Ga0207709_10466144
1881 Ga0207669_10021091
1882 Ga0207669_10181166
1883 Ga0207704_10303876
1884 Ga0207691_10671910
1885 Ga0207689_10023203
1886 Ga0207679_10000109
1887 Ga0207667_10139375
1888 Ga0207651_10284339
1889 Ga0207651_10646988
1890 Ga0207712_10085813
1891 Ga0207712_10115856
1892 Ga0207668_10024637
1893 Ga0207678_10098511
1894 Ga0207702_10047716
1895 Ga0207648_10237869
1896 Ga0207674_10010723
1897 Ga0207675_100001039
1898 Ga0207675_100285137
1899 Ga0207683_10469601
1900 Ga0207683_10528422
1901 Ga0207698_10016450
1902 Ga0209281_1000011
1903 Ga0209281_1000314
1904 Ga0209281_1000463
1905 Ga0209281_1003764
1906 Ga0209371_1001425
1907 Ga0209999_1048711
1908 Ga0209282_1000068
1909 Ga0209282_1192036
1910 Ga0209813_10069115
1911 Ga0207428_10000098
1912 Ga0207428_10045742
1913 Ga0207428_10200020
1914 Ga0207428_10204214
1915 Ga0268266_10468457
1916 Ga0268265_10058252
1917 Ga0268264_10300480
1918 Ga0307515_10006683
1919 Ga0307515_10097680
1920 Ga0268256_1001855
1921 Ga0307511_10084883
1922 Ga0307512_10046883
1923 Ga0314311_1003930
1924 Ga0316179_1019939
1925 Ga0316178_1142514
1926 Ga0265330_10063920
1927 Ga0265339_10037873
1928 Ga0307513_10000259
1929 Ga0307513_10184150
1930 Ga0307408_100332515
1931 Ga0307408_100605538
1932 Ga0307516_10274752
1933 Ga0307405_10042440
1934 Ga0307412_10700786
1935 Ga0307409_101178847
1936 Ga0307507_10295229
1937 Ga0307510_10000904
1938 Ga0307510_10140416
1939 Ga0315913_1002536
1940 Ga0315915_1000007
1941 Ga0373943_0219716
1942 Ga0373935_0306116
1943 Ga0373925_0000771
1944 Ga0395905_0022998
1945 Ga0395905_0037462
1946 Ga0395905_0241463
1947 Ga0237819_00367
1948 Ga0436365_1612465
1949 Ga0436361_0928105
1950 Ga0439436_0023912
1951 Ga0439436_0048333
1952 Ga0439438_029644
1953 Ga0439447_000379
1954 Ga0439447_028651
1955 Ga0439466_0000125
1956 Ga0439466_0030986
1957 Ga0439466_0031687
1958 Ga0439465_0007366
1959 Ga0439465_0034550
1960 Ga0439465_0036768
1961 Ga0451798_0048890
1962 Ga0451804_0978079
1963 Ga0451835_0984855
1964 Ga0451845_0935886
1965 Ga0451847_0024524
1966 Ga0451851_0582068
1967 Ga0451855_0354570
1968 Ga0439432_000588
1969 Ga0439432_002973
1970 Ga0439449_0026652
1971 Ga0439449_0120861
1972 Ga0439451_010453
1973 Ga0439451_021005
1974 Ga0439452_000274
1975 Ga0439452_003833
1976 Ga0439452_012209
1977 Ga0439452_016156
1978 Ga0439456_004086
1979 Ga0439463_000824
1980 Ga0439463_004733
1981 Ga0450911_007211
1982 Ga0450919_009519
1983 Ga0450906_000930
1984 Ga0450907_000043
1985 Ga0450909_001700
1986 Ga0439460_0004605
1987 Ga0439460_0006604
1988 Ga0439440_0000499
1989 Ga0466966_0046273
1990 Ga0466963_0011584
1991 Ga0466971_0171191
1992 Ga0466970_0000136
1993 Ga0466970_0105673
1994 Ga0466957_0011830
1995 Ga0466959_0456278
1996 Ga0451576_0008377
1997 Ga0451576_0290625
1998 Ga0466958_0093997
1999 Ga0466967_0065100
2000 Ga0495617_000121
2001 Ga0495617_011317
2002 Ga0495617_070018
2003 Ga0495627_001717
2004 Ga0495627_046391
2005 Ga0495590_0001126
2006 Ga0495591_000086
2007 Ga0495591_000125
2008 Ga0495591_000260
2009 Ga0495591_001495
