F494580
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1528 | 508 | 3056 | 61 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_101562058|Ga0070680_1015620581 |
| Length | 71 |
| Sequence | MAKIKIKQIGSPIRRTKDQRATLIGLGLNKMHKVSELEDTPEVRGMIRKLPHMVTIVINRRSTNRRPSSRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 22 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 23 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 24 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 25 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 133 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 134 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 151 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 158 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 159 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 247 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 248 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 262 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 263 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 275 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 278 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 279 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 280 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 281 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 282 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 284 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 290 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 294 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 295 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 296 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 297 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 298 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 299 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 300 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 301 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 302 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 303 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 304 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 305 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 306 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 307 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 308 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 309 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 310 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 311 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 312 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 313 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 314 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 319 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 320 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 321 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 322 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 323 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 324 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 325 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 377 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 378 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 379 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 380 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 381 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 382 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 385 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 386 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 387 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 388 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 389 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 390 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 391 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 392 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 393 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 394 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 395 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 396 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 397 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 398 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 399 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 400 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 401 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 406 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 407 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 408 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 409 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 410 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 437 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 438 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 439 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 440 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 441 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 442 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 443 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 444 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 445 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 446 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 447 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 448 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 449 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 450 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 451 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 452 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 456 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 457 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 460 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 461 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 467 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 469 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 470 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 471 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 472 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 473 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 475 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 476 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 478 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 480 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 481 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 482 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 483 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 484 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 485 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 490 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.86 |
| Metatranscriptomes | 3.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.24 |
| Nodule | 0 |
| Rhizoplane | 3.73 |
| Rhizosphere | 77.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_101562058 | 3300005336 | Bacteria | 572 |
| 2 | ARcpr5oldR_c003367 | 3300000041 | Bacteria | 1422 |
| 3 | ARcpr5yngRDRAFT_c000513 | 3300000043 | Bacteria | 4977 |
| 4 | JGI24736J21556_1000064 | 3300001904 | Bacteria | 17271 |
| 5 | JGI24736J21556_1009108 | 3300001904 | Bacteria | 1642 |
| 6 | JGI24736J21556_1017419 | 3300001904 | Bacteria | 1140 |
| 7 | JGI24741J21665_1001255 | 3300001915 | Bacteria | 7456 |
| 8 | JGI24741J21665_1011514 | 3300001915 | Bacteria | 1543 |
| 9 | JGI24752J21851_1000348 | 3300001976 | Bacteria | 6448 |
| 10 | JGI24752J21851_1000507 | 3300001976 | Bacteria | 5227 |
| 11 | JGI24740J21852_10001392 | 3300001979 | Bacteria | 11043 |
| 12 | JGI24740J21852_10002955 | 3300001979 | Bacteria | 7552 |
| 13 | JGI24740J21852_10036607 | 3300001979 | Bacteria | 1523 |
| 14 | JGI24740J21852_10038021 | 3300001979 | Bacteria | 1480 |
| 15 | JGI24740J21852_10120951 | 3300001979 | Bacteria | 656 |
| 16 | JGI24739J22299_10003209 | 3300001989 | Bacteria | 6234 |
| 17 | JGI24739J22299_10004443 | 3300001989 | Bacteria | 5373 |
| 18 | JGI24739J22299_10009935 | 3300001989 | Bacteria | 3538 |
| 19 | JGI24739J22299_10021051 | 3300001989 | Bacteria | 2325 |
| 20 | JGI24739J22299_10029358 | 3300001989 | Bacteria | 1913 |
| 21 | JGI24739J22299_10051500 | 3300001989 | Bacteria | 1328 |
| 22 | JGI24739J22299_10134404 | 3300001989 | Bacteria | 735 |
| 23 | JGI24739J22299_10157074 | 3300001989 | Bacteria | 672 |
| 24 | JGI24737J22298_10001590 | 3300001990 | Bacteria | 8075 |
| 25 | JGI24737J22298_10003732 | 3300001990 | Bacteria | 5360 |
| 26 | JGI24737J22298_10027060 | 3300001990 | Bacteria | 1810 |
| 27 | JGI24737J22298_10036959 | 3300001990 | Bacteria | 1506 |
| 28 | JGI24737J22298_10041158 | 3300001990 | Bacteria | 1417 |
| 29 | JGI24737J22298_10061695 | 3300001990 | Bacteria | 1127 |
| 30 | JGI24737J22298_10068351 | 3300001990 | Bacteria | 1062 |
| 31 | JGI24737J22298_10069519 | 3300001990 | Bacteria | 1052 |
| 32 | JGI24737J22298_10085395 | 3300001990 | Bacteria | 938 |
| 33 | JGI24737J22298_10117018 | 3300001990 | Bacteria | 788 |
| 34 | JGI24743J22301_10122747 | 3300001991 | Bacteria | 570 |
| 35 | JGI24735J21928_10001961 | 3300002067 | Bacteria | 7231 |
| 36 | JGI24735J21928_10013354 | 3300002067 | Bacteria | 2584 |
| 37 | JGI24735J21928_10020484 | 3300002067 | Bacteria | 2025 |
| 38 | JGI24735J21928_10037139 | 3300002067 | Bacteria | 1428 |
| 39 | JGI24735J21928_10050720 | 3300002067 | Bacteria | 1198 |
| 40 | JGI24735J21928_10087919 | 3300002067 | Bacteria | 890 |
| 41 | JGI24735J21928_10122964 | 3300002067 | Bacteria | 747 |
| 42 | JGI24735J21928_10164286 | 3300002067 | Bacteria | 641 |
| 43 | JGI24735J21928_10251458 | 3300002067 | Bacteria | 515 |
| 44 | JGI24750J21931_1000199 | 3300002070 | Bacteria | 10095 |
| 45 | JGI24748J21848_1000070 | 3300002074 | Bacteria | 36407 |
| 46 | JGI24748J21848_1012787 | 3300002074 | Bacteria | 991 |
| 47 | JGI24738J21930_10001288 | 3300002075 | Bacteria | 7018 |
| 48 | JGI24738J21930_10004666 | 3300002075 | Bacteria | 3337 |
| 49 | JGI24738J21930_10132714 | 3300002075 | Bacteria | 546 |
| 50 | JGI24749J21850_1000118 | 3300002076 | Bacteria | 13310 |
| 51 | JGI24744J21845_10005787 | 3300002077 | Bacteria | 2561 |
| 52 | JGI24033J26618_1073154 | 3300002155 | Bacteria | 517 |
| 53 | JGI24034J26672_10000038 | 3300002239 | Bacteria | 75372 |
| 54 | JGI24034J26672_10012171 | 3300002239 | Bacteria | 1294 |
| 55 | JGI24742J22300_10128925 | 3300002244 | Bacteria | 503 |
| 56 | JGI24751J29686_10000379 | 3300002459 | Bacteria | 14986 |
| 57 | JGI25157J39369_1026112 | 3300002741 | Bacteria | 679 |
| 58 | JGI25152J39213_1045210 | 3300002773 | Bacteria | 597 |
| 59 | JGI25150J39212_1000365 | 3300002774 | Bacteria | 21872 |
| 60 | JGI25150J39212_1000837 | 3300002774 | Bacteria | 10314 |
| 61 | JGI25151J46595_10029327 | 3300003187 | Bacteria | 2180 |
| 62 | JGI25165J46597_1000021 | 3300003214 | Bacteria | 359288 |
| 63 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 64 | JGI25153J46596_10000173 | 3300003215 | Bacteria | 64195 |
| 65 | JGI25153J46596_10001359 | 3300003215 | Bacteria | 14645 |
| 66 | JGI25153J46596_10087839 | 3300003215 | Bacteria | 759 |
| 67 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 68 | Ga0055542_1000025 | 3300003762 | Bacteria | 263538 |
| 69 | Ga0055542_1013672 | 3300003762 | Bacteria | 1358 |
| 70 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 71 | Ga0055529_1012053 | 3300003763 | Bacteria | 1109 |
| 72 | Ga0055526_1001689 | 3300003771 | Bacteria | 15428 |
| 73 | Ga0055537_1002389 | 3300003773 | Bacteria | 6339 |
| 74 | Ga0055537_1013876 | 3300003773 | Bacteria | 1490 |
| 75 | Ga0055524_1000320 | 3300003775 | Bacteria | 45185 |
| 76 | Ga0055524_1000341 | 3300003775 | Bacteria | 42723 |
| 77 | Ga0055536_1004136 | 3300003781 | Bacteria | 7522 |
| 78 | Ga0055536_1024452 | 3300003781 | Bacteria | 1749 |
| 79 | Ga0055536_1046965 | 3300003781 | Bacteria | 977 |
| 80 | Ga0055534_1019454 | 3300003784 | Bacteria | 1164 |
| 81 | Ga0055528_1076706 | 3300003790 | Bacteria | 594 |
| 82 | Ga0055528_1078700 | 3300003790 | Bacteria | 582 |
| 83 | Ga0055530_10001710 | 3300003791 | Bacteria | 15484 |
| 84 | Ga0055530_10013813 | 3300003791 | Bacteria | 2732 |
| 85 | Ga0055530_10014457 | 3300003791 | Bacteria | 2627 |
| 86 | Ga0055530_10019749 | 3300003791 | Bacteria | 2033 |
| 87 | Ga0055530_10026068 | 3300003791 | Bacteria | 1622 |
| 88 | Ga0055540_1000723 | 3300003792 | Bacteria | 22522 |
| 89 | Ga0055531_10002727 | 3300003794 | Bacteria | 11616 |
| 90 | Ga0055531_10012970 | 3300003794 | Bacteria | 3879 |
| 91 | Ga0055531_10025423 | 3300003794 | Bacteria | 2151 |
| 92 | Ga0055531_10025502 | 3300003794 | Bacteria | 2143 |
| 93 | Ga0055531_10032983 | 3300003794 | Bacteria | 1678 |
| 94 | Ga0055531_10034125 | 3300003794 | Bacteria | 1622 |
| 95 | Ga0055531_10041336 | 3300003794 | Bacteria | 1336 |
| 96 | JGI25405J52794_10009841 | 3300003911 | Bacteria | 1812 |
| 97 | Ga0055543_1014693 | 3300004625 | Bacteria | 1522 |
| 98 | Ga0065165_1015699 | 3300005262 | Bacteria | 2876 |
| 99 | Ga0065165_1069905 | 3300005262 | Bacteria | 935 |
| 100 | Ga0065165_1094332 | 3300005262 | Bacteria | 757 |
| 101 | Ga0065165_1167928 | 3300005262 | Bacteria | 503 |
| 102 | Ga0065714_10315197 | 3300005288 | Bacteria | 676 |
| 103 | Ga0065704_10278800 | 3300005289 | Bacteria | 927 |
| 104 | Ga0065704_10314217 | 3300005289 | Bacteria | 863 |
| 105 | Ga0065715_10782746 | 3300005293 | Bacteria | 617 |
| 106 | Ga0065707_10000576 | 3300005295 | Bacteria | 23548 |
| 107 | Ga0065707_10091874 | 3300005295 | Bacteria | 3866 |
| 108 | Ga0065707_10211558 | 3300005295 | Bacteria | 1259 |
| 109 | Ga0065707_10274776 | 3300005295 | Bacteria | 1057 |
| 110 | Ga0065707_10452404 | 3300005295 | Bacteria | 799 |
| 111 | Ga0070658_10001786 | 3300005327 | Bacteria | 18103 |
| 112 | Ga0070658_10010598 | 3300005327 | Bacteria | 7384 |
| 113 | Ga0070658_10293600 | 3300005327 | Bacteria | 1385 |
| 114 | Ga0070658_10340516 | 3300005327 | Bacteria | 1283 |
| 115 | Ga0070658_10441688 | 3300005327 | Bacteria | 1120 |
| 116 | Ga0070658_10517219 | 3300005327 | Bacteria | 1032 |
| 117 | Ga0070658_10661252 | 3300005327 | Bacteria | 907 |
| 118 | Ga0070658_10829423 | 3300005327 | Bacteria | 803 |
| 119 | Ga0070658_10947640 | 3300005327 | Bacteria | 748 |
| 120 | Ga0070676_10209264 | 3300005328 | Bacteria | 1283 |
| 121 | Ga0070676_10323450 | 3300005328 | Bacteria | 1052 |
| 122 | Ga0070683_100204503 | 3300005329 | Bacteria | 1875 |
| 123 | Ga0070683_100277426 | 3300005329 | Bacteria | 1595 |
| 124 | Ga0070683_101594646 | 3300005329 | Bacteria | 628 |
| 125 | Ga0070683_102166812 | 3300005329 | Bacteria | 534 |
| 126 | Ga0070690_100000097 | 3300005330 | Bacteria | 44576 |
| 127 | Ga0070670_100000075 | 3300005331 | Bacteria | 97494 |
| 128 | Ga0070670_100000093 | 3300005331 | Bacteria | 84800 |
| 129 | Ga0070670_100010675 | 3300005331 | Bacteria | 7846 |
| 130 | Ga0070670_100093304 | 3300005331 | Bacteria | 2589 |
| 131 | Ga0070670_100687098 | 3300005331 | Bacteria | 920 |
| 132 | Ga0070677_10069925 | 3300005333 | Bacteria | 1474 |
| 133 | Ga0070677_10083489 | 3300005333 | Bacteria | 1373 |
| 134 | Ga0068869_100000029 | 3300005334 | Bacteria | 61111 |
| 135 | Ga0068869_100056174 | 3300005334 | Bacteria | 2871 |
| 136 | Ga0068869_100556697 | 3300005334 | Bacteria | 964 |
| 137 | Ga0068869_100619997 | 3300005334 | Bacteria | 915 |
| 138 | Ga0068869_102032265 | 3300005334 | Bacteria | 516 |
| 139 | Ga0070666_10000004 | 3300005335 | Bacteria | 372098 |
| 140 | Ga0070666_10150584 | 3300005335 | Bacteria | 1623 |
| 141 | Ga0070666_10514357 | 3300005335 | Bacteria | 869 |
| 142 | Ga0070666_10788306 | 3300005335 | Bacteria | 699 |
| 143 | Ga0070666_11000859 | 3300005335 | Bacteria | 620 |
| 144 | Ga0070680_100021258 | 3300005336 | Bacteria | 5156 |
| 145 | Ga0070680_100933788 | 3300005336 | Bacteria | 749 |
| 146 | Ga0070682_100076023 | 3300005337 | Bacteria | 2161 |
| 147 | Ga0070682_100710784 | 3300005337 | Bacteria | 807 |
| 148 | Ga0068868_100003973 | 3300005338 | Bacteria | 10321 |
| 149 | Ga0068868_100501188 | 3300005338 | Bacteria | 1063 |
| 150 | Ga0068868_100841095 | 3300005338 | Bacteria | 831 |
| 151 | Ga0068868_101749607 | 3300005338 | Bacteria | 586 |
| 152 | Ga0070660_100016618 | 3300005339 | Bacteria | 5345 |
| 153 | Ga0070660_100061300 | 3300005339 | Bacteria | 2921 |
| 154 | Ga0070660_100125410 | 3300005339 | Bacteria | 2051 |
| 155 | Ga0070660_100173748 | 3300005339 | Bacteria | 1741 |
| 156 | Ga0070660_100240844 | 3300005339 | Bacteria | 1473 |
| 157 | Ga0070660_100286815 | 3300005339 | Bacteria | 1348 |
| 158 | Ga0070660_100559437 | 3300005339 | Bacteria | 954 |
| 159 | Ga0070660_100594981 | 3300005339 | Bacteria | 925 |
| 160 | Ga0070689_100050883 | 3300005340 | Bacteria | 3201 |
| 161 | Ga0070689_100919983 | 3300005340 | Bacteria | 774 |
| 162 | Ga0070691_10456170 | 3300005341 | Bacteria | 731 |
| 163 | Ga0070687_100420059 | 3300005343 | Bacteria | 882 |
| 164 | Ga0070661_100020393 | 3300005344 | Bacteria | 4726 |
| 165 | Ga0070661_100031335 | 3300005344 | Bacteria | 3845 |
| 166 | Ga0070661_100230723 | 3300005344 | Bacteria | 1422 |
| 167 | Ga0070661_100377865 | 3300005344 | Bacteria | 1116 |
| 168 | Ga0070661_100808839 | 3300005344 | Bacteria | 769 |
| 169 | Ga0070661_100862778 | 3300005344 | Bacteria | 746 |
| 170 | Ga0070661_101126156 | 3300005344 | Bacteria | 654 |
| 171 | Ga0070692_10841793 | 3300005345 | Bacteria | 630 |
| 172 | Ga0070668_100000831 | 3300005347 | Bacteria | 21324 |
| 173 | Ga0070668_100017594 | 3300005347 | Bacteria | 5360 |
| 174 | Ga0070668_100719613 | 3300005347 | Bacteria | 881 |
| 175 | Ga0070668_100732995 | 3300005347 | Bacteria | 874 |
| 176 | Ga0070669_100000115 | 3300005353 | Bacteria | 75928 |
| 177 | Ga0070669_100000296 | 3300005353 | Bacteria | 39004 |
| 178 | Ga0070669_100854356 | 3300005353 | Bacteria | 776 |
| 179 | Ga0070669_100934560 | 3300005353 | Bacteria | 742 |
| 180 | Ga0070669_100991154 | 3300005353 | Bacteria | 721 |
| 181 | Ga0070675_100098854 | 3300005354 | Bacteria | 2455 |
| 182 | Ga0070675_100126421 | 3300005354 | Bacteria | 2175 |
| 183 | Ga0070675_101302178 | 3300005354 | Bacteria | 670 |
| 184 | Ga0070671_100024172 | 3300005355 | Bacteria | 4973 |
| 185 | Ga0070671_100145848 | 3300005355 | Bacteria | 1998 |
| 186 | Ga0070671_100287990 | 3300005355 | Bacteria | 1398 |
| 187 | Ga0070671_100436300 | 3300005355 | Bacteria | 1123 |
| 188 | Ga0070671_100488119 | 3300005355 | Bacteria | 1059 |
| 189 | Ga0070671_100615864 | 3300005355 | Bacteria | 939 |
| 190 | Ga0070674_100058209 | 3300005356 | Bacteria | 2685 |
| 191 | Ga0070674_100829410 | 3300005356 | Bacteria | 800 |
| 192 | Ga0070674_100861718 | 3300005356 | Bacteria | 786 |
| 193 | Ga0070673_100000019 | 3300005364 | Bacteria | 107024 |
| 194 | Ga0070673_100286720 | 3300005364 | Bacteria | 1446 |
| 195 | Ga0070673_101102375 | 3300005364 | Bacteria | 742 |
| 196 | Ga0070673_101841538 | 3300005364 | Bacteria | 573 |
| 197 | Ga0070673_102297973 | 3300005364 | Bacteria | 513 |
