F494580

General Info

Members Datasets Scaffolds Average Seq Length
1528 508 3056 61

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101562058|Ga0070680_1015620581
Length 71
Sequence MAKIKIKQIGSPIRRTKDQRATLIGLGLNKMHKVSELEDTPEVRGMIRKLPHMVTIVINRRSTNRRPSSRT

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
133 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
134 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
151 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
158 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
165 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
170 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
247 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
275 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
279 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
280 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
281 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
282 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
283 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
284 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
285 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
286 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
287 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
288 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
289 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
290 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
291 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
292 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
293 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
294 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
295 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
296 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
297 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
298 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
299 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
300 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
301 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
302 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
303 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
304 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
305 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
306 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
307 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
308 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
311 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
312 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
313 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
314 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
319 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
320 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
321 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
328 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
331 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
332 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
336 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
340 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
341 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
342 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
343 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
344 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
345 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
346 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
347 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
348 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
351 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
352 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
353 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
357 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
360 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
363 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
364 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
365 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
366 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
367 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
368 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
369 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
370 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
371 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
375 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
386 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
387 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
388 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
391 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
392 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
393 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
394 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
404 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
405 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
406 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
407 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
408 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
409 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
410 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
437 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
438 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
439 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
440 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
441 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
442 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
443 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
444 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
445 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
446 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
447 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
448 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
449 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
450 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
451 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
456 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
460 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
461 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
462 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
463 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
464 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
465 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
466 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
467 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
468 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
469 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
470 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
471 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
472 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
473 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
474 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
475 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
476 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
477 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
478 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
479 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
480 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
481 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
482 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
483 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
484 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
485 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
486 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
487 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
488 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
489 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
490 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
508 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 3.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.24
Nodule 0
Rhizoplane 3.73
Rhizosphere 77.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_101562058 3300005336 Bacteria 572
2 ARcpr5oldR_c003367 3300000041 Bacteria 1422
3 ARcpr5yngRDRAFT_c000513 3300000043 Bacteria 4977
4 JGI24736J21556_1000064 3300001904 Bacteria 17271
5 JGI24736J21556_1009108 3300001904 Bacteria 1642
6 JGI24736J21556_1017419 3300001904 Bacteria 1140
7 JGI24741J21665_1001255 3300001915 Bacteria 7456
8 JGI24741J21665_1011514 3300001915 Bacteria 1543
9 JGI24752J21851_1000348 3300001976 Bacteria 6448
10 JGI24752J21851_1000507 3300001976 Bacteria 5227
11 JGI24740J21852_10001392 3300001979 Bacteria 11043
12 JGI24740J21852_10002955 3300001979 Bacteria 7552
13 JGI24740J21852_10036607 3300001979 Bacteria 1523
14 JGI24740J21852_10038021 3300001979 Bacteria 1480
15 JGI24740J21852_10120951 3300001979 Bacteria 656
16 JGI24739J22299_10003209 3300001989 Bacteria 6234
17 JGI24739J22299_10004443 3300001989 Bacteria 5373
18 JGI24739J22299_10009935 3300001989 Bacteria 3538
19 JGI24739J22299_10021051 3300001989 Bacteria 2325
20 JGI24739J22299_10029358 3300001989 Bacteria 1913
21 JGI24739J22299_10051500 3300001989 Bacteria 1328
22 JGI24739J22299_10134404 3300001989 Bacteria 735
23 JGI24739J22299_10157074 3300001989 Bacteria 672
24 JGI24737J22298_10001590 3300001990 Bacteria 8075
25 JGI24737J22298_10003732 3300001990 Bacteria 5360
26 JGI24737J22298_10027060 3300001990 Bacteria 1810
27 JGI24737J22298_10036959 3300001990 Bacteria 1506
28 JGI24737J22298_10041158 3300001990 Bacteria 1417
29 JGI24737J22298_10061695 3300001990 Bacteria 1127
30 JGI24737J22298_10068351 3300001990 Bacteria 1062
31 JGI24737J22298_10069519 3300001990 Bacteria 1052
32 JGI24737J22298_10085395 3300001990 Bacteria 938
33 JGI24737J22298_10117018 3300001990 Bacteria 788
34 JGI24743J22301_10122747 3300001991 Bacteria 570
35 JGI24735J21928_10001961 3300002067 Bacteria 7231
36 JGI24735J21928_10013354 3300002067 Bacteria 2584
37 JGI24735J21928_10020484 3300002067 Bacteria 2025
38 JGI24735J21928_10037139 3300002067 Bacteria 1428
39 JGI24735J21928_10050720 3300002067 Bacteria 1198
40 JGI24735J21928_10087919 3300002067 Bacteria 890
41 JGI24735J21928_10122964 3300002067 Bacteria 747
42 JGI24735J21928_10164286 3300002067 Bacteria 641
43 JGI24735J21928_10251458 3300002067 Bacteria 515