2010 Ga0495591_001994
2011 Ga0495591_002103
2012 Ga0495591_014302
2013 Ga0495591_047982
2014 Ga0495591_057901
2015 Ga0495629_0008153
2016 Ga0495638_0000622
2017 Ga0495638_0040688
2018 Ga0495638_0045328
2019 Ga0495638_0290071
2020 Ga0495651_0243875
2021 Ga0495650_0000362
2022 Ga0495650_0002865
2023 Ga0495650_0019272
2024 Ga0495650_0019926
2025 Ga0495650_0045429
2026 Ga0495582_0269574
2027 Ga0495605_0000001
2028 Ga0495605_0000025
2029 Ga0495605_0000346
2030 Ga0495605_0003188
2031 Ga0495605_0020734
2032 Ga0495605_0023315
2033 Ga0495605_0027855
2034 Ga0495605_0087023
2035 Ga0495605_0131386
2036 Ga0495639_0000996
2037 Ga0495662_0007315
2038 Ga0495584_0001257
2039 Ga0495584_0049354
2040 Ga0495584_0050165
2041 Ga0495584_0066940
2042 Ga0495585_0000149
2043 Ga0495585_0115687
2044 Ga0495594_0013205
2045 Ga0495596_0000027
2046 Ga0495596_0110877
2047 Ga0495607_0000036
2048 Ga0495607_0000167
2049 Ga0495607_0001042
2050 Ga0495607_0005883
2051 Ga0495607_0009965
2052 Ga0495607_0042895
2053 Ga0495607_0067349
2054 Ga0495607_0129440
2055 Ga0495607_0133662
2056 Ga0495607_0152662
2057 Ga0495583_0000070
2058 Ga0495583_0001762
2059 Ga0495583_0002032
2060 Ga0495583_0002891
2061 Ga0495583_0006127
2062 Ga0495583_0008378
2063 Ga0495583_0100447
2064 Ga0495606_0000079
2065 Ga0495606_0002580
2066 Ga0495606_0010880
2067 Ga0495606_0011881
2068 Ga0495606_0070130
2069 Ga0495606_0203403
2070 Ga0495610_0011337
2071 Ga0495610_0021168
2072 Ga0495610_0041249
2073 Ga0495610_0073016
2074 Ga0495610_0085546
2075 Ga0495616_0000079
2076 Ga0495616_0000425
2077 Ga0495616_0027250
2078 Ga0495616_0029472
2079 Ga0495616_0056248
2080 Ga0495616_0066638
2081 Ga0495620_0000009
2082 Ga0495620_0009058
2083 Ga0495620_0010750
2084 Ga0495620_0011527
2085 Ga0495620_0022194
2086 Ga0495620_0029113
2087 Ga0495620_0048012
2088 Ga0495631_0000126
2089 Ga0495631_0006438
2090 Ga0495631_0024815
2091 Ga0495632_0000802
2092 Ga0495632_0008573
2093 Ga0495632_0030503
2094 Ga0495632_0112330
2095 Ga0495632_0193809
2096 Ga0495637_0000075
2097 Ga0495637_0002202
2098 Ga0495637_0015218
2099 Ga0495637_0090293
2100 Ga0495637_0093780
2101 Ga0495643_0001828
2102 Ga0495644_0000477
2103 Ga0495644_0003929
2104 Ga0495648_0010903
2105 Ga0495648_0012695
2106 Ga0495648_0013902
2107 Ga0495648_0015893
2108 Ga0495648_0020720
2109 Ga0495648_0117409
2110 Ga0495666_0014693
2111 Ga0495666_0058173
2112 Ga0495642_0000402
2113 Ga0495642_0000571
2114 Ga0495652_0471174
2115 Ga0495654_0000470
2116 Ga0495654_0001097
2117 Ga0495654_0008212
2118 Ga0495654_0011909
2119 Ga0495654_0014489
2120 Ga0495654_0047804
2121 Ga0495654_0076284
2122 Ga0495654_0098190
2123 Ga0495654_0191161
2124 Ga0495640_0132830
2125 Ga0495587_0010225
2126 Ga0495609_0000014
2127 Ga0495609_0000016
2128 Ga0495609_0001549
2129 Ga0495609_0010463
2130 Ga0495609_0024324
2131 Ga0495609_0094174
2132 Ga0495609_0124205
2133 Ga0495597_0007901
2134 Ga0495597_0009335
2135 Ga0495597_0009540
2136 Ga0495597_0014559
2137 Ga0495622_0000708
2138 Ga0495622_0001279
2139 Ga0495622_0007393
2140 Ga0495633_0000010