| 198 | Ga0070688_100004740 | 3300005365 | Bacteria | 7107 |
| 199 | Ga0070688_100955353 | 3300005365 | Bacteria | 679 |
| 200 | Ga0070659_100095005 | 3300005366 | Bacteria | 2394 |
| 201 | Ga0070659_100140885 | 3300005366 | Bacteria | 1963 |
| 202 | Ga0070659_100221271 | 3300005366 | Bacteria | 1562 |
| 203 | Ga0070659_100222739 | 3300005366 | Bacteria | 1557 |
| 204 | Ga0070659_100246930 | 3300005366 | Bacteria | 1478 |
| 205 | Ga0070659_100704189 | 3300005366 | Bacteria | 873 |
| 206 | Ga0070659_101377798 | 3300005366 | Bacteria | 626 |
| 207 | Ga0070659_101819905 | 3300005366 | Bacteria | 545 |
| 208 | Ga0070659_102069681 | 3300005366 | Bacteria | 512 |
| 209 | Ga0070667_100000039 | 3300005367 | Bacteria | 170228 |
| 210 | Ga0070667_100013671 | 3300005367 | Bacteria | 6708 |
| 211 | Ga0070667_100044820 | 3300005367 | Bacteria | 3716 |
| 212 | Ga0070667_100188643 | 3300005367 | Bacteria | 1825 |
| 213 | Ga0070667_101768041 | 3300005367 | Bacteria | 582 |
| 214 | Ga0070667_102150848 | 3300005367 | Bacteria | 526 |
| 215 | Ga0070710_10640199 | 3300005437 | Bacteria | 744 |
| 216 | Ga0070701_10673112 | 3300005438 | Bacteria | 693 |
| 217 | Ga0070694_101003286 | 3300005444 | Bacteria | 693 |
| 218 | Ga0070663_100081755 | 3300005455 | Bacteria | 2375 |
| 219 | Ga0070663_100148712 | 3300005455 | Bacteria | 1794 |
| 220 | Ga0070663_100225700 | 3300005455 | Bacteria | 1473 |
| 221 | Ga0070663_100420899 | 3300005455 | Bacteria | 1095 |
| 222 | Ga0070663_100669376 | 3300005455 | Bacteria | 880 |
| 223 | Ga0070678_100006601 | 3300005456 | Bacteria | 6820 |
| 224 | Ga0070678_100040527 | 3300005456 | Bacteria | 3296 |
| 225 | Ga0070678_101189213 | 3300005456 | Bacteria | 707 |
| 226 | Ga0070678_101574103 | 3300005456 | Bacteria | 617 |
| 227 | Ga0070662_100020163 | 3300005457 | Bacteria | 4537 |
| 228 | Ga0070662_100024536 | 3300005457 | Bacteria | 4155 |
| 229 | Ga0070662_100044582 | 3300005457 | Bacteria | 3177 |
| 230 | Ga0070662_100358188 | 3300005457 | Bacteria | 1196 |
| 231 | Ga0070662_100377085 | 3300005457 | Bacteria | 1167 |
| 232 | Ga0070662_100436172 | 3300005457 | Bacteria | 1085 |
| 233 | Ga0070662_100519772 | 3300005457 | Bacteria | 994 |
| 234 | Ga0070662_100811721 | 3300005457 | Bacteria | 795 |
| 235 | Ga0070662_101285102 | 3300005457 | Bacteria | 630 |
| 236 | Ga0070662_101615296 | 3300005457 | Bacteria | 560 |
| 237 | Ga0070662_101777111 | 3300005457 | Bacteria | 533 |
| 238 | Ga0070662_101986251 | 3300005457 | Bacteria | 503 |
| 239 | Ga0070681_10078394 | 3300005458 | Bacteria | 3261 |
| 240 | Ga0070681_10131424 | 3300005458 | Bacteria | 2436 |
| 241 | Ga0068867_100000014 | 3300005459 | Bacteria | 112097 |
| 242 | Ga0068867_100083516 | 3300005459 | Bacteria | 2411 |
| 243 | Ga0068867_101459937 | 3300005459 | Bacteria | 636 |
| 244 | Ga0070685_10000806 | 3300005466 | Bacteria | 17034 |
| 245 | Ga0070706_101846410 | 3300005467 | Bacteria | 549 |
| 246 | Ga0070679_100000873 | 3300005530 | Bacteria | 26175 |
| 247 | Ga0070679_100651895 | 3300005530 | Bacteria | 995 |
| 248 | Ga0070679_101959785 | 3300005530 | Bacteria | 535 |
| 249 | Ga0070684_100136074 | 3300005535 | Bacteria | 2219 |
| 250 | Ga0070684_100204115 | 3300005535 | Bacteria | 1801 |
| 251 | Ga0070684_101536557 | 3300005535 | Bacteria | 627 |
| 252 | Ga0068853_100000960 | 3300005539 | Bacteria | 20266 |
| 253 | Ga0068853_100202129 | 3300005539 | Bacteria | 1808 |
| 254 | Ga0068853_100282094 | 3300005539 | Bacteria | 1531 |
| 255 | Ga0068853_100306801 | 3300005539 | Bacteria | 1468 |
| 256 | Ga0068853_100337575 | 3300005539 | Bacteria | 1399 |
| 257 | Ga0068853_100618322 | 3300005539 | Bacteria | 1030 |
| 258 | Ga0068853_100656641 | 3300005539 | Bacteria | 998 |
| 259 | Ga0068853_101091271 | 3300005539 | Bacteria | 769 |
| 260 | Ga0068853_102037210 | 3300005539 | Bacteria | 557 |
| 261 | Ga0070672_100182037 | 3300005543 | Bacteria | 1751 |
| 262 | Ga0070672_100534380 | 3300005543 | Bacteria | 1017 |
| 263 | Ga0070686_100000061 | 3300005544 | Bacteria | 83811 |
| 264 | Ga0070686_100006821 | 3300005544 | Bacteria | 6358 |
| 265 | Ga0070686_100561102 | 3300005544 | Bacteria | 895 |
| 266 | Ga0070686_101857804 | 3300005544 | Bacteria | 513 |
| 267 | Ga0070693_100211135 | 3300005547 | Bacteria | 1267 |
| 268 | Ga0070693_100435491 | 3300005547 | Bacteria | 917 |
| 269 | Ga0070693_100802929 | 3300005547 | Bacteria | 698 |
| 270 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 271 | Ga0070665_100000109 | 3300005548 | Bacteria | 155026 |
| 272 | Ga0070665_100001527 | 3300005548 | Bacteria | 26808 |
| 273 | Ga0070665_100010005 | 3300005548 | Bacteria | 9595 |
| 274 | Ga0070665_100126607 | 3300005548 | Bacteria | 2557 |
| 275 | Ga0070665_100255203 | 3300005548 | Bacteria | 1754 |
| 276 | Ga0070665_100429143 | 3300005548 | Bacteria | 1331 |
| 277 | Ga0070665_101247662 | 3300005548 | Bacteria | 754 |
| 278 | Ga0068855_100010206 | 3300005563 | Bacteria | 11321 |
| 279 | Ga0068855_100237795 | 3300005563 | Bacteria | 2036 |
| 280 | Ga0068855_100361015 | 3300005563 | Bacteria | 1598 |
| 281 | Ga0068855_100456541 | 3300005563 | Bacteria | 1394 |
| 282 | Ga0068855_100491032 | 3300005563 | Bacteria | 1335 |
| 283 | Ga0068855_100508392 | 3300005563 | Bacteria | 1308 |
| 284 | Ga0068855_100822833 | 3300005563 | Bacteria | 986 |
| 285 | Ga0068855_100855046 | 3300005563 | Bacteria | 964 |
| 286 | Ga0068855_101257490 | 3300005563 | Bacteria | 768 |
| 287 | Ga0068855_102579830 | 3300005563 | Bacteria | 504 |
| 288 | Ga0070664_100063876 | 3300005564 | Bacteria | 3139 |
| 289 | Ga0070664_100145529 | 3300005564 | Bacteria | 2089 |
| 290 | Ga0070664_100698762 | 3300005564 | Bacteria | 945 |
| 291 | Ga0070664_101529857 | 3300005564 | Bacteria | 631 |
| 292 | Ga0070664_101765256 | 3300005564 | Bacteria | 587 |
| 293 | Ga0068857_100055851 | 3300005577 | Bacteria | 3503 |
| 294 | Ga0068857_100060023 | 3300005577 | Bacteria | 3379 |
| 295 | Ga0068857_100066375 | 3300005577 | Bacteria | 3210 |
| 296 | Ga0068857_100167943 | 3300005577 | Bacteria | 1993 |
| 297 | Ga0068857_100233827 | 3300005577 | Bacteria | 1681 |
| 298 | Ga0068857_101240083 | 3300005577 | Bacteria | 723 |
| 299 | Ga0068857_101884696 | 3300005577 | Bacteria | 586 |
| 300 | Ga0068854_100031424 | 3300005578 | Bacteria | 3689 |
| 301 | Ga0068854_100051084 | 3300005578 | Bacteria | 2961 |
| 302 | Ga0068854_100074235 | 3300005578 | Bacteria | 2494 |
| 303 | Ga0068854_100092457 | 3300005578 | Bacteria | 2253 |
| 304 | Ga0068854_100410357 | 3300005578 | Bacteria | 1123 |
| 305 | Ga0068854_100465647 | 3300005578 | Bacteria | 1058 |
| 306 | Ga0068854_100845579 | 3300005578 | Bacteria | 801 |
| 307 | Ga0068854_101759412 | 3300005578 | Bacteria | 568 |
| 308 | Ga0068856_100060779 | 3300005614 | Bacteria | 3732 |
| 309 | Ga0068856_100262174 | 3300005614 | Bacteria | 1743 |
| 310 | Ga0068856_100338965 | 3300005614 | Bacteria | 1521 |
| 311 | Ga0068856_100372649 | 3300005614 | Bacteria | 1446 |
| 312 | Ga0068856_100443696 | 3300005614 | Bacteria | 1318 |
| 313 | Ga0068856_100480227 | 3300005614 | Bacteria | 1264 |
| 314 | Ga0068856_100620097 | 3300005614 | Bacteria | 1102 |
| 315 | Ga0068852_100098053 | 3300005616 | Bacteria | 2638 |
| 316 | Ga0068852_100185948 | 3300005616 | Bacteria | 1957 |
| 317 | Ga0068852_100239696 | 3300005616 | Bacteria | 1732 |
| 318 | Ga0068852_100262271 | 3300005616 | Bacteria | 1659 |
| 319 | Ga0068852_100443711 | 3300005616 | Bacteria | 1283 |
| 320 | Ga0068852_101031550 | 3300005616 | Bacteria | 842 |
| 321 | Ga0068852_101812706 | 3300005616 | Bacteria | 632 |
| 322 | Ga0068852_102499611 | 3300005616 | Bacteria | 537 |
| 323 | Ga0068852_102720078 | 3300005616 | Bacteria | 514 |
| 324 | Ga0068859_100001416 | 3300005617 | Bacteria | 24328 |
| 325 | Ga0068859_100009835 | 3300005617 | Bacteria | 9655 |
| 326 | Ga0068859_100058681 | 3300005617 | Bacteria | 3877 |
| 327 | Ga0068859_100166281 | 3300005617 | Bacteria | 2286 |
| 328 | Ga0068859_100173979 | 3300005617 | Bacteria | 2235 |
| 329 | Ga0068859_100505472 | 3300005617 | Bacteria | 1304 |
| 330 | Ga0068859_100798469 | 3300005617 | Bacteria | 1032 |
| 331 | Ga0068864_100000016 | 3300005618 | Bacteria | 292454 |
| 332 | Ga0068864_100000087 | 3300005618 | Bacteria | 98532 |
| 333 | Ga0068864_100002567 | 3300005618 | Bacteria | 14987 |
| 334 | Ga0068864_102434270 | 3300005618 | Bacteria | 530 |
| 335 | Ga0068866_11085482 | 3300005718 | Bacteria | 573 |
| 336 | Ga0068861_100000040 | 3300005719 | Bacteria | 59725 |
| 337 | Ga0068861_100006640 | 3300005719 | Bacteria | 7896 |
| 338 | Ga0068861_100635023 | 3300005719 | Bacteria | 984 |
| 339 | Ga0068861_101939186 | 3300005719 | Bacteria | 586 |
| 340 | Ga0068861_102125254 | 3300005719 | Bacteria | 562 |
| 341 | Ga0068851_10010412 | 3300005834 | Bacteria | 4342 |
| 342 | Ga0068851_10056665 | 3300005834 | Bacteria | 1999 |
| 343 | Ga0068851_10329818 | 3300005834 | Bacteria | 883 |
| 344 | Ga0068851_11038818 | 3300005834 | Bacteria | 518 |
| 345 | Ga0068870_10096183 | 3300005840 | Bacteria | 1665 |
| 346 | Ga0068870_10558785 | 3300005840 | Bacteria | 772 |
| 347 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 348 | Ga0068863_100000017 | 3300005841 | Bacteria | 207950 |
| 349 | Ga0068863_100000033 | 3300005841 | Bacteria | 170238 |
| 350 | Ga0068863_100008320 | 3300005841 | Bacteria | 10132 |
| 351 | Ga0068863_100140643 | 3300005841 | Bacteria | 2307 |
| 352 | Ga0068863_100234419 | 3300005841 | Bacteria | 1771 |
| 353 | Ga0068863_100358661 | 3300005841 | Bacteria | 1421 |
| 354 | Ga0068858_100000664 | 3300005842 | Bacteria | 35973 |
| 355 | Ga0068858_100004566 | 3300005842 | Bacteria | 13557 |
| 356 | Ga0068858_100708504 | 3300005842 | Bacteria | 980 |
| 357 | Ga0068858_102283401 | 3300005842 | Bacteria | 535 |
| 358 | Ga0068860_100000009 | 3300005843 | Bacteria | 372089 |
| 359 | Ga0068860_100028829 | 3300005843 | Bacteria | 5342 |
| 360 | Ga0068860_100053483 | 3300005843 | Bacteria | 3839 |
| 361 | Ga0068860_100264367 | 3300005843 | Bacteria | 1678 |
| 362 | Ga0068862_100000032 | 3300005844 | Bacteria | 179887 |
| 363 | Ga0068862_100000040 | 3300005844 | Bacteria | 167832 |
| 364 | Ga0068862_100000466 | 3300005844 | Bacteria | 43651 |
| 365 | Ga0068862_100001446 | 3300005844 | Bacteria | 21877 |
| 366 | Ga0068862_100105127 | 3300005844 | Bacteria | 2474 |
| 367 | Ga0068862_101080627 | 3300005844 | Bacteria | 797 |
| 368 | Ga0081455_10000215 | 3300005937 | Bacteria | 73808 |
| 369 | Ga0081540_1013216 | 3300005983 | Bacteria | 5381 |
| 370 | Ga0075364_10001520 | 3300006051 | Bacteria | 12625 |
| 371 | Ga0075364_11177761 | 3300006051 | Bacteria | 520 |
| 372 | Ga0075362_10167624 | 3300006177 | Bacteria | 1060 |
| 373 | Ga0075369_10031638 | 3300006186 | Bacteria | 2235 |
| 374 | Ga0075369_10084853 | 3300006186 | Bacteria | 1408 |
| 375 | Ga0075369_10116166 | 3300006186 | Bacteria | 1209 |
| 376 | Ga0075369_10337703 | 3300006186 | Bacteria | 706 |
| 377 | Ga0075366_10130637 | 3300006195 | Bacteria | 1516 |
| 378 | Ga0075366_10182388 | 3300006195 | Bacteria | 1275 |
| 379 | Ga0075366_10233689 | 3300006195 | Bacteria | 1120 |
| 380 | Ga0075366_10759202 | 3300006195 | Bacteria | 603 |
| 381 | Ga0075366_11042173 | 3300006195 | Bacteria | 511 |
| 382 | Ga0097621_100240098 | 3300006237 | Bacteria | 1584 |
| 383 | Ga0097621_101343528 | 3300006237 | Bacteria | 676 |
| 384 | Ga0097621_101467576 | 3300006237 | Bacteria | 647 |
| 385 | Ga0097621_101723020 | 3300006237 | Bacteria | 597 |
| 386 | Ga0097621_101868557 | 3300006237 | Bacteria | 573 |
| 387 | Ga0097621_102103718 | 3300006237 | Bacteria | 540 |
| 388 | Ga0075370_10008629 | 3300006353 | Bacteria | 5252 |
| 389 | Ga0075370_10023057 | 3300006353 | Bacteria | 3424 |
| 390 | Ga0075370_10412683 | 3300006353 | Bacteria | 811 |
| 391 | Ga0075370_10664875 | 3300006353 | Bacteria | 633 |
| 392 | Ga0075370_10676786 | 3300006353 | Bacteria | 627 |
| 393 | Ga0068871_100261117 | 3300006358 | Bacteria | 1511 |
| 394 | Ga0068871_100587711 | 3300006358 | Bacteria | 1012 |
| 395 | Ga0068871_101186315 | 3300006358 | Bacteria | 716 |
| 396 | Ga0075430_101078196 | 3300006846 | Bacteria | 662 |
| 397 | Ga0075434_100255877 | 3300006871 | Bacteria | 1770 |
| 398 | Ga0068865_100000018 | 3300006881 | Bacteria | 106975 |
| 399 | Ga0097620_100001416 | 3300006931 | Bacteria | 24328 |
| 400 | Ga0097620_100009835 | 3300006931 | Bacteria | 9655 |
| 401 | Ga0097620_100058681 | 3300006931 | Bacteria | 3877 |
| 402 | Ga0097620_100166292 | 3300006931 | Bacteria | 2286 |
| 403 | Ga0097620_100173972 | 3300006931 | Bacteria | 2235 |
| 404 | Ga0097620_100505473 | 3300006931 | Bacteria | 1304 |
| 405 | Ga0097620_100798483 | 3300006931 | Bacteria | 1032 |
| 406 | Ga0105251_10004716 | 3300009011 | Bacteria | 9147 |
| 407 | Ga0105251_10155260 | 3300009011 | Bacteria | 1032 |
| 408 | Ga0105244_10297884 | 3300009036 | Bacteria | 747 |
| 409 | Ga0105240_10001116 | 3300009093 | Bacteria | 47225 |
| 410 | Ga0105240_10024394 | 3300009093 | Bacteria | 7971 |
| 411 | Ga0105240_10191747 | 3300009093 | Bacteria | 2403 |
| 412 | Ga0105240_10610797 | 3300009093 | Bacteria | 1200 |
| 413 | Ga0105240_10749955 | 3300009093 | Bacteria | 1061 |
| 414 | Ga0105240_12393971 | 3300009093 | Bacteria | 546 |
| 415 | Ga0105240_12490842 | 3300009093 | Bacteria | 535 |
| 416 | Ga0105245_10002967 | 3300009098 | Bacteria | 15205 |
| 417 | Ga0105245_10005275 | 3300009098 | Bacteria | 11352 |
| 418 | Ga0105245_10406216 | 3300009098 | Bacteria | 1362 |
| 419 | Ga0105245_11568913 | 3300009098 | Bacteria | 710 |
| 420 | Ga0105247_10018821 | 3300009101 | Bacteria | 4146 |
| 421 | Ga0105247_10086839 | 3300009101 | Bacteria | 1980 |
| 422 | Ga0105247_10091941 | 3300009101 | Bacteria | 1927 |
| 423 | Ga0114129_12342286 | 3300009147 | Bacteria | 640 |
| 424 | Ga0105243_10000076 | 3300009148 | Bacteria | 110445 |
| 425 | Ga0105243_10003106 | 3300009148 | Bacteria | 13657 |
| 426 | Ga0105243_10358718 | 3300009148 | Bacteria | 1341 |
| 427 | Ga0105243_10522486 | 3300009148 | Bacteria | 1129 |
| 428 | Ga0105243_10693651 | 3300009148 | Bacteria | 992 |
| 429 | Ga0105243_11675996 | 3300009148 | Bacteria | 664 |
| 430 | Ga0105243_11796911 | 3300009148 | Bacteria | 644 |
| 431 | Ga0105243_13135099 | 3300009148 | Bacteria | 500 |
| 432 | Ga0105241_10004308 | 3300009174 | Bacteria | 10523 |
| 433 | Ga0105241_10090211 | 3300009174 | Bacteria | 2417 |
| 434 | Ga0105241_10407073 | 3300009174 | Bacteria | 1194 |
| 435 | Ga0105241_10417038 | 3300009174 | Bacteria | 1181 |
| 436 | Ga0105241_11874660 | 3300009174 | Bacteria | 587 |
| 437 | Ga0105241_11879984 | 3300009174 | Bacteria | 586 |
| 438 | Ga0105242_10009804 | 3300009176 | Bacteria | 7341 |
| 439 | Ga0105242_11353886 | 3300009176 | Bacteria | 737 |
| 440 | Ga0105248_10000021 | 3300009177 | Bacteria | 276159 |
| 441 | Ga0105248_10003987 | 3300009177 | Bacteria | 16323 |
| 442 | Ga0105248_10006062 | 3300009177 | Bacteria | 13270 |
| 443 | Ga0105248_10008689 | 3300009177 | Bacteria | 11162 |
| 444 | Ga0105248_10255282 | 3300009177 | Bacteria | 1973 |
| 445 | Ga0105248_10504523 | 3300009177 | Bacteria | 1364 |
| 446 | Ga0105237_10002858 | 3300009545 | Bacteria | 20999 |
| 447 | Ga0105237_10011259 | 3300009545 | Bacteria | 9464 |
| 448 | Ga0105237_10045964 | 3300009545 | Bacteria | 4393 |
| 449 | Ga0105237_10082257 | 3300009545 | Bacteria | 3211 |
| 450 | Ga0105237_10114196 | 3300009545 | Bacteria | 2693 |
| 451 | Ga0105237_10200169 | 3300009545 | Bacteria | 1997 |
| 452 | Ga0105237_10469740 | 3300009545 | Bacteria | 1264 |
| 453 | Ga0105237_11204749 | 3300009545 | Bacteria | 764 |
| 454 | Ga0105237_11486404 | 3300009545 | Bacteria | 684 |
| 455 | Ga0105237_12270548 | 3300009545 | Bacteria | 552 |
| 456 | Ga0105238_10103849 | 3300009551 | Bacteria | 2823 |
| 457 | Ga0105238_10108749 | 3300009551 | Bacteria | 2754 |
| 458 | Ga0105238_10138886 | 3300009551 | Bacteria | 2407 |
| 459 | Ga0105238_10157495 | 3300009551 | Bacteria | 2246 |
| 460 | Ga0105238_10214234 | 3300009551 | Bacteria | 1902 |
| 461 | Ga0105238_10373621 | 3300009551 | Bacteria | 1416 |
| 462 | Ga0105238_10421717 | 3300009551 | Bacteria | 1329 |
| 463 | Ga0105238_10521037 | 3300009551 | Bacteria | 1191 |
| 464 | Ga0105238_10541365 | 3300009551 | Bacteria | 1168 |
| 465 | Ga0105238_10843372 | 3300009551 | Bacteria | 933 |
| 466 | Ga0105238_11477082 | 3300009551 | Bacteria | 708 |
| 467 | Ga0105238_12385496 | 3300009551 | Bacteria | 564 |
| 468 | Ga0105238_12416452 | 3300009551 | Bacteria | 561 |
| 469 | Ga0105238_12548021 | 3300009551 | Bacteria | 547 |
| 470 | Ga0105238_12971625 | 3300009551 | Bacteria | 510 |
| 471 | Ga0105249_10000006 | 3300009553 | Bacteria | 354449 |
| 472 | Ga0105249_10000017 | 3300009553 | Bacteria | 277115 |
| 473 | Ga0105249_10001881 | 3300009553 | Bacteria | 18180 |
| 474 | Ga0105249_10203829 | 3300009553 | Bacteria | 1937 |
| 475 | Ga0105249_10249779 | 3300009553 | Bacteria | 1758 |
| 476 | Ga0105249_12218491 | 3300009553 | Bacteria | 622 |
| 477 | Ga0105239_10000546 | 3300010375 | Bacteria | 53959 |
| 478 | Ga0105239_10070988 | 3300010375 | Bacteria | 3826 |
| 479 | Ga0105239_10379102 | 3300010375 | Bacteria | 1599 |
| 480 | Ga0105239_11008231 | 3300010375 | Bacteria | 957 |
| 481 | Ga0105239_11166215 | 3300010375 | Bacteria | 887 |
| 482 | Ga0105239_12076595 | 3300010375 | Bacteria | 660 |
| 483 | Ga0105239_12764741 | 3300010375 | Bacteria | 573 |
| 484 | Ga0105239_13631876 | 3300010375 | Bacteria | 501 |
| 485 | Ga0105246_10161931 | 3300011119 | Bacteria | 1705 |
| 486 | Ga0105246_10588517 | 3300011119 | Bacteria | 959 |
| 487 | Ga0105246_10851547 | 3300011119 | Bacteria | 813 |
| 488 | Ga0105246_11219958 | 3300011119 | Bacteria | 693 |
| 489 | Ga0157317_1023388 | 3300012475 | Bacteria | 564 |
| 490 | Ga0157315_1007765 | 3300012508 | Bacteria | 879 |
| 491 | Ga0157326_1079519 | 3300012513 | Bacteria | 534 |
| 492 | Ga0157373_10081148 | 3300013100 | Bacteria | 2287 |
| 493 | Ga0157373_10565416 | 3300013100 | Bacteria | 826 |
| 494 | Ga0157373_10660838 | 3300013100 | Bacteria | 764 |
| 495 | Ga0157373_10662801 | 3300013100 | Bacteria | 763 |
| 496 | Ga0157373_10798128 | 3300013100 | Bacteria | 696 |
| 497 | Ga0157373_11528879 | 3300013100 | Bacteria | 510 |
| 498 | Ga0157371_10000059 | 3300013102 | Bacteria | 170541 |
| 499 | Ga0157371_10089328 | 3300013102 | Bacteria | 2182 |
| 500 | Ga0157371_10342701 | 3300013102 | Bacteria | 1087 |
| 501 | Ga0157371_10606382 | 3300013102 | Bacteria | 815 |
| 502 | Ga0157371_11339788 | 3300013102 | Bacteria | 555 |
| 503 | Ga0157370_10327199 | 3300013104 | Bacteria | 1413 |
| 504 | Ga0157370_10370331 | 3300013104 | Bacteria | 1320 |
| 505 | Ga0157370_10415992 | 3300013104 | Bacteria | 1237 |
| 506 | Ga0157370_10545838 | 3300013104 | Bacteria | 1063 |
| 507 | Ga0157370_11249102 | 3300013104 | Bacteria | 670 |
| 508 | Ga0157369_10073353 | 3300013105 | Bacteria | 3672 |
| 509 | Ga0157369_10083235 | 3300013105 | Bacteria | 3422 |
| 510 | Ga0157369_10211906 | 3300013105 | Bacteria | 2030 |
| 511 | Ga0157369_10281167 | 3300013105 | Bacteria | 1733 |
| 512 | Ga0157369_10298220 | 3300013105 | Bacteria | 1677 |
| 513 | Ga0157369_10312143 | 3300013105 | Bacteria | 1635 |