44 JGI24750J21931_1000199 3300002070 Bacteria 10095
45 JGI24748J21848_1000070 3300002074 Bacteria 36407
46 JGI24748J21848_1012787 3300002074 Bacteria 991
47 JGI24738J21930_10001288 3300002075 Bacteria 7018
48 JGI24738J21930_10004666 3300002075 Bacteria 3337
49 JGI24738J21930_10132714 3300002075 Bacteria 546
50 JGI24749J21850_1000118 3300002076 Bacteria 13310
51 JGI24744J21845_10005787 3300002077 Bacteria 2561
52 JGI24033J26618_1073154 3300002155 Bacteria 517
53 JGI24034J26672_10000038 3300002239 Bacteria 75372
54 JGI24034J26672_10012171 3300002239 Bacteria 1294
55 JGI24742J22300_10128925 3300002244 Bacteria 503
56 JGI24751J29686_10000379 3300002459 Bacteria 14986
57 JGI25157J39369_1026112 3300002741 Bacteria 679
58 JGI25152J39213_1045210 3300002773 Bacteria 597
59 JGI25150J39212_1000365 3300002774 Bacteria 21872
60 JGI25150J39212_1000837 3300002774 Bacteria 10314
61 JGI25151J46595_10029327 3300003187 Bacteria 2180
62 JGI25165J46597_1000021 3300003214 Bacteria 359288
63 JGI25165J46597_1000023 3300003214 Bacteria 338873
64 JGI25153J46596_10000173 3300003215 Bacteria 64195
65 JGI25153J46596_10001359 3300003215 Bacteria 14645
66 JGI25153J46596_10087839 3300003215 Bacteria 759
67 Ga0055525_1000012 3300003759 Bacteria 486564
68 Ga0055542_1000025 3300003762 Bacteria 263538
69 Ga0055542_1013672 3300003762 Bacteria 1358
70 Ga0055529_1000014 3300003763 Bacteria 367283
71 Ga0055529_1012053 3300003763 Bacteria 1109
72 Ga0055526_1001689 3300003771 Bacteria 15428
73 Ga0055537_1002389 3300003773 Bacteria 6339
74 Ga0055537_1013876 3300003773 Bacteria 1490
75 Ga0055524_1000320 3300003775 Bacteria 45185
76 Ga0055524_1000341 3300003775 Bacteria 42723
77 Ga0055536_1004136 3300003781 Bacteria 7522
78 Ga0055536_1024452 3300003781 Bacteria 1749
79 Ga0055536_1046965 3300003781 Bacteria 977
80 Ga0055534_1019454 3300003784 Bacteria 1164
81 Ga0055528_1076706 3300003790 Bacteria 594
82 Ga0055528_1078700 3300003790 Bacteria 582
83 Ga0055530_10001710 3300003791 Bacteria 15484
84 Ga0055530_10013813 3300003791 Bacteria 2732
85 Ga0055530_10014457 3300003791 Bacteria 2627
86 Ga0055530_10019749 3300003791 Bacteria 2033
87 Ga0055530_10026068 3300003791 Bacteria 1622
88 Ga0055540_1000723 3300003792 Bacteria 22522
89 Ga0055531_10002727 3300003794 Bacteria 11616
90 Ga0055531_10012970 3300003794 Bacteria 3879
91 Ga0055531_10025423 3300003794 Bacteria 2151
92 Ga0055531_10025502 3300003794 Bacteria 2143
93 Ga0055531_10032983 3300003794 Bacteria 1678
94 Ga0055531_10034125 3300003794 Bacteria 1622
95 Ga0055531_10041336 3300003794 Bacteria 1336
96 JGI25405J52794_10009841 3300003911 Bacteria 1812
97 Ga0055543_1014693 3300004625 Bacteria 1522
98 Ga0065165_1015699 3300005262 Bacteria 2876
99 Ga0065165_1069905 3300005262 Bacteria 935
100 Ga0065165_1094332 3300005262 Bacteria 757
101 Ga0065165_1167928 3300005262 Bacteria 503
102 Ga0065714_10315197 3300005288 Bacteria 676
103 Ga0065704_10278800 3300005289 Bacteria 927
104 Ga0065704_10314217 3300005289 Bacteria 863
105 Ga0065715_10782746 3300005293 Bacteria 617
106 Ga0065707_10000576 3300005295 Bacteria 23548
107 Ga0065707_10091874 3300005295 Bacteria 3866
108 Ga0065707_10211558 3300005295 Bacteria 1259
109 Ga0065707_10274776 3300005295 Bacteria 1057
110 Ga0065707_10452404 3300005295 Bacteria 799
111 Ga0070658_10001786 3300005327 Bacteria 18103
112 Ga0070658_10010598 3300005327 Bacteria 7384
113 Ga0070658_10293600 3300005327 Bacteria 1385
114 Ga0070658_10340516 3300005327 Bacteria 1283
115 Ga0070658_10441688 3300005327 Bacteria 1120
116 Ga0070658_10517219 3300005327 Bacteria 1032
117 Ga0070658_10661252 3300005327 Bacteria 907
118 Ga0070658_10829423 3300005327 Bacteria 803
119 Ga0070658_10947640 3300005327 Bacteria 748
120 Ga0070676_10209264 3300005328 Bacteria 1283
121 Ga0070676_10323450 3300005328 Bacteria 1052
122 Ga0070683_100204503 3300005329 Bacteria 1875
123 Ga0070683_100277426 3300005329 Bacteria 1595
124 Ga0070683_101594646 3300005329 Bacteria 628
125 Ga0070683_102166812 3300005329 Bacteria 534
126 Ga0070690_100000097 3300005330 Bacteria 44576
127 Ga0070670_100000075 3300005331 Bacteria 97494
128 Ga0070670_100000093 3300005331 Bacteria 84800
129 Ga0070670_100010675 3300005331 Bacteria 7846
130 Ga0070670_100093304 3300005331 Bacteria 2589
131 Ga0070670_100687098 3300005331 Bacteria 920
132 Ga0070677_10069925 3300005333 Bacteria 1474
133 Ga0070677_10083489 3300005333 Bacteria 1373
134 Ga0068869_100000029 3300005334 Bacteria 61111
135 Ga0068869_100056174 3300005334 Bacteria 2871
136 Ga0068869_100556697 3300005334 Bacteria 964
137 Ga0068869_100619997 3300005334 Bacteria 915
138 Ga0068869_102032265 3300005334 Bacteria 516
139 Ga0070666_10000004 3300005335 Bacteria 372098
140 Ga0070666_10150584 3300005335 Bacteria 1623
141 Ga0070666_10514357 3300005335 Bacteria 869
142 Ga0070666_10788306 3300005335 Bacteria 699
143 Ga0070666_11000859 3300005335 Bacteria 620
144 Ga0070680_100021258 3300005336 Bacteria 5156
145 Ga0070680_100933788 3300005336 Bacteria 749
146 Ga0070682_100076023 3300005337 Bacteria 2161
147 Ga0070682_100710784 3300005337 Bacteria 807
148 Ga0068868_100003973 3300005338 Bacteria 10321
149 Ga0068868_100501188 3300005338 Bacteria 1063
150 Ga0068868_100841095 3300005338 Bacteria 831
151 Ga0068868_101749607 3300005338 Bacteria 586
152 Ga0070660_100016618 3300005339 Bacteria 5345
153 Ga0070660_100061300 3300005339 Bacteria 2921
154 Ga0070660_100125410 3300005339 Bacteria 2051
155 Ga0070660_100173748 3300005339 Bacteria 1741
156 Ga0070660_100240844 3300005339 Bacteria 1473
157 Ga0070660_100286815 3300005339 Bacteria 1348
158 Ga0070660_100559437 3300005339 Bacteria 954
159 Ga0070660_100594981 3300005339 Bacteria 925
160 Ga0070689_100050883 3300005340 Bacteria 3201
161 Ga0070689_100919983 3300005340 Bacteria 774
162 Ga0070691_10456170 3300005341 Bacteria 731
163 Ga0070687_100420059 3300005343 Bacteria 882
164 Ga0070661_100020393 3300005344 Bacteria 4726
165 Ga0070661_100031335 3300005344 Bacteria 3845
166 Ga0070661_100230723 3300005344 Bacteria 1422
167 Ga0070661_100377865 3300005344 Bacteria 1116
168 Ga0070661_100808839 3300005344 Bacteria 769
169 Ga0070661_100862778 3300005344 Bacteria 746
170 Ga0070661_101126156 3300005344 Bacteria 654
171 Ga0070692_10841793 3300005345 Bacteria 630
172 Ga0070668_100000831 3300005347 Bacteria 21324
173 Ga0070668_100017594 3300005347 Bacteria 5360
174 Ga0070668_100719613 3300005347 Bacteria 881
175 Ga0070668_100732995 3300005347 Bacteria 874
176 Ga0070669_100000115 3300005353 Bacteria 75928
177 Ga0070669_100000296 3300005353 Bacteria 39004
178 Ga0070669_100854356 3300005353 Bacteria 776
179 Ga0070669_100934560 3300005353 Bacteria 742
180 Ga0070669_100991154 3300005353 Bacteria 721
181 Ga0070675_100098854 3300005354 Bacteria 2455
182 Ga0070675_100126421 3300005354 Bacteria 2175
183 Ga0070675_101302178 3300005354 Bacteria 670
184 Ga0070671_100024172 3300005355 Bacteria 4973
185 Ga0070671_100145848 3300005355 Bacteria 1998
186 Ga0070671_100287990 3300005355 Bacteria 1398
187 Ga0070671_100436300 3300005355 Bacteria 1123
188 Ga0070671_100488119 3300005355 Bacteria 1059
189 Ga0070671_100615864 3300005355 Bacteria 939
190 Ga0070674_100058209 3300005356 Bacteria 2685
191 Ga0070674_100829410 3300005356 Bacteria 800
192 Ga0070674_100861718 3300005356 Bacteria 786
193 Ga0070673_100000019 3300005364 Bacteria 107024
194 Ga0070673_100286720 3300005364 Bacteria 1446
195 Ga0070673_101102375 3300005364 Bacteria 742
196 Ga0070673_101841538 3300005364 Bacteria 573
197 Ga0070673_102297973 3300005364 Bacteria 513
198 Ga0070688_100004740 3300005365 Bacteria 7107
199 Ga0070688_100955353 3300005365 Bacteria 679
200 Ga0070659_100095005 3300005366 Bacteria 2394
201 Ga0070659_100140885 3300005366 Bacteria 1963
202 Ga0070659_100221271 3300005366 Bacteria 1562
203 Ga0070659_100222739 3300005366 Bacteria 1557
204 Ga0070659_100246930 3300005366 Bacteria 1478
205 Ga0070659_100704189 3300005366 Bacteria 873
206 Ga0070659_101377798 3300005366 Bacteria 626
207 Ga0070659_101819905 3300005366 Bacteria 545
208 Ga0070659_102069681 3300005366 Bacteria 512
209 Ga0070667_100000039 3300005367 Bacteria 170228
210 Ga0070667_100013671 3300005367 Bacteria 6708
211 Ga0070667_100044820 3300005367 Bacteria 3716
212 Ga0070667_100188643 3300005367 Bacteria 1825
213 Ga0070667_101768041 3300005367 Bacteria 582
214 Ga0070667_102150848 3300005367 Bacteria 526
215 Ga0070710_10640199 3300005437 Bacteria 744
216 Ga0070701_10673112 3300005438 Bacteria 693
217 Ga0070694_101003286 3300005444 Bacteria 693
218 Ga0070663_100081755 3300005455 Bacteria 2375
219 Ga0070663_100148712 3300005455 Bacteria 1794
220 Ga0070663_100225700 3300005455 Bacteria 1473
221 Ga0070663_100420899 3300005455 Bacteria 1095
222 Ga0070663_100669376 3300005455 Bacteria 880
223 Ga0070678_100006601 3300005456 Bacteria 6820
224 Ga0070678_100040527 3300005456 Bacteria 3296
225 Ga0070678_101189213 3300005456 Bacteria 707
226 Ga0070678_101574103 3300005456 Bacteria 617
227 Ga0070662_100020163 3300005457 Bacteria 4537
228 Ga0070662_100024536 3300005457 Bacteria 4155
229 Ga0070662_100044582 3300005457 Bacteria 3177
230 Ga0070662_100358188 3300005457 Bacteria 1196
231 Ga0070662_100377085 3300005457 Bacteria 1167
232 Ga0070662_100436172 3300005457 Bacteria 1085
233 Ga0070662_100519772 3300005457 Bacteria 994
234 Ga0070662_100811721 3300005457 Bacteria 795
235 Ga0070662_101285102 3300005457 Bacteria 630
236 Ga0070662_101615296 3300005457 Bacteria 560
237 Ga0070662_101777111 3300005457 Bacteria 533
238 Ga0070662_101986251 3300005457 Bacteria 503
239 Ga0070681_10078394 3300005458 Bacteria 3261
240 Ga0070681_10131424 3300005458 Bacteria 2436
241 Ga0068867_100000014 3300005459 Bacteria 112097
242 Ga0068867_100083516 3300005459 Bacteria 2411
243 Ga0068867_101459937 3300005459 Bacteria 636
244 Ga0070685_10000806 3300005466 Bacteria 17034
245 Ga0070706_101846410 3300005467 Bacteria 549
246 Ga0070679_100000873 3300005530 Bacteria 26175
247 Ga0070679_100651895 3300005530 Bacteria 995
248 Ga0070679_101959785 3300005530 Bacteria 535
249 Ga0070684_100136074 3300005535 Bacteria 2219
250 Ga0070684_100204115 3300005535 Bacteria 1801
251 Ga0070684_101536557 3300005535 Bacteria 627
252 Ga0068853_100000960 3300005539 Bacteria 20266
253 Ga0068853_100202129 3300005539 Bacteria 1808
254 Ga0068853_100282094 3300005539 Bacteria 1531
255 Ga0068853_100306801 3300005539 Bacteria 1468
256 Ga0068853_100337575 3300005539 Bacteria 1399
257 Ga0068853_100618322 3300005539 Bacteria 1030
258 Ga0068853_100656641 3300005539 Bacteria 998
259 Ga0068853_101091271 3300005539 Bacteria 769
260 Ga0068853_102037210 3300005539 Bacteria 557