2141 Ga0495633_0000525
2142 Ga0495656_0000902
2143 Ga0495668_0003496
2144 Ga0495668_0054619
2145 Ga0495668_0131197
2146 Ga0495668_0376538
2147 Ga0495611_0000048
2148 Ga0495611_0000152
2149 Ga0495611_0025448
2150 Ga0495611_0058018
2151 Ga0495625_0000084
2152 Ga0495625_0002299
2153 Ga0495625_0002568
2154 Ga0495625_0010597
2155 Ga0495625_0044245
2156 Ga0495625_0045296
2157 Ga0495625_0088336
2158 Ga0495625_0144184
2159 Ga0495625_0183784
2160 Ga0495625_0265970
2161 Ga0495625_0364773
2162 Ga0495635_0000973
2163 Ga0495635_0240372
2164 Ga0495659_0000392
2165 Ga0495661_0000008
2166 Ga0495661_0000191
2167 Ga0495661_0001498
2168 Ga0495661_0003071
2169 Ga0495661_0017906
2170 Ga0495661_0062167
2171 Ga0495657_0020397
2172 Ga0495623_0091743
2173 Ga0495658_0211393
2174 Ga0495669_0016104
2175 Ga0495670_0001804
2176 Ga0495670_0012534
2177 Ga0495670_0175616
2178 Ga0495670_0184536
2179 Ga0495670_0204537
2180 Ga0495671_0000853
2181 Ga0495671_0008768
2182 Ga0495671_0012449
2183 Ga0495671_0054971
2184 Ga0495671_0065921
2185 Ga0495649_0000257
2186 Ga0495649_0019003
2187 Ga0495649_0020457
2188 Ga0495649_0066761
2189 Ga0495649_0265784
2190 Ga0495589_0000415
2191 Ga0495589_0082046
2192 Ga0495589_0099905
2193 Ga0495600_0031896
2194 Ga0495600_0046755
2195 Ga0495660_0008599
2196 Ga0495660_0052407
2197 Ga0495660_0113146
2198 Ga0495660_0122406
2199 Ga0495660_0132940
2200 Ga0495660_0151824
2201 Ga0495660_0224643
2202 Ga0495604_0005508
2203 Ga0495604_0055591
2204 Ga0495636_0012242
2205 Ga0495636_0096144
2206 Ga0495636_0287316
2207 Ga0495674_0308786
2208 Ga0495672_0002860
2209 Ga0495672_0013706
2210 Ga0495672_0027794
2211 Ga0495672_0029995
2212 Ga0495672_0063445
2213 Ga0495672_0169014
2214 Ga0495676_0000039
2215 Ga0495680_0009250
2216 Ga0495683_0000002
2217 Ga0495683_0000231
2218 Ga0495683_0000358
2219 Ga0495683_0033779
2220 Ga0495683_0057525
2221 Ga0495683_0179221
2222 Ga0495687_000232
2223 Ga0495687_002451
2224 Ga0495687_005527
2225 Ga0495687_009154
2226 Ga0495687_015074
2227 Ga0495675_0065462
2228 Ga0495679_000086
2229 Ga0495679_000133
2230 Ga0495679_025427
2231 Ga0495673_0000077
2232 Ga0495673_0000281
2233 Ga0495673_0000656
2234 Ga0495673_0000966
2235 Ga0495673_0001880
2236 Ga0495673_0005342
2237 Ga0495673_0009546
2238 Ga0495673_0012894
2239 Ga0495673_0027832
2240 Ga0495673_0076687
2241 Ga0495681_0000031
2242 Ga0495681_0008454
2243 Ga0495681_0017000
2244 Ga0495681_0018044
2245 Ga0495686_0000418
2246 Ga0495686_0032054
2247 Ga0495686_0103431
2248 Ga0495686_0224665
2249 Ga0495686_0387828
2250 Ga0495602_0084832
2251 Ga0495626_0000002
2252 Ga0495626_0000451
2253 Ga0495626_0000748
2254 Ga0495626_0001395
2255 Ga0495626_0002100
2256 Ga0495626_0059482
2257 Ga0495626_0078118
2258 Ga0496101_0076974
2259 Ga0496102_0000475
2260 Ga0496102_0051450
2261 Ga0496103_0018945
2262 Ga0496106_0329371
2263 Ga0496113_0017486
2264 Ga0496114_0383799
2265 Ga0496115_0113582
2266 Ga0496116_0003732
2267 Ga0496116_0028731
2268 Ga0496116_0191739
2269 Ga0496117_0000246
2270 Ga0496117_0002266
2271 Ga0496117_0015728