| 514 | Ga0157369_10444995 | 3300013105 | Bacteria | 1342 |
| 515 | Ga0157369_10840300 | 3300013105 | Bacteria | 943 |
| 516 | Ga0157369_11229243 | 3300013105 | Bacteria | 764 |
| 517 | Ga0157369_11658669 | 3300013105 | Bacteria | 650 |
| 518 | Ga0157369_12017709 | 3300013105 | Bacteria | 585 |
| 519 | Ga0157369_12583312 | 3300013105 | Bacteria | 514 |
| 520 | Ga0157374_10412425 | 3300013296 | Bacteria | 1349 |
| 521 | Ga0157378_10000504 | 3300013297 | Bacteria | 37070 |
| 522 | Ga0157378_10107742 | 3300013297 | Bacteria | 2550 |
| 523 | Ga0157378_10539715 | 3300013297 | Bacteria | 1170 |
| 524 | Ga0157378_10950271 | 3300013297 | Bacteria | 892 |
| 525 | Ga0157378_11480740 | 3300013297 | Bacteria | 723 |
| 526 | Ga0157378_11587366 | 3300013297 | Bacteria | 700 |
| 527 | Ga0163162_10092290 | 3300013306 | Bacteria | 3111 |
| 528 | Ga0163162_10421093 | 3300013306 | Bacteria | 1468 |
| 529 | Ga0163162_11521886 | 3300013306 | Bacteria | 762 |
| 530 | Ga0163162_12218841 | 3300013306 | Bacteria | 630 |
| 531 | Ga0157372_10084779 | 3300013307 | Bacteria | 3592 |
| 532 | Ga0157372_10573559 | 3300013307 | Bacteria | 1315 |
| 533 | Ga0157372_11126859 | 3300013307 | Bacteria | 907 |
| 534 | Ga0157372_11317178 | 3300013307 | Bacteria | 833 |
| 535 | Ga0157372_11994999 | 3300013307 | Bacteria | 667 |
| 536 | Ga0157372_12178074 | 3300013307 | Bacteria | 637 |
| 537 | Ga0157375_10082591 | 3300013308 | Bacteria | 3255 |
| 538 | Ga0157375_10446526 | 3300013308 | Bacteria | 1459 |
| 539 | Ga0157375_11409902 | 3300013308 | Bacteria | 821 |
| 540 | Ga0157375_13608339 | 3300013308 | Bacteria | 515 |
| 541 | Ga0163163_10465584 | 3300014325 | Bacteria | 1325 |
| 542 | Ga0163163_11563685 | 3300014325 | Bacteria | 721 |
| 543 | Ga0163163_11777425 | 3300014325 | Bacteria | 677 |
| 544 | Ga0163163_12645250 | 3300014325 | Bacteria | 559 |
| 545 | Ga0157380_10000157 | 3300014326 | Bacteria | 39384 |
| 546 | Ga0157380_10002166 | 3300014326 | Bacteria | 13178 |
| 547 | Ga0157380_10006678 | 3300014326 | Bacteria | 8144 |
| 548 | Ga0157380_10812507 | 3300014326 | Bacteria | 953 |
| 549 | Ga0157380_11992912 | 3300014326 | Bacteria | 642 |
| 550 | Ga0182008_10166668 | 3300014497 | Bacteria | 1111 |
| 551 | Ga0157377_10082035 | 3300014745 | Bacteria | 1887 |
| 552 | Ga0157377_10180500 | 3300014745 | Bacteria | 1327 |
| 553 | Ga0157377_10583524 | 3300014745 | Bacteria | 795 |
| 554 | Ga0157379_10001735 | 3300014968 | Bacteria | 18043 |
| 555 | Ga0157379_10051816 | 3300014968 | Bacteria | 3664 |
| 556 | Ga0157379_11466984 | 3300014968 | Bacteria | 663 |
| 557 | Ga0157379_12505109 | 3300014968 | Bacteria | 516 |
| 558 | Ga0157376_10000092 | 3300014969 | Bacteria | 68198 |
| 559 | Ga0157376_10492886 | 3300014969 | Bacteria | 1203 |
| 560 | Ga0157376_10716193 | 3300014969 | Bacteria | 1007 |
| 561 | Ga0157376_11441483 | 3300014969 | Bacteria | 721 |
| 562 | Ga0157376_11622424 | 3300014969 | Bacteria | 681 |
| 563 | Ga0183360_10368 | 3300015689 | Bacteria | 1189 |
| 564 | Ga0183363_1006 | 3300015690 | Bacteria | 400466 |
| 565 | Ga0163161_10000208 | 3300017792 | Bacteria | 53837 |
| 566 | Ga0163161_10144828 | 3300017792 | Bacteria | 1801 |
| 567 | Ga0163161_10167645 | 3300017792 | Bacteria | 1678 |
| 568 | Ga0163161_10541954 | 3300017792 | Bacteria | 953 |
| 569 | Ga0163161_10943367 | 3300017792 | Bacteria | 733 |
| 570 | Ga0197907_10274206 | 3300020069 | Bacteria | 875 |
| 571 | Ga0206356_10317151 | 3300020070 | Bacteria | 1289 |
| 572 | Ga0206349_1668694 | 3300020075 | Bacteria | 936 |
| 573 | Ga0206353_11808888 | 3300020082 | Bacteria | 1435 |
| 574 | Ga0213876_10016636 | 3300021384 | Bacteria | 3886 |
| 575 | Ga0213875_10001626 | 3300021388 | Bacteria | 14182 |
| 576 | Ga0209674_101560 | 3300025226 | Bacteria | 5818 |
| 577 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 578 | Ga0207427_104026 | 3300025231 | Bacteria | 2681 |
| 579 | Ga0209437_123370 | 3300025233 | Bacteria | 712 |
| 580 | Ga0207425_1000049 | 3300025245 | Bacteria | 180735 |
| 581 | Ga0207425_1011898 | 3300025245 | Bacteria | 2058 |
| 582 | Ga0209646_1020951 | 3300025246 | Bacteria | 941 |
| 583 | Ga0209646_1031500 | 3300025246 | Bacteria | 710 |
| 584 | Ga0209026_1000352 | 3300025250 | Bacteria | 43432 |
| 585 | Ga0209026_1013989 | 3300025250 | Bacteria | 1352 |
| 586 | Ga0209026_1031029 | 3300025250 | Bacteria | 792 |
| 587 | Ga0209677_105325 | 3300025253 | Bacteria | 3391 |
| 588 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 589 | Ga0209148_1000243 | 3300025254 | Bacteria | 86896 |
| 590 | Ga0209148_1005193 | 3300025254 | Bacteria | 3032 |
| 591 | Ga0209129_1000471 | 3300025258 | Bacteria | 29587 |
| 592 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 593 | Ga0209233_1000065 | 3300025261 | Bacteria | 387195 |
| 594 | Ga0209233_1006188 | 3300025261 | Bacteria | 3877 |
| 595 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 596 | Ga0209565_1000985 | 3300025263 | Bacteria | 14637 |
| 597 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 598 | Ga0209455_1002555 | 3300025272 | Bacteria | 6959 |
| 599 | Ga0209455_1031389 | 3300025272 | Bacteria | 893 |
| 600 | Ga0209673_1004450 | 3300025273 | Bacteria | 7501 |
| 601 | Ga0209673_1023801 | 3300025273 | Bacteria | 2075 |
| 602 | Ga0209675_1000104 | 3300025291 | Bacteria | 121249 |
| 603 | Ga0209676_1000512 | 3300025292 | Bacteria | 61167 |
| 604 | Ga0209676_1000807 | 3300025292 | Bacteria | 41068 |
| 605 | Ga0209676_1001199 | 3300025292 | Bacteria | 27715 |
| 606 | Ga0209676_1009827 | 3300025292 | Bacteria | 4068 |
| 607 | Ga0209676_1021566 | 3300025292 | Bacteria | 2159 |
| 608 | Ga0209676_1029229 | 3300025292 | Bacteria | 1705 |
| 609 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 610 | Ga0209025_1011083 | 3300025294 | Bacteria | 6006 |
| 611 | Ga0209025_1050489 | 3300025294 | Bacteria | 1662 |
| 612 | Ga0209564_1000335 | 3300025295 | Bacteria | 91079 |
| 613 | Ga0209564_1016953 | 3300025295 | Bacteria | 2869 |
| 614 | Ga0209564_1085619 | 3300025295 | Bacteria | 598 |
| 615 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 616 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 617 | Ga0209758_1017731 | 3300025297 | Bacteria | 3525 |
| 618 | Ga0209758_1169594 | 3300025297 | Bacteria | 534 |
| 619 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 620 | Ga0209050_1000286 | 3300025298 | Bacteria | 106566 |
| 621 | Ga0209050_1002774 | 3300025298 | Bacteria | 14045 |
| 622 | Ga0209050_1003389 | 3300025298 | Bacteria | 11828 |
| 623 | Ga0209050_1035962 | 3300025298 | Bacteria | 1455 |
| 624 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 625 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 626 | Ga0207426_1140179 | 3300025302 | Bacteria | 575 |
| 627 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 628 | Ga0209051_1038886 | 3300025303 | Bacteria | 1726 |
| 629 | Ga0209257_1000245 | 3300025304 | Bacteria | 125987 |
| 630 | Ga0209257_1000321 | 3300025304 | Bacteria | 100476 |
| 631 | Ga0209257_1000577 | 3300025304 | Bacteria | 61710 |
| 632 | Ga0209257_1000597 | 3300025304 | Bacteria | 59900 |
| 633 | Ga0209257_1003551 | 3300025304 | Bacteria | 13248 |
| 634 | Ga0209257_1004959 | 3300025304 | Bacteria | 9760 |
| 635 | Ga0209257_1016465 | 3300025304 | Bacteria | 2990 |
| 636 | Ga0209257_1026884 | 3300025304 | Bacteria | 1928 |
| 637 | Ga0209257_1028408 | 3300025304 | Bacteria | 1841 |
| 638 | Ga0209257_1035933 | 3300025304 | Bacteria | 1527 |
| 639 | Ga0207656_10004180 | 3300025321 | Bacteria | 5025 |
| 640 | Ga0207656_10023916 | 3300025321 | Bacteria | 2465 |
| 641 | Ga0207656_10229427 | 3300025321 | Bacteria | 904 |
| 642 | Ga0207656_10302528 | 3300025321 | Bacteria | 792 |
| 643 | Ga0207682_10001453 | 3300025893 | Bacteria | 10936 |
| 644 | Ga0207682_10407906 | 3300025893 | Bacteria | 642 |
| 645 | Ga0207682_10474015 | 3300025893 | Bacteria | 593 |
| 646 | Ga0207692_10992207 | 3300025898 | Bacteria | 554 |
| 647 | Ga0207642_10869034 | 3300025899 | Bacteria | 576 |
| 648 | Ga0207710_10004955 | 3300025900 | Bacteria | 5769 |
| 649 | Ga0207710_10008017 | 3300025900 | Bacteria | 4465 |
| 650 | Ga0207710_10066752 | 3300025900 | Bacteria | 1642 |
| 651 | Ga0207688_10302991 | 3300025901 | Bacteria | 977 |
| 652 | Ga0207688_10449418 | 3300025901 | Bacteria | 803 |
| 653 | Ga0207688_11080046 | 3300025901 | Bacteria | 506 |
| 654 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 655 | Ga0207680_10559990 | 3300025903 | Bacteria | 816 |
| 656 | Ga0207680_10775750 | 3300025903 | Bacteria | 687 |
| 657 | Ga0207680_10792934 | 3300025903 | Bacteria | 679 |
| 658 | Ga0207680_11343394 | 3300025903 | Bacteria | 508 |
| 659 | Ga0207647_10000069 | 3300025904 | Bacteria | 80952 |
| 660 | Ga0207647_10009251 | 3300025904 | Bacteria | 7006 |
| 661 | Ga0207647_10035876 | 3300025904 | Bacteria | 3155 |
| 662 | Ga0207647_10068151 | 3300025904 | Bacteria | 2154 |
| 663 | Ga0207647_10137710 | 3300025904 | Bacteria | 1432 |
| 664 | Ga0207647_10168495 | 3300025904 | Bacteria | 1276 |
| 665 | Ga0207645_10014111 | 3300025907 | Bacteria | 5353 |
| 666 | Ga0207645_10021253 | 3300025907 | Bacteria | 4234 |
| 667 | Ga0207645_10372006 | 3300025907 | Bacteria | 958 |
| 668 | Ga0207705_10000084 | 3300025909 | Bacteria | 116809 |
| 669 | Ga0207705_10000243 | 3300025909 | Bacteria | 53479 |
| 670 | Ga0207705_10000511 | 3300025909 | Bacteria | 33036 |
| 671 | Ga0207705_10002954 | 3300025909 | Bacteria | 12998 |
| 672 | Ga0207705_10049162 | 3300025909 | Bacteria | 3035 |
| 673 | Ga0207705_10841844 | 3300025909 | Bacteria | 711 |
| 674 | Ga0207705_10862539 | 3300025909 | Bacteria | 702 |
| 675 | Ga0207705_11032938 | 3300025909 | Bacteria | 634 |
| 676 | Ga0207684_11444845 | 3300025910 | Bacteria | 561 |
| 677 | Ga0207654_10000796 | 3300025911 | Bacteria | 17350 |
| 678 | Ga0207654_10000810 | 3300025911 | Bacteria | 17231 |
| 679 | Ga0207654_10195143 | 3300025911 | Bacteria | 1330 |
| 680 | Ga0207707_10045078 | 3300025912 | Bacteria | 3843 |
| 681 | Ga0207695_10000288 | 3300025913 | Bacteria | 125085 |
| 682 | Ga0207695_10003496 | 3300025913 | Bacteria | 22050 |
| 683 | Ga0207695_10006167 | 3300025913 | Bacteria | 15631 |
| 684 | Ga0207695_10095035 | 3300025913 | Bacteria | 2986 |
| 685 | Ga0207695_10103895 | 3300025913 | Bacteria | 2832 |
| 686 | Ga0207695_10171402 | 3300025913 | Bacteria | 2096 |
| 687 | Ga0207671_10002884 | 3300025914 | Bacteria | 17804 |
| 688 | Ga0207671_10003173 | 3300025914 | Bacteria | 16603 |
| 689 | Ga0207671_10003747 | 3300025914 | Bacteria | 14974 |
| 690 | Ga0207671_10022700 | 3300025914 | Bacteria | 4741 |
| 691 | Ga0207671_10182611 | 3300025914 | Bacteria | 1633 |
| 692 | Ga0207671_10552124 | 3300025914 | Bacteria | 918 |
| 693 | Ga0207660_10001492 | 3300025917 | Bacteria | 15752 |
| 694 | Ga0207660_11185096 | 3300025917 | Bacteria | 622 |
| 695 | Ga0207662_11065466 | 3300025918 | Bacteria | 574 |
| 696 | Ga0207657_10028620 | 3300025919 | Bacteria | 5080 |
| 697 | Ga0207657_10028866 | 3300025919 | Bacteria | 5055 |
| 698 | Ga0207657_10028985 | 3300025919 | Bacteria | 5044 |
| 699 | Ga0207657_10048886 | 3300025919 | Bacteria | 3690 |
| 700 | Ga0207657_10085735 | 3300025919 | Bacteria | 2637 |
| 701 | Ga0207657_10139728 | 3300025919 | Bacteria | 1979 |
| 702 | Ga0207657_10214187 | 3300025919 | Bacteria | 1545 |
| 703 | Ga0207657_10232634 | 3300025919 | Bacteria | 1473 |
| 704 | Ga0207657_10276144 | 3300025919 | Bacteria | 1335 |
| 705 | Ga0207657_10495134 | 3300025919 | Bacteria | 958 |
| 706 | Ga0207657_10506335 | 3300025919 | Bacteria | 946 |
| 707 | Ga0207657_10632222 | 3300025919 | Bacteria | 834 |
| 708 | Ga0207649_10000212 | 3300025920 | Bacteria | 48063 |
| 709 | Ga0207649_10003617 | 3300025920 | Bacteria | 8440 |
| 710 | Ga0207649_10103905 | 3300025920 | Bacteria | 1886 |
| 711 | Ga0207649_10197129 | 3300025920 | Bacteria | 1420 |
| 712 | Ga0207649_10395053 | 3300025920 | Bacteria | 1033 |
| 713 | Ga0207649_11186539 | 3300025920 | Bacteria | 603 |
| 714 | Ga0207652_10000008 | 3300025921 | Bacteria | 286698 |
| 715 | Ga0207652_10502029 | 3300025921 | Bacteria | 1092 |
| 716 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 717 | Ga0207681_10000197 | 3300025923 | Bacteria | 48475 |
| 718 | Ga0207681_10684161 | 3300025923 | Bacteria | 852 |
| 719 | Ga0207681_11150961 | 3300025923 | Bacteria | 652 |
| 720 | Ga0207694_10002782 | 3300025924 | Bacteria | 14124 |
| 721 | Ga0207694_10016018 | 3300025924 | Bacteria | 5657 |
| 722 | Ga0207694_10049198 | 3300025924 | Bacteria | 3263 |
| 723 | Ga0207694_10124310 | 3300025924 | Bacteria | 2062 |
| 724 | Ga0207694_10363345 | 3300025924 | Bacteria | 1200 |
| 725 | Ga0207694_10382618 | 3300025924 | Bacteria | 1168 |
| 726 | Ga0207694_10659746 | 3300025924 | Bacteria | 881 |
| 727 | Ga0207694_11014525 | 3300025924 | Bacteria | 702 |
| 728 | Ga0207694_11894867 | 3300025924 | Bacteria | 500 |
| 729 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 730 | Ga0207650_10000069 | 3300025925 | Bacteria | 138442 |
| 731 | Ga0207650_10068635 | 3300025925 | Bacteria | 2662 |
| 732 | Ga0207650_10208243 | 3300025925 | Bacteria | 1570 |
| 733 | Ga0207650_10218925 | 3300025925 | Bacteria | 1531 |
| 734 | Ga0207659_10009064 | 3300025926 | Bacteria | 6208 |
| 735 | Ga0207659_10396469 | 3300025926 | Bacteria | 1153 |
| 736 | Ga0207659_11003722 | 3300025926 | Bacteria | 718 |
| 737 | Ga0207659_11019975 | 3300025926 | Bacteria | 712 |
| 738 | Ga0207687_10003114 | 3300025927 | Bacteria | 11241 |
| 739 | Ga0207687_10079745 | 3300025927 | Bacteria | 2361 |
| 740 | Ga0207687_10236428 | 3300025927 | Bacteria | 1446 |
| 741 | Ga0207687_11118299 | 3300025927 | Bacteria | 677 |
| 742 | Ga0207644_10000145 | 3300025931 | Bacteria | 50586 |
| 743 | Ga0207644_10058536 | 3300025931 | Bacteria | 2785 |
| 744 | Ga0207644_10163232 | 3300025931 | Bacteria | 1733 |
| 745 | Ga0207644_10312997 | 3300025931 | Bacteria | 1268 |
| 746 | Ga0207644_10611291 | 3300025931 | Bacteria | 906 |
| 747 | Ga0207690_10004341 | 3300025932 | Bacteria | 8375 |
| 748 | Ga0207690_10066595 | 3300025932 | Bacteria | 2468 |
| 749 | Ga0207690_10075431 | 3300025932 | Bacteria | 2339 |
| 750 | Ga0207690_10480941 | 3300025932 | Bacteria | 1002 |
| 751 | Ga0207690_10666319 | 3300025932 | Bacteria | 854 |
| 752 | Ga0207690_10725464 | 3300025932 | Bacteria | 818 |
| 753 | Ga0207690_11366109 | 3300025932 | Bacteria | 592 |
| 754 | Ga0207690_11450002 | 3300025932 | Bacteria | 574 |
| 755 | Ga0207706_10022259 | 3300025933 | Bacteria | 5687 |
| 756 | Ga0207706_10041508 | 3300025933 | Bacteria | 4079 |
| 757 | Ga0207706_10180514 | 3300025933 | Bacteria | 1854 |
| 758 | Ga0207706_10181057 | 3300025933 | Bacteria | 1851 |
| 759 | Ga0207706_10229574 | 3300025933 | Bacteria | 1624 |
| 760 | Ga0207706_10310239 | 3300025933 | Bacteria | 1374 |
| 761 | Ga0207706_10344241 | 3300025933 | Bacteria | 1297 |
| 762 | Ga0207706_10361163 | 3300025933 | Bacteria | 1262 |
| 763 | Ga0207706_10702569 | 3300025933 | Bacteria | 864 |
| 764 | Ga0207706_10946056 | 3300025933 | Bacteria | 726 |
| 765 | Ga0207706_11181552 | 3300025933 | Bacteria | 636 |
| 766 | Ga0207686_10004287 | 3300025934 | Bacteria | 7648 |
| 767 | Ga0207686_10156000 | 3300025934 | Bacteria | 1595 |
| 768 | Ga0207686_11396709 | 3300025934 | Bacteria | 576 |
| 769 | Ga0207709_10000114 | 3300025935 | Bacteria | 124672 |
| 770 | Ga0207709_10000246 | 3300025935 | Bacteria | 66685 |
| 771 | Ga0207709_10462012 | 3300025935 | Bacteria | 983 |
| 772 | Ga0207709_10550523 | 3300025935 | Bacteria | 907 |
| 773 | Ga0207709_10703101 | 3300025935 | Bacteria | 809 |
| 774 | Ga0207670_10017586 | 3300025936 | Bacteria | 4324 |
| 775 | Ga0207670_11740647 | 3300025936 | Bacteria | 530 |
| 776 | Ga0207669_10005822 | 3300025937 | Bacteria | 5575 |
| 777 | Ga0207669_10017734 | 3300025937 | Bacteria | 3660 |
| 778 | Ga0207669_10629947 | 3300025937 | Bacteria | 875 |
| 779 | Ga0207669_10946787 | 3300025937 | Bacteria | 721 |
| 780 | Ga0207704_10000008 | 3300025938 | Bacteria | 204682 |
| 781 | Ga0207691_10125275 | 3300025940 | Bacteria | 2274 |
| 782 | Ga0207691_10473191 | 3300025940 | Bacteria | 1065 |
| 783 | Ga0207691_10492740 | 3300025940 | Bacteria | 1041 |
| 784 | Ga0207691_11152377 | 3300025940 | Bacteria | 644 |
| 785 | Ga0207691_11629418 | 3300025940 | Bacteria | 524 |
| 786 | Ga0207711_10000025 | 3300025941 | Bacteria | 289972 |
| 787 | Ga0207711_10001472 | 3300025941 | Bacteria | 21955 |
| 788 | Ga0207711_10005846 | 3300025941 | Bacteria | 10390 |
| 789 | Ga0207711_10006762 | 3300025941 | Bacteria | 9642 |
| 790 | Ga0207711_10015720 | 3300025941 | Bacteria | 6277 |
| 791 | Ga0207689_10000608 | 3300025942 | Bacteria | 34222 |
| 792 | Ga0207689_10099854 | 3300025942 | Bacteria | 2385 |
| 793 | Ga0207689_10280169 | 3300025942 | Bacteria | 1381 |
| 794 | Ga0207689_10392332 | 3300025942 | Bacteria | 1156 |
| 795 | Ga0207689_10716978 | 3300025942 | Bacteria | 844 |
| 796 | Ga0207661_10236839 | 3300025944 | Bacteria | 1618 |
| 797 | Ga0207661_10536130 | 3300025944 | Bacteria | 1071 |
| 798 | Ga0207661_10638479 | 3300025944 | Bacteria | 978 |
| 799 | Ga0207661_11430975 | 3300025944 | Bacteria | 634 |
| 800 | Ga0207679_10050964 | 3300025945 | Bacteria | 3028 |
| 801 | Ga0207679_10157897 | 3300025945 | Bacteria | 1854 |
| 802 | Ga0207679_10378715 | 3300025945 | Bacteria | 1240 |
| 803 | Ga0207679_11301270 | 3300025945 | Bacteria | 667 |
| 804 | Ga0207679_11432425 | 3300025945 | Bacteria | 634 |
| 805 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 806 | Ga0207667_10000024 | 3300025949 | Bacteria | 355874 |
| 807 | Ga0207667_10004183 | 3300025949 | Bacteria | 17730 |
| 808 | Ga0207667_10206634 | 3300025949 | Bacteria | 2013 |
| 809 | Ga0207667_10491059 | 3300025949 | Bacteria | 1246 |
| 810 | Ga0207667_10553369 | 3300025949 | Bacteria | 1163 |
| 811 | Ga0207667_10686476 | 3300025949 | Bacteria | 1027 |
| 812 | Ga0207667_11598959 | 3300025949 | Bacteria | 620 |
| 813 | Ga0207651_10000008 | 3300025960 | Bacteria | 204538 |
| 814 | Ga0207651_10486602 | 3300025960 | Bacteria | 1064 |
| 815 | Ga0207651_11659456 | 3300025960 | Bacteria | 576 |
| 816 | Ga0207651_11838274 | 3300025960 | Bacteria | 545 |
| 817 | Ga0207712_10000012 | 3300025961 | Bacteria | 392363 |
| 818 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 819 | Ga0207712_10005054 | 3300025961 | Bacteria | 8350 |
| 820 | Ga0207712_10074681 | 3300025961 | Bacteria | 2448 |
| 821 | Ga0207712_10124290 | 3300025961 | Bacteria | 1957 |
| 822 | Ga0207668_10000113 | 3300025972 | Bacteria | 57453 |
| 823 | Ga0207668_10017274 | 3300025972 | Bacteria | 4516 |
| 824 | Ga0207668_10817192 | 3300025972 | Bacteria | 826 |
| 825 | Ga0207668_11440424 | 3300025972 | Bacteria | 621 |
| 826 | Ga0207668_11921966 | 3300025972 | Bacteria | 533 |
| 827 | Ga0207640_10002027 | 3300025981 | Bacteria | 10944 |
| 828 | Ga0207640_10013183 | 3300025981 | Bacteria | 4730 |
| 829 | Ga0207640_10036573 | 3300025981 | Bacteria | 3084 |
| 830 | Ga0207640_10100085 | 3300025981 | Bacteria | 2030 |
| 831 | Ga0207640_10440941 | 3300025981 | Bacteria | 1071 |
| 832 | Ga0207640_10608503 | 3300025981 | Bacteria | 926 |