261 Ga0070672_100182037 3300005543 Bacteria 1751
262 Ga0070672_100534380 3300005543 Bacteria 1017
263 Ga0070686_100000061 3300005544 Bacteria 83811
264 Ga0070686_100006821 3300005544 Bacteria 6358
265 Ga0070686_100561102 3300005544 Bacteria 895
266 Ga0070686_101857804 3300005544 Bacteria 513
267 Ga0070693_100211135 3300005547 Bacteria 1267
268 Ga0070693_100435491 3300005547 Bacteria 917
269 Ga0070693_100802929 3300005547 Bacteria 698
270 Ga0070665_100000004 3300005548 Bacteria 785500
271 Ga0070665_100000109 3300005548 Bacteria 155026
272 Ga0070665_100001527 3300005548 Bacteria 26808
273 Ga0070665_100010005 3300005548 Bacteria 9595
274 Ga0070665_100126607 3300005548 Bacteria 2557
275 Ga0070665_100255203 3300005548 Bacteria 1754
276 Ga0070665_100429143 3300005548 Bacteria 1331
277 Ga0070665_101247662 3300005548 Bacteria 754
278 Ga0068855_100010206 3300005563 Bacteria 11321
279 Ga0068855_100237795 3300005563 Bacteria 2036
280 Ga0068855_100361015 3300005563 Bacteria 1598
281 Ga0068855_100456541 3300005563 Bacteria 1394
282 Ga0068855_100491032 3300005563 Bacteria 1335
283 Ga0068855_100508392 3300005563 Bacteria 1308
284 Ga0068855_100822833 3300005563 Bacteria 986
285 Ga0068855_100855046 3300005563 Bacteria 964
286 Ga0068855_101257490 3300005563 Bacteria 768
287 Ga0068855_102579830 3300005563 Bacteria 504
288 Ga0070664_100063876 3300005564 Bacteria 3139
289 Ga0070664_100145529 3300005564 Bacteria 2089
290 Ga0070664_100698762 3300005564 Bacteria 945
291 Ga0070664_101529857 3300005564 Bacteria 631
292 Ga0070664_101765256 3300005564 Bacteria 587
293 Ga0068857_100055851 3300005577 Bacteria 3503
294 Ga0068857_100060023 3300005577 Bacteria 3379
295 Ga0068857_100066375 3300005577 Bacteria 3210
296 Ga0068857_100167943 3300005577 Bacteria 1993
297 Ga0068857_100233827 3300005577 Bacteria 1681
298 Ga0068857_101240083 3300005577 Bacteria 723
299 Ga0068857_101884696 3300005577 Bacteria 586
300 Ga0068854_100031424 3300005578 Bacteria 3689
301 Ga0068854_100051084 3300005578 Bacteria 2961
302 Ga0068854_100074235 3300005578 Bacteria 2494
303 Ga0068854_100092457 3300005578 Bacteria 2253
304 Ga0068854_100410357 3300005578 Bacteria 1123
305 Ga0068854_100465647 3300005578 Bacteria 1058
306 Ga0068854_100845579 3300005578 Bacteria 801
307 Ga0068854_101759412 3300005578 Bacteria 568
308 Ga0068856_100060779 3300005614 Bacteria 3732
309 Ga0068856_100262174 3300005614 Bacteria 1743
310 Ga0068856_100338965 3300005614 Bacteria 1521
311 Ga0068856_100372649 3300005614 Bacteria 1446
312 Ga0068856_100443696 3300005614 Bacteria 1318
313 Ga0068856_100480227 3300005614 Bacteria 1264
314 Ga0068856_100620097 3300005614 Bacteria 1102
315 Ga0068852_100098053 3300005616 Bacteria 2638
316 Ga0068852_100185948 3300005616 Bacteria 1957
317 Ga0068852_100239696 3300005616 Bacteria 1732
318 Ga0068852_100262271 3300005616 Bacteria 1659
319 Ga0068852_100443711 3300005616 Bacteria 1283
320 Ga0068852_101031550 3300005616 Bacteria 842
321 Ga0068852_101812706 3300005616 Bacteria 632
322 Ga0068852_102499611 3300005616 Bacteria 537
323 Ga0068852_102720078 3300005616 Bacteria 514
324 Ga0068859_100001416 3300005617 Bacteria 24328
325 Ga0068859_100009835 3300005617 Bacteria 9655
326 Ga0068859_100058681 3300005617 Bacteria 3877
327 Ga0068859_100166281 3300005617 Bacteria 2286
328 Ga0068859_100173979 3300005617 Bacteria 2235
329 Ga0068859_100505472 3300005617 Bacteria 1304
330 Ga0068859_100798469 3300005617 Bacteria 1032
331 Ga0068864_100000016 3300005618 Bacteria 292454
332 Ga0068864_100000087 3300005618 Bacteria 98532
333 Ga0068864_100002567 3300005618 Bacteria 14987
334 Ga0068864_102434270 3300005618 Bacteria 530
335 Ga0068866_11085482 3300005718 Bacteria 573
336 Ga0068861_100000040 3300005719 Bacteria 59725
337 Ga0068861_100006640 3300005719 Bacteria 7896
338 Ga0068861_100635023 3300005719 Bacteria 984
339 Ga0068861_101939186 3300005719 Bacteria 586
340 Ga0068861_102125254 3300005719 Bacteria 562
341 Ga0068851_10010412 3300005834 Bacteria 4342
342 Ga0068851_10056665 3300005834 Bacteria 1999
343 Ga0068851_10329818 3300005834 Bacteria 883
344 Ga0068851_11038818 3300005834 Bacteria 518
345 Ga0068870_10096183 3300005840 Bacteria 1665
346 Ga0068870_10558785 3300005840 Bacteria 772
347 Ga0068863_100000013 3300005841 Bacteria 220357
348 Ga0068863_100000017 3300005841 Bacteria 207950
349 Ga0068863_100000033 3300005841 Bacteria 170238
350 Ga0068863_100008320 3300005841 Bacteria 10132
351 Ga0068863_100140643 3300005841 Bacteria 2307
352 Ga0068863_100234419 3300005841 Bacteria 1771
353 Ga0068863_100358661 3300005841 Bacteria 1421
354 Ga0068858_100000664 3300005842 Bacteria 35973
355 Ga0068858_100004566 3300005842 Bacteria 13557
356 Ga0068858_100708504 3300005842 Bacteria 980
357 Ga0068858_102283401 3300005842 Bacteria 535
358 Ga0068860_100000009 3300005843 Bacteria 372089
359 Ga0068860_100028829 3300005843 Bacteria 5342
360 Ga0068860_100053483 3300005843 Bacteria 3839
361 Ga0068860_100264367 3300005843 Bacteria 1678
362 Ga0068862_100000032 3300005844 Bacteria 179887
363 Ga0068862_100000040 3300005844 Bacteria 167832
364 Ga0068862_100000466 3300005844 Bacteria 43651
365 Ga0068862_100001446 3300005844 Bacteria 21877
366 Ga0068862_100105127 3300005844 Bacteria 2474
367 Ga0068862_101080627 3300005844 Bacteria 797
368 Ga0081455_10000215 3300005937 Bacteria 73808
369 Ga0081540_1013216 3300005983 Bacteria 5381
370 Ga0075364_10001520 3300006051 Bacteria 12625
371 Ga0075364_11177761 3300006051 Bacteria 520
372 Ga0075362_10167624 3300006177 Bacteria 1060
373 Ga0075369_10031638 3300006186 Bacteria 2235
374 Ga0075369_10084853 3300006186 Bacteria 1408
375 Ga0075369_10116166 3300006186 Bacteria 1209
376 Ga0075369_10337703 3300006186 Bacteria 706
377 Ga0075366_10130637 3300006195 Bacteria 1516
378 Ga0075366_10182388 3300006195 Bacteria 1275
379 Ga0075366_10233689 3300006195 Bacteria 1120
380 Ga0075366_10759202 3300006195 Bacteria 603
381 Ga0075366_11042173 3300006195 Bacteria 511
382 Ga0097621_100240098 3300006237 Bacteria 1584
383 Ga0097621_101343528 3300006237 Bacteria 676
384 Ga0097621_101467576 3300006237 Bacteria 647
385 Ga0097621_101723020 3300006237 Bacteria 597
386 Ga0097621_101868557 3300006237 Bacteria 573
387 Ga0097621_102103718 3300006237 Bacteria 540
388 Ga0075370_10008629 3300006353 Bacteria 5252
389 Ga0075370_10023057 3300006353 Bacteria 3424
390 Ga0075370_10412683 3300006353 Bacteria 811
391 Ga0075370_10664875 3300006353 Bacteria 633
392 Ga0075370_10676786 3300006353 Bacteria 627
393 Ga0068871_100261117 3300006358 Bacteria 1511
394 Ga0068871_100587711 3300006358 Bacteria 1012
395 Ga0068871_101186315 3300006358 Bacteria 716
396 Ga0075430_101078196 3300006846 Bacteria 662
397 Ga0075434_100255877 3300006871 Bacteria 1770
398 Ga0068865_100000018 3300006881 Bacteria 106975
399 Ga0097620_100001416 3300006931 Bacteria 24328
400 Ga0097620_100009835 3300006931 Bacteria 9655
401 Ga0097620_100058681 3300006931 Bacteria 3877
402 Ga0097620_100166292 3300006931 Bacteria 2286
403 Ga0097620_100173972 3300006931 Bacteria 2235
404 Ga0097620_100505473 3300006931 Bacteria 1304
405 Ga0097620_100798483 3300006931 Bacteria 1032
406 Ga0105251_10004716 3300009011 Bacteria 9147
407 Ga0105251_10155260 3300009011 Bacteria 1032
408 Ga0105244_10297884 3300009036 Bacteria 747
409 Ga0105240_10001116 3300009093 Bacteria 47225
410 Ga0105240_10024394 3300009093 Bacteria 7971
411 Ga0105240_10191747 3300009093 Bacteria 2403
412 Ga0105240_10610797 3300009093 Bacteria 1200
413 Ga0105240_10749955 3300009093 Bacteria 1061
414 Ga0105240_12393971 3300009093 Bacteria 546
415 Ga0105240_12490842 3300009093 Bacteria 535
416 Ga0105245_10002967 3300009098 Bacteria 15205
417 Ga0105245_10005275 3300009098 Bacteria 11352
418 Ga0105245_10406216 3300009098 Bacteria 1362
419 Ga0105245_11568913 3300009098 Bacteria 710
420 Ga0105247_10018821 3300009101 Bacteria 4146
421 Ga0105247_10086839 3300009101 Bacteria 1980
422 Ga0105247_10091941 3300009101 Bacteria 1927
423 Ga0114129_12342286 3300009147 Bacteria 640
424 Ga0105243_10000076 3300009148 Bacteria 110445
425 Ga0105243_10003106 3300009148 Bacteria 13657
426 Ga0105243_10358718 3300009148 Bacteria 1341
427 Ga0105243_10522486 3300009148 Bacteria 1129
428 Ga0105243_10693651 3300009148 Bacteria 992
429 Ga0105243_11675996 3300009148 Bacteria 664
430 Ga0105243_11796911 3300009148 Bacteria 644
431 Ga0105243_13135099 3300009148 Bacteria 500
432 Ga0105241_10004308 3300009174 Bacteria 10523
433 Ga0105241_10090211 3300009174 Bacteria 2417
434 Ga0105241_10407073 3300009174 Bacteria 1194
435 Ga0105241_10417038 3300009174 Bacteria 1181
436 Ga0105241_11874660 3300009174 Bacteria 587
437 Ga0105241_11879984 3300009174 Bacteria 586
438 Ga0105242_10009804 3300009176 Bacteria 7341
439 Ga0105242_11353886 3300009176 Bacteria 737
440 Ga0105248_10000021 3300009177 Bacteria 276159
441 Ga0105248_10003987 3300009177 Bacteria 16323
442 Ga0105248_10006062 3300009177 Bacteria 13270
443 Ga0105248_10008689 3300009177 Bacteria 11162
444 Ga0105248_10255282 3300009177 Bacteria 1973
445 Ga0105248_10504523 3300009177 Bacteria 1364
446 Ga0105237_10002858 3300009545 Bacteria 20999
447 Ga0105237_10011259 3300009545 Bacteria 9464
448 Ga0105237_10045964 3300009545 Bacteria 4393
449 Ga0105237_10082257 3300009545 Bacteria 3211
450 Ga0105237_10114196 3300009545 Bacteria 2693
451 Ga0105237_10200169 3300009545 Bacteria 1997
452 Ga0105237_10469740 3300009545 Bacteria 1264
453 Ga0105237_11204749 3300009545 Bacteria 764
454 Ga0105237_11486404 3300009545 Bacteria 684
455 Ga0105237_12270548 3300009545 Bacteria 552
456 Ga0105238_10103849 3300009551 Bacteria 2823
457 Ga0105238_10108749 3300009551 Bacteria 2754
458 Ga0105238_10138886 3300009551 Bacteria 2407
459 Ga0105238_10157495 3300009551 Bacteria 2246
460 Ga0105238_10214234 3300009551 Bacteria 1902
461 Ga0105238_10373621 3300009551 Bacteria 1416
462 Ga0105238_10421717 3300009551 Bacteria 1329
463 Ga0105238_10521037 3300009551 Bacteria 1191
464 Ga0105238_10541365 3300009551 Bacteria 1168
465 Ga0105238_10843372 3300009551 Bacteria 933
466 Ga0105238_11477082 3300009551 Bacteria 708
467 Ga0105238_12385496 3300009551 Bacteria 564
468 Ga0105238_12416452 3300009551 Bacteria 561
469 Ga0105238_12548021 3300009551 Bacteria 547
470 Ga0105238_12971625 3300009551 Bacteria 510
471 Ga0105249_10000006 3300009553 Bacteria 354449
472 Ga0105249_10000017 3300009553 Bacteria 277115
473 Ga0105249_10001881 3300009553 Bacteria 18180
474 Ga0105249_10203829 3300009553 Bacteria 1937
475 Ga0105249_10249779 3300009553 Bacteria 1758
476 Ga0105249_12218491 3300009553 Bacteria 622