2272 Ga0496117_0116632
2273 Ga0496117_0207220
2274 Ga0496118_0004214
2275 Ga0496118_0015631
2276 Ga0496118_0146221
2277 Ga0496118_0194586
2278 Ga0496119_0004102
2279 Ga0496119_0029831
2280 Ga0496119_0056253
2281 Ga0496120_0043574
2282 Ga0496120_0049134
2283 Ga0496121_0000005
2284 Ga0496121_0003531
2285 Ga0496121_0003988
2286 Ga0496121_0008277
2287 Ga0496121_0009440
2288 Ga0496121_0014636
2289 Ga0496121_0228514
2290 Ga0496122_0000565
2291 Ga0496122_0001036
2292 Ga0496122_0005625
2293 Ga0496122_0007679
2294 Ga0496122_0023009
2295 Ga0496122_0048469
2296 Ga0496122_0075317
2297 Ga0496122_0282790
2298 Ga0496123_0000055
2299 Ga0496123_0000247
2300 Ga0496123_0002102
2301 Ga0496123_0008936
2302 Ga0496123_0040314
2303 Ga0496123_0054773
2304 Ga0496123_0061406
2305 Ga0496124_0000035
2306 Ga0496124_0008204
2307 Ga0496124_0009778
2308 Ga0496124_0017485
2309 Ga0496124_0052504
2310 Ga0496124_0120840
2311 Ga0496124_0233405
2312 Ga0496125_0000034
2313 Ga0496125_0000161
2314 Ga0496125_0000266
2315 Ga0496125_0008970
2316 Ga0496126_0013447
2317 Ga0496126_0022221
2318 Ga0496126_0058087
2319 Ga0496126_0086223
2320 Ga0495678_000005
2321 Ga0495678_001061
2322 Ga0495678_003876
2323 Ga0495678_005542
2324 Ga0495678_093102
2325 Ga0495682_0000393
2326 Ga0495682_0001543
2327 Ga0495682_0030792
2328 Ga0495682_0031766
2329 Ga0495682_0053446
2330 Ga0495682_0079108
2331 Ga0501031_0213518
2332 Ga0501033_0188868
2333 Ga0501034_0040564
2334 Ga0501036_0209961
2335 Ga0501037_0209353
2336 Ga0501038_0090129
2337 Ga0501040_0029490
2338 Ga0501043_0186491
2339 Ga0501046_0064317
2340 Ga0501071_0065219
2341 Ga0501072_0037498
2342 Ga0501074_0212353
2343 Ga0501075_0034514
2344 Ga0501076_0051094
2345 Ga0501077_0019800
2346 Ga0501079_0094277
2347 Ga0501080_0064762
2348 Ga0501081_0020717
2349 Ga0501045_0002223
2350 nmdc:mga03683_126274_c1
2351 nmdc:mga03683_41700_c1
2352 nmdc:mga03683_50458_c1
2353 nmdc:mga03683_5053_c1
2354 nmdc:mga03n38_62468_c1
2355 nmdc:mga00v17_22877_c1
2356 nmdc:mga00v17_245805_c1
2357 nmdc:mga0yw44_34560_c1
2358 nmdc:mga0yw44_45400_c1
2359 nmdc:mga0k408_153059_c1
2360 nmdc:mga0k408_193476_c1
2361 nmdc:mga0k408_290201_c1
2362 nmdc:mga0k408_43645_c1
2363 nmdc:mga0k408_55925_c1
2364 nmdc:mga0k408_6388_c1
2365 nmdc:mga06z11_22523_c1
2366 nmdc:mga06z11_9219_c1
2367 nmdc:mga04h51_52650_c1
2368 nmdc:mga07m45_1812_c1
2369 nmdc:mga07m45_20536_c1
2370 nmdc:mga07m45_6130_c1
2371 nmdc:mga07m45_70564_c1
2372 nmdc:mga0qj67_169175_c1
2373 nmdc:mga06r32_40858_c1
2374 nmdc:mga08y16_71_c1
2375 nmdc:mga0sz30_12176_c1
2376 nmdc:mga0sz30_297_c1
2377 Ga0500610_0004448
2378 Ga0500578_0129235
2379 Ga0500578_0164099
2380 Ga0500644_0009483
2381 Ga0500651_0065608
2382 Ga0500651_0176470
2383 Ga0500650_0089569
2384 Ga0500555_001653
2385 Ga0500556_0000200
2386 Ga0500556_0081647
2387 Ga0500557_011251
2388 Ga0500569_003341
2389 Ga0500594_0000551
2390 Ga0500658_0007852
2391 Ga0500568_0000612
2392 Ga0500588_0054248
2393 Ga0500590_000323
2394 Ga0500616_0001106
2395 Ga0500616_0035069
2396 Ga0500622_0145694