| 833 | Ga0207640_10998134 | 3300025981 | Bacteria | 736 |
| 834 | Ga0207640_11205523 | 3300025981 | Bacteria | 673 |
| 835 | Ga0207658_10000428 | 3300025986 | Bacteria | 39861 |
| 836 | Ga0207658_10009141 | 3300025986 | Bacteria | 6722 |
| 837 | Ga0207658_10010246 | 3300025986 | Bacteria | 6368 |
| 838 | Ga0207658_11843379 | 3300025986 | Bacteria | 551 |
| 839 | Ga0207677_10000091 | 3300026023 | Bacteria | 74163 |
| 840 | Ga0207677_11302107 | 3300026023 | Bacteria | 667 |
| 841 | Ga0207677_11497990 | 3300026023 | Bacteria | 623 |
| 842 | Ga0207703_10002426 | 3300026035 | Bacteria | 16170 |
| 843 | Ga0207703_10003828 | 3300026035 | Bacteria | 12502 |
| 844 | Ga0207703_10994092 | 3300026035 | Bacteria | 805 |
| 845 | Ga0207639_10003616 | 3300026041 | Bacteria | 10382 |
| 846 | Ga0207639_10013397 | 3300026041 | Bacteria | 5739 |
| 847 | Ga0207639_10020428 | 3300026041 | Bacteria | 4740 |
| 848 | Ga0207639_10020539 | 3300026041 | Bacteria | 4728 |
| 849 | Ga0207639_10041198 | 3300026041 | Bacteria | 3454 |
| 850 | Ga0207639_10119130 | 3300026041 | Bacteria | 2166 |
| 851 | Ga0207639_10200720 | 3300026041 | Bacteria | 1710 |
| 852 | Ga0207639_10272272 | 3300026041 | Bacteria | 1486 |
| 853 | Ga0207639_10307772 | 3300026041 | Bacteria | 1403 |
| 854 | Ga0207639_11098996 | 3300026041 | Bacteria | 746 |
| 855 | Ga0207639_11296198 | 3300026041 | Bacteria | 684 |
| 856 | Ga0207678_10004876 | 3300026067 | Bacteria | 12048 |
| 857 | Ga0207678_10016489 | 3300026067 | Bacteria | 6486 |
| 858 | Ga0207678_10175338 | 3300026067 | Bacteria | 1831 |
| 859 | Ga0207678_10301146 | 3300026067 | Bacteria | 1378 |
| 860 | Ga0207678_10703703 | 3300026067 | Bacteria | 889 |
| 861 | Ga0207678_10909510 | 3300026067 | Bacteria | 778 |
| 862 | Ga0207702_10003021 | 3300026078 | Bacteria | 15630 |
| 863 | Ga0207702_10005062 | 3300026078 | Bacteria | 11576 |
| 864 | Ga0207702_10006302 | 3300026078 | Bacteria | 10251 |
| 865 | Ga0207702_10153725 | 3300026078 | Bacteria | 2095 |
| 866 | Ga0207702_10192692 | 3300026078 | Bacteria | 1884 |
| 867 | Ga0207702_10210284 | 3300026078 | Bacteria | 1808 |
| 868 | Ga0207702_10274235 | 3300026078 | Bacteria | 1592 |
| 869 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 870 | Ga0207641_10000036 | 3300026088 | Bacteria | 213165 |
| 871 | Ga0207641_10000099 | 3300026088 | Bacteria | 122892 |
| 872 | Ga0207641_10006011 | 3300026088 | Bacteria | 10288 |
| 873 | Ga0207641_10112331 | 3300026088 | Bacteria | 2417 |
| 874 | Ga0207641_10223420 | 3300026088 | Bacteria | 1747 |
| 875 | Ga0207641_11260024 | 3300026088 | Bacteria | 740 |
| 876 | Ga0207648_10000009 | 3300026089 | Bacteria | 204229 |
| 877 | Ga0207648_10014717 | 3300026089 | Bacteria | 7220 |
| 878 | Ga0207648_10603009 | 3300026089 | Bacteria | 1012 |
| 879 | Ga0207648_10787837 | 3300026089 | Bacteria | 884 |
| 880 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 881 | Ga0207676_10000044 | 3300026095 | Bacteria | 161679 |
| 882 | Ga0207676_10001345 | 3300026095 | Bacteria | 18261 |
| 883 | Ga0207676_10922563 | 3300026095 | Bacteria | 857 |
| 884 | Ga0207676_12417247 | 3300026095 | Bacteria | 522 |
| 885 | Ga0207674_10017839 | 3300026116 | Bacteria | 7737 |
| 886 | Ga0207674_10050570 | 3300026116 | Bacteria | 4245 |
| 887 | Ga0207674_10066644 | 3300026116 | Bacteria | 3626 |
| 888 | Ga0207674_10095821 | 3300026116 | Bacteria | 2953 |
| 889 | Ga0207674_10197887 | 3300026116 | Bacteria | 1959 |
| 890 | Ga0207674_10423883 | 3300026116 | Bacteria | 1286 |
| 891 | Ga0207674_10536182 | 3300026116 | Bacteria | 1131 |
| 892 | Ga0207674_11775389 | 3300026116 | Bacteria | 584 |
| 893 | Ga0207674_12056820 | 3300026116 | Bacteria | 535 |
| 894 | Ga0207675_100000157 | 3300026118 | Bacteria | 59865 |
| 895 | Ga0207675_100001117 | 3300026118 | Bacteria | 26571 |
| 896 | Ga0207675_100015082 | 3300026118 | Bacteria | 7210 |
| 897 | Ga0207675_100318652 | 3300026118 | Bacteria | 1518 |
| 898 | Ga0207675_102043211 | 3300026118 | Bacteria | 590 |
| 899 | Ga0207683_10004633 | 3300026121 | Bacteria | 11856 |
| 900 | Ga0207683_10006500 | 3300026121 | Bacteria | 10001 |
| 901 | Ga0207683_10701972 | 3300026121 | Bacteria | 938 |
| 902 | Ga0207683_11689544 | 3300026121 | Bacteria | 582 |
| 903 | Ga0207698_10000496 | 3300026142 | Bacteria | 22942 |
| 904 | Ga0207698_10002491 | 3300026142 | Bacteria | 10925 |
| 905 | Ga0207698_10005844 | 3300026142 | Bacteria | 7643 |
| 906 | Ga0207698_10215161 | 3300026142 | Bacteria | 1732 |
| 907 | Ga0207698_10235827 | 3300026142 | Bacteria | 1664 |
| 908 | Ga0207698_10308204 | 3300026142 | Bacteria | 1477 |
| 909 | Ga0207698_10579932 | 3300026142 | Bacteria | 1103 |
| 910 | Ga0207698_10826820 | 3300026142 | Bacteria | 930 |
| 911 | Ga0207698_11144138 | 3300026142 | Bacteria | 792 |
| 912 | Ga0209998_10068929 | 3300027717 | Bacteria | 843 |
| 913 | Ga0209974_10058972 | 3300027876 | Bacteria | 1298 |
| 914 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 915 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 916 | Ga0268266_10000560 | 3300028379 | Bacteria | 51866 |
| 917 | Ga0268266_10008365 | 3300028379 | Bacteria | 9202 |
| 918 | Ga0268266_10157745 | 3300028379 | Bacteria | 2051 |
| 919 | Ga0268266_10553148 | 3300028379 | Bacteria | 1103 |
| 920 | Ga0268266_11113731 | 3300028379 | Bacteria | 764 |
| 921 | Ga0268266_11854022 | 3300028379 | Bacteria | 577 |
| 922 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 923 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 924 | Ga0268265_10000047 | 3300028380 | Bacteria | 179354 |
| 925 | Ga0268265_10000125 | 3300028380 | Bacteria | 96710 |
| 926 | Ga0268265_10231745 | 3300028380 | Bacteria | 1623 |
| 927 | Ga0268265_12333057 | 3300028380 | Bacteria | 542 |
| 928 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 929 | Ga0268264_10014193 | 3300028381 | Bacteria | 6550 |
| 930 | Ga0268264_10074867 | 3300028381 | Bacteria | 2877 |
| 931 | Ga0268264_10205367 | 3300028381 | Bacteria | 1805 |
| 932 | Ga0268264_11672397 | 3300028381 | Bacteria | 647 |
| 933 | Ga0307515_10341363 | 3300028794 | Bacteria | 1150 |
| 934 | Ga0265338_10170208 | 3300028800 | Bacteria | 1672 |
| 935 | Ga0314311_1129629 | 3300030733 | Bacteria | 894 |
| 936 | Ga0316183_1101809 | 3300030742 | Bacteria | 3404 |
| 937 | Ga0307513_10032777 | 3300031456 | Bacteria | 5852 |
| 938 | Ga0307513_10259144 | 3300031456 | Bacteria | 1530 |
| 939 | Ga0307513_10504297 | 3300031456 | Bacteria | 927 |
| 940 | Ga0307513_10691202 | 3300031456 | Bacteria | 726 |
| 941 | Ga0307513_10745609 | 3300031456 | Bacteria | 685 |
| 942 | Ga0307408_100002738 | 3300031548 | Bacteria | 12231 |
| 943 | Ga0307408_100999629 | 3300031548 | Bacteria | 771 |
| 944 | Ga0307408_101455450 | 3300031548 | Bacteria | 646 |
| 945 | Ga0307508_10004384 | 3300031616 | Bacteria | 13803 |
| 946 | Ga0307405_10045306 | 3300031731 | Bacteria | 2694 |
| 947 | Ga0307405_10064746 | 3300031731 | Bacteria | 2324 |
| 948 | Ga0307405_10341476 | 3300031731 | Bacteria | 1151 |
| 949 | Ga0307405_10464188 | 3300031731 | Bacteria | 1007 |
| 950 | Ga0307405_10912860 | 3300031731 | Bacteria | 743 |
| 951 | Ga0307405_11445527 | 3300031731 | Bacteria | 602 |
| 952 | Ga0307405_11717863 | 3300031731 | Bacteria | 556 |
| 953 | Ga0307405_11939894 | 3300031731 | Bacteria | 526 |
| 954 | Ga0307413_10074350 | 3300031824 | Bacteria | 2152 |
| 955 | Ga0307413_10267957 | 3300031824 | Bacteria | 1277 |
| 956 | Ga0307413_10876998 | 3300031824 | Bacteria | 760 |
| 957 | Ga0307413_10923106 | 3300031824 | Bacteria | 743 |
| 958 | Ga0307413_10989766 | 3300031824 | Bacteria | 720 |
| 959 | Ga0307413_11491805 | 3300031824 | Bacteria | 597 |
| 960 | Ga0307410_10020800 | 3300031852 | Bacteria | 4023 |
| 961 | Ga0307410_10182426 | 3300031852 | Bacteria | 1590 |
| 962 | Ga0307410_10757338 | 3300031852 | Bacteria | 823 |
| 963 | Ga0307410_11125492 | 3300031852 | Bacteria | 681 |
| 964 | Ga0307406_10022639 | 3300031901 | Bacteria | 3730 |
| 965 | Ga0307406_10040041 | 3300031901 | Bacteria | 2911 |
| 966 | Ga0307406_10047398 | 3300031901 | Bacteria | 2708 |
| 967 | Ga0307406_10198586 | 3300031901 | Bacteria | 1474 |
| 968 | Ga0307406_10271505 | 3300031901 | Bacteria | 1288 |
| 969 | Ga0307406_10409954 | 3300031901 | Bacteria | 1077 |
| 970 | Ga0307406_10431566 | 3300031901 | Bacteria | 1052 |
| 971 | Ga0307406_10900703 | 3300031901 | Bacteria | 753 |
| 972 | Ga0307406_11616058 | 3300031901 | Bacteria | 573 |
| 973 | Ga0307407_10050253 | 3300031903 | Bacteria | 2385 |
| 974 | Ga0307407_10202991 | 3300031903 | Bacteria | 1330 |
| 975 | Ga0307412_10000330 | 3300031911 | Bacteria | 30088 |
| 976 | Ga0307412_10002114 | 3300031911 | Bacteria | 11025 |
| 977 | Ga0307412_10005437 | 3300031911 | Bacteria | 7151 |
| 978 | Ga0307412_10031479 | 3300031911 | Bacteria | 3351 |
| 979 | Ga0307412_10032820 | 3300031911 | Bacteria | 3294 |
| 980 | Ga0307412_10063499 | 3300031911 | Bacteria | 2491 |
| 981 | Ga0307412_10069509 | 3300031911 | Bacteria | 2397 |
| 982 | Ga0307412_10133634 | 3300031911 | Bacteria | 1806 |
| 983 | Ga0307412_10731022 | 3300031911 | Bacteria | 852 |
| 984 | Ga0307409_100075828 | 3300031995 | Bacteria | 2694 |
| 985 | Ga0307409_101074060 | 3300031995 | Bacteria | 825 |
| 986 | Ga0307409_101444973 | 3300031995 | Bacteria | 714 |
| 987 | Ga0307416_100013642 | 3300032002 | Bacteria | 5533 |
| 988 | Ga0307416_100024455 | 3300032002 | Bacteria | 4410 |
| 989 | Ga0307416_100056646 | 3300032002 | Bacteria | 3165 |
| 990 | Ga0307416_100228529 | 3300032002 | Bacteria | 1791 |
| 991 | Ga0307416_100296789 | 3300032002 | Bacteria | 1603 |
| 992 | Ga0307416_101661728 | 3300032002 | Bacteria | 744 |
| 993 | Ga0307416_101971073 | 3300032002 | Bacteria | 687 |
| 994 | Ga0307414_10000117 | 3300032004 | Bacteria | 56697 |
| 995 | Ga0307414_10000371 | 3300032004 | Bacteria | 24637 |
| 996 | Ga0307414_10031754 | 3300032004 | Bacteria | 3468 |
| 997 | Ga0307414_10036610 | 3300032004 | Bacteria | 3278 |
| 998 | Ga0307414_10115431 | 3300032004 | Bacteria | 2053 |
| 999 | Ga0307414_10342652 | 3300032004 | Bacteria | 1280 |
| 1000 | Ga0307414_10344197 | 3300032004 | Bacteria | 1277 |
| 1001 | Ga0307414_10449790 | 3300032004 | Bacteria | 1129 |
| 1002 | Ga0307414_10922789 | 3300032004 | Bacteria | 801 |
| 1003 | Ga0307414_11157305 | 3300032004 | Bacteria | 715 |
| 1004 | Ga0307414_12074244 | 3300032004 | Bacteria | 531 |
| 1005 | Ga0307411_10069400 | 3300032005 | Bacteria | 2380 |
| 1006 | Ga0307411_10182421 | 3300032005 | Bacteria | 1594 |
| 1007 | Ga0307411_10227412 | 3300032005 | Bacteria | 1452 |
| 1008 | Ga0307411_10249025 | 3300032005 | Bacteria | 1396 |
| 1009 | Ga0307411_10877007 | 3300032005 | Bacteria | 796 |
| 1010 | Ga0307415_100135597 | 3300032126 | Bacteria | 1871 |
| 1011 | Ga0307415_100208297 | 3300032126 | Bacteria | 1558 |
| 1012 | Ga0307415_101494312 | 3300032126 | Bacteria | 646 |
| 1013 | Ga0307415_101576380 | 3300032126 | Bacteria | 630 |
| 1014 | Ga0307510_10127422 | 3300033180 | Bacteria | 2230 |
| 1015 | Ga0307510_10608921 | 3300033180 | Bacteria | 545 |
| 1016 | Ga0373954_0204433 | 3300035118 | Bacteria | 970 |
| 1017 | Ga0373931_0061226 | 3300035691 | Bacteria | 2029 |
| 1018 | Ga0373935_0588072 | 3300035692 | Bacteria | 813 |
| 1019 | Ga0373927_0041187 | 3300035695 | Bacteria | 2996 |
| 1020 | Ga0373925_0449014 | 3300037068 | Bacteria | 1056 |
| 1021 | Ga0395899_0116591 | 3300037312 | Bacteria | 1916 |
| 1022 | Ga0395899_0134214 | 3300037312 | Bacteria | 1765 |
| 1023 | Ga0395900_0232480 | 3300037418 | Bacteria | 1853 |
| 1024 | Ga0395900_0265355 | 3300037418 | Bacteria | 1713 |
| 1025 | Ga0395900_0549404 | 3300037418 | Bacteria | 1100 |
| 1026 | Ga0395898_0804277 | 3300037466 | Bacteria | 880 |
| 1027 | Ga0395905_0257057 | 3300037471 | Bacteria | 1631 |
| 1028 | Ga0395905_0501499 | 3300037471 | Bacteria | 1114 |
| 1029 | Ga0395905_0520966 | 3300037471 | Bacteria | 1089 |
| 1030 | Ga0395905_1136521 | 3300037471 | Bacteria | 684 |
| 1031 | Ga0436364_0957806 | 3300037853 | Bacteria | 2079 |
| 1032 | Ga0436364_1065372 | 3300037853 | Bacteria | 196587 |
| 1033 | Ga0436364_1253875 | 3300037853 | Bacteria | 646 |
| 1034 | Ga0395901_0318284 | 3300038443 | Bacteria | 1610 |
| 1035 | Ga0395901_0617526 | 3300038443 | Bacteria | 1091 |
| 1036 | Ga0395901_0863371 | 3300038443 | Bacteria | 889 |
| 1037 | Ga0237819_00478 | 3300038705 | Bacteria | 13587 |
| 1038 | Ga0237816_01697 | 3300039145 | Bacteria | 1758 |
| 1039 | Ga0436365_1056819 | 3300039437 | Bacteria | 544 |
| 1040 | Ga0436365_1234023 | 3300039437 | Bacteria | 954 |
| 1041 | Ga0436365_1437704 | 3300039437 | Bacteria | 4356 |
| 1042 | Ga0436365_1495591 | 3300039437 | Bacteria | 728 |
| 1043 | Ga0436362_0379666 | 3300039453 | Bacteria | 1169 |
| 1044 | Ga0439436_0104422 | 3300041404 | Bacteria | 790 |
| 1045 | Ga0439436_0166421 | 3300041404 | Bacteria | 624 |
| 1046 | Ga0439439_0019879 | 3300041406 | Bacteria | 1668 |
| 1047 | Ga0439461_0003935 | 3300041410 | Bacteria | 2463 |
| 1048 | Ga0439461_0096709 | 3300041410 | Bacteria | 714 |
| 1049 | Ga0439465_0004239 | 3300041413 | Bacteria | 4665 |
| 1050 | Ga0439465_0005674 | 3300041413 | Bacteria | 3972 |
| 1051 | Ga0439465_0042157 | 3300041413 | Bacteria | 1478 |
| 1052 | Ga0451789_0548732 | 3300041443 | Bacteria | 552 |
| 1053 | Ga0451790_23905 | 3300041444 | Bacteria | 890 |
| 1054 | Ga0451791_0198074 | 3300041451 | Bacteria | 555 |
| 1055 | Ga0451791_0638383 | 3300041451 | Bacteria | 513 |
| 1056 | Ga0451791_0752784 | 3300041451 | Bacteria | 600 |
| 1057 | Ga0451791_0863431 | 3300041451 | Bacteria | 652 |
| 1058 | Ga0451797_1153188 | 3300041453 | Bacteria | 1021 |
| 1059 | Ga0451795_0712337 | 3300041456 | Bacteria | 778 |
| 1060 | Ga0451795_1707330 | 3300041456 | Bacteria | 970 |
| 1061 | Ga0451795_1714707 | 3300041456 | Bacteria | 592 |
| 1062 | Ga0451800_0368767 | 3300041459 | Bacteria | 523 |
| 1063 | Ga0451802_0283989 | 3300041460 | Bacteria | 2618 |
| 1064 | Ga0451802_0673154 | 3300041460 | Bacteria | 653 |
| 1065 | Ga0451802_1024104 | 3300041460 | Bacteria | 545 |
| 1066 | Ga0451802_2140950 | 3300041460 | Bacteria | 964 |
| 1067 | Ga0451805_129527 | 3300041461 | Bacteria | 521 |
| 1068 | Ga0451806_203876 | 3300041462 | Bacteria | 788 |
| 1069 | Ga0451806_592453 | 3300041462 | Bacteria | 527 |
| 1070 | Ga0451806_758294 | 3300041462 | Bacteria | 796 |
| 1071 | Ga0451804_0246643 | 3300041463 | Bacteria | 672 |
| 1072 | Ga0451804_0292217 | 3300041463 | Bacteria | 510 |
| 1073 | Ga0451804_0477757 | 3300041463 | Bacteria | 504 |
| 1074 | Ga0451807_0470631 | 3300041486 | Bacteria | 648 |
| 1075 | Ga0451807_1170541 | 3300041486 | Bacteria | 851 |
| 1076 | Ga0451807_1532452 | 3300041486 | Bacteria | 708 |
| 1077 | Ga0451807_2302565 | 3300041486 | Bacteria | 1010 |
| 1078 | Ga0451807_2545728 | 3300041486 | Bacteria | 947 |
| 1079 | Ga0451807_2637162 | 3300041486 | Bacteria | 1229 |
| 1080 | Ga0451833_1456891 | 3300041491 | Bacteria | 520 |
| 1081 | Ga0451837_0903713 | 3300041494 | Bacteria | 504 |
| 1082 | Ga0451837_1313285 | 3300041494 | Bacteria | 648 |
| 1083 | Ga0451841_1289656 | 3300041498 | Bacteria | 510 |
| 1084 | Ga0451845_0647259 | 3300041501 | Bacteria | 1089 |
| 1085 | Ga0451843_0561276 | 3300041509 | Bacteria | 511 |
| 1086 | Ga0451843_0868889 | 3300041509 | Bacteria | 503 |
| 1087 | Ga0451855_0464587 | 3300041511 | Bacteria | 881 |
| 1088 | Ga0451853_1470546 | 3300041512 | Bacteria | 620 |
| 1089 | Ga0451853_1927772 | 3300041512 | Bacteria | 577 |
| 1090 | Ga0451853_1977551 | 3300041512 | Bacteria | 1202 |
| 1091 | Ga0439431_0003098 | 3300041997 | Bacteria | 3653 |
| 1092 | Ga0439431_0139411 | 3300041997 | Bacteria | 684 |
| 1093 | Ga0439445_0001259 | 3300042004 | Bacteria | 5489 |
| 1094 | Ga0439445_0046001 | 3300042004 | Bacteria | 1169 |
| 1095 | Ga0439445_0057073 | 3300042004 | Bacteria | 1063 |
| 1096 | Ga0439445_0064378 | 3300042004 | Bacteria | 1006 |
| 1097 | Ga0439445_0077090 | 3300042004 | Bacteria | 928 |
| 1098 | Ga0439448_0001965 | 3300042005 | Bacteria | 5493 |
| 1099 | Ga0439448_0021597 | 3300042005 | Bacteria | 1995 |
| 1100 | Ga0439448_0034484 | 3300042005 | Bacteria | 1617 |
| 1101 | Ga0439432_006259 | 3300042006 | Bacteria | 4257 |
| 1102 | Ga0439450_143599 | 3300042008 | Bacteria | 623 |
| 1103 | Ga0439452_041030 | 3300042010 | Bacteria | 1090 |
| 1104 | Ga0439455_0003944 | 3300042012 | Bacteria | 2893 |
| 1105 | Ga0439455_0064401 | 3300042012 | Bacteria | 976 |
| 1106 | Ga0439462_0004404 | 3300042015 | Bacteria | 3435 |
| 1107 | Ga0439462_0004785 | 3300042015 | Bacteria | 3319 |
| 1108 | Ga0450894_038137 | 3300042131 | Bacteria | 685 |
| 1109 | Ga0439446_0019699 | 3300042156 | Bacteria | 1898 |
| 1110 | Ga0439458_0001028 | 3300042157 | Bacteria | 7126 |
| 1111 | Ga0439458_0004227 | 3300042157 | Bacteria | 3315 |
| 1112 | Ga0439434_0000103 | 3300042435 | Bacteria | 21899 |
| 1113 | Ga0439434_0075974 | 3300042435 | Bacteria | 1062 |
| 1114 | Ga0439464_0179423 | 3300042439 | Bacteria | 670 |
| 1115 | Ga0450893_0027173 | 3300042532 | Bacteria | 1008 |
| 1116 | Ga0466972_0022049 | 3300044658 | Bacteria | 3171 |
| 1117 | Ga0466966_0224862 | 3300044684 | Bacteria | 1133 |
| 1118 | Ga0466961_0076990 | 3300044693 | Bacteria | 2113 |
| 1119 | Ga0466963_0015793 | 3300044694 | Bacteria | 4685 |
| 1120 | Ga0466964_0641459 | 3300044706 | Bacteria | 586 |
| 1121 | Ga0466971_0041189 | 3300044719 | Bacteria | 2074 |
| 1122 | Ga0466971_0531987 | 3300044719 | Bacteria | 582 |
| 1123 | Ga0466968_0457697 | 3300044735 | Bacteria | 631 |
| 1124 | Ga0466970_0075472 | 3300044765 | Bacteria | 1816 |
| 1125 | Ga0466957_0608401 | 3300044842 | Bacteria | 765 |
| 1126 | Ga0466957_0732249 | 3300044842 | Bacteria | 699 |
| 1127 | Ga0466957_1334854 | 3300044842 | Bacteria | 521 |
| 1128 | Ga0466960_0887854 | 3300044901 | Bacteria | 543 |
| 1129 | Ga0466959_0030393 | 3300045049 | Bacteria | 3999 |
| 1130 | Ga0466958_0020347 | 3300045836 | Bacteria | 3868 |
| 1131 | Ga0466958_0298961 | 3300045836 | Bacteria | 1033 |
| 1132 | Ga0466958_0655830 | 3300045836 | Bacteria | 683 |
| 1133 | Ga0466967_1115467 | 3300045976 | Bacteria | 786 |
| 1134 | Ga0466967_2500056 | 3300045976 | Bacteria | 511 |
| 1135 | Ga0495627_084823 | 3300046453 | Bacteria | 915 |
| 1136 | Ga0495627_099887 | 3300046453 | Bacteria | 829 |
| 1137 | Ga0495590_0364510 | 3300046457 | Bacteria | 551 |
| 1138 | Ga0495629_0842767 | 3300046459 | Bacteria | 603 |
| 1139 | Ga0495638_0004617 | 3300046460 | Bacteria | 10422 |
| 1140 | Ga0495638_0038151 | 3300046460 | Bacteria | 3055 |
| 1141 | Ga0495638_0054219 | 3300046460 | Bacteria | 2493 |
| 1142 | Ga0495638_0502409 | 3300046460 | Bacteria | 610 |
| 1143 | Ga0495638_0560184 | 3300046460 | Bacteria | 567 |
| 1144 | Ga0495650_0001317 | 3300046471 | Bacteria | 25056 |
| 1145 | Ga0495639_0309034 | 3300046475 | Bacteria | 789 |
| 1146 | Ga0495584_0111019 | 3300046491 | Bacteria | 1387 |
| 1147 | Ga0495585_0133334 | 3300046492 | Bacteria | 1305 |
| 1148 | Ga0495585_0277392 | 3300046492 | Bacteria | 829 |
| 1149 | Ga0495585_0341219 | 3300046492 | Bacteria | 729 |
| 1150 | Ga0495585_0588467 | 3300046492 | Bacteria | 524 |
| 1151 | Ga0495596_0175517 | 3300046500 | Bacteria | 833 |