477 Ga0105239_10000546 3300010375 Bacteria 53959
478 Ga0105239_10070988 3300010375 Bacteria 3826
479 Ga0105239_10379102 3300010375 Bacteria 1599
480 Ga0105239_11008231 3300010375 Bacteria 957
481 Ga0105239_11166215 3300010375 Bacteria 887
482 Ga0105239_12076595 3300010375 Bacteria 660
483 Ga0105239_12764741 3300010375 Bacteria 573
484 Ga0105239_13631876 3300010375 Bacteria 501
485 Ga0105246_10161931 3300011119 Bacteria 1705
486 Ga0105246_10588517 3300011119 Bacteria 959
487 Ga0105246_10851547 3300011119 Bacteria 813
488 Ga0105246_11219958 3300011119 Bacteria 693
489 Ga0157317_1023388 3300012475 Bacteria 564
490 Ga0157315_1007765 3300012508 Bacteria 879
491 Ga0157326_1079519 3300012513 Bacteria 534
492 Ga0157373_10081148 3300013100 Bacteria 2287
493 Ga0157373_10565416 3300013100 Bacteria 826
494 Ga0157373_10660838 3300013100 Bacteria 764
495 Ga0157373_10662801 3300013100 Bacteria 763
496 Ga0157373_10798128 3300013100 Bacteria 696
497 Ga0157373_11528879 3300013100 Bacteria 510
498 Ga0157371_10000059 3300013102 Bacteria 170541
499 Ga0157371_10089328 3300013102 Bacteria 2182
500 Ga0157371_10342701 3300013102 Bacteria 1087
501 Ga0157371_10606382 3300013102 Bacteria 815
502 Ga0157371_11339788 3300013102 Bacteria 555
503 Ga0157370_10327199 3300013104 Bacteria 1413
504 Ga0157370_10370331 3300013104 Bacteria 1320
505 Ga0157370_10415992 3300013104 Bacteria 1237
506 Ga0157370_10545838 3300013104 Bacteria 1063
507 Ga0157370_11249102 3300013104 Bacteria 670
508 Ga0157369_10073353 3300013105 Bacteria 3672
509 Ga0157369_10083235 3300013105 Bacteria 3422
510 Ga0157369_10211906 3300013105 Bacteria 2030
511 Ga0157369_10281167 3300013105 Bacteria 1733
512 Ga0157369_10298220 3300013105 Bacteria 1677
513 Ga0157369_10312143 3300013105 Bacteria 1635
514 Ga0157369_10444995 3300013105 Bacteria 1342
515 Ga0157369_10840300 3300013105 Bacteria 943
516 Ga0157369_11229243 3300013105 Bacteria 764
517 Ga0157369_11658669 3300013105 Bacteria 650
518 Ga0157369_12017709 3300013105 Bacteria 585
519 Ga0157369_12583312 3300013105 Bacteria 514
520 Ga0157374_10412425 3300013296 Bacteria 1349
521 Ga0157378_10000504 3300013297 Bacteria 37070
522 Ga0157378_10107742 3300013297 Bacteria 2550
523 Ga0157378_10539715 3300013297 Bacteria 1170
524 Ga0157378_10950271 3300013297 Bacteria 892
525 Ga0157378_11480740 3300013297 Bacteria 723
526 Ga0157378_11587366 3300013297 Bacteria 700
527 Ga0163162_10092290 3300013306 Bacteria 3111
528 Ga0163162_10421093 3300013306 Bacteria 1468
529 Ga0163162_11521886 3300013306 Bacteria 762
530 Ga0163162_12218841 3300013306 Bacteria 630
531 Ga0157372_10084779 3300013307 Bacteria 3592
532 Ga0157372_10573559 3300013307 Bacteria 1315
533 Ga0157372_11126859 3300013307 Bacteria 907
534 Ga0157372_11317178 3300013307 Bacteria 833
535 Ga0157372_11994999 3300013307 Bacteria 667
536 Ga0157372_12178074 3300013307 Bacteria 637
537 Ga0157375_10082591 3300013308 Bacteria 3255
538 Ga0157375_10446526 3300013308 Bacteria 1459
539 Ga0157375_11409902 3300013308 Bacteria 821
540 Ga0157375_13608339 3300013308 Bacteria 515
541 Ga0163163_10465584 3300014325 Bacteria 1325
542 Ga0163163_11563685 3300014325 Bacteria 721
543 Ga0163163_11777425 3300014325 Bacteria 677
544 Ga0163163_12645250 3300014325 Bacteria 559
545 Ga0157380_10000157 3300014326 Bacteria 39384
546 Ga0157380_10002166 3300014326 Bacteria 13178
547 Ga0157380_10006678 3300014326 Bacteria 8144
548 Ga0157380_10812507 3300014326 Bacteria 953
549 Ga0157380_11992912 3300014326 Bacteria 642
550 Ga0182008_10166668 3300014497 Bacteria 1111
551 Ga0157377_10082035 3300014745 Bacteria 1887
552 Ga0157377_10180500 3300014745 Bacteria 1327
553 Ga0157377_10583524 3300014745 Bacteria 795
554 Ga0157379_10001735 3300014968 Bacteria 18043
555 Ga0157379_10051816 3300014968 Bacteria 3664
556 Ga0157379_11466984 3300014968 Bacteria 663
557 Ga0157379_12505109 3300014968 Bacteria 516
558 Ga0157376_10000092 3300014969 Bacteria 68198
559 Ga0157376_10492886 3300014969 Bacteria 1203
560 Ga0157376_10716193 3300014969 Bacteria 1007
561 Ga0157376_11441483 3300014969 Bacteria 721
562 Ga0157376_11622424 3300014969 Bacteria 681
563 Ga0183360_10368 3300015689 Bacteria 1189
564 Ga0183363_1006 3300015690 Bacteria 400466
565 Ga0163161_10000208 3300017792 Bacteria 53837
566 Ga0163161_10144828 3300017792 Bacteria 1801
567 Ga0163161_10167645 3300017792 Bacteria 1678
568 Ga0163161_10541954 3300017792 Bacteria 953
569 Ga0163161_10943367 3300017792 Bacteria 733
570 Ga0197907_10274206 3300020069 Bacteria 875
571 Ga0206356_10317151 3300020070 Bacteria 1289
572 Ga0206349_1668694 3300020075 Bacteria 936
573 Ga0206353_11808888 3300020082 Bacteria 1435
574 Ga0213876_10016636 3300021384 Bacteria 3886
575 Ga0213875_10001626 3300021388 Bacteria 14182
576 Ga0209674_101560 3300025226 Bacteria 5818
577 Ga0209563_100030 3300025230 Bacteria 489259
578 Ga0207427_104026 3300025231 Bacteria 2681
579 Ga0209437_123370 3300025233 Bacteria 712
580 Ga0207425_1000049 3300025245 Bacteria 180735
581 Ga0207425_1011898 3300025245 Bacteria 2058
582 Ga0209646_1020951 3300025246 Bacteria 941
583 Ga0209646_1031500 3300025246 Bacteria 710
584 Ga0209026_1000352 3300025250 Bacteria 43432
585 Ga0209026_1013989 3300025250 Bacteria 1352
586 Ga0209026_1031029 3300025250 Bacteria 792
587 Ga0209677_105325 3300025253 Bacteria 3391
588 Ga0209148_1000011 3300025254 Bacteria 1196503
589 Ga0209148_1000243 3300025254 Bacteria 86896
590 Ga0209148_1005193 3300025254 Bacteria 3032
591 Ga0209129_1000471 3300025258 Bacteria 29587
592 Ga0209233_1000003 3300025261 Bacteria 1607366
593 Ga0209233_1000065 3300025261 Bacteria 387195
594 Ga0209233_1006188 3300025261 Bacteria 3877
595 Ga0209565_1000008 3300025263 Bacteria 774179
596 Ga0209565_1000985 3300025263 Bacteria 14637
597 Ga0209455_1000006 3300025272 Bacteria 1196503
598 Ga0209455_1002555 3300025272 Bacteria 6959
599 Ga0209455_1031389 3300025272 Bacteria 893
600 Ga0209673_1004450 3300025273 Bacteria 7501
601 Ga0209673_1023801 3300025273 Bacteria 2075
602 Ga0209675_1000104 3300025291 Bacteria 121249
603 Ga0209676_1000512 3300025292 Bacteria 61167
604 Ga0209676_1000807 3300025292 Bacteria 41068
605 Ga0209676_1001199 3300025292 Bacteria 27715
606 Ga0209676_1009827 3300025292 Bacteria 4068
607 Ga0209676_1021566 3300025292 Bacteria 2159
608 Ga0209676_1029229 3300025292 Bacteria 1705
609 Ga0209025_1000068 3300025294 Bacteria 294129
610 Ga0209025_1011083 3300025294 Bacteria 6006
611 Ga0209025_1050489 3300025294 Bacteria 1662
612 Ga0209564_1000335 3300025295 Bacteria 91079
613 Ga0209564_1016953 3300025295 Bacteria 2869
614 Ga0209564_1085619 3300025295 Bacteria 598
615 Ga0209758_1000001 3300025297 Bacteria 1981790
616 Ga0209758_1000004 3300025297 Bacteria 1375322
617 Ga0209758_1017731 3300025297 Bacteria 3525
618 Ga0209758_1169594 3300025297 Bacteria 534
619 Ga0209050_1000001 3300025298 Bacteria 3563507
620 Ga0209050_1000286 3300025298 Bacteria 106566
621 Ga0209050_1002774 3300025298 Bacteria 14045
622 Ga0209050_1003389 3300025298 Bacteria 11828
623 Ga0209050_1035962 3300025298 Bacteria 1455
624 Ga0209256_1000009 3300025299 Bacteria 922071
625 Ga0209256_1000010 3300025299 Bacteria 912110
626 Ga0207426_1140179 3300025302 Bacteria 575
627 Ga0209051_1000191 3300025303 Bacteria 108763
628 Ga0209051_1038886 3300025303 Bacteria 1726
629 Ga0209257_1000245 3300025304 Bacteria 125987
630 Ga0209257_1000321 3300025304 Bacteria 100476
631 Ga0209257_1000577 3300025304 Bacteria 61710
632 Ga0209257_1000597 3300025304 Bacteria 59900
633 Ga0209257_1003551 3300025304 Bacteria 13248
634 Ga0209257_1004959 3300025304 Bacteria 9760
635 Ga0209257_1016465 3300025304 Bacteria 2990
636 Ga0209257_1026884 3300025304 Bacteria 1928
637 Ga0209257_1028408 3300025304 Bacteria 1841
638 Ga0209257_1035933 3300025304 Bacteria 1527
639 Ga0207656_10004180 3300025321 Bacteria 5025
640 Ga0207656_10023916 3300025321 Bacteria 2465
641 Ga0207656_10229427 3300025321 Bacteria 904
642 Ga0207656_10302528 3300025321 Bacteria 792
643 Ga0207682_10001453 3300025893 Bacteria 10936
644 Ga0207682_10407906 3300025893 Bacteria 642
645 Ga0207682_10474015 3300025893 Bacteria 593
646 Ga0207692_10992207 3300025898 Bacteria 554
647 Ga0207642_10869034 3300025899 Bacteria 576
648 Ga0207710_10004955 3300025900 Bacteria 5769
649 Ga0207710_10008017 3300025900 Bacteria 4465
650 Ga0207710_10066752 3300025900 Bacteria 1642
651 Ga0207688_10302991 3300025901 Bacteria 977
652 Ga0207688_10449418 3300025901 Bacteria 803
653 Ga0207688_11080046 3300025901 Bacteria 506
654 Ga0207680_10000010 3300025903 Bacteria 414170
655 Ga0207680_10559990 3300025903 Bacteria 816
656 Ga0207680_10775750 3300025903 Bacteria 687
657 Ga0207680_10792934 3300025903 Bacteria 679
658 Ga0207680_11343394 3300025903 Bacteria 508
659 Ga0207647_10000069 3300025904 Bacteria 80952
660 Ga0207647_10009251 3300025904 Bacteria 7006
661 Ga0207647_10035876 3300025904 Bacteria 3155
662 Ga0207647_10068151 3300025904 Bacteria 2154
663 Ga0207647_10137710 3300025904 Bacteria 1432
664 Ga0207647_10168495 3300025904 Bacteria 1276
665 Ga0207645_10014111 3300025907 Bacteria 5353
666 Ga0207645_10021253 3300025907 Bacteria 4234
667 Ga0207645_10372006 3300025907 Bacteria 958
668 Ga0207705_10000084 3300025909 Bacteria 116809
669 Ga0207705_10000243 3300025909 Bacteria 53479
670 Ga0207705_10000511 3300025909 Bacteria 33036
671 Ga0207705_10002954 3300025909 Bacteria 12998
672 Ga0207705_10049162 3300025909 Bacteria 3035
673 Ga0207705_10841844 3300025909 Bacteria 711
674 Ga0207705_10862539 3300025909 Bacteria 702
675 Ga0207705_11032938 3300025909 Bacteria 634
676 Ga0207684_11444845 3300025910 Bacteria 561
677 Ga0207654_10000796 3300025911 Bacteria 17350
678 Ga0207654_10000810 3300025911 Bacteria 17231
679 Ga0207654_10195143 3300025911 Bacteria 1330
680 Ga0207707_10045078 3300025912 Bacteria 3843
681 Ga0207695_10000288 3300025913 Bacteria 125085
682 Ga0207695_10003496 3300025913 Bacteria 22050
683 Ga0207695_10006167 3300025913 Bacteria 15631
684 Ga0207695_10095035 3300025913 Bacteria 2986
685 Ga0207695_10103895 3300025913 Bacteria 2832
686 Ga0207695_10171402 3300025913 Bacteria 2096
687 Ga0207671_10002884 3300025914 Bacteria 17804
688 Ga0207671_10003173 3300025914 Bacteria 16603
689 Ga0207671_10003747 3300025914 Bacteria 14974
690 Ga0207671_10022700 3300025914 Bacteria 4741
691 Ga0207671_10182611 3300025914 Bacteria 1633
692 Ga0207671_10552124 3300025914 Bacteria 918
693 Ga0207660_10001492 3300025917 Bacteria 15752
694 Ga0207660_11185096 3300025917 Bacteria 622
695 Ga0207662_11065466 3300025918 Bacteria 574
696 Ga0207657_10028620 3300025919 Bacteria 5080
697 Ga0207657_10028866 3300025919 Bacteria 5055