2397 Ga0500627_0068506
2398 Ga0500636_0169942
2399 Ga0500611_158100
2400 Ga0501084_0004231
2401 Ga0501082_0007932
2402 Ga0530510_0149257
2403 2509074650
2404 2509112287
2405 2509379412
2406 2509390760
2407 2509441805
2408 2510136360
2409 2510284821
2410 2510295131
2411 2510308676
2412 2510312199
2413 2510892615
2414 2511132834
2415 2511186029
2416 2511254271
2417 2511274521
2418 2511293059
2419 2511296145
2420 2511301727
2421 2511312832
2422 2511321204
2423 2511327176
2424 2511330064
2425 2511340405
2426 2511342475
2427 2511351634
2428 2511360283
2429 2511367051
2430 2511412691
2431 2511498209
2432 2511825242
2433 2512529365
2434 2512969522
2435 2513568656
2436 2513579865
2437 2513587912
2438 2513606254
2439 2513619677
2440 2513630481
2441 2513711234
2442 2513885170
2443 2513906241
2444 2513909472
2445 2513923787
2446 2513985038
2447 2513999040
2448 2514007969
2449 2514018513
2450 2515108696
2451 2515610782
2452 2515632552
2453 2515640483
2454 2515656597
2455 2515738169
2456 2516207527
2457 2516896148
2458 2517040618
2459 2517080231
2460 2517098249
2461 2517409754
2462 2517565600
2463 2520380544
2464 2523469309
2465 2524449582
2466 2530648528
2467 2551674951
2468 2551687267
2469 2551692443
2470 2551697821
2471 2551708279
2472 2551721584
2473 2551728197
2474 2551734443
2475 2551743254
2476 2558861459
2477 2585255578
2478 2585272450
2479 2585277716
2480 2585389412
2481 2585397666
2482 2585403117
2483 2585530023
2484 2585533416
2485 2585537366
2486 2585557250
2487 2585561486
2488 2585823939
2489 2585840228
2490 2585901901
2491 2585906714
2492 2587982135
2493 2597864357
2494 2597870178
2495 2599329875
2496 2599398686
2497 2599415819
2498 2599450741
2499 2599504745
2500 2599509049
2501 2599513175
2502 2599520863
2503 2599612150
2504 2599771708
2505 2599880176
2506 2599884245
2507 2599891851
2508 2599899250
2509 2599931168
2510 2599941420
2511 2599947114
2512 2599953060
2513 2599958615
2514 2599968290
2515 2599970178
2516 2599979476
2517 2599982686
2518 2599989713
2519 2599993064
2520 2599998610
2521 2600003522
2522 2600010015
2523 2600018099
2524 2600022947
2525 2600028913
2526 2600036777
2527 2600042999
2528 2600047288
2529 2600052618
2530 2600058040
2531 2600066285
2532 2600069455
2533 2600076315
2534 2600358080
2535 2601624505
2536 2601691579
2537 2601798804
2538 2606077699
2539 2606130126
2540 2616297834
2541 2616310605
2542 2616553139
2543 2617384460
2544 2621299255
2545 2624481041
2546 2624491621
2547 2643808956
2548 2643841558
2549 2643870538
2550 2644069199
2551 2644104848
2552 2644129972
2553 2644151279
2554 2644186503
2555 2644280837
2556 2644313267
2557 2644336353
2558 2644378548
2559 2644420270
2560 2644453677
2561 2644494919
2562 2644547189
2563 2644612890
2564 2644622861
2565 2644692376
2566 2652547715
2567 2657684296
2568 2671091319
2569 2671116991
2570 2671129372
2571 2677896066
2572 2678263191
2573 2687579157
2574 2692318428
2575 2715750579
2576 2715757084
2577 2718633938
2578 2719184670
2579 2719389294
2580 2719668650
2581 2719728690