| 1152 | Ga0495607_0408716 | 3300046501 | Bacteria | 616 |
| 1153 | Ga0495583_0000766 | 3300046506 | Bacteria | 40320 |
| 1154 | Ga0495583_0007683 | 3300046506 | Bacteria | 6720 |
| 1155 | Ga0495583_0063474 | 3300046506 | Bacteria | 1641 |
| 1156 | Ga0495583_0078340 | 3300046506 | Bacteria | 1439 |
| 1157 | Ga0495583_0082064 | 3300046506 | Bacteria | 1399 |
| 1158 | Ga0495583_0278645 | 3300046506 | Bacteria | 667 |
| 1159 | Ga0495606_0023498 | 3300046507 | Bacteria | 4464 |
| 1160 | Ga0495606_0042086 | 3300046507 | Bacteria | 3058 |
| 1161 | Ga0495606_0097880 | 3300046507 | Bacteria | 1791 |
| 1162 | Ga0495606_0214158 | 3300046507 | Bacteria | 1089 |
| 1163 | Ga0495606_0545327 | 3300046507 | Bacteria | 578 |
| 1164 | Ga0495610_0371230 | 3300046512 | Bacteria | 534 |
| 1165 | Ga0495616_0129000 | 3300046513 | Bacteria | 1160 |
| 1166 | Ga0495616_0373886 | 3300046513 | Bacteria | 590 |
| 1167 | Ga0495620_0132850 | 3300046515 | Bacteria | 976 |
| 1168 | Ga0495631_0046334 | 3300046518 | Bacteria | 1912 |
| 1169 | Ga0495631_0474017 | 3300046518 | Bacteria | 533 |
| 1170 | Ga0495632_0206744 | 3300046519 | Bacteria | 892 |
| 1171 | Ga0495632_0367474 | 3300046519 | Bacteria | 631 |
| 1172 | Ga0495632_0462517 | 3300046519 | Bacteria | 549 |
| 1173 | Ga0495637_0118426 | 3300046520 | Bacteria | 1021 |
| 1174 | Ga0495637_0123343 | 3300046520 | Bacteria | 995 |
| 1175 | Ga0495643_0008456 | 3300046522 | Bacteria | 6513 |
| 1176 | Ga0495643_0011725 | 3300046522 | Bacteria | 5321 |
| 1177 | Ga0495643_0057255 | 3300046522 | Bacteria | 2078 |
| 1178 | Ga0495643_0449081 | 3300046522 | Bacteria | 561 |
| 1179 | Ga0495643_0460848 | 3300046522 | Bacteria | 552 |
| 1180 | Ga0495648_0000507 | 3300046524 | Bacteria | 41960 |
| 1181 | Ga0495648_0166532 | 3300046524 | Bacteria | 1134 |
| 1182 | Ga0495648_0338835 | 3300046524 | Bacteria | 691 |
| 1183 | Ga0495663_0002619 | 3300046525 | Bacteria | 5363 |
| 1184 | Ga0495663_0123542 | 3300046525 | Bacteria | 868 |
| 1185 | Ga0495642_0431045 | 3300046528 | Bacteria | 582 |
| 1186 | Ga0495652_0326049 | 3300046529 | Bacteria | 1108 |
| 1187 | Ga0495654_0004604 | 3300046530 | Bacteria | 8143 |
| 1188 | Ga0495654_0036570 | 3300046530 | Bacteria | 2467 |
| 1189 | Ga0495654_0131481 | 3300046530 | Bacteria | 1123 |
| 1190 | Ga0495654_0342787 | 3300046530 | Bacteria | 602 |
| 1191 | Ga0495654_0447958 | 3300046530 | Bacteria | 508 |
| 1192 | Ga0495598_0008568 | 3300046537 | Bacteria | 2387 |
| 1193 | Ga0495609_0423917 | 3300046538 | Bacteria | 531 |
| 1194 | Ga0495597_0063768 | 3300046542 | Bacteria | 1601 |
| 1195 | Ga0495597_0193287 | 3300046542 | Bacteria | 818 |
| 1196 | Ga0495597_0425513 | 3300046542 | Bacteria | 503 |
| 1197 | Ga0495622_0048141 | 3300046557 | Bacteria | 1981 |
| 1198 | Ga0495633_0028185 | 3300046558 | Bacteria | 2739 |
| 1199 | Ga0495633_0070471 | 3300046558 | Bacteria | 1631 |
| 1200 | Ga0495668_0000015 | 3300046616 | Bacteria | 441932 |
| 1201 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 1202 | Ga0495668_0019898 | 3300046616 | Bacteria | 3863 |
| 1203 | Ga0495668_0033266 | 3300046616 | Bacteria | 2897 |
| 1204 | Ga0495668_0311375 | 3300046616 | Bacteria | 863 |
| 1205 | Ga0495668_0440036 | 3300046616 | Bacteria | 717 |
| 1206 | Ga0495668_0556016 | 3300046616 | Bacteria | 633 |
| 1207 | Ga0495668_0652397 | 3300046616 | Bacteria | 582 |
| 1208 | Ga0495611_0020624 | 3300046648 | Bacteria | 2838 |
| 1209 | Ga0495611_0158187 | 3300046648 | Bacteria | 1058 |
| 1210 | Ga0495611_0296985 | 3300046648 | Bacteria | 745 |
| 1211 | Ga0495611_0314971 | 3300046648 | Bacteria | 720 |
| 1212 | Ga0495625_0000072 | 3300046660 | Bacteria | 166439 |
| 1213 | Ga0495625_0004430 | 3300046660 | Bacteria | 13282 |
| 1214 | Ga0495625_0007474 | 3300046660 | Bacteria | 9501 |
| 1215 | Ga0495625_0075318 | 3300046660 | Bacteria | 2361 |
| 1216 | Ga0495625_0169691 | 3300046660 | Bacteria | 1457 |
| 1217 | Ga0495625_0265515 | 3300046660 | Bacteria | 1109 |
| 1218 | Ga0495625_0269124 | 3300046660 | Bacteria | 1100 |
| 1219 | Ga0495625_0402133 | 3300046660 | Bacteria | 855 |
| 1220 | Ga0495625_0555976 | 3300046660 | Bacteria | 694 |
| 1221 | Ga0495625_0591105 | 3300046660 | Bacteria | 667 |
| 1222 | Ga0495625_0665985 | 3300046660 | Bacteria | 618 |
| 1223 | Ga0495661_0011622 | 3300046665 | Bacteria | 5969 |
| 1224 | Ga0495661_0116274 | 3300046665 | Bacteria | 1484 |
| 1225 | Ga0495661_0572121 | 3300046665 | Bacteria | 533 |
| 1226 | Ga0495669_0000529 | 3300046684 | Bacteria | 17238 |
| 1227 | Ga0495613_0831096 | 3300046689 | Bacteria | 601 |
| 1228 | Ga0495670_0000015 | 3300046691 | Bacteria | 131137 |
| 1229 | Ga0495670_0008829 | 3300046691 | Bacteria | 4959 |
| 1230 | Ga0495670_0015640 | 3300046691 | Bacteria | 3729 |
| 1231 | Ga0495670_0467011 | 3300046691 | Bacteria | 684 |
| 1232 | Ga0495671_0063051 | 3300046692 | Bacteria | 1826 |
| 1233 | Ga0495649_0148846 | 3300046694 | Bacteria | 1230 |
| 1234 | Ga0495649_0249991 | 3300046694 | Bacteria | 911 |
| 1235 | Ga0495649_0425440 | 3300046694 | Bacteria | 665 |
| 1236 | Ga0495589_0133912 | 3300046794 | Bacteria | 1189 |
| 1237 | Ga0495600_0009109 | 3300046809 | Bacteria | 6121 |
| 1238 | Ga0495660_0430779 | 3300046810 | Bacteria | 573 |
| 1239 | Ga0495683_0116301 | 3300047323 | Bacteria | 1272 |
| 1240 | Ga0495683_0122323 | 3300047323 | Bacteria | 1234 |
| 1241 | Ga0495687_000649 | 3300047443 | Bacteria | 39837 |
| 1242 | Ga0495687_004871 | 3300047443 | Bacteria | 8814 |
| 1243 | Ga0495687_062746 | 3300047443 | Bacteria | 1524 |
| 1244 | Ga0495677_0021122 | 3300047445 | Bacteria | 2360 |
| 1245 | Ga0495677_0036383 | 3300047445 | Bacteria | 1798 |
| 1246 | Ga0495673_0019216 | 3300047469 | Bacteria | 3427 |
| 1247 | Ga0495681_0011958 | 3300047470 | Bacteria | 5128 |
| 1248 | Ga0495681_0041622 | 3300047470 | Bacteria | 2229 |
| 1249 | Ga0495681_0309730 | 3300047470 | Bacteria | 609 |
| 1250 | Ga0495686_0000530 | 3300047472 | Bacteria | 54741 |
| 1251 | Ga0495686_0000723 | 3300047472 | Bacteria | 44178 |
| 1252 | Ga0495686_0001008 | 3300047472 | Bacteria | 34224 |
| 1253 | Ga0495686_0024914 | 3300047472 | Bacteria | 3925 |
| 1254 | Ga0495686_0070575 | 3300047472 | Bacteria | 2152 |
| 1255 | Ga0495686_0182374 | 3300047472 | Bacteria | 1215 |
| 1256 | Ga0495686_0279442 | 3300047472 | Bacteria | 928 |
| 1257 | Ga0495686_0659667 | 3300047472 | Bacteria | 537 |
| 1258 | Ga0496100_0561651 | 3300048903 | Bacteria | 884 |
| 1259 | Ga0496101_0915559 | 3300048904 | Bacteria | 690 |
| 1260 | Ga0496102_0003035 | 3300048905 | Bacteria | 14220 |
| 1261 | Ga0496102_0003155 | 3300048905 | Bacteria | 13978 |
| 1262 | Ga0496102_0757323 | 3300048905 | Bacteria | 894 |
| 1263 | Ga0496102_1378167 | 3300048905 | Bacteria | 624 |
| 1264 | Ga0496102_1627729 | 3300048905 | Bacteria | 564 |
| 1265 | Ga0496103_0000903 | 3300048906 | Bacteria | 21301 |
| 1266 | Ga0496103_0001742 | 3300048906 | Bacteria | 14206 |
| 1267 | Ga0496104_0082332 | 3300048907 | Bacteria | 3069 |
| 1268 | Ga0496105_0005151 | 3300048908 | Bacteria | 9912 |
| 1269 | Ga0496105_0197990 | 3300048908 | Bacteria | 1640 |
| 1270 | Ga0496106_0182822 | 3300048909 | Bacteria | 1665 |
| 1271 | Ga0496107_0194779 | 3300048910 | Bacteria | 1506 |
| 1272 | Ga0496107_0580837 | 3300048910 | Bacteria | 829 |
| 1273 | Ga0496108_0519986 | 3300048911 | Bacteria | 1039 |
| 1274 | Ga0496108_1257974 | 3300048911 | Bacteria | 624 |
| 1275 | Ga0496109_0296717 | 3300048912 | Bacteria | 1524 |
| 1276 | Ga0496109_0882846 | 3300048912 | Bacteria | 832 |
| 1277 | Ga0496110_0774142 | 3300048913 | Bacteria | 863 |
| 1278 | Ga0496111_0009790 | 3300048914 | Bacteria | 6408 |
| 1279 | Ga0496111_0129586 | 3300048914 | Bacteria | 1866 |
| 1280 | Ga0496111_1045338 | 3300048914 | Bacteria | 584 |
| 1281 | Ga0496112_1451392 | 3300048915 | Bacteria | 600 |
| 1282 | Ga0496113_0811620 | 3300048916 | Bacteria | 743 |
| 1283 | Ga0496113_1336816 | 3300048916 | Bacteria | 556 |
| 1284 | Ga0496114_0007549 | 3300048917 | Bacteria | 8603 |
| 1285 | Ga0496115_0002111 | 3300048918 | Bacteria | 14223 |
| 1286 | Ga0496115_0002506 | 3300048918 | Bacteria | 13194 |
| 1287 | Ga0496116_0024085 | 3300048919 | Bacteria | 4511 |
| 1288 | Ga0496116_0091775 | 3300048919 | Bacteria | 1844 |
| 1289 | Ga0496116_0483207 | 3300048919 | Bacteria | 520 |
| 1290 | Ga0496117_0000324 | 3300048920 | Bacteria | 83876 |
| 1291 | Ga0496117_0005438 | 3300048920 | Bacteria | 13377 |
| 1292 | Ga0496117_0034695 | 3300048920 | Bacteria | 3798 |
| 1293 | Ga0496117_0062804 | 3300048920 | Bacteria | 2543 |
| 1294 | Ga0496117_0117705 | 3300048920 | Bacteria | 1639 |
| 1295 | Ga0496118_0002151 | 3300048921 | Bacteria | 27486 |
| 1296 | Ga0496118_0004152 | 3300048921 | Bacteria | 17499 |
| 1297 | Ga0496118_0017136 | 3300048921 | Bacteria | 6610 |
| 1298 | Ga0496118_0019807 | 3300048921 | Bacteria | 6000 |
| 1299 | Ga0496118_0117741 | 3300048921 | Bacteria | 1741 |
| 1300 | Ga0496119_0006610 | 3300048922 | Bacteria | 10677 |
| 1301 | Ga0496119_0047821 | 3300048922 | Bacteria | 2658 |
| 1302 | Ga0496119_0329689 | 3300048922 | Bacteria | 745 |
| 1303 | Ga0496120_0093468 | 3300048923 | Bacteria | 1602 |
| 1304 | Ga0496120_0275078 | 3300048923 | Bacteria | 780 |
| 1305 | Ga0496120_0439828 | 3300048923 | Bacteria | 569 |
| 1306 | Ga0496121_0001314 | 3300048924 | Bacteria | 42592 |
| 1307 | Ga0496121_0002794 | 3300048924 | Bacteria | 25864 |
| 1308 | Ga0496121_0038248 | 3300048924 | Bacteria | 4253 |
| 1309 | Ga0496121_0040520 | 3300048924 | Bacteria | 4084 |
| 1310 | Ga0496121_0050670 | 3300048924 | Bacteria | 3504 |
| 1311 | Ga0496121_0052395 | 3300048924 | Bacteria | 3428 |
| 1312 | Ga0496121_0276551 | 3300048924 | Bacteria | 1151 |
| 1313 | Ga0496122_0001531 | 3300048925 | Bacteria | 36790 |
| 1314 | Ga0496122_0055074 | 3300048925 | Bacteria | 2979 |
| 1315 | Ga0496122_0112139 | 3300048925 | Bacteria | 1786 |
| 1316 | Ga0496122_0256430 | 3300048925 | Bacteria | 974 |
| 1317 | Ga0496122_0360994 | 3300048925 | Bacteria | 754 |
| 1318 | Ga0496123_0001418 | 3300048926 | Bacteria | 33502 |
| 1319 | Ga0496123_0016952 | 3300048926 | Bacteria | 5884 |
| 1320 | Ga0496123_0022246 | 3300048926 | Bacteria | 4893 |
| 1321 | Ga0496123_0070087 | 3300048926 | Bacteria | 2196 |
| 1322 | Ga0496123_0176423 | 3300048926 | Bacteria | 1121 |
| 1323 | Ga0496123_0294026 | 3300048926 | Bacteria | 778 |
| 1324 | Ga0496123_0431617 | 3300048926 | Bacteria | 591 |
| 1325 | Ga0496124_0000351 | 3300048927 | Bacteria | 84021 |
| 1326 | Ga0496124_0005829 | 3300048927 | Bacteria | 13673 |
| 1327 | Ga0496124_0014083 | 3300048927 | Bacteria | 7755 |
| 1328 | Ga0496124_0040538 | 3300048927 | Bacteria | 4026 |
| 1329 | Ga0496124_0052819 | 3300048927 | Bacteria | 3451 |
| 1330 | Ga0496124_0085511 | 3300048927 | Bacteria | 2584 |
| 1331 | Ga0496124_0744331 | 3300048927 | Bacteria | 615 |
| 1332 | Ga0496125_0003470 | 3300048928 | Bacteria | 19085 |
| 1333 | Ga0496125_0198394 | 3300048928 | Bacteria | 1317 |
| 1334 | Ga0496125_0729088 | 3300048928 | Bacteria | 522 |
| 1335 | Ga0496126_0002155 | 3300048929 | Bacteria | 27384 |
| 1336 | Ga0496126_0127852 | 3300048929 | Bacteria | 2198 |
| 1337 | Ga0496126_0304599 | 3300048929 | Bacteria | 1313 |
| 1338 | Ga0496126_0542348 | 3300048929 | Bacteria | 924 |
| 1339 | Ga0496126_0609894 | 3300048929 | Bacteria | 859 |
| 1340 | Ga0496126_0855323 | 3300048929 | Bacteria | 693 |
| 1341 | Ga0496126_0886973 | 3300048929 | Bacteria | 677 |
| 1342 | Ga0496126_1093170 | 3300048929 | Bacteria | 593 |
| 1343 | Ga0496126_1276051 | 3300048929 | Bacteria | 536 |
| 1344 | Ga0501306_063096 | 3300049127 | Bacteria | 613 |
| 1345 | Ga0501308_086036 | 3300049128 | Bacteria | 506 |
| 1346 | Ga0495678_068202 | 3300049459 | Bacteria | 1312 |
| 1347 | Ga0495678_088048 | 3300049459 | Bacteria | 1100 |
| 1348 | Ga0495682_0008950 | 3300049460 | Bacteria | 3927 |
| 1349 | Ga0501290_000352 | 3300049513 | Bacteria | 7476 |
| 1350 | Ga0501290_006382 | 3300049513 | Bacteria | 1477 |
| 1351 | Ga0501292_000088 | 3300049515 | Bacteria | 16990 |
| 1352 | Ga0501294_000241 | 3300049517 | Bacteria | 6800 |
| 1353 | Ga0501299_092320 | 3300049522 | Bacteria | 690 |
| 1354 | Ga0501300_003094 | 3300049523 | Bacteria | 2482 |
| 1355 | Ga0501300_006532 | 3300049523 | Bacteria | 1714 |
| 1356 | Ga0501314_000002 | 3300049530 | Bacteria | 13192 |
| 1357 | Ga0501314_013552 | 3300049530 | Bacteria | 791 |
| 1358 | Ga0501315_002307 | 3300049531 | Bacteria | 1774 |
| 1359 | Ga0501315_012821 | 3300049531 | Bacteria | 1042 |
| 1360 | Ga0501315_051550 | 3300049531 | Bacteria | 647 |
| 1361 | Ga0501317_001577 | 3300049533 | Bacteria | 1992 |
| 1362 | Ga0501317_018595 | 3300049533 | Bacteria | 920 |
| 1363 | Ga0501318_029866 | 3300049534 | Bacteria | 737 |
| 1364 | Ga0501321_068786 | 3300049537 | Bacteria | 547 |
| 1365 | Ga0501323_001589 | 3300049539 | Bacteria | 2057 |
| 1366 | Ga0501324_027655 | 3300049540 | Bacteria | 607 |
| 1367 | Ga0501333_008957 | 3300049549 | Bacteria | 697 |
| 1368 | Ga0501334_14279 | 3300049550 | Bacteria | 601 |
| 1369 | Ga0501335_038136 | 3300049551 | Bacteria | 560 |
| 1370 | Ga0501335_047919 | 3300049551 | Bacteria | 516 |
| 1371 | Ga0501338_09186 | 3300049554 | Bacteria | 655 |
| 1372 | Ga0501338_12382 | 3300049554 | Bacteria | 589 |
| 1373 | Ga0501031_0035501 | 3300049568 | Bacteria | 3252 |
| 1374 | Ga0501032_0011615 | 3300049569 | Bacteria | 6316 |
| 1375 | Ga0501032_0901662 | 3300049569 | Bacteria | 557 |
| 1376 | Ga0501033_0133191 | 3300049570 | Bacteria | 1799 |
| 1377 | Ga0501033_0649458 | 3300049570 | Bacteria | 721 |
| 1378 | Ga0501034_0007538 | 3300049571 | Bacteria | 11575 |
| 1379 | Ga0501034_0027253 | 3300049571 | Bacteria | 5813 |
| 1380 | Ga0501034_0082782 | 3300049571 | Bacteria | 3211 |
| 1381 | Ga0501034_0647934 | 3300049571 | Bacteria | 958 |
| 1382 | Ga0501034_0982730 | 3300049571 | Bacteria | 729 |
| 1383 | Ga0501036_0050187 | 3300049572 | Bacteria | 3533 |
| 1384 | Ga0501036_1539549 | 3300049572 | Bacteria | 538 |
| 1385 | Ga0501037_0046965 | 3300049573 | Bacteria | 3165 |
| 1386 | Ga0501038_0052443 | 3300049574 | Bacteria | 3516 |
| 1387 | Ga0501039_0005639 | 3300049575 | Bacteria | 9478 |
| 1388 | Ga0501043_0075885 | 3300049579 | Bacteria | 2640 |
| 1389 | Ga0501043_0885135 | 3300049579 | Bacteria | 641 |
| 1390 | Ga0501046_0389609 | 3300049580 | Bacteria | 1007 |
| 1391 | Ga0501047_0032215 | 3300049581 | Bacteria | 5059 |
| 1392 | Ga0501047_0144807 | 3300049581 | Bacteria | 2253 |
| 1393 | Ga0501047_0427174 | 3300049581 | Bacteria | 1156 |
| 1394 | Ga0501047_0850754 | 3300049581 | Bacteria | 726 |
| 1395 | Ga0501048_0109379 | 3300049582 | Bacteria | 1951 |
| 1396 | Ga0501069_0035055 | 3300049585 | Bacteria | 2763 |
| 1397 | Ga0501070_0027529 | 3300049586 | Bacteria | 4768 |
| 1398 | Ga0501071_1605970 | 3300049587 | Bacteria | 502 |
| 1399 | Ga0501206_000112 | 3300049653 | Bacteria | 8412 |
| 1400 | Ga0501222_000376 | 3300049662 | Bacteria | 6857 |
| 1401 | Ga0501223_002540 | 3300049663 | Bacteria | 4039 |
| 1402 | Ga0501223_019504 | 3300049663 | Bacteria | 1332 |
| 1403 | Ga0501223_036026 | 3300049663 | Bacteria | 962 |
| 1404 | Ga0501224_000009 | 3300049664 | Bacteria | 107191 |
| 1405 | Ga0501224_000219 | 3300049664 | Bacteria | 6508 |
| 1406 | Ga0501227_008045 | 3300049665 | Bacteria | 2263 |
| 1407 | Ga0501233_000279 | 3300049668 | Bacteria | 7827 |
| 1408 | Ga0501235_000736 | 3300049669 | Bacteria | 6680 |
| 1409 | Ga0501235_002385 | 3300049669 | Bacteria | 4050 |
| 1410 | Ga0501257_000052 | 3300049686 | Bacteria | 32874 |
| 1411 | Ga0501261_000417 | 3300049690 | Bacteria | 5575 |
| 1412 | Ga0501225_0000094 | 3300049705 | Bacteria | 28402 |
| 1413 | Ga0501241_025197 | 3300049758 | Bacteria | 1107 |
| 1414 | Ga0501276_009720 | 3300049773 | Bacteria | 800 |
| 1415 | Ga0501279_000074 | 3300049775 | Bacteria | 16852 |
| 1416 | Ga0501280_000191 | 3300049776 | Bacteria | 15378 |
| 1417 | Ga0501280_012759 | 3300049776 | Bacteria | 1183 |
| 1418 | Ga0501281_00081 | 3300049777 | Bacteria | 11133 |
| 1419 | Ga0501282_000381 | 3300049778 | Bacteria | 5364 |
| 1420 | Ga0501282_001529 | 3300049778 | Bacteria | 2555 |
| 1421 | Ga0501035_0013966 | 3300049822 | Bacteria | 7408 |
| 1422 | Ga0501035_0492686 | 3300049822 | Bacteria | 1009 |
| 1423 | Ga0501035_0886643 | 3300049822 | Bacteria | 707 |
| 1424 | Ga0501035_1498850 | 3300049822 | Bacteria | 514 |
| 1425 | Ga0501044_0055624 | 3300049823 | Bacteria | 4064 |
| 1426 | Ga0501044_0102207 | 3300049823 | Bacteria | 2882 |
| 1427 | Ga0501044_0324206 | 3300049823 | Bacteria | 1464 |
| 1428 | Ga0501044_0633561 | 3300049823 | Bacteria | 959 |
| 1429 | Ga0501045_0671437 | 3300049824 | Bacteria | 765 |
| 1430 | Ga0501226_000076 | 3300049853 | Bacteria | 29950 |
| 1431 | nmdc:mga03683_313206_c1 | 3300050489 | Bacteria | 738 |
| 1432 | nmdc:mga00v17_3387_c2 | 3300050491 | Bacteria | 5533 |
| 1433 | nmdc:mga00v17_538492_c1 | 3300050491 | Bacteria | 755 |
| 1434 | nmdc:mga00v17_784798_c1 | 3300050491 | Bacteria | 607 |
| 1435 | nmdc:mga0yw44_1193152_c1 | 3300050492 | Bacteria | 513 |
| 1436 | nmdc:mga0k408_30694_c1 | 3300050493 | Bacteria | 3065 |
| 1437 | nmdc:mga0k408_398724_c1 | 3300050493 | Bacteria | 819 |
| 1438 | nmdc:mga0k408_501721_c1 | 3300050493 | Bacteria | 719 |
| 1439 | nmdc:mga0k408_748769_c1 | 3300050493 | Bacteria | 571 |
| 1440 | nmdc:mga07m45_16117_c1 | 3300050496 | Bacteria | 3999 |
| 1441 | nmdc:mga07m45_186221_c1 | 3300050496 | Bacteria | 1207 |
| 1442 | nmdc:mga07m45_84920_c1 | 3300050496 | Bacteria | 1810 |
| 1443 | nmdc:mga05p37_847024_c1 | 3300050507 | Bacteria | 993 |
| 1444 | nmdc:mga0qj67_1518855_c1 | 3300050509 | Bacteria | 515 |
| 1445 | nmdc:mga0n895_418106_c1 | 3300050512 | Bacteria | 1355 |
| 1446 | nmdc:mga0n895_823850_c1 | 3300050512 | Bacteria | 917 |
| 1447 | nmdc:mga0sz30_105445_c1 | 3300050516 | Bacteria | 1233 |
| 1448 | nmdc:mga0sz30_99383_c1 | 3300050516 | Bacteria | 1270 |
| 1449 | Ga0500610_0000216 | 3300053079 | Bacteria | 17601 |
| 1450 | Ga0500643_000134 | 3300053087 | Bacteria | 75321 |
| 1451 | Ga0500643_003488 | 3300053087 | Bacteria | 7555 |
| 1452 | Ga0500643_005556 | 3300053087 | Bacteria | 5412 |
| 1453 | Ga0500643_026980 | 3300053087 | Bacteria | 1791 |
| 1454 | Ga0500643_088711 | 3300053087 | Bacteria | 844 |
| 1455 | Ga0500643_088712 | 3300053087 | Bacteria | 844 |
| 1456 | Ga0500643_137458 | 3300053087 | Bacteria | 657 |
| 1457 | Ga0500644_0260304 | 3300053088 | Bacteria | 734 |
| 1458 | Ga0500646_0091936 | 3300053090 | Bacteria | 940 |
| 1459 | Ga0500647_0213226 | 3300053091 | Bacteria | 869 |
| 1460 | Ga0500651_0120217 | 3300053093 | Bacteria | 1595 |
| 1461 | Ga0500651_0352155 | 3300053093 | Bacteria | 835 |
| 1462 | Ga0500566_0039514 | 3300053094 | Bacteria | 2728 |
| 1463 | Ga0500555_001780 | 3300053103 | Bacteria | 6438 |
| 1464 | Ga0500556_0246324 | 3300053104 | Bacteria | 704 |
| 1465 | Ga0500556_0315331 | 3300053104 | Bacteria | 610 |
| 1466 | Ga0500592_001405 | 3300053116 | Bacteria | 3894 |
| 1467 | Ga0500592_001411 | 3300053116 | Bacteria | 3886 |
| 1468 | Ga0500592_010909 | 3300053116 | Bacteria | 1450 |
| 1469 | Ga0500592_054166 | 3300053116 | Bacteria | 653 |
| 1470 | Ga0500595_017021 | 3300053119 | Bacteria | 2695 |