698 Ga0207657_10028985 3300025919 Bacteria 5044
699 Ga0207657_10048886 3300025919 Bacteria 3690
700 Ga0207657_10085735 3300025919 Bacteria 2637
701 Ga0207657_10139728 3300025919 Bacteria 1979
702 Ga0207657_10214187 3300025919 Bacteria 1545
703 Ga0207657_10232634 3300025919 Bacteria 1473
704 Ga0207657_10276144 3300025919 Bacteria 1335
705 Ga0207657_10495134 3300025919 Bacteria 958
706 Ga0207657_10506335 3300025919 Bacteria 946
707 Ga0207657_10632222 3300025919 Bacteria 834
708 Ga0207649_10000212 3300025920 Bacteria 48063
709 Ga0207649_10003617 3300025920 Bacteria 8440
710 Ga0207649_10103905 3300025920 Bacteria 1886
711 Ga0207649_10197129 3300025920 Bacteria 1420
712 Ga0207649_10395053 3300025920 Bacteria 1033
713 Ga0207649_11186539 3300025920 Bacteria 603
714 Ga0207652_10000008 3300025921 Bacteria 286698
715 Ga0207652_10502029 3300025921 Bacteria 1092
716 Ga0207681_10000005 3300025923 Bacteria 555724
717 Ga0207681_10000197 3300025923 Bacteria 48475
718 Ga0207681_10684161 3300025923 Bacteria 852
719 Ga0207681_11150961 3300025923 Bacteria 652
720 Ga0207694_10002782 3300025924 Bacteria 14124
721 Ga0207694_10016018 3300025924 Bacteria 5657
722 Ga0207694_10049198 3300025924 Bacteria 3263
723 Ga0207694_10124310 3300025924 Bacteria 2062
724 Ga0207694_10363345 3300025924 Bacteria 1200
725 Ga0207694_10382618 3300025924 Bacteria 1168
726 Ga0207694_10659746 3300025924 Bacteria 881
727 Ga0207694_11014525 3300025924 Bacteria 702
728 Ga0207694_11894867 3300025924 Bacteria 500
729 Ga0207650_10000004 3300025925 Bacteria 743372
730 Ga0207650_10000069 3300025925 Bacteria 138442
731 Ga0207650_10068635 3300025925 Bacteria 2662
732 Ga0207650_10208243 3300025925 Bacteria 1570
733 Ga0207650_10218925 3300025925 Bacteria 1531
734 Ga0207659_10009064 3300025926 Bacteria 6208
735 Ga0207659_10396469 3300025926 Bacteria 1153
736 Ga0207659_11003722 3300025926 Bacteria 718
737 Ga0207659_11019975 3300025926 Bacteria 712
738 Ga0207687_10003114 3300025927 Bacteria 11241
739 Ga0207687_10079745 3300025927 Bacteria 2361
740 Ga0207687_10236428 3300025927 Bacteria 1446
741 Ga0207687_11118299 3300025927 Bacteria 677
742 Ga0207644_10000145 3300025931 Bacteria 50586
743 Ga0207644_10058536 3300025931 Bacteria 2785
744 Ga0207644_10163232 3300025931 Bacteria 1733
745 Ga0207644_10312997 3300025931 Bacteria 1268
746 Ga0207644_10611291 3300025931 Bacteria 906
747 Ga0207690_10004341 3300025932 Bacteria 8375
748 Ga0207690_10066595 3300025932 Bacteria 2468
749 Ga0207690_10075431 3300025932 Bacteria 2339
750 Ga0207690_10480941 3300025932 Bacteria 1002
751 Ga0207690_10666319 3300025932 Bacteria 854
752 Ga0207690_10725464 3300025932 Bacteria 818
753 Ga0207690_11366109 3300025932 Bacteria 592
754 Ga0207690_11450002 3300025932 Bacteria 574
755 Ga0207706_10022259 3300025933 Bacteria 5687
756 Ga0207706_10041508 3300025933 Bacteria 4079
757 Ga0207706_10180514 3300025933 Bacteria 1854
758 Ga0207706_10181057 3300025933 Bacteria 1851
759 Ga0207706_10229574 3300025933 Bacteria 1624
760 Ga0207706_10310239 3300025933 Bacteria 1374
761 Ga0207706_10344241 3300025933 Bacteria 1297
762 Ga0207706_10361163 3300025933 Bacteria 1262
763 Ga0207706_10702569 3300025933 Bacteria 864
764 Ga0207706_10946056 3300025933 Bacteria 726
765 Ga0207706_11181552 3300025933 Bacteria 636
766 Ga0207686_10004287 3300025934 Bacteria 7648
767 Ga0207686_10156000 3300025934 Bacteria 1595
768 Ga0207686_11396709 3300025934 Bacteria 576
769 Ga0207709_10000114 3300025935 Bacteria 124672
770 Ga0207709_10000246 3300025935 Bacteria 66685
771 Ga0207709_10462012 3300025935 Bacteria 983
772 Ga0207709_10550523 3300025935 Bacteria 907
773 Ga0207709_10703101 3300025935 Bacteria 809
774 Ga0207670_10017586 3300025936 Bacteria 4324
775 Ga0207670_11740647 3300025936 Bacteria 530
776 Ga0207669_10005822 3300025937 Bacteria 5575
777 Ga0207669_10017734 3300025937 Bacteria 3660
778 Ga0207669_10629947 3300025937 Bacteria 875
779 Ga0207669_10946787 3300025937 Bacteria 721
780 Ga0207704_10000008 3300025938 Bacteria 204682
781 Ga0207691_10125275 3300025940 Bacteria 2274
782 Ga0207691_10473191 3300025940 Bacteria 1065
783 Ga0207691_10492740 3300025940 Bacteria 1041
784 Ga0207691_11152377 3300025940 Bacteria 644
785 Ga0207691_11629418 3300025940 Bacteria 524
786 Ga0207711_10000025 3300025941 Bacteria 289972
787 Ga0207711_10001472 3300025941 Bacteria 21955
788 Ga0207711_10005846 3300025941 Bacteria 10390
789 Ga0207711_10006762 3300025941 Bacteria 9642
790 Ga0207711_10015720 3300025941 Bacteria 6277
791 Ga0207689_10000608 3300025942 Bacteria 34222
792 Ga0207689_10099854 3300025942 Bacteria 2385
793 Ga0207689_10280169 3300025942 Bacteria 1381
794 Ga0207689_10392332 3300025942 Bacteria 1156
795 Ga0207689_10716978 3300025942 Bacteria 844
796 Ga0207661_10236839 3300025944 Bacteria 1618
797 Ga0207661_10536130 3300025944 Bacteria 1071
798 Ga0207661_10638479 3300025944 Bacteria 978
799 Ga0207661_11430975 3300025944 Bacteria 634
800 Ga0207679_10050964 3300025945 Bacteria 3028
801 Ga0207679_10157897 3300025945 Bacteria 1854
802 Ga0207679_10378715 3300025945 Bacteria 1240
803 Ga0207679_11301270 3300025945 Bacteria 667
804 Ga0207679_11432425 3300025945 Bacteria 634
805 Ga0207667_10000002 3300025949 Bacteria 895662
806 Ga0207667_10000024 3300025949 Bacteria 355874
807 Ga0207667_10004183 3300025949 Bacteria 17730
808 Ga0207667_10206634 3300025949 Bacteria 2013
809 Ga0207667_10491059 3300025949 Bacteria 1246
810 Ga0207667_10553369 3300025949 Bacteria 1163
811 Ga0207667_10686476 3300025949 Bacteria 1027
812 Ga0207667_11598959 3300025949 Bacteria 620
813 Ga0207651_10000008 3300025960 Bacteria 204538
814 Ga0207651_10486602 3300025960 Bacteria 1064
815 Ga0207651_11659456 3300025960 Bacteria 576
816 Ga0207651_11838274 3300025960 Bacteria 545
817 Ga0207712_10000012 3300025961 Bacteria 392363
818 Ga0207712_10000014 3300025961 Bacteria 375393
819 Ga0207712_10005054 3300025961 Bacteria 8350
820 Ga0207712_10074681 3300025961 Bacteria 2448
821 Ga0207712_10124290 3300025961 Bacteria 1957
822 Ga0207668_10000113 3300025972 Bacteria 57453
823 Ga0207668_10017274 3300025972 Bacteria 4516
824 Ga0207668_10817192 3300025972 Bacteria 826
825 Ga0207668_11440424 3300025972 Bacteria 621
826 Ga0207668_11921966 3300025972 Bacteria 533
827 Ga0207640_10002027 3300025981 Bacteria 10944
828 Ga0207640_10013183 3300025981 Bacteria 4730
829 Ga0207640_10036573 3300025981 Bacteria 3084
830 Ga0207640_10100085 3300025981 Bacteria 2030
831 Ga0207640_10440941 3300025981 Bacteria 1071
832 Ga0207640_10608503 3300025981 Bacteria 926
833 Ga0207640_10998134 3300025981 Bacteria 736
834 Ga0207640_11205523 3300025981 Bacteria 673
835 Ga0207658_10000428 3300025986 Bacteria 39861
836 Ga0207658_10009141 3300025986 Bacteria 6722
837 Ga0207658_10010246 3300025986 Bacteria 6368
838 Ga0207658_11843379 3300025986 Bacteria 551
839 Ga0207677_10000091 3300026023 Bacteria 74163
840 Ga0207677_11302107 3300026023 Bacteria 667
841 Ga0207677_11497990 3300026023 Bacteria 623
842 Ga0207703_10002426 3300026035 Bacteria 16170
843 Ga0207703_10003828 3300026035 Bacteria 12502
844 Ga0207703_10994092 3300026035 Bacteria 805
845 Ga0207639_10003616 3300026041 Bacteria 10382
846 Ga0207639_10013397 3300026041 Bacteria 5739
847 Ga0207639_10020428 3300026041 Bacteria 4740
848 Ga0207639_10020539 3300026041 Bacteria 4728
849 Ga0207639_10041198 3300026041 Bacteria 3454
850 Ga0207639_10119130 3300026041 Bacteria 2166
851 Ga0207639_10200720 3300026041 Bacteria 1710
852 Ga0207639_10272272 3300026041 Bacteria 1486
853 Ga0207639_10307772 3300026041 Bacteria 1403
854 Ga0207639_11098996 3300026041 Bacteria 746
855 Ga0207639_11296198 3300026041 Bacteria 684
856 Ga0207678_10004876 3300026067 Bacteria 12048
857 Ga0207678_10016489 3300026067 Bacteria 6486
858 Ga0207678_10175338 3300026067 Bacteria 1831
859 Ga0207678_10301146 3300026067 Bacteria 1378
860 Ga0207678_10703703 3300026067 Bacteria 889
861 Ga0207678_10909510 3300026067 Bacteria 778
862 Ga0207702_10003021 3300026078 Bacteria 15630
863 Ga0207702_10005062 3300026078 Bacteria 11576
864 Ga0207702_10006302 3300026078 Bacteria 10251
865 Ga0207702_10153725 3300026078 Bacteria 2095
866 Ga0207702_10192692 3300026078 Bacteria 1884
867 Ga0207702_10210284 3300026078 Bacteria 1808
868 Ga0207702_10274235 3300026078 Bacteria 1592
869 Ga0207641_10000002 3300026088 Bacteria 981004
870 Ga0207641_10000036 3300026088 Bacteria 213165
871 Ga0207641_10000099 3300026088 Bacteria 122892
872 Ga0207641_10006011 3300026088 Bacteria 10288
873 Ga0207641_10112331 3300026088 Bacteria 2417
874 Ga0207641_10223420 3300026088 Bacteria 1747
875 Ga0207641_11260024 3300026088 Bacteria 740
876 Ga0207648_10000009 3300026089 Bacteria 204229
877 Ga0207648_10014717 3300026089 Bacteria 7220
878 Ga0207648_10603009 3300026089 Bacteria 1012
879 Ga0207648_10787837 3300026089 Bacteria 884
880 Ga0207676_10000006 3300026095 Bacteria 681936
881 Ga0207676_10000044 3300026095 Bacteria 161679
882 Ga0207676_10001345 3300026095 Bacteria 18261
883 Ga0207676_10922563 3300026095 Bacteria 857
884 Ga0207676_12417247 3300026095 Bacteria 522
885 Ga0207674_10017839 3300026116 Bacteria 7737
886 Ga0207674_10050570 3300026116 Bacteria 4245
887 Ga0207674_10066644 3300026116 Bacteria 3626
888 Ga0207674_10095821 3300026116 Bacteria 2953
889 Ga0207674_10197887 3300026116 Bacteria 1959
890 Ga0207674_10423883 3300026116 Bacteria 1286
891 Ga0207674_10536182 3300026116 Bacteria 1131
892 Ga0207674_11775389 3300026116 Bacteria 584
893 Ga0207674_12056820 3300026116 Bacteria 535
894 Ga0207675_100000157 3300026118 Bacteria 59865
895 Ga0207675_100001117 3300026118 Bacteria 26571
896 Ga0207675_100015082 3300026118 Bacteria 7210
897 Ga0207675_100318652 3300026118 Bacteria 1518
898 Ga0207675_102043211 3300026118 Bacteria 590
899 Ga0207683_10004633 3300026121 Bacteria 11856
900 Ga0207683_10006500 3300026121 Bacteria 10001
901 Ga0207683_10701972 3300026121 Bacteria 938
902 Ga0207683_11689544 3300026121 Bacteria 582
903 Ga0207698_10000496 3300026142 Bacteria 22942
904 Ga0207698_10002491 3300026142 Bacteria 10925
905 Ga0207698_10005844 3300026142 Bacteria 7643
906 Ga0207698_10215161 3300026142 Bacteria 1732
907 Ga0207698_10235827 3300026142 Bacteria 1664
908 Ga0207698_10308204 3300026142 Bacteria 1477
909 Ga0207698_10579932 3300026142 Bacteria 1103
910 Ga0207698_10826820 3300026142 Bacteria 930
911 Ga0207698_11144138 3300026142 Bacteria 792
912 Ga0209998_10068929 3300027717 Bacteria 843
913 Ga0209974_10058972 3300027876 Bacteria 1298
914 Ga0268266_10000009 3300028379 Bacteria 1097737
915 Ga0268266_10000015 3300028379 Bacteria 630629