2582 2720489343
2583 2720610025
2584 2720617448
2585 2720628594
2586 2720772544
2587 2721144381
2588 2721156325
2589 2721161751
2590 2721402060
2591 2722842896
2592 2723029983
2593 2723248400
2594 2723564388
2595 2723569970
2596 2724035893
2597 2724041715
2598 2724092573
2599 2724101517
2600 2724112949
2601 2725949625
2602 2730110516
2603 2730160785
2604 2730295858
2605 2738674797
2606 2738687997
2607 2738753190
2608 2738806396
2609 2738862101
2610 2738893756
2611 2739036151
2612 2739199236
2613 2739257081
2614 2739263568
2615 2739309963
2616 2739314620
2617 2739349593
2618 2745009523
2619 2753463552
2620 2765467273
2621 2766069125
2622 2774120154
2623 2774131323
2624 2774134008
2625 2776273061
2626 2776282096
2627 2778177884
2628 2784264224
2629 2784311915
2630 2792580481
2631 2792619488
2632 2792627259
2633 2792639844
2634 2793297810
2635 2793312862
2636 2793322468
2637 2793331904
2638 2793337540
2639 2793344412
2640 2793345560
2641 2793354968
2642 2793363699
2643 2793370366
2644 2794597644
2645 2802722043
2646 2802723024
2647 2802728843
2648 2802735210
2649 2802742186
2650 2802748633
2651 2804754702
2652 2805927229
2653 2805934343
2654 2806046273
2655 2806053193
2656 2806059599
2657 2806068661
2658 2806075083
2659 2808855302
2660 2808923024
2661 2808932921
2662 2808935122
2663 2808945102
2664 2808955010
2665 2808956378
2666 2808963807
2667 2808978732
2668 2808994464
2669 2808998695
2670 2809214633
2671 2817491643
2672 2819613728
2673 2819643091
2674 2819659453
2675 2825652579
2676 2826583813
2677 2834030196
2678 2838016144
2679 2838025327
2680 2838032842
2681 2838035936
2682 2838044263
2683 2838049766
2684 2838062033
2685 2838068676
2686 2838077728
2687 2838665054
2688 2838669456
2689 2838684543
2690 2838690754
2691 2838698704
2692 2838701827
2693 2838712415
2694 2838735800
2695 2838748704
2696 2839996473
2697 2840770414
2698 2841858325
2699 2841865926
2700 2842116801
2701 2842122814
2702 2842160620
2703 2842164115
2704 2842184236
2705 2842196096
2706 2842200893
2707 2842209735
2708 2842219921
2709 2842231818
2710 2842241827
2711 2842249506
2712 2842251749
2713 2842263614
2714 2842265014
2715 2842274931
2716 2842283189
2717 2842295662
2718 2842307621
2719 2842315633
2720 2842320149
2721 2842347710
2722 2842364171
2723 2842374456
2724 2842382066
2725 2842389362
2726 2842397204
2727 2842405768
2728 2842412352
2729 2842418998
2730 2842422822
2731 2842428932
2732 2842435545
2733 2842441592
2734 2842448366
2735 2842463356
2736 2842469876
2737 2842479575
2738 2842486648
2739 2842489725
2740 2842498231
2741 2842506760
2742 2842524784
2743 2842816073
2744 2842830847
2745 2842835017
2746 2842840265
2747 2842846754
2748 2842851120
2749 2842855121
2750 2844169599
2751 2844460408
2752 2847423070
2753 2848997537
2754 2850084573
2755 2852614119
2756 2852657691
2757 2852668144
2758 2855829027
2759 2855844145
2760 2855874057
2761 2857517953
2762 2858806605
2763 2860342949
2764 2860870276
2765 2878032966
2766 2880233697
2767 2891374313
2768 2894656881
2769 2896391841