| 1471 | Ga0500618_017029 | 3300053125 | Bacteria | 1812 |
| 1472 | Ga0500655_000265 | 3300053133 | Bacteria | 12247 |
| 1473 | Ga0500658_0004652 | 3300053134 | Bacteria | 5122 |
| 1474 | Ga0500658_0036311 | 3300053134 | Bacteria | 1954 |
| 1475 | Ga0500658_0070509 | 3300053134 | Bacteria | 1473 |
| 1476 | Ga0500658_0503432 | 3300053134 | Bacteria | 548 |
| 1477 | Ga0500559_0343820 | 3300053136 | Bacteria | 698 |
| 1478 | Ga0500568_0013737 | 3300053139 | Bacteria | 3681 |
| 1479 | Ga0500568_0022667 | 3300053139 | Bacteria | 2682 |
| 1480 | Ga0500568_0033063 | 3300053139 | Bacteria | 2124 |
| 1481 | Ga0500573_0000559 | 3300053140 | Bacteria | 16226 |
| 1482 | Ga0500573_0327745 | 3300053140 | Bacteria | 753 |
| 1483 | Ga0500573_0409230 | 3300053140 | Bacteria | 640 |
| 1484 | Ga0500573_0456536 | 3300053140 | Bacteria | 589 |
| 1485 | Ga0500577_0504599 | 3300053142 | Bacteria | 528 |
| 1486 | Ga0500590_004805 | 3300053148 | Bacteria | 6438 |
| 1487 | Ga0500604_0000014 | 3300053151 | Bacteria | 92128 |
| 1488 | Ga0500604_0017943 | 3300053151 | Bacteria | 1966 |
| 1489 | Ga0500604_0299102 | 3300053151 | Bacteria | 558 |
| 1490 | Ga0500604_0315302 | 3300053151 | Bacteria | 543 |
| 1491 | Ga0500616_0000591 | 3300053153 | Bacteria | 44073 |
| 1492 | Ga0500616_0030468 | 3300053153 | Bacteria | 2963 |
| 1493 | Ga0500616_0083831 | 3300053153 | Bacteria | 1596 |
| 1494 | Ga0500619_136027 | 3300053154 | Bacteria | 837 |
| 1495 | Ga0500627_0000009 | 3300053158 | Bacteria | 153203 |
| 1496 | Ga0500627_0000899 | 3300053158 | Bacteria | 7974 |
| 1497 | Ga0500627_0027229 | 3300053158 | Bacteria | 2364 |
| 1498 | Ga0500627_0042078 | 3300053158 | Bacteria | 1965 |
| 1499 | Ga0500627_0378000 | 3300053158 | Bacteria | 607 |
| 1500 | Ga0500636_0047080 | 3300053177 | Bacteria | 2541 |
| 1501 | Ga0500636_0539332 | 3300053177 | Bacteria | 507 |
| 1502 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 1503 | Ga0500645_162740 | 3300053730 | Bacteria | 611 |
| 1504 | Ga0587084_022267 | 3300059477 | Bacteria | 957 |
| 1505 | Ga0587084_041804 | 3300059477 | Bacteria | 782 |
| 1506 | Ga0587070_116903 | 3300059491 | Bacteria | 633 |
| 1507 | Ga0587077_060294 | 3300059493 | Bacteria | 820 |
| 1508 | Ga0587077_085234 | 3300059493 | Bacteria | 733 |
| 1509 | Ga0587077_106908 | 3300059493 | Bacteria | 680 |
| 1510 | Ga0587077_188520 | 3300059493 | Bacteria | 563 |
| 1511 | Ga0587090_135625 | 3300059510 | Bacteria | 546 |
| 1512 | Ga0587098_014146 | 3300059604 | Bacteria | 937 |
| 1513 | Ga0587106_030729 | 3300059605 | Bacteria | 861 |
| 1514 | Ga0587101_102335 | 3300059623 | Bacteria | 571 |
| 1515 | Ga0587062_043481 | 3300059639 | Bacteria | 737 |
| 1516 | Ga0587069_047511 | 3300059642 | Bacteria | 753 |
| 1517 | Ga0587072_051597 | 3300059643 | Bacteria | 825 |
| 1518 | Ga0587076_052651 | 3300059645 | Bacteria | 798 |
| 1519 | Ga0587078_042375 | 3300059646 | Bacteria | 646 |
| 1520 | Ga0587102_016703 | 3300059649 | Bacteria | 792 |
| 1521 | Ga0587107_030945 | 3300059652 | Bacteria | 814 |
| 1522 | Ga0587108_025880 | 3300059653 | Bacteria | 580 |
| 1523 | Ga0587071_088394 | 3300060344 | Bacteria | 700 |
| 1524 | Ga0587111_0148151 | 3300060346 | Bacteria | 628 |
| 1525 | Ga0587111_0211339 | 3300060346 | Bacteria | 555 |
| 1526 | Ga0587111_0275893 | 3300060346 | Bacteria | 506 |
| 1527 | Ga0501082_1880845 | 3300060353 | Bacteria | 522 |
| 1528 | Ga0466962_0357974 | 3300061719 | Bacteria | 727 |
| 1529 | Ga0070680_101562058 | |||
| 1530 | ARcpr5oldR_c003367 | |||
| 1531 | ARcpr5yngRDRAFT_c000513 | |||
| 1532 | JGI24736J21556_1000064 | |||
| 1533 | JGI24736J21556_1009108 | |||
| 1534 | JGI24736J21556_1017419 | |||
| 1535 | JGI24741J21665_1001255 | |||
| 1536 | JGI24741J21665_1011514 | |||
| 1537 | JGI24752J21851_1000348 | |||
| 1538 | JGI24752J21851_1000507 | |||
| 1539 | JGI24740J21852_10001392 | |||
| 1540 | JGI24740J21852_10002955 | |||
| 1541 | JGI24740J21852_10036607 | |||
| 1542 | JGI24740J21852_10038021 | |||
| 1543 | JGI24740J21852_10120951 | |||
| 1544 | JGI24739J22299_10003209 | |||
| 1545 | JGI24739J22299_10004443 | |||
| 1546 | JGI24739J22299_10009935 | |||
| 1547 | JGI24739J22299_10021051 | |||
| 1548 | JGI24739J22299_10029358 | |||
| 1549 | JGI24739J22299_10051500 | |||
| 1550 | JGI24739J22299_10134404 | |||
| 1551 | JGI24739J22299_10157074 | |||
| 1552 | JGI24737J22298_10001590 | |||
| 1553 | JGI24737J22298_10003732 | |||
| 1554 | JGI24737J22298_10027060 | |||
| 1555 | JGI24737J22298_10036959 | |||
| 1556 | JGI24737J22298_10041158 | |||
| 1557 | JGI24737J22298_10061695 | |||
| 1558 | JGI24737J22298_10068351 | |||
| 1559 | JGI24737J22298_10069519 | |||
| 1560 | JGI24737J22298_10085395 | |||
| 1561 | JGI24737J22298_10117018 | |||
| 1562 | JGI24743J22301_10122747 | |||
| 1563 | JGI24735J21928_10001961 | |||
| 1564 | JGI24735J21928_10013354 | |||
| 1565 | JGI24735J21928_10020484 | |||
| 1566 | JGI24735J21928_10037139 | |||
| 1567 | JGI24735J21928_10050720 | |||
| 1568 | JGI24735J21928_10087919 | |||
| 1569 | JGI24735J21928_10122964 | |||
| 1570 | JGI24735J21928_10164286 | |||
| 1571 | JGI24735J21928_10251458 | |||
| 1572 | JGI24750J21931_1000199 | |||
| 1573 | JGI24748J21848_1000070 | |||
| 1574 | JGI24748J21848_1012787 | |||
| 1575 | JGI24738J21930_10001288 | |||
| 1576 | JGI24738J21930_10004666 | |||
| 1577 | JGI24738J21930_10132714 | |||
| 1578 | JGI24749J21850_1000118 | |||
| 1579 | JGI24744J21845_10005787 | |||
| 1580 | JGI24033J26618_1073154 | |||
| 1581 | JGI24034J26672_10000038 | |||
| 1582 | JGI24034J26672_10012171 | |||
| 1583 | JGI24742J22300_10128925 | |||
| 1584 | JGI24751J29686_10000379 | |||
| 1585 | JGI25157J39369_1026112 | |||
| 1586 | JGI25152J39213_1045210 | |||
| 1587 | JGI25150J39212_1000365 | |||
| 1588 | JGI25150J39212_1000837 | |||
| 1589 | JGI25151J46595_10029327 | |||
| 1590 | JGI25165J46597_1000021 | |||
| 1591 | JGI25165J46597_1000023 | |||
| 1592 | JGI25153J46596_10000173 | |||
| 1593 | JGI25153J46596_10001359 | |||
| 1594 | JGI25153J46596_10087839 | |||
| 1595 | Ga0055525_1000012 | |||
| 1596 | Ga0055542_1000025 | |||
| 1597 | Ga0055542_1013672 | |||
| 1598 | Ga0055529_1000014 | |||
| 1599 | Ga0055529_1012053 | |||
| 1600 | Ga0055526_1001689 | |||
| 1601 | Ga0055537_1002389 | |||
| 1602 | Ga0055537_1013876 | |||
| 1603 | Ga0055524_1000320 | |||
| 1604 | Ga0055524_1000341 | |||
| 1605 | Ga0055536_1004136 | |||
| 1606 | Ga0055536_1024452 | |||
| 1607 | Ga0055536_1046965 | |||
| 1608 | Ga0055534_1019454 | |||
| 1609 | Ga0055528_1076706 | |||
| 1610 | Ga0055528_1078700 | |||
| 1611 | Ga0055530_10001710 | |||
| 1612 | Ga0055530_10013813 | |||
| 1613 | Ga0055530_10014457 | |||
| 1614 | Ga0055530_10019749 | |||
| 1615 | Ga0055530_10026068 | |||
| 1616 | Ga0055540_1000723 | |||
| 1617 | Ga0055531_10002727 | |||
| 1618 | Ga0055531_10012970 | |||
| 1619 | Ga0055531_10025423 | |||
| 1620 | Ga0055531_10025502 | |||
| 1621 | Ga0055531_10032983 | |||
| 1622 | Ga0055531_10034125 | |||
| 1623 | Ga0055531_10041336 | |||
| 1624 | JGI25405J52794_10009841 | |||
| 1625 | Ga0055543_1014693 | |||
| 1626 | Ga0065165_1015699 | |||
| 1627 | Ga0065165_1069905 | |||
| 1628 | Ga0065165_1094332 | |||
| 1629 | Ga0065165_1167928 | |||
| 1630 | Ga0065714_10315197 | |||
| 1631 | Ga0065704_10278800 | |||
| 1632 | Ga0065704_10314217 | |||
| 1633 | Ga0065715_10782746 | |||
| 1634 | Ga0065707_10000576 | |||
| 1635 | Ga0065707_10091874 | |||
| 1636 | Ga0065707_10211558 | |||
| 1637 | Ga0065707_10274776 | |||
| 1638 | Ga0065707_10452404 | |||
| 1639 | Ga0070658_10001786 | |||
| 1640 | Ga0070658_10010598 | |||
| 1641 | Ga0070658_10293600 | |||
| 1642 | Ga0070658_10340516 | |||
| 1643 | Ga0070658_10441688 | |||
| 1644 | Ga0070658_10517219 | |||
| 1645 | Ga0070658_10661252 | |||
| 1646 | Ga0070658_10829423 | |||
| 1647 | Ga0070658_10947640 | |||
| 1648 | Ga0070676_10209264 | |||
| 1649 | Ga0070676_10323450 | |||
| 1650 | Ga0070683_100204503 | |||
| 1651 | Ga0070683_100277426 | |||
| 1652 | Ga0070683_101594646 | |||
| 1653 | Ga0070683_102166812 | |||
| 1654 | Ga0070690_100000097 | |||
| 1655 | Ga0070670_100000075 | |||
| 1656 | Ga0070670_100000093 | |||
| 1657 | Ga0070670_100010675 | |||
| 1658 | Ga0070670_100093304 | |||
| 1659 | Ga0070670_100687098 | |||
| 1660 | Ga0070677_10069925 | |||
| 1661 | Ga0070677_10083489 | |||
| 1662 | Ga0068869_100000029 | |||
| 1663 | Ga0068869_100056174 | |||
| 1664 | Ga0068869_100556697 | |||
| 1665 | Ga0068869_100619997 | |||
| 1666 | Ga0068869_102032265 | |||
| 1667 | Ga0070666_10000004 | |||
| 1668 | Ga0070666_10150584 | |||
| 1669 | Ga0070666_10514357 | |||
| 1670 | Ga0070666_10788306 | |||
| 1671 | Ga0070666_11000859 | |||
| 1672 | Ga0070680_100021258 | |||
| 1673 | Ga0070680_100933788 | |||
| 1674 | Ga0070682_100076023 | |||
| 1675 | Ga0070682_100710784 | |||
| 1676 | Ga0068868_100003973 | |||
| 1677 | Ga0068868_100501188 | |||
| 1678 | Ga0068868_100841095 | |||
| 1679 | Ga0068868_101749607 | |||
| 1680 | Ga0070660_100016618 | |||
| 1681 | Ga0070660_100061300 | |||
| 1682 | Ga0070660_100125410 | |||
| 1683 | Ga0070660_100173748 | |||
| 1684 | Ga0070660_100240844 | |||
| 1685 | Ga0070660_100286815 | |||
| 1686 | Ga0070660_100559437 | |||
| 1687 | Ga0070660_100594981 | |||
| 1688 | Ga0070689_100050883 | |||
| 1689 | Ga0070689_100919983 | |||
| 1690 | Ga0070691_10456170 | |||
| 1691 | Ga0070687_100420059 | |||
| 1692 | Ga0070661_100020393 | |||
| 1693 | Ga0070661_100031335 | |||
| 1694 | Ga0070661_100230723 | |||
| 1695 | Ga0070661_100377865 | |||
| 1696 | Ga0070661_100808839 | |||
| 1697 | Ga0070661_100862778 | |||
| 1698 | Ga0070661_101126156 | |||
| 1699 | Ga0070692_10841793 | |||
| 1700 | Ga0070668_100000831 | |||
| 1701 | Ga0070668_100017594 | |||
| 1702 | Ga0070668_100719613 | |||
| 1703 | Ga0070668_100732995 | |||
| 1704 | Ga0070669_100000115 | |||
| 1705 | Ga0070669_100000296 | |||
| 1706 | Ga0070669_100854356 | |||
| 1707 | Ga0070669_100934560 | |||
| 1708 | Ga0070669_100991154 | |||
| 1709 | Ga0070675_100098854 | |||
| 1710 | Ga0070675_100126421 | |||
| 1711 | Ga0070675_101302178 | |||
| 1712 | Ga0070671_100024172 | |||
| 1713 | Ga0070671_100145848 | |||
| 1714 | Ga0070671_100287990 | |||
| 1715 | Ga0070671_100436300 | |||
| 1716 | Ga0070671_100488119 | |||
| 1717 | Ga0070671_100615864 | |||
| 1718 | Ga0070674_100058209 | |||
| 1719 | Ga0070674_100829410 | |||
| 1720 | Ga0070674_100861718 | |||
| 1721 | Ga0070673_100000019 | |||
| 1722 | Ga0070673_100286720 | |||
| 1723 | Ga0070673_101102375 | |||
| 1724 | Ga0070673_101841538 | |||
| 1725 | Ga0070673_102297973 | |||
| 1726 | Ga0070688_100004740 | |||
| 1727 | Ga0070688_100955353 | |||
| 1728 | Ga0070659_100095005 | |||
| 1729 | Ga0070659_100140885 | |||
| 1730 | Ga0070659_100221271 | |||
| 1731 | Ga0070659_100222739 | |||
| 1732 | Ga0070659_100246930 | |||
| 1733 | Ga0070659_100704189 | |||
| 1734 | Ga0070659_101377798 | |||
| 1735 | Ga0070659_101819905 | |||
| 1736 | Ga0070659_102069681 | |||
| 1737 | Ga0070667_100000039 | |||
| 1738 | Ga0070667_100013671 | |||
| 1739 | Ga0070667_100044820 | |||
| 1740 | Ga0070667_100188643 | |||
| 1741 | Ga0070667_101768041 | |||
| 1742 | Ga0070667_102150848 | |||
| 1743 | Ga0070710_10640199 | |||
| 1744 | Ga0070701_10673112 | |||
| 1745 | Ga0070694_101003286 | |||
| 1746 | Ga0070663_100081755 | |||
| 1747 | Ga0070663_100148712 | |||
| 1748 | Ga0070663_100225700 | |||
| 1749 | Ga0070663_100420899 | |||
| 1750 | Ga0070663_100669376 | |||
| 1751 | Ga0070678_100006601 | |||
| 1752 | Ga0070678_100040527 | |||
| 1753 | Ga0070678_101189213 | |||
| 1754 | Ga0070678_101574103 | |||
| 1755 | Ga0070662_100020163 | |||
| 1756 | Ga0070662_100024536 | |||
| 1757 | Ga0070662_100044582 | |||
| 1758 | Ga0070662_100358188 | |||
| 1759 | Ga0070662_100377085 | |||
| 1760 | Ga0070662_100436172 | |||
| 1761 | Ga0070662_100519772 | |||
| 1762 | Ga0070662_100811721 | |||
| 1763 | Ga0070662_101285102 | |||
| 1764 | Ga0070662_101615296 | |||
| 1765 | Ga0070662_101777111 | |||
| 1766 | Ga0070662_101986251 | |||
| 1767 | Ga0070681_10078394 | |||
| 1768 | Ga0070681_10131424 | |||
| 1769 | Ga0068867_100000014 | |||
| 1770 | Ga0068867_100083516 | |||
| 1771 | Ga0068867_101459937 | |||
| 1772 | Ga0070685_10000806 | |||
| 1773 | Ga0070706_101846410 | |||
| 1774 | Ga0070679_100000873 | |||
| 1775 | Ga0070679_100651895 | |||
| 1776 | Ga0070679_101959785 | |||
| 1777 | Ga0070684_100136074 | |||
| 1778 | Ga0070684_100204115 | |||
| 1779 | Ga0070684_101536557 | |||
| 1780 | Ga0068853_100000960 | |||
| 1781 | Ga0068853_100202129 | |||
| 1782 | Ga0068853_100282094 | |||
| 1783 | Ga0068853_100306801 | |||
| 1784 | Ga0068853_100337575 | |||
| 1785 | Ga0068853_100618322 | |||
| 1786 | Ga0068853_100656641 | |||
| 1787 | Ga0068853_101091271 | |||
| 1788 | Ga0068853_102037210 | |||
| 1789 | Ga0070672_100182037 | |||
| 1790 | Ga0070672_100534380 | |||
| 1791 | Ga0070686_100000061 | |||
| 1792 | Ga0070686_100006821 | |||
| 1793 | Ga0070686_100561102 | |||
| 1794 | Ga0070686_101857804 | |||
| 1795 | Ga0070693_100211135 | |||
| 1796 | Ga0070693_100435491 | |||
| 1797 | Ga0070693_100802929 | |||
| 1798 | Ga0070665_100000004 | |||
| 1799 | Ga0070665_100000109 | |||
| 1800 | Ga0070665_100001527 | |||
| 1801 | Ga0070665_100010005 | |||
| 1802 | Ga0070665_100126607 | |||
| 1803 | Ga0070665_100255203 | |||
| 1804 | Ga0070665_100429143 | |||
| 1805 | Ga0070665_101247662 | |||
| 1806 | Ga0068855_100010206 | |||
| 1807 | Ga0068855_100237795 | |||
| 1808 | Ga0068855_100361015 | |||
| 1809 | Ga0068855_100456541 | |||
| 1810 | Ga0068855_100491032 | |||
| 1811 | Ga0068855_100508392 | |||
| 1812 | Ga0068855_100822833 | |||
| 1813 | Ga0068855_100855046 | |||
| 1814 | Ga0068855_101257490 | |||
| 1815 | Ga0068855_102579830 | |||
| 1816 | Ga0070664_100063876 | |||
| 1817 | Ga0070664_100145529 | |||
| 1818 | Ga0070664_100698762 | |||
| 1819 | Ga0070664_101529857 | |||
| 1820 | Ga0070664_101765256 | |||
| 1821 | Ga0068857_100055851 | |||
| 1822 | Ga0068857_100060023 | |||
| 1823 | Ga0068857_100066375 | |||
| 1824 | Ga0068857_100167943 | |||
| 1825 | Ga0068857_100233827 | |||
| 1826 | Ga0068857_101240083 | |||
| 1827 | Ga0068857_101884696 | |||
| 1828 | Ga0068854_100031424 | |||
| 1829 | Ga0068854_100051084 | |||
| 1830 | Ga0068854_100074235 | |||
| 1831 | Ga0068854_100092457 | |||
| 1832 | Ga0068854_100410357 | |||
| 1833 | Ga0068854_100465647 | |||
| 1834 | Ga0068854_100845579 | |||
| 1835 | Ga0068854_101759412 | |||
| 1836 | Ga0068856_100060779 | |||
| 1837 | Ga0068856_100262174 | |||
| 1838 | Ga0068856_100338965 | |||
| 1839 | Ga0068856_100372649 | |||
| 1840 | Ga0068856_100443696 | |||
| 1841 | Ga0068856_100480227 | |||
| 1842 | Ga0068856_100620097 | |||
| 1843 | Ga0068852_100098053 | |||
| 1844 | Ga0068852_100185948 | |||
| 1845 | Ga0068852_100239696 | |||
| 1846 | Ga0068852_100262271 | |||
| 1847 | Ga0068852_100443711 | |||
| 1848 | Ga0068852_101031550 | |||
| 1849 | Ga0068852_101812706 | |||
| 1850 | Ga0068852_102499611 | |||
| 1851 | Ga0068852_102720078 | |||
| 1852 | Ga0068859_100001416 | |||
| 1853 | Ga0068859_100009835 | |||
| 1854 | Ga0068859_100058681 | |||
| 1855 | Ga0068859_100166281 | |||
| 1856 | Ga0068859_100173979 | |||
| 1857 | Ga0068859_100505472 | |||
| 1858 | Ga0068859_100798469 | |||
| 1859 | Ga0068864_100000016 | |||
| 1860 | Ga0068864_100000087 | |||
| 1861 | Ga0068864_100002567 | |||
| 1862 | Ga0068864_102434270 | |||
| 1863 | Ga0068866_11085482 | |||
| 1864 | Ga0068861_100000040 | |||
| 1865 | Ga0068861_100006640 | |||
| 1866 | Ga0068861_100635023 | |||
| 1867 | Ga0068861_101939186 | |||
| 1868 | Ga0068861_102125254 | |||
| 1869 | Ga0068851_10010412 | |||
| 1870 | Ga0068851_10056665 | |||
| 1871 | Ga0068851_10329818 | |||
| 1872 | Ga0068851_11038818 | |||
| 1873 | Ga0068870_10096183 | |||
| 1874 | Ga0068870_10558785 | |||
| 1875 | Ga0068863_100000013 | |||
| 1876 | Ga0068863_100000017 | |||
| 1877 | Ga0068863_100000033 | |||
| 1878 | Ga0068863_100008320 | |||
| 1879 | Ga0068863_100140643 | |||
| 1880 | Ga0068863_100234419 | |||
| 1881 | Ga0068863_100358661 | |||
| 1882 | Ga0068858_100000664 | |||
| 1883 | Ga0068858_100004566 | |||
| 1884 | Ga0068858_100708504 | |||
| 1885 | Ga0068858_102283401 | |||
| 1886 | Ga0068860_100000009 | |||
| 1887 | Ga0068860_100028829 | |||
| 1888 | Ga0068860_100053483 | |||
| 1889 | Ga0068860_100264367 | |||
| 1890 | Ga0068862_100000032 | |||
| 1891 | Ga0068862_100000040 | |||
| 1892 | Ga0068862_100000466 | |||
| 1893 | Ga0068862_100001446 | |||
| 1894 | Ga0068862_100105127 | |||
| 1895 | Ga0068862_101080627 | |||
| 1896 | Ga0081455_10000215 | |||
| 1897 | Ga0081540_1013216 | |||
| 1898 | Ga0075364_10001520 | |||
| 1899 | Ga0075364_11177761 | |||
| 1900 | Ga0075362_10167624 | |||
| 1901 | Ga0075369_10031638 | |||
| 1902 | Ga0075369_10084853 | |||
| 1903 | Ga0075369_10116166 | |||
| 1904 | Ga0075369_10337703 | |||
| 1905 | Ga0075366_10130637 | |||
| 1906 | Ga0075366_10182388 | |||
| 1907 | Ga0075366_10233689 | |||
| 1908 | Ga0075366_10759202 | |||
| 1909 | Ga0075366_11042173 | |||
| 1910 | Ga0097621_100240098 | |||
| 1911 | Ga0097621_101343528 | |||
| 1912 | Ga0097621_101467576 | |||
| 1913 | Ga0097621_101723020 | |||
| 1914 | Ga0097621_101868557 | |||
| 1915 | Ga0097621_102103718 | |||
| 1916 | Ga0075370_10008629 | |||
| 1917 | Ga0075370_10023057 | |||
| 1918 | Ga0075370_10412683 | |||
| 1919 | Ga0075370_10664875 | |||
| 1920 | Ga0075370_10676786 | |||
| 1921 | Ga0068871_100261117 | |||
| 1922 | Ga0068871_100587711 | |||
| 1923 | Ga0068871_101186315 | |||
| 1924 | Ga0075430_101078196 | |||
| 1925 | Ga0075434_100255877 | |||
| 1926 | Ga0068865_100000018 | |||
| 1927 | Ga0097620_100001416 | |||
| 1928 | Ga0097620_100009835 | |||
| 1929 | Ga0097620_100058681 | |||
| 1930 | Ga0097620_100166292 | |||
| 1931 | Ga0097620_100173972 | |||
| 1932 | Ga0097620_100505473 | |||
| 1933 | Ga0097620_100798483 | |||
| 1934 | Ga0105251_10004716 | |||
| 1935 | Ga0105251_10155260 | |||
| 1936 | Ga0105244_10297884 | |||
| 1937 | Ga0105240_10001116 | |||
| 1938 | Ga0105240_10024394 | |||
| 1939 | Ga0105240_10191747 | |||
| 1940 | Ga0105240_10610797 | |||
| 1941 | Ga0105240_10749955 | |||
| 1942 | Ga0105240_12393971 | |||
| 1943 | Ga0105240_12490842 | |||
| 1944 | Ga0105245_10002967 | |||
| 1945 | Ga0105245_10005275 | |||
| 1946 | Ga0105245_10406216 | |||
| 1947 | Ga0105245_11568913 | |||
| 1948 | Ga0105247_10018821 | |||
| 1949 | Ga0105247_10086839 | |||
| 1950 | Ga0105247_10091941 | |||
| 1951 | Ga0114129_12342286 | |||
| 1952 | Ga0105243_10000076 | |||
| 1953 | Ga0105243_10003106 | |||
| 1954 | Ga0105243_10358718 | |||
| 1955 | Ga0105243_10522486 | |||
| 1956 | Ga0105243_10693651 | |||
| 1957 | Ga0105243_11675996 | |||
| 1958 | Ga0105243_11796911 | |||
| 1959 | Ga0105243_13135099 | |||
| 1960 | Ga0105241_10004308 | |||
| 1961 | Ga0105241_10090211 | |||
| 1962 | Ga0105241_10407073 | |||
| 1963 | Ga0105241_10417038 | |||
| 1964 | Ga0105241_11874660 | |||
| 1965 | Ga0105241_11879984 | |||
| 1966 | Ga0105242_10009804 | |||
| 1967 | Ga0105242_11353886 | |||
| 1968 | Ga0105248_10000021 | |||
| 1969 | Ga0105248_10003987 | |||
| 1970 | Ga0105248_10006062 | |||
| 1971 | Ga0105248_10008689 | |||
| 1972 | Ga0105248_10255282 | |||