916 Ga0268266_10000560 3300028379 Bacteria 51866
917 Ga0268266_10008365 3300028379 Bacteria 9202
918 Ga0268266_10157745 3300028379 Bacteria 2051
919 Ga0268266_10553148 3300028379 Bacteria 1103
920 Ga0268266_11113731 3300028379 Bacteria 764
921 Ga0268266_11854022 3300028379 Bacteria 577
922 Ga0268265_10000001 3300028380 Bacteria 1230727
923 Ga0268265_10000003 3300028380 Bacteria 949201
924 Ga0268265_10000047 3300028380 Bacteria 179354
925 Ga0268265_10000125 3300028380 Bacteria 96710
926 Ga0268265_10231745 3300028380 Bacteria 1623
927 Ga0268265_12333057 3300028380 Bacteria 542
928 Ga0268264_10000023 3300028381 Bacteria 471408
929 Ga0268264_10014193 3300028381 Bacteria 6550
930 Ga0268264_10074867 3300028381 Bacteria 2877
931 Ga0268264_10205367 3300028381 Bacteria 1805
932 Ga0268264_11672397 3300028381 Bacteria 647
933 Ga0307515_10341363 3300028794 Bacteria 1150
934 Ga0265338_10170208 3300028800 Bacteria 1672
935 Ga0314311_1129629 3300030733 Bacteria 894
936 Ga0316183_1101809 3300030742 Bacteria 3404
937 Ga0307513_10032777 3300031456 Bacteria 5852
938 Ga0307513_10259144 3300031456 Bacteria 1530
939 Ga0307513_10504297 3300031456 Bacteria 927
940 Ga0307513_10691202 3300031456 Bacteria 726
941 Ga0307513_10745609 3300031456 Bacteria 685
942 Ga0307408_100002738 3300031548 Bacteria 12231
943 Ga0307408_100999629 3300031548 Bacteria 771
944 Ga0307408_101455450 3300031548 Bacteria 646
945 Ga0307508_10004384 3300031616 Bacteria 13803
946 Ga0307405_10045306 3300031731 Bacteria 2694
947 Ga0307405_10064746 3300031731 Bacteria 2324
948 Ga0307405_10341476 3300031731 Bacteria 1151
949 Ga0307405_10464188 3300031731 Bacteria 1007
950 Ga0307405_10912860 3300031731 Bacteria 743
951 Ga0307405_11445527 3300031731 Bacteria 602
952 Ga0307405_11717863 3300031731 Bacteria 556
953 Ga0307405_11939894 3300031731 Bacteria 526
954 Ga0307413_10074350 3300031824 Bacteria 2152
955 Ga0307413_10267957 3300031824 Bacteria 1277
956 Ga0307413_10876998 3300031824 Bacteria 760
957 Ga0307413_10923106 3300031824 Bacteria 743
958 Ga0307413_10989766 3300031824 Bacteria 720
959 Ga0307413_11491805 3300031824 Bacteria 597
960 Ga0307410_10020800 3300031852 Bacteria 4023
961 Ga0307410_10182426 3300031852 Bacteria 1590
962 Ga0307410_10757338 3300031852 Bacteria 823
963 Ga0307410_11125492 3300031852 Bacteria 681
964 Ga0307406_10022639 3300031901 Bacteria 3730
965 Ga0307406_10040041 3300031901 Bacteria 2911
966 Ga0307406_10047398 3300031901 Bacteria 2708
967 Ga0307406_10198586 3300031901 Bacteria 1474
968 Ga0307406_10271505 3300031901 Bacteria 1288
969 Ga0307406_10409954 3300031901 Bacteria 1077
970 Ga0307406_10431566 3300031901 Bacteria 1052
971 Ga0307406_10900703 3300031901 Bacteria 753
972 Ga0307406_11616058 3300031901 Bacteria 573
973 Ga0307407_10050253 3300031903 Bacteria 2385
974 Ga0307407_10202991 3300031903 Bacteria 1330
975 Ga0307412_10000330 3300031911 Bacteria 30088
976 Ga0307412_10002114 3300031911 Bacteria 11025
977 Ga0307412_10005437 3300031911 Bacteria 7151
978 Ga0307412_10031479 3300031911 Bacteria 3351
979 Ga0307412_10032820 3300031911 Bacteria 3294
980 Ga0307412_10063499 3300031911 Bacteria 2491
981 Ga0307412_10069509 3300031911 Bacteria 2397
982 Ga0307412_10133634 3300031911 Bacteria 1806
983 Ga0307412_10731022 3300031911 Bacteria 852
984 Ga0307409_100075828 3300031995 Bacteria 2694
985 Ga0307409_101074060 3300031995 Bacteria 825
986 Ga0307409_101444973 3300031995 Bacteria 714
987 Ga0307416_100013642 3300032002 Bacteria 5533
988 Ga0307416_100024455 3300032002 Bacteria 4410
989 Ga0307416_100056646 3300032002 Bacteria 3165
990 Ga0307416_100228529 3300032002 Bacteria 1791
991 Ga0307416_100296789 3300032002 Bacteria 1603
992 Ga0307416_101661728 3300032002 Bacteria 744
993 Ga0307416_101971073 3300032002 Bacteria 687
994 Ga0307414_10000117 3300032004 Bacteria 56697
995 Ga0307414_10000371 3300032004 Bacteria 24637
996 Ga0307414_10031754 3300032004 Bacteria 3468
997 Ga0307414_10036610 3300032004 Bacteria 3278
998 Ga0307414_10115431 3300032004 Bacteria 2053
999 Ga0307414_10342652 3300032004 Bacteria 1280
1000 Ga0307414_10344197 3300032004 Bacteria 1277
1001 Ga0307414_10449790 3300032004 Bacteria 1129
1002 Ga0307414_10922789 3300032004 Bacteria 801
1003 Ga0307414_11157305 3300032004 Bacteria 715
1004 Ga0307414_12074244 3300032004 Bacteria 531
1005 Ga0307411_10069400 3300032005 Bacteria 2380
1006 Ga0307411_10182421 3300032005 Bacteria 1594
1007 Ga0307411_10227412 3300032005 Bacteria 1452
1008 Ga0307411_10249025 3300032005 Bacteria 1396
1009 Ga0307411_10877007 3300032005 Bacteria 796
1010 Ga0307415_100135597 3300032126 Bacteria 1871
1011 Ga0307415_100208297 3300032126 Bacteria 1558
1012 Ga0307415_101494312 3300032126 Bacteria 646
1013 Ga0307415_101576380 3300032126 Bacteria 630
1014 Ga0307510_10127422 3300033180 Bacteria 2230
1015 Ga0307510_10608921 3300033180 Bacteria 545
1016 Ga0373954_0204433 3300035118 Bacteria 970
1017 Ga0373931_0061226 3300035691 Bacteria 2029
1018 Ga0373935_0588072 3300035692 Bacteria 813
1019 Ga0373927_0041187 3300035695 Bacteria 2996
1020 Ga0373925_0449014 3300037068 Bacteria 1056
1021 Ga0395899_0116591 3300037312 Bacteria 1916
1022 Ga0395899_0134214 3300037312 Bacteria 1765
1023 Ga0395900_0232480 3300037418 Bacteria 1853
1024 Ga0395900_0265355 3300037418 Bacteria 1713
1025 Ga0395900_0549404 3300037418 Bacteria 1100
1026 Ga0395898_0804277 3300037466 Bacteria 880
1027 Ga0395905_0257057 3300037471 Bacteria 1631
1028 Ga0395905_0501499 3300037471 Bacteria 1114
1029 Ga0395905_0520966 3300037471 Bacteria 1089
1030 Ga0395905_1136521 3300037471 Bacteria 684
1031 Ga0436364_0957806 3300037853 Bacteria 2079
1032 Ga0436364_1065372 3300037853 Bacteria 196587
1033 Ga0436364_1253875 3300037853 Bacteria 646
1034 Ga0395901_0318284 3300038443 Bacteria 1610
1035 Ga0395901_0617526 3300038443 Bacteria 1091
1036 Ga0395901_0863371 3300038443 Bacteria 889
1037 Ga0237819_00478 3300038705 Bacteria 13587
1038 Ga0237816_01697 3300039145 Bacteria 1758
1039 Ga0436365_1056819 3300039437 Bacteria 544
1040 Ga0436365_1234023 3300039437 Bacteria 954
1041 Ga0436365_1437704 3300039437 Bacteria 4356
1042 Ga0436365_1495591 3300039437 Bacteria 728
1043 Ga0436362_0379666 3300039453 Bacteria 1169
1044 Ga0439436_0104422 3300041404 Bacteria 790
1045 Ga0439436_0166421 3300041404 Bacteria 624
1046 Ga0439439_0019879 3300041406 Bacteria 1668
1047 Ga0439461_0003935 3300041410 Bacteria 2463
1048 Ga0439461_0096709 3300041410 Bacteria 714
1049 Ga0439465_0004239 3300041413 Bacteria 4665
1050 Ga0439465_0005674 3300041413 Bacteria 3972
1051 Ga0439465_0042157 3300041413 Bacteria 1478
1052 Ga0451789_0548732 3300041443 Bacteria 552
1053 Ga0451790_23905 3300041444 Bacteria 890
1054 Ga0451791_0198074 3300041451 Bacteria 555
1055 Ga0451791_0638383 3300041451 Bacteria 513
1056 Ga0451791_0752784 3300041451 Bacteria 600
1057 Ga0451791_0863431 3300041451 Bacteria 652
1058 Ga0451797_1153188 3300041453 Bacteria 1021
1059 Ga0451795_0712337 3300041456 Bacteria 778
1060 Ga0451795_1707330 3300041456 Bacteria 970
1061 Ga0451795_1714707 3300041456 Bacteria 592
1062 Ga0451800_0368767 3300041459 Bacteria 523
1063 Ga0451802_0283989 3300041460 Bacteria 2618
1064 Ga0451802_0673154 3300041460 Bacteria 653
1065 Ga0451802_1024104 3300041460 Bacteria 545
1066 Ga0451802_2140950 3300041460 Bacteria 964
1067 Ga0451805_129527 3300041461 Bacteria 521
1068 Ga0451806_203876 3300041462 Bacteria 788
1069 Ga0451806_592453 3300041462 Bacteria 527
1070 Ga0451806_758294 3300041462 Bacteria 796
1071 Ga0451804_0246643 3300041463 Bacteria 672
1072 Ga0451804_0292217 3300041463 Bacteria 510
1073 Ga0451804_0477757 3300041463 Bacteria 504
1074 Ga0451807_0470631 3300041486 Bacteria 648
1075 Ga0451807_1170541 3300041486 Bacteria 851
1076 Ga0451807_1532452 3300041486 Bacteria 708
1077 Ga0451807_2302565 3300041486 Bacteria 1010
1078 Ga0451807_2545728 3300041486 Bacteria 947
1079 Ga0451807_2637162 3300041486 Bacteria 1229
1080 Ga0451833_1456891 3300041491 Bacteria 520
1081 Ga0451837_0903713 3300041494 Bacteria 504
1082 Ga0451837_1313285 3300041494 Bacteria 648
1083 Ga0451841_1289656 3300041498 Bacteria 510
1084 Ga0451845_0647259 3300041501 Bacteria 1089
1085 Ga0451843_0561276 3300041509 Bacteria 511
1086 Ga0451843_0868889 3300041509 Bacteria 503
1087 Ga0451855_0464587 3300041511 Bacteria 881
1088 Ga0451853_1470546 3300041512 Bacteria 620
1089 Ga0451853_1927772 3300041512 Bacteria 577
1090 Ga0451853_1977551 3300041512 Bacteria 1202
1091 Ga0439431_0003098 3300041997 Bacteria 3653
1092 Ga0439431_0139411 3300041997 Bacteria 684
1093 Ga0439445_0001259 3300042004 Bacteria 5489
1094 Ga0439445_0046001 3300042004 Bacteria 1169
1095 Ga0439445_0057073 3300042004 Bacteria 1063
1096 Ga0439445_0064378 3300042004 Bacteria 1006
1097 Ga0439445_0077090 3300042004 Bacteria 928
1098 Ga0439448_0001965 3300042005 Bacteria 5493
1099 Ga0439448_0021597 3300042005 Bacteria 1995
1100 Ga0439448_0034484 3300042005 Bacteria 1617
1101 Ga0439432_006259 3300042006 Bacteria 4257
1102 Ga0439450_143599 3300042008 Bacteria 623
1103 Ga0439452_041030 3300042010 Bacteria 1090
1104 Ga0439455_0003944 3300042012 Bacteria 2893
1105 Ga0439455_0064401 3300042012 Bacteria 976
1106 Ga0439462_0004404 3300042015 Bacteria 3435
1107 Ga0439462_0004785 3300042015 Bacteria 3319
1108 Ga0450894_038137 3300042131 Bacteria 685
1109 Ga0439446_0019699 3300042156 Bacteria 1898
1110 Ga0439458_0001028 3300042157 Bacteria 7126
1111 Ga0439458_0004227 3300042157 Bacteria 3315
1112 Ga0439434_0000103 3300042435 Bacteria 21899
1113 Ga0439434_0075974 3300042435 Bacteria 1062
1114 Ga0439464_0179423 3300042439 Bacteria 670
1115 Ga0450893_0027173 3300042532 Bacteria 1008
1116 Ga0466972_0022049 3300044658 Bacteria 3171
1117 Ga0466966_0224862 3300044684 Bacteria 1133
1118 Ga0466961_0076990 3300044693 Bacteria 2113
1119 Ga0466963_0015793 3300044694 Bacteria 4685
1120 Ga0466964_0641459 3300044706 Bacteria 586
1121 Ga0466971_0041189 3300044719 Bacteria 2074
1122 Ga0466971_0531987 3300044719 Bacteria 582
1123 Ga0466968_0457697 3300044735 Bacteria 631
1124 Ga0466970_0075472 3300044765 Bacteria 1816
1125 Ga0466957_0608401 3300044842 Bacteria 765
1126 Ga0466957_0732249 3300044842 Bacteria 699
1127 Ga0466957_1334854 3300044842 Bacteria 521
1128 Ga0466960_0887854 3300044901 Bacteria 543
1129 Ga0466959_0030393 3300045049 Bacteria 3999
1130 Ga0466958_0020347 3300045836 Bacteria 3868
1131 Ga0466958_0298961 3300045836 Bacteria 1033
1132 Ga0466958_0655830 3300045836 Bacteria 683
1133 Ga0466967_1115467 3300045976 Bacteria 786
1134 Ga0466967_2500056 3300045976 Bacteria 511
1135 Ga0495627_084823 3300046453 Bacteria 915