2770 2899806986
2771 2904519890
2772 2904554442
2773 2904582606
2774 2908450309
2775 2913038966
2776 2913296783
2777 2915983617
2778 2915992193
2779 2915999267
2780 2916001352
2781 2916011596
2782 2916018871
2783 2916026078
2784 2916032095
2785 2916039041
2786 2916046168
2787 2916051903
2788 2916060892
2789 2916065315
2790 2916070117
2791 2916077900
2792 2917834192
2793 2919064722
2794 2919124086
2795 2919127746
2796 2919390237
2797 2919451764
2798 2919460530
2799 2919483978
2800 2919489268
2801 2919703384
2802 2920765018
2803 2921203572
2804 2921209968
2805 2921237772
2806 2921248305
2807 2921256856
2808 2921260996
2809 2921267911
2810 2921283710
2811 2921289715
2812 2921297832
2813 2923586825
2814 2924145728
2815 2924155830
2816 2924162431
2817 2924166684
2818 2924179581
2819 2924183384
2820 2924186849
2821 2924204577
2822 2924213692
2823 2924217236
2824 2924222615
2825 2924233890
2826 2929142571
2827 2929147912
2828 2929192963
2829 2931370180
2830 2931393572
2831 2931401563
2832 2933020129
2833 2933573724
2834 2933593017
2835 2933600294
2836 2935898622
2837 2935903216
2838 2936374455
2839 2936378703
2840 2936384427
2841 2937002249
2842 2937007241
2843 2937016035
2844 2937020762
2845 2937026934
2846 2937034969
2847 2937039200
2848 2937048046
2849 2937054141
2850 2937060596
2851 2937068030
2852 2937071598
2853 2937084387
2854 2937091408
2855 2937095319
2856 2937103584
2857 2937110317
2858 2937117176
2859 2937123603
2860 2937130538
2861 2941504485
2862 2945933110
2863 2945964335
2864 2946010410
2865 2946030511
2866 2947238164
2867 2957379116
2868 2957386350
2869 2957392771
2870 2957401463
2871 2957406662
2872 2957414649
2873 2957415719
2874 2957427370
2875 2957437915
2876 2957450482
2877 2957457521
2878 2957461459
2879 2957468597
2880 2957471586
2881 2957484254
2882 2957488621
2883 2957497262
2884 2957505329
2885 2957509676
2886 2960585878
2887 2960596432
2888 2960601095
2889 2960608829
2890 2960617139
2891 2960623588
2892 2960625719
2893 2960634336
2894 2960645317
2895 2960649769
2896 2960654722
2897 2960667286
2898 2960671626
2899 2960679881
2900 2960683435
2901 2960693832
2902 2960695287
2903 2964611951
2904 2964619642
2905 2964623583
2906 2964636007
2907 2964640065
2908 2964647444
2909 2964653801
2910 2964663397
2911 2964670540
2912 2964673141
2913 2964682782
2914 2964690168
2915 2964695597
2916 2964703763
2917 2964712625
2918 2964716267
2919 2964720625
2920 2967665763
2921 2967672515
2922 2967683339
2923 2967688008
2924 2967696993
2925 2967703942
2926 2967711173
2927 2967718418
2928 2967727007
2929 2967734056
2930 2967738813
2931 2967747978
2932 2967759418
2933 2967766277
2934 2967773556
2935 2967780797
2936 2969307881
2937 2970020129
2938 2970028930
2939 2970034226
2940 2970042409
2941 2970051672
2942 2970059189
2943 2970065406
2944 2970074089
2945 2970080732
2946 2970087098
2947 2970093138
2948 2970099666
2949 2970106507
2950 2970113698
2951 2970120066
2952 2970128481
2953 2970135708
2954 2970141918
2955 2970147812
2956 2970154086
2957 2970161916