| 1973 | Ga0105248_10504523 | |||
| 1974 | Ga0105237_10002858 | |||
| 1975 | Ga0105237_10011259 | |||
| 1976 | Ga0105237_10045964 | |||
| 1977 | Ga0105237_10082257 | |||
| 1978 | Ga0105237_10114196 | |||
| 1979 | Ga0105237_10200169 | |||
| 1980 | Ga0105237_10469740 | |||
| 1981 | Ga0105237_11204749 | |||
| 1982 | Ga0105237_11486404 | |||
| 1983 | Ga0105237_12270548 | |||
| 1984 | Ga0105238_10103849 | |||
| 1985 | Ga0105238_10108749 | |||
| 1986 | Ga0105238_10138886 | |||
| 1987 | Ga0105238_10157495 | |||
| 1988 | Ga0105238_10214234 | |||
| 1989 | Ga0105238_10373621 | |||
| 1990 | Ga0105238_10421717 | |||
| 1991 | Ga0105238_10521037 | |||
| 1992 | Ga0105238_10541365 | |||
| 1993 | Ga0105238_10843372 | |||
| 1994 | Ga0105238_11477082 | |||
| 1995 | Ga0105238_12385496 | |||
| 1996 | Ga0105238_12416452 | |||
| 1997 | Ga0105238_12548021 | |||
| 1998 | Ga0105238_12971625 | |||
| 1999 | Ga0105249_10000006 | |||
| 2000 | Ga0105249_10000017 | |||
| 2001 | Ga0105249_10001881 | |||
| 2002 | Ga0105249_10203829 | |||
| 2003 | Ga0105249_10249779 | |||
| 2004 | Ga0105249_12218491 | |||
| 2005 | Ga0105239_10000546 | |||
| 2006 | Ga0105239_10070988 | |||
| 2007 | Ga0105239_10379102 | |||
| 2008 | Ga0105239_11008231 | |||
| 2009 | Ga0105239_11166215 | |||
| 2010 | Ga0105239_12076595 | |||
| 2011 | Ga0105239_12764741 | |||
| 2012 | Ga0105239_13631876 | |||
| 2013 | Ga0105246_10161931 | |||
| 2014 | Ga0105246_10588517 | |||
| 2015 | Ga0105246_10851547 | |||
| 2016 | Ga0105246_11219958 | |||
| 2017 | Ga0157317_1023388 | |||
| 2018 | Ga0157315_1007765 | |||
| 2019 | Ga0157326_1079519 | |||
| 2020 | Ga0157373_10081148 | |||
| 2021 | Ga0157373_10565416 | |||
| 2022 | Ga0157373_10660838 | |||
| 2023 | Ga0157373_10662801 | |||
| 2024 | Ga0157373_10798128 | |||
| 2025 | Ga0157373_11528879 | |||
| 2026 | Ga0157371_10000059 | |||
| 2027 | Ga0157371_10089328 | |||
| 2028 | Ga0157371_10342701 | |||
| 2029 | Ga0157371_10606382 | |||
| 2030 | Ga0157371_11339788 | |||
| 2031 | Ga0157370_10327199 | |||
| 2032 | Ga0157370_10370331 | |||
| 2033 | Ga0157370_10415992 | |||
| 2034 | Ga0157370_10545838 | |||
| 2035 | Ga0157370_11249102 | |||
| 2036 | Ga0157369_10073353 | |||
| 2037 | Ga0157369_10083235 | |||
| 2038 | Ga0157369_10211906 | |||
| 2039 | Ga0157369_10281167 | |||
| 2040 | Ga0157369_10298220 | |||
| 2041 | Ga0157369_10312143 | |||
| 2042 | Ga0157369_10444995 | |||
| 2043 | Ga0157369_10840300 | |||
| 2044 | Ga0157369_11229243 | |||
| 2045 | Ga0157369_11658669 | |||
| 2046 | Ga0157369_12017709 | |||
| 2047 | Ga0157369_12583312 | |||
| 2048 | Ga0157374_10412425 | |||
| 2049 | Ga0157378_10000504 | |||
| 2050 | Ga0157378_10107742 | |||
| 2051 | Ga0157378_10539715 | |||
| 2052 | Ga0157378_10950271 | |||
| 2053 | Ga0157378_11480740 | |||
| 2054 | Ga0157378_11587366 | |||
| 2055 | Ga0163162_10092290 | |||
| 2056 | Ga0163162_10421093 | |||
| 2057 | Ga0163162_11521886 | |||
| 2058 | Ga0163162_12218841 | |||
| 2059 | Ga0157372_10084779 | |||
| 2060 | Ga0157372_10573559 | |||
| 2061 | Ga0157372_11126859 | |||
| 2062 | Ga0157372_11317178 | |||
| 2063 | Ga0157372_11994999 | |||
| 2064 | Ga0157372_12178074 | |||
| 2065 | Ga0157375_10082591 | |||
| 2066 | Ga0157375_10446526 | |||
| 2067 | Ga0157375_11409902 | |||
| 2068 | Ga0157375_13608339 | |||
| 2069 | Ga0163163_10465584 | |||
| 2070 | Ga0163163_11563685 | |||
| 2071 | Ga0163163_11777425 | |||
| 2072 | Ga0163163_12645250 | |||
| 2073 | Ga0157380_10000157 | |||
| 2074 | Ga0157380_10002166 | |||
| 2075 | Ga0157380_10006678 | |||
| 2076 | Ga0157380_10812507 | |||
| 2077 | Ga0157380_11992912 | |||
| 2078 | Ga0182008_10166668 | |||
| 2079 | Ga0157377_10082035 | |||
| 2080 | Ga0157377_10180500 | |||
| 2081 | Ga0157377_10583524 | |||
| 2082 | Ga0157379_10001735 | |||
| 2083 | Ga0157379_10051816 | |||
| 2084 | Ga0157379_11466984 | |||
| 2085 | Ga0157379_12505109 | |||
| 2086 | Ga0157376_10000092 | |||
| 2087 | Ga0157376_10492886 | |||
| 2088 | Ga0157376_10716193 | |||
| 2089 | Ga0157376_11441483 | |||
| 2090 | Ga0157376_11622424 | |||
| 2091 | Ga0183360_10368 | |||
| 2092 | Ga0183363_1006 | |||
| 2093 | Ga0163161_10000208 | |||
| 2094 | Ga0163161_10144828 | |||
| 2095 | Ga0163161_10167645 | |||
| 2096 | Ga0163161_10541954 | |||
| 2097 | Ga0163161_10943367 | |||
| 2098 | Ga0197907_10274206 | |||
| 2099 | Ga0206356_10317151 | |||
| 2100 | Ga0206349_1668694 | |||
| 2101 | Ga0206353_11808888 | |||
| 2102 | Ga0213876_10016636 | |||
| 2103 | Ga0213875_10001626 | |||
| 2104 | Ga0209674_101560 | |||
| 2105 | Ga0209563_100030 | |||
| 2106 | Ga0207427_104026 | |||
| 2107 | Ga0209437_123370 | |||
| 2108 | Ga0207425_1000049 | |||
| 2109 | Ga0207425_1011898 | |||
| 2110 | Ga0209646_1020951 | |||
| 2111 | Ga0209646_1031500 | |||
| 2112 | Ga0209026_1000352 | |||
| 2113 | Ga0209026_1013989 | |||
| 2114 | Ga0209026_1031029 | |||
| 2115 | Ga0209677_105325 | |||
| 2116 | Ga0209148_1000011 | |||
| 2117 | Ga0209148_1000243 | |||
| 2118 | Ga0209148_1005193 | |||
| 2119 | Ga0209129_1000471 | |||
| 2120 | Ga0209233_1000003 | |||
| 2121 | Ga0209233_1000065 | |||
| 2122 | Ga0209233_1006188 | |||
| 2123 | Ga0209565_1000008 | |||
| 2124 | Ga0209565_1000985 | |||
| 2125 | Ga0209455_1000006 | |||
| 2126 | Ga0209455_1002555 | |||
| 2127 | Ga0209455_1031389 | |||
| 2128 | Ga0209673_1004450 | |||
| 2129 | Ga0209673_1023801 | |||
| 2130 | Ga0209675_1000104 | |||
| 2131 | Ga0209676_1000512 | |||
| 2132 | Ga0209676_1000807 | |||
| 2133 | Ga0209676_1001199 | |||
| 2134 | Ga0209676_1009827 | |||
| 2135 | Ga0209676_1021566 | |||
| 2136 | Ga0209676_1029229 | |||
| 2137 | Ga0209025_1000068 | |||
| 2138 | Ga0209025_1011083 | |||
| 2139 | Ga0209025_1050489 | |||
| 2140 | Ga0209564_1000335 | |||
| 2141 | Ga0209564_1016953 | |||
| 2142 | Ga0209564_1085619 | |||
| 2143 | Ga0209758_1000001 | |||
| 2144 | Ga0209758_1000004 | |||
| 2145 | Ga0209758_1017731 | |||
| 2146 | Ga0209758_1169594 | |||
| 2147 | Ga0209050_1000001 | |||
| 2148 | Ga0209050_1000286 | |||
| 2149 | Ga0209050_1002774 | |||
| 2150 | Ga0209050_1003389 | |||
| 2151 | Ga0209050_1035962 | |||
| 2152 | Ga0209256_1000009 | |||
| 2153 | Ga0209256_1000010 | |||
| 2154 | Ga0207426_1140179 | |||
| 2155 | Ga0209051_1000191 | |||
| 2156 | Ga0209051_1038886 | |||
| 2157 | Ga0209257_1000245 | |||
| 2158 | Ga0209257_1000321 | |||
| 2159 | Ga0209257_1000577 | |||
| 2160 | Ga0209257_1000597 | |||
| 2161 | Ga0209257_1003551 | |||
| 2162 | Ga0209257_1004959 | |||
| 2163 | Ga0209257_1016465 | |||
| 2164 | Ga0209257_1026884 | |||
| 2165 | Ga0209257_1028408 | |||
| 2166 | Ga0209257_1035933 | |||
| 2167 | Ga0207656_10004180 | |||
| 2168 | Ga0207656_10023916 | |||
| 2169 | Ga0207656_10229427 | |||
| 2170 | Ga0207656_10302528 | |||
| 2171 | Ga0207682_10001453 | |||
| 2172 | Ga0207682_10407906 | |||
| 2173 | Ga0207682_10474015 | |||
| 2174 | Ga0207692_10992207 | |||
| 2175 | Ga0207642_10869034 | |||
| 2176 | Ga0207710_10004955 | |||
| 2177 | Ga0207710_10008017 | |||
| 2178 | Ga0207710_10066752 | |||
| 2179 | Ga0207688_10302991 | |||
| 2180 | Ga0207688_10449418 | |||
| 2181 | Ga0207688_11080046 | |||
| 2182 | Ga0207680_10000010 | |||
| 2183 | Ga0207680_10559990 | |||
| 2184 | Ga0207680_10775750 | |||
| 2185 | Ga0207680_10792934 | |||
| 2186 | Ga0207680_11343394 | |||
| 2187 | Ga0207647_10000069 | |||
| 2188 | Ga0207647_10009251 | |||
| 2189 | Ga0207647_10035876 | |||
| 2190 | Ga0207647_10068151 | |||
| 2191 | Ga0207647_10137710 | |||
| 2192 | Ga0207647_10168495 | |||
| 2193 | Ga0207645_10014111 | |||
| 2194 | Ga0207645_10021253 | |||
| 2195 | Ga0207645_10372006 | |||
| 2196 | Ga0207705_10000084 | |||
| 2197 | Ga0207705_10000243 | |||
| 2198 | Ga0207705_10000511 | |||
| 2199 | Ga0207705_10002954 | |||
| 2200 | Ga0207705_10049162 | |||
| 2201 | Ga0207705_10841844 | |||
| 2202 | Ga0207705_10862539 | |||
| 2203 | Ga0207705_11032938 | |||
| 2204 | Ga0207684_11444845 | |||
| 2205 | Ga0207654_10000796 | |||
| 2206 | Ga0207654_10000810 | |||
| 2207 | Ga0207654_10195143 | |||
| 2208 | Ga0207707_10045078 | |||
| 2209 | Ga0207695_10000288 | |||
| 2210 | Ga0207695_10003496 | |||
| 2211 | Ga0207695_10006167 | |||
| 2212 | Ga0207695_10095035 | |||
| 2213 | Ga0207695_10103895 | |||
| 2214 | Ga0207695_10171402 | |||
| 2215 | Ga0207671_10002884 | |||
| 2216 | Ga0207671_10003173 | |||
| 2217 | Ga0207671_10003747 | |||
| 2218 | Ga0207671_10022700 | |||
| 2219 | Ga0207671_10182611 | |||
| 2220 | Ga0207671_10552124 | |||
| 2221 | Ga0207660_10001492 | |||
| 2222 | Ga0207660_11185096 | |||
| 2223 | Ga0207662_11065466 | |||
| 2224 | Ga0207657_10028620 | |||
| 2225 | Ga0207657_10028866 | |||
| 2226 | Ga0207657_10028985 | |||
| 2227 | Ga0207657_10048886 | |||
| 2228 | Ga0207657_10085735 | |||
| 2229 | Ga0207657_10139728 | |||
| 2230 | Ga0207657_10214187 | |||
| 2231 | Ga0207657_10232634 | |||
| 2232 | Ga0207657_10276144 | |||
| 2233 | Ga0207657_10495134 | |||
| 2234 | Ga0207657_10506335 | |||
| 2235 | Ga0207657_10632222 | |||
| 2236 | Ga0207649_10000212 | |||
| 2237 | Ga0207649_10003617 | |||
| 2238 | Ga0207649_10103905 | |||
| 2239 | Ga0207649_10197129 | |||
| 2240 | Ga0207649_10395053 | |||
| 2241 | Ga0207649_11186539 | |||
| 2242 | Ga0207652_10000008 | |||
| 2243 | Ga0207652_10502029 | |||
| 2244 | Ga0207681_10000005 | |||
| 2245 | Ga0207681_10000197 | |||
| 2246 | Ga0207681_10684161 | |||
| 2247 | Ga0207681_11150961 | |||
| 2248 | Ga0207694_10002782 | |||
| 2249 | Ga0207694_10016018 | |||
| 2250 | Ga0207694_10049198 | |||
| 2251 | Ga0207694_10124310 | |||
| 2252 | Ga0207694_10363345 | |||
| 2253 | Ga0207694_10382618 | |||
| 2254 | Ga0207694_10659746 | |||
| 2255 | Ga0207694_11014525 | |||
| 2256 | Ga0207694_11894867 | |||
| 2257 | Ga0207650_10000004 | |||
| 2258 | Ga0207650_10000069 | |||
| 2259 | Ga0207650_10068635 | |||
| 2260 | Ga0207650_10208243 | |||
| 2261 | Ga0207650_10218925 | |||
| 2262 | Ga0207659_10009064 | |||
| 2263 | Ga0207659_10396469 | |||
| 2264 | Ga0207659_11003722 | |||
| 2265 | Ga0207659_11019975 | |||
| 2266 | Ga0207687_10003114 | |||
| 2267 | Ga0207687_10079745 | |||
| 2268 | Ga0207687_10236428 | |||
| 2269 | Ga0207687_11118299 | |||
| 2270 | Ga0207644_10000145 | |||
| 2271 | Ga0207644_10058536 | |||
| 2272 | Ga0207644_10163232 | |||
| 2273 | Ga0207644_10312997 | |||
| 2274 | Ga0207644_10611291 | |||
| 2275 | Ga0207690_10004341 | |||
| 2276 | Ga0207690_10066595 | |||
| 2277 | Ga0207690_10075431 | |||
| 2278 | Ga0207690_10480941 | |||
| 2279 | Ga0207690_10666319 | |||
| 2280 | Ga0207690_10725464 | |||
| 2281 | Ga0207690_11366109 | |||
| 2282 | Ga0207690_11450002 | |||
| 2283 | Ga0207706_10022259 | |||
| 2284 | Ga0207706_10041508 | |||
| 2285 | Ga0207706_10180514 | |||
| 2286 | Ga0207706_10181057 | |||
| 2287 | Ga0207706_10229574 | |||
| 2288 | Ga0207706_10310239 | |||
| 2289 | Ga0207706_10344241 | |||
| 2290 | Ga0207706_10361163 | |||
| 2291 | Ga0207706_10702569 | |||
| 2292 | Ga0207706_10946056 | |||
| 2293 | Ga0207706_11181552 | |||
| 2294 | Ga0207686_10004287 | |||
| 2295 | Ga0207686_10156000 | |||
| 2296 | Ga0207686_11396709 | |||
| 2297 | Ga0207709_10000114 | |||
| 2298 | Ga0207709_10000246 | |||
| 2299 | Ga0207709_10462012 | |||
| 2300 | Ga0207709_10550523 | |||
| 2301 | Ga0207709_10703101 | |||
| 2302 | Ga0207670_10017586 | |||
| 2303 | Ga0207670_11740647 | |||
| 2304 | Ga0207669_10005822 | |||
| 2305 | Ga0207669_10017734 | |||
| 2306 | Ga0207669_10629947 | |||
| 2307 | Ga0207669_10946787 | |||
| 2308 | Ga0207704_10000008 | |||
| 2309 | Ga0207691_10125275 | |||
| 2310 | Ga0207691_10473191 | |||
| 2311 | Ga0207691_10492740 | |||
| 2312 | Ga0207691_11152377 | |||
| 2313 | Ga0207691_11629418 | |||
| 2314 | Ga0207711_10000025 | |||
| 2315 | Ga0207711_10001472 | |||
| 2316 | Ga0207711_10005846 | |||
| 2317 | Ga0207711_10006762 | |||
| 2318 | Ga0207711_10015720 | |||
| 2319 | Ga0207689_10000608 | |||
| 2320 | Ga0207689_10099854 | |||
| 2321 | Ga0207689_10280169 | |||
| 2322 | Ga0207689_10392332 | |||
| 2323 | Ga0207689_10716978 | |||
| 2324 | Ga0207661_10236839 | |||
| 2325 | Ga0207661_10536130 | |||
| 2326 | Ga0207661_10638479 | |||
| 2327 | Ga0207661_11430975 | |||
| 2328 | Ga0207679_10050964 | |||
| 2329 | Ga0207679_10157897 | |||
| 2330 | Ga0207679_10378715 | |||
| 2331 | Ga0207679_11301270 | |||
| 2332 | Ga0207679_11432425 | |||
| 2333 | Ga0207667_10000002 | |||
| 2334 | Ga0207667_10000024 | |||
| 2335 | Ga0207667_10004183 | |||
| 2336 | Ga0207667_10206634 | |||
| 2337 | Ga0207667_10491059 | |||
| 2338 | Ga0207667_10553369 | |||
| 2339 | Ga0207667_10686476 | |||
| 2340 | Ga0207667_11598959 | |||
| 2341 | Ga0207651_10000008 | |||
| 2342 | Ga0207651_10486602 | |||
| 2343 | Ga0207651_11659456 | |||
| 2344 | Ga0207651_11838274 | |||
| 2345 | Ga0207712_10000012 | |||
| 2346 | Ga0207712_10000014 | |||
| 2347 | Ga0207712_10005054 | |||
| 2348 | Ga0207712_10074681 | |||
| 2349 | Ga0207712_10124290 | |||
| 2350 | Ga0207668_10000113 | |||
| 2351 | Ga0207668_10017274 | |||
| 2352 | Ga0207668_10817192 | |||
| 2353 | Ga0207668_11440424 | |||
| 2354 | Ga0207668_11921966 | |||
| 2355 | Ga0207640_10002027 | |||
| 2356 | Ga0207640_10013183 | |||
| 2357 | Ga0207640_10036573 | |||
| 2358 | Ga0207640_10100085 | |||
| 2359 | Ga0207640_10440941 | |||
| 2360 | Ga0207640_10608503 | |||
| 2361 | Ga0207640_10998134 | |||
| 2362 | Ga0207640_11205523 | |||
| 2363 | Ga0207658_10000428 | |||
| 2364 | Ga0207658_10009141 | |||
| 2365 | Ga0207658_10010246 | |||
| 2366 | Ga0207658_11843379 | |||
| 2367 | Ga0207677_10000091 | |||
| 2368 | Ga0207677_11302107 | |||
| 2369 | Ga0207677_11497990 | |||
| 2370 | Ga0207703_10002426 | |||
| 2371 | Ga0207703_10003828 | |||
| 2372 | Ga0207703_10994092 | |||
| 2373 | Ga0207639_10003616 | |||
| 2374 | Ga0207639_10013397 | |||
| 2375 | Ga0207639_10020428 | |||
| 2376 | Ga0207639_10020539 | |||
| 2377 | Ga0207639_10041198 | |||
| 2378 | Ga0207639_10119130 | |||
| 2379 | Ga0207639_10200720 | |||
| 2380 | Ga0207639_10272272 | |||
| 2381 | Ga0207639_10307772 | |||
| 2382 | Ga0207639_11098996 | |||
| 2383 | Ga0207639_11296198 | |||
| 2384 | Ga0207678_10004876 | |||
| 2385 | Ga0207678_10016489 | |||
| 2386 | Ga0207678_10175338 | |||
| 2387 | Ga0207678_10301146 | |||
| 2388 | Ga0207678_10703703 | |||
| 2389 | Ga0207678_10909510 | |||
| 2390 | Ga0207702_10003021 | |||
| 2391 | Ga0207702_10005062 | |||
| 2392 | Ga0207702_10006302 | |||
| 2393 | Ga0207702_10153725 | |||
| 2394 | Ga0207702_10192692 | |||
| 2395 | Ga0207702_10210284 | |||
| 2396 | Ga0207702_10274235 | |||
| 2397 | Ga0207641_10000002 | |||
| 2398 | Ga0207641_10000036 | |||
| 2399 | Ga0207641_10000099 | |||
| 2400 | Ga0207641_10006011 | |||
| 2401 | Ga0207641_10112331 | |||
| 2402 | Ga0207641_10223420 | |||
| 2403 | Ga0207641_11260024 | |||
| 2404 | Ga0207648_10000009 | |||
| 2405 | Ga0207648_10014717 | |||
| 2406 | Ga0207648_10603009 | |||
| 2407 | Ga0207648_10787837 | |||
| 2408 | Ga0207676_10000006 | |||
| 2409 | Ga0207676_10000044 | |||
| 2410 | Ga0207676_10001345 | |||
| 2411 | Ga0207676_10922563 | |||
| 2412 | Ga0207676_12417247 | |||
| 2413 | Ga0207674_10017839 | |||
| 2414 | Ga0207674_10050570 | |||
| 2415 | Ga0207674_10066644 | |||
| 2416 | Ga0207674_10095821 | |||
| 2417 | Ga0207674_10197887 | |||
| 2418 | Ga0207674_10423883 | |||
| 2419 | Ga0207674_10536182 | |||
| 2420 | Ga0207674_11775389 | |||
| 2421 | Ga0207674_12056820 | |||
| 2422 | Ga0207675_100000157 | |||
| 2423 | Ga0207675_100001117 | |||
| 2424 | Ga0207675_100015082 | |||
| 2425 | Ga0207675_100318652 | |||
| 2426 | Ga0207675_102043211 | |||
| 2427 | Ga0207683_10004633 | |||
| 2428 | Ga0207683_10006500 | |||
| 2429 | Ga0207683_10701972 | |||
| 2430 | Ga0207683_11689544 | |||
| 2431 | Ga0207698_10000496 | |||
| 2432 | Ga0207698_10002491 | |||
| 2433 | Ga0207698_10005844 | |||
| 2434 | Ga0207698_10215161 | |||
| 2435 | Ga0207698_10235827 | |||
| 2436 | Ga0207698_10308204 | |||
| 2437 | Ga0207698_10579932 | |||
| 2438 | Ga0207698_10826820 | |||
| 2439 | Ga0207698_11144138 | |||
| 2440 | Ga0209998_10068929 | |||
| 2441 | Ga0209974_10058972 | |||
| 2442 | Ga0268266_10000009 | |||
| 2443 | Ga0268266_10000015 | |||
| 2444 | Ga0268266_10000560 | |||
| 2445 | Ga0268266_10008365 | |||
| 2446 | Ga0268266_10157745 | |||
| 2447 | Ga0268266_10553148 | |||
| 2448 | Ga0268266_11113731 | |||
| 2449 | Ga0268266_11854022 | |||
| 2450 | Ga0268265_10000001 | |||
| 2451 | Ga0268265_10000003 | |||
| 2452 | Ga0268265_10000047 | |||
| 2453 | Ga0268265_10000125 | |||
| 2454 | Ga0268265_10231745 | |||
| 2455 | Ga0268265_12333057 | |||
| 2456 | Ga0268264_10000023 | |||
| 2457 | Ga0268264_10014193 | |||
| 2458 | Ga0268264_10074867 | |||
| 2459 | Ga0268264_10205367 | |||
| 2460 | Ga0268264_11672397 | |||
| 2461 | Ga0307515_10341363 | |||
| 2462 | Ga0265338_10170208 | |||
| 2463 | Ga0314311_1129629 | |||
| 2464 | Ga0316183_1101809 | |||
| 2465 | Ga0307513_10032777 | |||
| 2466 | Ga0307513_10259144 | |||
| 2467 | Ga0307513_10504297 | |||
| 2468 | Ga0307513_10691202 | |||
| 2469 | Ga0307513_10745609 | |||
| 2470 | Ga0307408_100002738 | |||
| 2471 | Ga0307408_100999629 | |||
| 2472 | Ga0307408_101455450 | |||
| 2473 | Ga0307508_10004384 | |||
| 2474 | Ga0307405_10045306 | |||
| 2475 | Ga0307405_10064746 | |||
| 2476 | Ga0307405_10341476 | |||
| 2477 | Ga0307405_10464188 | |||
| 2478 | Ga0307405_10912860 | |||
| 2479 | Ga0307405_11445527 | |||
| 2480 | Ga0307405_11717863 | |||
| 2481 | Ga0307405_11939894 | |||
| 2482 | Ga0307413_10074350 | |||
| 2483 | Ga0307413_10267957 | |||
| 2484 | Ga0307413_10876998 | |||
| 2485 | Ga0307413_10923106 | |||
| 2486 | Ga0307413_10989766 | |||
| 2487 | Ga0307413_11491805 | |||
| 2488 | Ga0307410_10020800 | |||
| 2489 | Ga0307410_10182426 | |||
| 2490 | Ga0307410_10757338 | |||
| 2491 | Ga0307410_11125492 | |||
| 2492 | Ga0307406_10022639 | |||
| 2493 | Ga0307406_10040041 | |||
| 2494 | Ga0307406_10047398 | |||
| 2495 | Ga0307406_10198586 | |||
| 2496 | Ga0307406_10271505 | |||
| 2497 | Ga0307406_10409954 | |||
| 2498 | Ga0307406_10431566 | |||
| 2499 | Ga0307406_10900703 | |||
| 2500 | Ga0307406_11616058 | |||
| 2501 | Ga0307407_10050253 | |||
| 2502 | Ga0307407_10202991 | |||
| 2503 | Ga0307412_10000330 | |||
| 2504 | Ga0307412_10002114 | |||
| 2505 | Ga0307412_10005437 | |||
| 2506 | Ga0307412_10031479 | |||
| 2507 | Ga0307412_10032820 | |||
| 2508 | Ga0307412_10063499 | |||
| 2509 | Ga0307412_10069509 | |||
| 2510 | Ga0307412_10133634 | |||
| 2511 | Ga0307412_10731022 | |||
| 2512 | Ga0307409_100075828 | |||
| 2513 | Ga0307409_101074060 | |||
| 2514 | Ga0307409_101444973 | |||
| 2515 | Ga0307416_100013642 | |||
| 2516 | Ga0307416_100024455 | |||
| 2517 | Ga0307416_100056646 | |||
| 2518 | Ga0307416_100228529 | |||
| 2519 | Ga0307416_100296789 | |||
| 2520 | Ga0307416_101661728 | |||
| 2521 | Ga0307416_101971073 | |||
| 2522 | Ga0307414_10000117 | |||
| 2523 | Ga0307414_10000371 | |||
| 2524 | Ga0307414_10031754 | |||
| 2525 | Ga0307414_10036610 | |||
| 2526 | Ga0307414_10115431 | |||
| 2527 | Ga0307414_10342652 | |||
| 2528 | Ga0307414_10344197 | |||
| 2529 | Ga0307414_10449790 | |||
| 2530 | Ga0307414_10922789 | |||
| 2531 | Ga0307414_11157305 | |||
| 2532 | Ga0307414_12074244 | |||
| 2533 | Ga0307411_10069400 | |||
| 2534 | Ga0307411_10182421 | |||
| 2535 | Ga0307411_10227412 | |||