1136 Ga0495627_099887 3300046453 Bacteria 829
1137 Ga0495590_0364510 3300046457 Bacteria 551
1138 Ga0495629_0842767 3300046459 Bacteria 603
1139 Ga0495638_0004617 3300046460 Bacteria 10422
1140 Ga0495638_0038151 3300046460 Bacteria 3055
1141 Ga0495638_0054219 3300046460 Bacteria 2493
1142 Ga0495638_0502409 3300046460 Bacteria 610
1143 Ga0495638_0560184 3300046460 Bacteria 567
1144 Ga0495650_0001317 3300046471 Bacteria 25056
1145 Ga0495639_0309034 3300046475 Bacteria 789
1146 Ga0495584_0111019 3300046491 Bacteria 1387
1147 Ga0495585_0133334 3300046492 Bacteria 1305
1148 Ga0495585_0277392 3300046492 Bacteria 829
1149 Ga0495585_0341219 3300046492 Bacteria 729
1150 Ga0495585_0588467 3300046492 Bacteria 524
1151 Ga0495596_0175517 3300046500 Bacteria 833
1152 Ga0495607_0408716 3300046501 Bacteria 616
1153 Ga0495583_0000766 3300046506 Bacteria 40320
1154 Ga0495583_0007683 3300046506 Bacteria 6720
1155 Ga0495583_0063474 3300046506 Bacteria 1641
1156 Ga0495583_0078340 3300046506 Bacteria 1439
1157 Ga0495583_0082064 3300046506 Bacteria 1399
1158 Ga0495583_0278645 3300046506 Bacteria 667
1159 Ga0495606_0023498 3300046507 Bacteria 4464
1160 Ga0495606_0042086 3300046507 Bacteria 3058
1161 Ga0495606_0097880 3300046507 Bacteria 1791
1162 Ga0495606_0214158 3300046507 Bacteria 1089
1163 Ga0495606_0545327 3300046507 Bacteria 578
1164 Ga0495610_0371230 3300046512 Bacteria 534
1165 Ga0495616_0129000 3300046513 Bacteria 1160
1166 Ga0495616_0373886 3300046513 Bacteria 590
1167 Ga0495620_0132850 3300046515 Bacteria 976
1168 Ga0495631_0046334 3300046518 Bacteria 1912
1169 Ga0495631_0474017 3300046518 Bacteria 533
1170 Ga0495632_0206744 3300046519 Bacteria 892
1171 Ga0495632_0367474 3300046519 Bacteria 631
1172 Ga0495632_0462517 3300046519 Bacteria 549
1173 Ga0495637_0118426 3300046520 Bacteria 1021
1174 Ga0495637_0123343 3300046520 Bacteria 995
1175 Ga0495643_0008456 3300046522 Bacteria 6513
1176 Ga0495643_0011725 3300046522 Bacteria 5321
1177 Ga0495643_0057255 3300046522 Bacteria 2078
1178 Ga0495643_0449081 3300046522 Bacteria 561
1179 Ga0495643_0460848 3300046522 Bacteria 552
1180 Ga0495648_0000507 3300046524 Bacteria 41960
1181 Ga0495648_0166532 3300046524 Bacteria 1134
1182 Ga0495648_0338835 3300046524 Bacteria 691
1183 Ga0495663_0002619 3300046525 Bacteria 5363
1184 Ga0495663_0123542 3300046525 Bacteria 868
1185 Ga0495642_0431045 3300046528 Bacteria 582
1186 Ga0495652_0326049 3300046529 Bacteria 1108
1187 Ga0495654_0004604 3300046530 Bacteria 8143
1188 Ga0495654_0036570 3300046530 Bacteria 2467
1189 Ga0495654_0131481 3300046530 Bacteria 1123
1190 Ga0495654_0342787 3300046530 Bacteria 602
1191 Ga0495654_0447958 3300046530 Bacteria 508
1192 Ga0495598_0008568 3300046537 Bacteria 2387
1193 Ga0495609_0423917 3300046538 Bacteria 531
1194 Ga0495597_0063768 3300046542 Bacteria 1601
1195 Ga0495597_0193287 3300046542 Bacteria 818
1196 Ga0495597_0425513 3300046542 Bacteria 503
1197 Ga0495622_0048141 3300046557 Bacteria 1981
1198 Ga0495633_0028185 3300046558 Bacteria 2739
1199 Ga0495633_0070471 3300046558 Bacteria 1631
1200 Ga0495668_0000015 3300046616 Bacteria 441932
1201 Ga0495668_0000016 3300046616 Bacteria 438197
1202 Ga0495668_0019898 3300046616 Bacteria 3863
1203 Ga0495668_0033266 3300046616 Bacteria 2897
1204 Ga0495668_0311375 3300046616 Bacteria 863
1205 Ga0495668_0440036 3300046616 Bacteria 717
1206 Ga0495668_0556016 3300046616 Bacteria 633
1207 Ga0495668_0652397 3300046616 Bacteria 582
1208 Ga0495611_0020624 3300046648 Bacteria 2838
1209 Ga0495611_0158187 3300046648 Bacteria 1058
1210 Ga0495611_0296985 3300046648 Bacteria 745
1211 Ga0495611_0314971 3300046648 Bacteria 720
1212 Ga0495625_0000072 3300046660 Bacteria 166439
1213 Ga0495625_0004430 3300046660 Bacteria 13282
1214 Ga0495625_0007474 3300046660 Bacteria 9501
1215 Ga0495625_0075318 3300046660 Bacteria 2361
1216 Ga0495625_0169691 3300046660 Bacteria 1457
1217 Ga0495625_0265515 3300046660 Bacteria 1109
1218 Ga0495625_0269124 3300046660 Bacteria 1100
1219 Ga0495625_0402133 3300046660 Bacteria 855
1220 Ga0495625_0555976 3300046660 Bacteria 694
1221 Ga0495625_0591105 3300046660 Bacteria 667
1222 Ga0495625_0665985 3300046660 Bacteria 618
1223 Ga0495661_0011622 3300046665 Bacteria 5969
1224 Ga0495661_0116274 3300046665 Bacteria 1484
1225 Ga0495661_0572121 3300046665 Bacteria 533
1226 Ga0495669_0000529 3300046684 Bacteria 17238
1227 Ga0495613_0831096 3300046689 Bacteria 601
1228 Ga0495670_0000015 3300046691 Bacteria 131137
1229 Ga0495670_0008829 3300046691 Bacteria 4959
1230 Ga0495670_0015640 3300046691 Bacteria 3729
1231 Ga0495670_0467011 3300046691 Bacteria 684
1232 Ga0495671_0063051 3300046692 Bacteria 1826
1233 Ga0495649_0148846 3300046694 Bacteria 1230
1234 Ga0495649_0249991 3300046694 Bacteria 911
1235 Ga0495649_0425440 3300046694 Bacteria 665
1236 Ga0495589_0133912 3300046794 Bacteria 1189
1237 Ga0495600_0009109 3300046809 Bacteria 6121
1238 Ga0495660_0430779 3300046810 Bacteria 573
1239 Ga0495683_0116301 3300047323 Bacteria 1272
1240 Ga0495683_0122323 3300047323 Bacteria 1234
1241 Ga0495687_000649 3300047443 Bacteria 39837
1242 Ga0495687_004871 3300047443 Bacteria 8814
1243 Ga0495687_062746 3300047443 Bacteria 1524
1244 Ga0495677_0021122 3300047445 Bacteria 2360
1245 Ga0495677_0036383 3300047445 Bacteria 1798
1246 Ga0495673_0019216 3300047469 Bacteria 3427
1247 Ga0495681_0011958 3300047470 Bacteria 5128
1248 Ga0495681_0041622 3300047470 Bacteria 2229
1249 Ga0495681_0309730 3300047470 Bacteria 609
1250 Ga0495686_0000530 3300047472 Bacteria 54741
1251 Ga0495686_0000723 3300047472 Bacteria 44178
1252 Ga0495686_0001008 3300047472 Bacteria 34224
1253 Ga0495686_0024914 3300047472 Bacteria 3925
1254 Ga0495686_0070575 3300047472 Bacteria 2152
1255 Ga0495686_0182374 3300047472 Bacteria 1215
1256 Ga0495686_0279442 3300047472 Bacteria 928
1257 Ga0495686_0659667 3300047472 Bacteria 537
1258 Ga0496100_0561651 3300048903 Bacteria 884
1259 Ga0496101_0915559 3300048904 Bacteria 690
1260 Ga0496102_0003035 3300048905 Bacteria 14220
1261 Ga0496102_0003155 3300048905 Bacteria 13978
1262 Ga0496102_0757323 3300048905 Bacteria 894
1263 Ga0496102_1378167 3300048905 Bacteria 624
1264 Ga0496102_1627729 3300048905 Bacteria 564
1265 Ga0496103_0000903 3300048906 Bacteria 21301
1266 Ga0496103_0001742 3300048906 Bacteria 14206
1267 Ga0496104_0082332 3300048907 Bacteria 3069
1268 Ga0496105_0005151 3300048908 Bacteria 9912
1269 Ga0496105_0197990 3300048908 Bacteria 1640
1270 Ga0496106_0182822 3300048909 Bacteria 1665
1271 Ga0496107_0194779 3300048910 Bacteria 1506
1272 Ga0496107_0580837 3300048910 Bacteria 829
1273 Ga0496108_0519986 3300048911 Bacteria 1039
1274 Ga0496108_1257974 3300048911 Bacteria 624
1275 Ga0496109_0296717 3300048912 Bacteria 1524
1276 Ga0496109_0882846 3300048912 Bacteria 832
1277 Ga0496110_0774142 3300048913 Bacteria 863
1278 Ga0496111_0009790 3300048914 Bacteria 6408
1279 Ga0496111_0129586 3300048914 Bacteria 1866
1280 Ga0496111_1045338 3300048914 Bacteria 584
1281 Ga0496112_1451392 3300048915 Bacteria 600
1282 Ga0496113_0811620 3300048916 Bacteria 743
1283 Ga0496113_1336816 3300048916 Bacteria 556
1284 Ga0496114_0007549 3300048917 Bacteria 8603
1285 Ga0496115_0002111 3300048918 Bacteria 14223
1286 Ga0496115_0002506 3300048918 Bacteria 13194
1287 Ga0496116_0024085 3300048919 Bacteria 4511
1288 Ga0496116_0091775 3300048919 Bacteria 1844
1289 Ga0496116_0483207 3300048919 Bacteria 520
1290 Ga0496117_0000324 3300048920 Bacteria 83876
1291 Ga0496117_0005438 3300048920 Bacteria 13377
1292 Ga0496117_0034695 3300048920 Bacteria 3798
1293 Ga0496117_0062804 3300048920 Bacteria 2543
1294 Ga0496117_0117705 3300048920 Bacteria 1639
1295 Ga0496118_0002151 3300048921 Bacteria 27486
1296 Ga0496118_0004152 3300048921 Bacteria 17499
1297 Ga0496118_0017136 3300048921 Bacteria 6610
1298 Ga0496118_0019807 3300048921 Bacteria 6000
1299 Ga0496118_0117741 3300048921 Bacteria 1741
1300 Ga0496119_0006610 3300048922 Bacteria 10677
1301 Ga0496119_0047821 3300048922 Bacteria 2658
1302 Ga0496119_0329689 3300048922 Bacteria 745
1303 Ga0496120_0093468 3300048923 Bacteria 1602
1304 Ga0496120_0275078 3300048923 Bacteria 780
1305 Ga0496120_0439828 3300048923 Bacteria 569
1306 Ga0496121_0001314 3300048924 Bacteria 42592
1307 Ga0496121_0002794 3300048924 Bacteria 25864
1308 Ga0496121_0038248 3300048924 Bacteria 4253
1309 Ga0496121_0040520 3300048924 Bacteria 4084
1310 Ga0496121_0050670 3300048924 Bacteria 3504
1311 Ga0496121_0052395 3300048924 Bacteria 3428
1312 Ga0496121_0276551 3300048924 Bacteria 1151
1313 Ga0496122_0001531 3300048925 Bacteria 36790
1314 Ga0496122_0055074 3300048925 Bacteria 2979
1315 Ga0496122_0112139 3300048925 Bacteria 1786
1316 Ga0496122_0256430 3300048925 Bacteria 974
1317 Ga0496122_0360994 3300048925 Bacteria 754
1318 Ga0496123_0001418 3300048926 Bacteria 33502
1319 Ga0496123_0016952 3300048926 Bacteria 5884
1320 Ga0496123_0022246 3300048926 Bacteria 4893
1321 Ga0496123_0070087 3300048926 Bacteria 2196
1322 Ga0496123_0176423 3300048926 Bacteria 1121
1323 Ga0496123_0294026 3300048926 Bacteria 778
1324 Ga0496123_0431617 3300048926 Bacteria 591
1325 Ga0496124_0000351 3300048927 Bacteria 84021
1326 Ga0496124_0005829 3300048927 Bacteria 13673
1327 Ga0496124_0014083 3300048927 Bacteria 7755
1328 Ga0496124_0040538 3300048927 Bacteria 4026
1329 Ga0496124_0052819 3300048927 Bacteria 3451
1330 Ga0496124_0085511 3300048927 Bacteria 2584
1331 Ga0496124_0744331 3300048927 Bacteria 615
1332 Ga0496125_0003470 3300048928 Bacteria 19085
1333 Ga0496125_0198394 3300048928 Bacteria 1317
1334 Ga0496125_0729088 3300048928 Bacteria 522
1335 Ga0496126_0002155 3300048929 Bacteria 27384
1336 Ga0496126_0127852 3300048929 Bacteria 2198
1337 Ga0496126_0304599 3300048929 Bacteria 1313
1338 Ga0496126_0542348 3300048929 Bacteria 924
1339 Ga0496126_0609894 3300048929 Bacteria 859
1340 Ga0496126_0855323 3300048929 Bacteria 693
1341 Ga0496126_0886973 3300048929 Bacteria 677
1342 Ga0496126_1093170 3300048929 Bacteria 593
1343 Ga0496126_1276051 3300048929 Bacteria 536
1344 Ga0501306_063096 3300049127 Bacteria 613
1345 Ga0501308_086036 3300049128 Bacteria 506
1346 Ga0495678_068202 3300049459 Bacteria 1312
1347 Ga0495678_088048 3300049459 Bacteria 1100
1348 Ga0495682_0008950 3300049460 Bacteria 3927
1349 Ga0501290_000352 3300049513 Bacteria 7476
1350 Ga0501290_006382 3300049513 Bacteria 1477
1351 Ga0501292_000088 3300049515 Bacteria 16990
1352 Ga0501294_000241 3300049517 Bacteria 6800
1353 Ga0501299_092320 3300049522 Bacteria 690
1354 Ga0501300_003094 3300049523 Bacteria 2482
1355 Ga0501300_006532 3300049523 Bacteria 1714
1356 Ga0501314_000002 3300049530 Bacteria 13192