2958 2970168101
2959 2970171607
2960 2970184547
2961 2970190232
2962 2970195935
2963 2974291258
2964 2974298662
2965 2977517617
2966 2977530685
2967 2977533933
2968 2977541596
2969 2977548021
2970 2977556296
2971 2977565764
2972 2977570189
2973 2977576928
2974 2977583429
2975 2980127607
2976 2984500905
2977 2984505653
2978 2988733952
2979 2996891197
2980 2996894397
2981 2998142520
2982 3002142153
2983 3003935637
2984 3005414876
2985 3005419809
2986 3005447474
2987 3007422990
2988 3007514020
2989 3007616164
2990 3007623407
2991 3007722579
2992 3007856672
2993 3007861805
2994 3007868605
2995 639644844
2996 643823033
2997 648738313
2998 8002288445
2999 8003996725
3000 8004004077
3001 8005261860
3002 8005277637
3003 8005288519
3004 8005290500
3005 8005301078
3006 8005307985
3007 8005316375
3008 8005325724
3009 8005379741
3010 8005385257
3011 8005396174
3012 8005431439
3013 8005467129
3014 8005487539
3015 8005502898
3016 8005562426
3017 8005566199
3018 8005572275
3019 8005624048
3020 8005629313
3021 8005651727
3022 8005674328
3023 8005683462
3024 8005689108
3025 8005697832
3026 8016732414
3027 8018132106
3028 8018163473
3029 8018180502
3030 8019778465
3031 8023681850
3032 8024482347
3033 8024488872
3034 8024507252
3035 8029998174
3036 8045868664
3037 8046772864
3038 8049298480
3039 8054289494
3040 8054351453
3041 8054506682
3042 8054561498
3043 8055821469
3044 8056134414
3045 8056146864
3046 8056154953
3047 8056159127
3048 8056165755
3049 8056168564
3050 8056174577
3051 8056177980
3052 8056377859
3053 8056382535
3054 8056571327
3055 8057529717
3056 8057878153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

56

238

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6656 16 213
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.6368 29 202
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.621 16 213
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.6075 21 208
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.596 27 207
ID Description Score Start End Superfamily
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6665 16 213 1.10.3720.10
af_P52094_1_222_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6553 25 213 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6495 22 214 1.10.3720.10
3tujB00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6374 26 210 1.10.3720.10
af_P0AFR9_7_261_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6328 39 206 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7Y5X0F8-F1-model_v4 ABC transporter permease subunit 0.851 31 114 GO:0006865
GO:0022857
GO:0043190
AF-A0A258LAW9-F1-model_v4 Amino acid ABC transporter permease 0.8118 27 118 GO:0006865
GO:0022857
GO:0043190
AF-A0A435XAJ2-F1-model_v4 ABC transporter permease subunit 0.7845 21 131 GO:0006865
GO:0022857
GO:0043190
AF-F3GBZ0-F1-model_v4 Amino acid ABC transporter permease 0.7835 21 111 GO:0006865
GO:0022857
GO:0043190
AF-A0A4Q3J9C9-F1-model_v4 Amino acid ABC transporter permease 0.7804 29 131 GO:0006865
GO:0022857
GO:0043190

Map