| 2536 | Ga0307411_10249025 | |||
| 2537 | Ga0307411_10877007 | |||
| 2538 | Ga0307415_100135597 | |||
| 2539 | Ga0307415_100208297 | |||
| 2540 | Ga0307415_101494312 | |||
| 2541 | Ga0307415_101576380 | |||
| 2542 | Ga0307510_10127422 | |||
| 2543 | Ga0307510_10608921 | |||
| 2544 | Ga0373954_0204433 | |||
| 2545 | Ga0373931_0061226 | |||
| 2546 | Ga0373935_0588072 | |||
| 2547 | Ga0373927_0041187 | |||
| 2548 | Ga0373925_0449014 | |||
| 2549 | Ga0395899_0116591 | |||
| 2550 | Ga0395899_0134214 | |||
| 2551 | Ga0395900_0232480 | |||
| 2552 | Ga0395900_0265355 | |||
| 2553 | Ga0395900_0549404 | |||
| 2554 | Ga0395898_0804277 | |||
| 2555 | Ga0395905_0257057 | |||
| 2556 | Ga0395905_0501499 | |||
| 2557 | Ga0395905_0520966 | |||
| 2558 | Ga0395905_1136521 | |||
| 2559 | Ga0436364_0957806 | |||
| 2560 | Ga0436364_1065372 | |||
| 2561 | Ga0436364_1253875 | |||
| 2562 | Ga0395901_0318284 | |||
| 2563 | Ga0395901_0617526 | |||
| 2564 | Ga0395901_0863371 | |||
| 2565 | Ga0237819_00478 | |||
| 2566 | Ga0237816_01697 | |||
| 2567 | Ga0436365_1056819 | |||
| 2568 | Ga0436365_1234023 | |||
| 2569 | Ga0436365_1437704 | |||
| 2570 | Ga0436365_1495591 | |||
| 2571 | Ga0436362_0379666 | |||
| 2572 | Ga0439436_0104422 | |||
| 2573 | Ga0439436_0166421 | |||
| 2574 | Ga0439439_0019879 | |||
| 2575 | Ga0439461_0003935 | |||
| 2576 | Ga0439461_0096709 | |||
| 2577 | Ga0439465_0004239 | |||
| 2578 | Ga0439465_0005674 | |||
| 2579 | Ga0439465_0042157 | |||
| 2580 | Ga0451789_0548732 | |||
| 2581 | Ga0451790_23905 | |||
| 2582 | Ga0451791_0198074 | |||
| 2583 | Ga0451791_0638383 | |||
| 2584 | Ga0451791_0752784 | |||
| 2585 | Ga0451791_0863431 | |||
| 2586 | Ga0451797_1153188 | |||
| 2587 | Ga0451795_0712337 | |||
| 2588 | Ga0451795_1707330 | |||
| 2589 | Ga0451795_1714707 | |||
| 2590 | Ga0451800_0368767 | |||
| 2591 | Ga0451802_0283989 | |||
| 2592 | Ga0451802_0673154 | |||
| 2593 | Ga0451802_1024104 | |||
| 2594 | Ga0451802_2140950 | |||
| 2595 | Ga0451805_129527 | |||
| 2596 | Ga0451806_203876 | |||
| 2597 | Ga0451806_592453 | |||
| 2598 | Ga0451806_758294 | |||
| 2599 | Ga0451804_0246643 | |||
| 2600 | Ga0451804_0292217 | |||
| 2601 | Ga0451804_0477757 | |||
| 2602 | Ga0451807_0470631 | |||
| 2603 | Ga0451807_1170541 | |||
| 2604 | Ga0451807_1532452 | |||
| 2605 | Ga0451807_2302565 | |||
| 2606 | Ga0451807_2545728 | |||
| 2607 | Ga0451807_2637162 | |||
| 2608 | Ga0451833_1456891 | |||
| 2609 | Ga0451837_0903713 | |||
| 2610 | Ga0451837_1313285 | |||
| 2611 | Ga0451841_1289656 | |||
| 2612 | Ga0451845_0647259 | |||
| 2613 | Ga0451843_0561276 | |||
| 2614 | Ga0451843_0868889 | |||
| 2615 | Ga0451855_0464587 | |||
| 2616 | Ga0451853_1470546 | |||
| 2617 | Ga0451853_1927772 | |||
| 2618 | Ga0451853_1977551 | |||
| 2619 | Ga0439431_0003098 | |||
| 2620 | Ga0439431_0139411 | |||
| 2621 | Ga0439445_0001259 | |||
| 2622 | Ga0439445_0046001 | |||
| 2623 | Ga0439445_0057073 | |||
| 2624 | Ga0439445_0064378 | |||
| 2625 | Ga0439445_0077090 | |||
| 2626 | Ga0439448_0001965 | |||
| 2627 | Ga0439448_0021597 | |||
| 2628 | Ga0439448_0034484 | |||
| 2629 | Ga0439432_006259 | |||
| 2630 | Ga0439450_143599 | |||
| 2631 | Ga0439452_041030 | |||
| 2632 | Ga0439455_0003944 | |||
| 2633 | Ga0439455_0064401 | |||
| 2634 | Ga0439462_0004404 | |||
| 2635 | Ga0439462_0004785 | |||
| 2636 | Ga0450894_038137 | |||
| 2637 | Ga0439446_0019699 | |||
| 2638 | Ga0439458_0001028 | |||
| 2639 | Ga0439458_0004227 | |||
| 2640 | Ga0439434_0000103 | |||
| 2641 | Ga0439434_0075974 | |||
| 2642 | Ga0439464_0179423 | |||
| 2643 | Ga0450893_0027173 | |||
| 2644 | Ga0466972_0022049 | |||
| 2645 | Ga0466966_0224862 | |||
| 2646 | Ga0466961_0076990 | |||
| 2647 | Ga0466963_0015793 | |||
| 2648 | Ga0466964_0641459 | |||
| 2649 | Ga0466971_0041189 | |||
| 2650 | Ga0466971_0531987 | |||
| 2651 | Ga0466968_0457697 | |||
| 2652 | Ga0466970_0075472 | |||
| 2653 | Ga0466957_0608401 | |||
| 2654 | Ga0466957_0732249 | |||
| 2655 | Ga0466957_1334854 | |||
| 2656 | Ga0466960_0887854 | |||
| 2657 | Ga0466959_0030393 | |||
| 2658 | Ga0466958_0020347 | |||
| 2659 | Ga0466958_0298961 | |||
| 2660 | Ga0466958_0655830 | |||
| 2661 | Ga0466967_1115467 | |||
| 2662 | Ga0466967_2500056 | |||
| 2663 | Ga0495627_084823 | |||
| 2664 | Ga0495627_099887 | |||
| 2665 | Ga0495590_0364510 | |||
| 2666 | Ga0495629_0842767 | |||
| 2667 | Ga0495638_0004617 | |||
| 2668 | Ga0495638_0038151 | |||
| 2669 | Ga0495638_0054219 | |||
| 2670 | Ga0495638_0502409 | |||
| 2671 | Ga0495638_0560184 | |||
| 2672 | Ga0495650_0001317 | |||
| 2673 | Ga0495639_0309034 | |||
| 2674 | Ga0495584_0111019 | |||
| 2675 | Ga0495585_0133334 | |||
| 2676 | Ga0495585_0277392 | |||
| 2677 | Ga0495585_0341219 | |||
| 2678 | Ga0495585_0588467 | |||
| 2679 | Ga0495596_0175517 | |||
| 2680 | Ga0495607_0408716 | |||
| 2681 | Ga0495583_0000766 | |||
| 2682 | Ga0495583_0007683 | |||
| 2683 | Ga0495583_0063474 | |||
| 2684 | Ga0495583_0078340 | |||
| 2685 | Ga0495583_0082064 | |||
| 2686 | Ga0495583_0278645 | |||
| 2687 | Ga0495606_0023498 | |||
| 2688 | Ga0495606_0042086 | |||
| 2689 | Ga0495606_0097880 | |||
| 2690 | Ga0495606_0214158 | |||
| 2691 | Ga0495606_0545327 | |||
| 2692 | Ga0495610_0371230 | |||
| 2693 | Ga0495616_0129000 | |||
| 2694 | Ga0495616_0373886 | |||
| 2695 | Ga0495620_0132850 | |||
| 2696 | Ga0495631_0046334 | |||
| 2697 | Ga0495631_0474017 | |||
| 2698 | Ga0495632_0206744 | |||
| 2699 | Ga0495632_0367474 | |||
| 2700 | Ga0495632_0462517 | |||
| 2701 | Ga0495637_0118426 | |||
| 2702 | Ga0495637_0123343 | |||
| 2703 | Ga0495643_0008456 | |||
| 2704 | Ga0495643_0011725 | |||
| 2705 | Ga0495643_0057255 | |||
| 2706 | Ga0495643_0449081 | |||
| 2707 | Ga0495643_0460848 | |||
| 2708 | Ga0495648_0000507 | |||
| 2709 | Ga0495648_0166532 | |||
| 2710 | Ga0495648_0338835 | |||
| 2711 | Ga0495663_0002619 | |||
| 2712 | Ga0495663_0123542 | |||
| 2713 | Ga0495642_0431045 | |||
| 2714 | Ga0495652_0326049 | |||
| 2715 | Ga0495654_0004604 | |||
| 2716 | Ga0495654_0036570 | |||
| 2717 | Ga0495654_0131481 | |||
| 2718 | Ga0495654_0342787 | |||
| 2719 | Ga0495654_0447958 | |||
| 2720 | Ga0495598_0008568 | |||
| 2721 | Ga0495609_0423917 | |||
| 2722 | Ga0495597_0063768 | |||
| 2723 | Ga0495597_0193287 | |||
| 2724 | Ga0495597_0425513 | |||
| 2725 | Ga0495622_0048141 | |||
| 2726 | Ga0495633_0028185 | |||
| 2727 | Ga0495633_0070471 | |||
| 2728 | Ga0495668_0000015 | |||
| 2729 | Ga0495668_0000016 | |||
| 2730 | Ga0495668_0019898 | |||
| 2731 | Ga0495668_0033266 | |||
| 2732 | Ga0495668_0311375 | |||
| 2733 | Ga0495668_0440036 | |||
| 2734 | Ga0495668_0556016 | |||
| 2735 | Ga0495668_0652397 | |||
| 2736 | Ga0495611_0020624 | |||
| 2737 | Ga0495611_0158187 | |||
| 2738 | Ga0495611_0296985 | |||
| 2739 | Ga0495611_0314971 | |||
| 2740 | Ga0495625_0000072 | |||
| 2741 | Ga0495625_0004430 | |||
| 2742 | Ga0495625_0007474 | |||
| 2743 | Ga0495625_0075318 | |||
| 2744 | Ga0495625_0169691 | |||
| 2745 | Ga0495625_0265515 | |||
| 2746 | Ga0495625_0269124 | |||
| 2747 | Ga0495625_0402133 | |||
| 2748 | Ga0495625_0555976 | |||
| 2749 | Ga0495625_0591105 | |||
| 2750 | Ga0495625_0665985 | |||
| 2751 | Ga0495661_0011622 | |||
| 2752 | Ga0495661_0116274 | |||
| 2753 | Ga0495661_0572121 | |||
| 2754 | Ga0495669_0000529 | |||
| 2755 | Ga0495613_0831096 | |||
| 2756 | Ga0495670_0000015 | |||
| 2757 | Ga0495670_0008829 | |||
| 2758 | Ga0495670_0015640 | |||
| 2759 | Ga0495670_0467011 | |||
| 2760 | Ga0495671_0063051 | |||
| 2761 | Ga0495649_0148846 | |||
| 2762 | Ga0495649_0249991 | |||
| 2763 | Ga0495649_0425440 | |||
| 2764 | Ga0495589_0133912 | |||
| 2765 | Ga0495600_0009109 | |||
| 2766 | Ga0495660_0430779 | |||
| 2767 | Ga0495683_0116301 | |||
| 2768 | Ga0495683_0122323 | |||
| 2769 | Ga0495687_000649 | |||
| 2770 | Ga0495687_004871 | |||
| 2771 | Ga0495687_062746 | |||
| 2772 | Ga0495677_0021122 | |||
| 2773 | Ga0495677_0036383 | |||
| 2774 | Ga0495673_0019216 | |||
| 2775 | Ga0495681_0011958 | |||
| 2776 | Ga0495681_0041622 | |||
| 2777 | Ga0495681_0309730 | |||
| 2778 | Ga0495686_0000530 | |||
| 2779 | Ga0495686_0000723 | |||
| 2780 | Ga0495686_0001008 | |||
| 2781 | Ga0495686_0024914 | |||
| 2782 | Ga0495686_0070575 | |||
| 2783 | Ga0495686_0182374 | |||
| 2784 | Ga0495686_0279442 | |||
| 2785 | Ga0495686_0659667 | |||
| 2786 | Ga0496100_0561651 | |||
| 2787 | Ga0496101_0915559 | |||
| 2788 | Ga0496102_0003035 | |||
| 2789 | Ga0496102_0003155 | |||
| 2790 | Ga0496102_0757323 | |||
| 2791 | Ga0496102_1378167 | |||
| 2792 | Ga0496102_1627729 | |||
| 2793 | Ga0496103_0000903 | |||
| 2794 | Ga0496103_0001742 | |||
| 2795 | Ga0496104_0082332 | |||
| 2796 | Ga0496105_0005151 | |||
| 2797 | Ga0496105_0197990 | |||
| 2798 | Ga0496106_0182822 | |||
| 2799 | Ga0496107_0194779 | |||
| 2800 | Ga0496107_0580837 | |||
| 2801 | Ga0496108_0519986 | |||
| 2802 | Ga0496108_1257974 | |||
| 2803 | Ga0496109_0296717 | |||
| 2804 | Ga0496109_0882846 | |||
| 2805 | Ga0496110_0774142 | |||
| 2806 | Ga0496111_0009790 | |||
| 2807 | Ga0496111_0129586 | |||
| 2808 | Ga0496111_1045338 | |||
| 2809 | Ga0496112_1451392 | |||
| 2810 | Ga0496113_0811620 | |||
| 2811 | Ga0496113_1336816 | |||
| 2812 | Ga0496114_0007549 | |||
| 2813 | Ga0496115_0002111 | |||
| 2814 | Ga0496115_0002506 | |||
| 2815 | Ga0496116_0024085 | |||
| 2816 | Ga0496116_0091775 | |||
| 2817 | Ga0496116_0483207 | |||
| 2818 | Ga0496117_0000324 | |||
| 2819 | Ga0496117_0005438 | |||
| 2820 | Ga0496117_0034695 | |||
| 2821 | Ga0496117_0062804 | |||
| 2822 | Ga0496117_0117705 | |||
| 2823 | Ga0496118_0002151 | |||
| 2824 | Ga0496118_0004152 | |||
| 2825 | Ga0496118_0017136 | |||
| 2826 | Ga0496118_0019807 | |||
| 2827 | Ga0496118_0117741 | |||
| 2828 | Ga0496119_0006610 | |||
| 2829 | Ga0496119_0047821 | |||
| 2830 | Ga0496119_0329689 | |||
| 2831 | Ga0496120_0093468 | |||
| 2832 | Ga0496120_0275078 | |||
| 2833 | Ga0496120_0439828 | |||
| 2834 | Ga0496121_0001314 | |||
| 2835 | Ga0496121_0002794 | |||
| 2836 | Ga0496121_0038248 | |||
| 2837 | Ga0496121_0040520 | |||
| 2838 | Ga0496121_0050670 | |||
| 2839 | Ga0496121_0052395 | |||
| 2840 | Ga0496121_0276551 | |||
| 2841 | Ga0496122_0001531 | |||
| 2842 | Ga0496122_0055074 | |||
| 2843 | Ga0496122_0112139 | |||
| 2844 | Ga0496122_0256430 | |||
| 2845 | Ga0496122_0360994 | |||
| 2846 | Ga0496123_0001418 | |||
| 2847 | Ga0496123_0016952 | |||
| 2848 | Ga0496123_0022246 | |||
| 2849 | Ga0496123_0070087 | |||
| 2850 | Ga0496123_0176423 | |||
| 2851 | Ga0496123_0294026 | |||
| 2852 | Ga0496123_0431617 | |||
| 2853 | Ga0496124_0000351 | |||
| 2854 | Ga0496124_0005829 | |||
| 2855 | Ga0496124_0014083 | |||
| 2856 | Ga0496124_0040538 | |||
| 2857 | Ga0496124_0052819 | |||
| 2858 | Ga0496124_0085511 | |||
| 2859 | Ga0496124_0744331 | |||
| 2860 | Ga0496125_0003470 | |||
| 2861 | Ga0496125_0198394 | |||
| 2862 | Ga0496125_0729088 | |||
| 2863 | Ga0496126_0002155 | |||
| 2864 | Ga0496126_0127852 | |||
| 2865 | Ga0496126_0304599 | |||
| 2866 | Ga0496126_0542348 | |||
| 2867 | Ga0496126_0609894 | |||
| 2868 | Ga0496126_0855323 | |||
| 2869 | Ga0496126_0886973 | |||
| 2870 | Ga0496126_1093170 | |||
| 2871 | Ga0496126_1276051 | |||
| 2872 | Ga0501306_063096 | |||
| 2873 | Ga0501308_086036 | |||
| 2874 | Ga0495678_068202 | |||
| 2875 | Ga0495678_088048 | |||
| 2876 | Ga0495682_0008950 | |||
| 2877 | Ga0501290_000352 | |||
| 2878 | Ga0501290_006382 | |||
| 2879 | Ga0501292_000088 | |||
| 2880 | Ga0501294_000241 | |||
| 2881 | Ga0501299_092320 | |||
| 2882 | Ga0501300_003094 | |||
| 2883 | Ga0501300_006532 | |||
| 2884 | Ga0501314_000002 | |||
| 2885 | Ga0501314_013552 | |||
| 2886 | Ga0501315_002307 | |||
| 2887 | Ga0501315_012821 | |||
| 2888 | Ga0501315_051550 | |||
| 2889 | Ga0501317_001577 | |||
| 2890 | Ga0501317_018595 | |||
| 2891 | Ga0501318_029866 | |||
| 2892 | Ga0501321_068786 | |||
| 2893 | Ga0501323_001589 | |||
| 2894 | Ga0501324_027655 | |||
| 2895 | Ga0501333_008957 | |||
| 2896 | Ga0501334_14279 | |||
| 2897 | Ga0501335_038136 | |||
| 2898 | Ga0501335_047919 | |||
| 2899 | Ga0501338_09186 | |||
| 2900 | Ga0501338_12382 | |||
| 2901 | Ga0501031_0035501 | |||
| 2902 | Ga0501032_0011615 | |||
| 2903 | Ga0501032_0901662 | |||
| 2904 | Ga0501033_0133191 | |||
| 2905 | Ga0501033_0649458 | |||
| 2906 | Ga0501034_0007538 | |||
| 2907 | Ga0501034_0027253 | |||
| 2908 | Ga0501034_0082782 | |||
| 2909 | Ga0501034_0647934 | |||
| 2910 | Ga0501034_0982730 | |||
| 2911 | Ga0501036_0050187 | |||
| 2912 | Ga0501036_1539549 | |||
| 2913 | Ga0501037_0046965 | |||
| 2914 | Ga0501038_0052443 | |||
| 2915 | Ga0501039_0005639 | |||
| 2916 | Ga0501043_0075885 | |||
| 2917 | Ga0501043_0885135 | |||
| 2918 | Ga0501046_0389609 | |||
| 2919 | Ga0501047_0032215 | |||
| 2920 | Ga0501047_0144807 | |||
| 2921 | Ga0501047_0427174 | |||
| 2922 | Ga0501047_0850754 | |||
| 2923 | Ga0501048_0109379 | |||
| 2924 | Ga0501069_0035055 | |||
| 2925 | Ga0501070_0027529 | |||
| 2926 | Ga0501071_1605970 | |||
| 2927 | Ga0501206_000112 | |||
| 2928 | Ga0501222_000376 | |||
| 2929 | Ga0501223_002540 | |||
| 2930 | Ga0501223_019504 | |||
| 2931 | Ga0501223_036026 | |||
| 2932 | Ga0501224_000009 | |||
| 2933 | Ga0501224_000219 | |||
| 2934 | Ga0501227_008045 | |||
| 2935 | Ga0501233_000279 | |||
| 2936 | Ga0501235_000736 | |||
| 2937 | Ga0501235_002385 | |||
| 2938 | Ga0501257_000052 | |||
| 2939 | Ga0501261_000417 | |||
| 2940 | Ga0501225_0000094 | |||
| 2941 | Ga0501241_025197 | |||
| 2942 | Ga0501276_009720 | |||
| 2943 | Ga0501279_000074 | |||
| 2944 | Ga0501280_000191 | |||
| 2945 | Ga0501280_012759 | |||
| 2946 | Ga0501281_00081 | |||
| 2947 | Ga0501282_000381 | |||
| 2948 | Ga0501282_001529 | |||
| 2949 | Ga0501035_0013966 | |||
| 2950 | Ga0501035_0492686 | |||
| 2951 | Ga0501035_0886643 | |||
| 2952 | Ga0501035_1498850 | |||
| 2953 | Ga0501044_0055624 | |||
| 2954 | Ga0501044_0102207 | |||
| 2955 | Ga0501044_0324206 | |||
| 2956 | Ga0501044_0633561 | |||
| 2957 | Ga0501045_0671437 | |||
| 2958 | Ga0501226_000076 | |||
| 2959 | nmdc:mga03683_313206_c1 | |||
| 2960 | nmdc:mga00v17_3387_c2 | |||
| 2961 | nmdc:mga00v17_538492_c1 | |||
| 2962 | nmdc:mga00v17_784798_c1 | |||
| 2963 | nmdc:mga0yw44_1193152_c1 | |||
| 2964 | nmdc:mga0k408_30694_c1 | |||
| 2965 | nmdc:mga0k408_398724_c1 | |||
| 2966 | nmdc:mga0k408_501721_c1 | |||
| 2967 | nmdc:mga0k408_748769_c1 | |||
| 2968 | nmdc:mga07m45_16117_c1 | |||
| 2969 | nmdc:mga07m45_186221_c1 | |||
| 2970 | nmdc:mga07m45_84920_c1 | |||
| 2971 | nmdc:mga05p37_847024_c1 | |||
| 2972 | nmdc:mga0qj67_1518855_c1 | |||
| 2973 | nmdc:mga0n895_418106_c1 | |||
| 2974 | nmdc:mga0n895_823850_c1 | |||
| 2975 | nmdc:mga0sz30_105445_c1 | |||
| 2976 | nmdc:mga0sz30_99383_c1 | |||
| 2977 | Ga0500610_0000216 | |||
| 2978 | Ga0500643_000134 | |||
| 2979 | Ga0500643_003488 | |||
| 2980 | Ga0500643_005556 | |||
| 2981 | Ga0500643_026980 | |||
| 2982 | Ga0500643_088711 | |||
| 2983 | Ga0500643_088712 | |||
| 2984 | Ga0500643_137458 | |||
| 2985 | Ga0500644_0260304 | |||
| 2986 | Ga0500646_0091936 | |||
| 2987 | Ga0500647_0213226 | |||
| 2988 | Ga0500651_0120217 | |||
| 2989 | Ga0500651_0352155 | |||
| 2990 | Ga0500566_0039514 | |||
| 2991 | Ga0500555_001780 | |||
| 2992 | Ga0500556_0246324 | |||
| 2993 | Ga0500556_0315331 | |||
| 2994 | Ga0500592_001405 | |||
| 2995 | Ga0500592_001411 | |||
| 2996 | Ga0500592_010909 | |||
| 2997 | Ga0500592_054166 | |||
| 2998 | Ga0500595_017021 | |||
| 2999 | Ga0500618_017029 | |||
| 3000 | Ga0500655_000265 | |||
| 3001 | Ga0500658_0004652 | |||
| 3002 | Ga0500658_0036311 | |||
| 3003 | Ga0500658_0070509 | |||
| 3004 | Ga0500658_0503432 | |||
| 3005 | Ga0500559_0343820 | |||
| 3006 | Ga0500568_0013737 | |||
| 3007 | Ga0500568_0022667 | |||
| 3008 | Ga0500568_0033063 | |||
| 3009 | Ga0500573_0000559 | |||
| 3010 | Ga0500573_0327745 | |||
| 3011 | Ga0500573_0409230 | |||
| 3012 | Ga0500573_0456536 | |||
| 3013 | Ga0500577_0504599 | |||
| 3014 | Ga0500590_004805 | |||
| 3015 | Ga0500604_0000014 | |||
| 3016 | Ga0500604_0017943 | |||
| 3017 | Ga0500604_0299102 | |||
| 3018 | Ga0500604_0315302 | |||
| 3019 | Ga0500616_0000591 | |||
| 3020 | Ga0500616_0030468 | |||
| 3021 | Ga0500616_0083831 | |||
| 3022 | Ga0500619_136027 | |||
| 3023 | Ga0500627_0000009 | |||
| 3024 | Ga0500627_0000899 | |||
| 3025 | Ga0500627_0027229 | |||
| 3026 | Ga0500627_0042078 | |||
| 3027 | Ga0500627_0378000 | |||
| 3028 | Ga0500636_0047080 | |||
| 3029 | Ga0500636_0539332 | |||
| 3030 | Ga0500645_000002 | |||
| 3031 | Ga0500645_162740 | |||
| 3032 | Ga0587084_022267 | |||
| 3033 | Ga0587084_041804 | |||
| 3034 | Ga0587070_116903 | |||
| 3035 | Ga0587077_060294 | |||
| 3036 | Ga0587077_085234 | |||
| 3037 | Ga0587077_106908 | |||
| 3038 | Ga0587077_188520 | |||
| 3039 | Ga0587090_135625 | |||
| 3040 | Ga0587098_014146 | |||
| 3041 | Ga0587106_030729 | |||
| 3042 | Ga0587101_102335 | |||
| 3043 | Ga0587062_043481 | |||
| 3044 | Ga0587069_047511 | |||
| 3045 | Ga0587072_051597 | |||
| 3046 | Ga0587076_052651 | |||
| 3047 | Ga0587078_042375 | |||
| 3048 | Ga0587102_016703 | |||
| 3049 | Ga0587107_030945 | |||
| 3050 | Ga0587108_025880 | |||
| 3051 | Ga0587071_088394 | |||
| 3052 | Ga0587111_0148151 | |||
| 3053 | Ga0587111_0211339 | |||
| 3054 | Ga0587111_0275893 | |||
| 3055 | Ga0501082_1880845 | |||
| 3056 | Ga0466962_0357974 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6enu-assembly1.cif.gz_Z | polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) | 0.9811 | 1 | 58 |
| 7ac7-assembly1.cif.gz_Z | structure of accomodated trans-translation complex on e. coli stalled ribosome. | 0.9794 | 4 | 58 |
| 8g34-assembly1.cif.gz_Z | time-resolved cryo-em study of the 70s recycling by the hflx:1st intermediate | 0.9768 | 1 | 58 |
| 7nhn-assembly1.cif.gz_3 | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9758 | 4 | 58 |
| 5kpw-assembly1.cif.gz_Y | structure of rela bound to ribosome in presence of a/r trna (structure iii) | 0.9752 | 1 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wfbW00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9767 | 2 | 58 | 3.30.1390.20 |
| 5hl7W00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9712 | 2 | 58 | 3.30.1390.20 |
| 4tomZ00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.969 | 1 | 58 | 3.30.1390.20 |
| af_B6SIL2_19_102_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9684 | 2 | 58 | 3.30.1390.20 |
| af_P9WHA3_1_65_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9655 | 1 | 57 | 3.30.1390.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y6YUC8-F1-model_v4 | Large ribosomal subunit protein uL30 | 1.008 | 2 | 58 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A212RIZ1-F1-model_v4 | Large ribosomal subunit protein uL30 | 1.007 | 2 | 58 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-Q98N39-F1-model_v4 | Large ribosomal subunit protein uL30 (50S ribosomal protein L30) | 1.006 | 3 | 58 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A849I581-F1-model_v4 | Large ribosomal subunit protein uL30 | 1.006 | 2 | 57 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-V4NU65-F1-model_v4 | Large ribosomal subunit protein uL30 | 1.005 | 2 | 58 |
GO:0003735
GO:0006412 GO:0022625 |