1357 Ga0501314_013552 3300049530 Bacteria 791
1358 Ga0501315_002307 3300049531 Bacteria 1774
1359 Ga0501315_012821 3300049531 Bacteria 1042
1360 Ga0501315_051550 3300049531 Bacteria 647
1361 Ga0501317_001577 3300049533 Bacteria 1992
1362 Ga0501317_018595 3300049533 Bacteria 920
1363 Ga0501318_029866 3300049534 Bacteria 737
1364 Ga0501321_068786 3300049537 Bacteria 547
1365 Ga0501323_001589 3300049539 Bacteria 2057
1366 Ga0501324_027655 3300049540 Bacteria 607
1367 Ga0501333_008957 3300049549 Bacteria 697
1368 Ga0501334_14279 3300049550 Bacteria 601
1369 Ga0501335_038136 3300049551 Bacteria 560
1370 Ga0501335_047919 3300049551 Bacteria 516
1371 Ga0501338_09186 3300049554 Bacteria 655
1372 Ga0501338_12382 3300049554 Bacteria 589
1373 Ga0501031_0035501 3300049568 Bacteria 3252
1374 Ga0501032_0011615 3300049569 Bacteria 6316
1375 Ga0501032_0901662 3300049569 Bacteria 557
1376 Ga0501033_0133191 3300049570 Bacteria 1799
1377 Ga0501033_0649458 3300049570 Bacteria 721
1378 Ga0501034_0007538 3300049571 Bacteria 11575
1379 Ga0501034_0027253 3300049571 Bacteria 5813
1380 Ga0501034_0082782 3300049571 Bacteria 3211
1381 Ga0501034_0647934 3300049571 Bacteria 958
1382 Ga0501034_0982730 3300049571 Bacteria 729
1383 Ga0501036_0050187 3300049572 Bacteria 3533
1384 Ga0501036_1539549 3300049572 Bacteria 538
1385 Ga0501037_0046965 3300049573 Bacteria 3165
1386 Ga0501038_0052443 3300049574 Bacteria 3516
1387 Ga0501039_0005639 3300049575 Bacteria 9478
1388 Ga0501043_0075885 3300049579 Bacteria 2640
1389 Ga0501043_0885135 3300049579 Bacteria 641
1390 Ga0501046_0389609 3300049580 Bacteria 1007
1391 Ga0501047_0032215 3300049581 Bacteria 5059
1392 Ga0501047_0144807 3300049581 Bacteria 2253
1393 Ga0501047_0427174 3300049581 Bacteria 1156
1394 Ga0501047_0850754 3300049581 Bacteria 726
1395 Ga0501048_0109379 3300049582 Bacteria 1951
1396 Ga0501069_0035055 3300049585 Bacteria 2763
1397 Ga0501070_0027529 3300049586 Bacteria 4768
1398 Ga0501071_1605970 3300049587 Bacteria 502
1399 Ga0501206_000112 3300049653 Bacteria 8412
1400 Ga0501222_000376 3300049662 Bacteria 6857
1401 Ga0501223_002540 3300049663 Bacteria 4039
1402 Ga0501223_019504 3300049663 Bacteria 1332
1403 Ga0501223_036026 3300049663 Bacteria 962
1404 Ga0501224_000009 3300049664 Bacteria 107191
1405 Ga0501224_000219 3300049664 Bacteria 6508
1406 Ga0501227_008045 3300049665 Bacteria 2263
1407 Ga0501233_000279 3300049668 Bacteria 7827
1408 Ga0501235_000736 3300049669 Bacteria 6680
1409 Ga0501235_002385 3300049669 Bacteria 4050
1410 Ga0501257_000052 3300049686 Bacteria 32874
1411 Ga0501261_000417 3300049690 Bacteria 5575
1412 Ga0501225_0000094 3300049705 Bacteria 28402
1413 Ga0501241_025197 3300049758 Bacteria 1107
1414 Ga0501276_009720 3300049773 Bacteria 800
1415 Ga0501279_000074 3300049775 Bacteria 16852
1416 Ga0501280_000191 3300049776 Bacteria 15378
1417 Ga0501280_012759 3300049776 Bacteria 1183
1418 Ga0501281_00081 3300049777 Bacteria 11133
1419 Ga0501282_000381 3300049778 Bacteria 5364
1420 Ga0501282_001529 3300049778 Bacteria 2555
1421 Ga0501035_0013966 3300049822 Bacteria 7408
1422 Ga0501035_0492686 3300049822 Bacteria 1009
1423 Ga0501035_0886643 3300049822 Bacteria 707
1424 Ga0501035_1498850 3300049822 Bacteria 514
1425 Ga0501044_0055624 3300049823 Bacteria 4064
1426 Ga0501044_0102207 3300049823 Bacteria 2882
1427 Ga0501044_0324206 3300049823 Bacteria 1464
1428 Ga0501044_0633561 3300049823 Bacteria 959
1429 Ga0501045_0671437 3300049824 Bacteria 765
1430 Ga0501226_000076 3300049853 Bacteria 29950
1431 nmdc:mga03683_313206_c1 3300050489 Bacteria 738
1432 nmdc:mga00v17_3387_c2 3300050491 Bacteria 5533
1433 nmdc:mga00v17_538492_c1 3300050491 Bacteria 755
1434 nmdc:mga00v17_784798_c1 3300050491 Bacteria 607
1435 nmdc:mga0yw44_1193152_c1 3300050492 Bacteria 513
1436 nmdc:mga0k408_30694_c1 3300050493 Bacteria 3065
1437 nmdc:mga0k408_398724_c1 3300050493 Bacteria 819
1438 nmdc:mga0k408_501721_c1 3300050493 Bacteria 719
1439 nmdc:mga0k408_748769_c1 3300050493 Bacteria 571
1440 nmdc:mga07m45_16117_c1 3300050496 Bacteria 3999
1441 nmdc:mga07m45_186221_c1 3300050496 Bacteria 1207
1442 nmdc:mga07m45_84920_c1 3300050496 Bacteria 1810
1443 nmdc:mga05p37_847024_c1 3300050507 Bacteria 993
1444 nmdc:mga0qj67_1518855_c1 3300050509 Bacteria 515
1445 nmdc:mga0n895_418106_c1 3300050512 Bacteria 1355
1446 nmdc:mga0n895_823850_c1 3300050512 Bacteria 917
1447 nmdc:mga0sz30_105445_c1 3300050516 Bacteria 1233
1448 nmdc:mga0sz30_99383_c1 3300050516 Bacteria 1270
1449 Ga0500610_0000216 3300053079 Bacteria 17601
1450 Ga0500643_000134 3300053087 Bacteria 75321
1451 Ga0500643_003488 3300053087 Bacteria 7555
1452 Ga0500643_005556 3300053087 Bacteria 5412
1453 Ga0500643_026980 3300053087 Bacteria 1791
1454 Ga0500643_088711 3300053087 Bacteria 844
1455 Ga0500643_088712 3300053087 Bacteria 844
1456 Ga0500643_137458 3300053087 Bacteria 657
1457 Ga0500644_0260304 3300053088 Bacteria 734
1458 Ga0500646_0091936 3300053090 Bacteria 940
1459 Ga0500647_0213226 3300053091 Bacteria 869
1460 Ga0500651_0120217 3300053093 Bacteria 1595
1461 Ga0500651_0352155 3300053093 Bacteria 835
1462 Ga0500566_0039514 3300053094 Bacteria 2728
1463 Ga0500555_001780 3300053103 Bacteria 6438
1464 Ga0500556_0246324 3300053104 Bacteria 704
1465 Ga0500556_0315331 3300053104 Bacteria 610
1466 Ga0500592_001405 3300053116 Bacteria 3894
1467 Ga0500592_001411 3300053116 Bacteria 3886
1468 Ga0500592_010909 3300053116 Bacteria 1450
1469 Ga0500592_054166 3300053116 Bacteria 653
1470 Ga0500595_017021 3300053119 Bacteria 2695
1471 Ga0500618_017029 3300053125 Bacteria 1812
1472 Ga0500655_000265 3300053133 Bacteria 12247
1473 Ga0500658_0004652 3300053134 Bacteria 5122
1474 Ga0500658_0036311 3300053134 Bacteria 1954
1475 Ga0500658_0070509 3300053134 Bacteria 1473
1476 Ga0500658_0503432 3300053134 Bacteria 548
1477 Ga0500559_0343820 3300053136 Bacteria 698
1478 Ga0500568_0013737 3300053139 Bacteria 3681
1479 Ga0500568_0022667 3300053139 Bacteria 2682
1480 Ga0500568_0033063 3300053139 Bacteria 2124
1481 Ga0500573_0000559 3300053140 Bacteria 16226
1482 Ga0500573_0327745 3300053140 Bacteria 753
1483 Ga0500573_0409230 3300053140 Bacteria 640
1484 Ga0500573_0456536 3300053140 Bacteria 589
1485 Ga0500577_0504599 3300053142 Bacteria 528
1486 Ga0500590_004805 3300053148 Bacteria 6438
1487 Ga0500604_0000014 3300053151 Bacteria 92128
1488 Ga0500604_0017943 3300053151 Bacteria 1966
1489 Ga0500604_0299102 3300053151 Bacteria 558
1490 Ga0500604_0315302 3300053151 Bacteria 543
1491 Ga0500616_0000591 3300053153 Bacteria 44073
1492 Ga0500616_0030468 3300053153 Bacteria 2963
1493 Ga0500616_0083831 3300053153 Bacteria 1596
1494 Ga0500619_136027 3300053154 Bacteria 837
1495 Ga0500627_0000009 3300053158 Bacteria 153203
1496 Ga0500627_0000899 3300053158 Bacteria 7974
1497 Ga0500627_0027229 3300053158 Bacteria 2364
1498 Ga0500627_0042078 3300053158 Bacteria 1965
1499 Ga0500627_0378000 3300053158 Bacteria 607
1500 Ga0500636_0047080 3300053177 Bacteria 2541
1501 Ga0500636_0539332 3300053177 Bacteria 507
1502 Ga0500645_000002 3300053730 Bacteria 388892
1503 Ga0500645_162740 3300053730 Bacteria 611
1504 Ga0587084_022267 3300059477 Bacteria 957
1505 Ga0587084_041804 3300059477 Bacteria 782
1506 Ga0587070_116903 3300059491 Bacteria 633
1507 Ga0587077_060294 3300059493 Bacteria 820
1508 Ga0587077_085234 3300059493 Bacteria 733
1509 Ga0587077_106908 3300059493 Bacteria 680
1510 Ga0587077_188520 3300059493 Bacteria 563
1511 Ga0587090_135625 3300059510 Bacteria 546
1512 Ga0587098_014146 3300059604 Bacteria 937
1513 Ga0587106_030729 3300059605 Bacteria 861
1514 Ga0587101_102335 3300059623 Bacteria 571
1515 Ga0587062_043481 3300059639 Bacteria 737
1516 Ga0587069_047511 3300059642 Bacteria 753
1517 Ga0587072_051597 3300059643 Bacteria 825
1518 Ga0587076_052651 3300059645 Bacteria 798
1519 Ga0587078_042375 3300059646 Bacteria 646
1520 Ga0587102_016703 3300059649 Bacteria 792
1521 Ga0587107_030945 3300059652 Bacteria 814
1522 Ga0587108_025880 3300059653 Bacteria 580
1523 Ga0587071_088394 3300060344 Bacteria 700
1524 Ga0587111_0148151 3300060346 Bacteria 628
1525 Ga0587111_0211339 3300060346 Bacteria 555
1526 Ga0587111_0275893 3300060346 Bacteria 506
1527 Ga0501082_1880845 3300060353 Bacteria 522
1528 Ga0466962_0357974 3300061719 Bacteria 727
1529 Ga0070680_101562058
1530 ARcpr5oldR_c003367
1531 ARcpr5yngRDRAFT_c000513
1532 JGI24736J21556_1000064
1533 JGI24736J21556_1009108
1534 JGI24736J21556_1017419
1535 JGI24741J21665_1001255
1536 JGI24741J21665_1011514
1537 JGI24752J21851_1000348
1538 JGI24752J21851_1000507
1539 JGI24740J21852_10001392
1540 JGI24740J21852_10002955
1541 JGI24740J21852_10036607
1542 JGI24740J21852_10038021
1543 JGI24740J21852_10120951
1544 JGI24739J22299_10003209
1545 JGI24739J22299_10004443
1546 JGI24739J22299_10009935
1547 JGI24739J22299_10021051
1548 JGI24739J22299_10029358
1549 JGI24739J22299_10051500
1550 JGI24739J22299_10134404
1551 JGI24739J22299_10157074
1552 JGI24737J22298_10001590
1553 JGI24737J22298_10003732
1554 JGI24737J22298_10027060
1555 JGI24737J22298_10036959
1556 JGI24737J22298_10041158
1557 JGI24737J22298_10061695
1558 JGI24737J22298_10068351
1559 JGI24737J22298_10069519
1560 JGI24737J22298_10085395
1561 JGI24737J22298_10117018
1562 JGI24743J22301_10122747
1563 JGI24735J21928_10001961
1564 JGI24735J21928_10013354
1565 JGI24735J21928_10020484
1566 JGI24735J21928_10037139
1567 JGI24735J21928_10050720
1568 JGI24735J21928_10087919
1569 JGI24735J21928_10122964
1570 JGI24735J21928_10164286
1571 JGI24735J21928_10251458
1572 JGI24750J21931_1000199
1573 JGI24748J21848_1000070
1574 JGI24748J21848_1012787
1575 JGI24738J21930_10001288
1576 JGI24738J21930_10004666
1577 JGI24738J21930_10132714
1578 JGI24749J21850_1000118
1579 JGI24744J21845_10005787
1580 JGI24033J26618_1073154
1581 JGI24034J26672_10000038
1582 JGI24034J26672_10012171
1583 JGI24742J22300_10128925
1584 JGI24751J29686_10000379
1585 JGI25157J39369_1026112
1586 JGI25152J39213_1045210
1587 JGI25150J39212_1000365
1588 JGI25150J39212_1000837
1589 JGI25151J46595_10029327
1590 JGI25165J46597_1000021
1591 JGI25165J46597_1000023
1592 JGI25153J46596_10000173
1593 JGI25153J46596_10001359
1594 JGI25153J46596_10087839
1595 Ga0055525_1000012
1596 Ga0055542_1000025
1597 Ga0055542_1013672
1598 Ga0055529_1000014
1599 Ga0055529_1012053
1600 Ga0055526_1001689
1601 Ga0055537_1002389
1602 Ga0055537_1013876
1603 Ga0055524_1000320
1604 Ga0055524_1000341
1605 Ga0055536_1004136
1606 Ga0055536_1024452
1607 Ga0055536_1046965
1608 Ga0055534_1019454
1609 Ga0055528_1076706
1610 Ga0055528_1078700
1611 Ga0055530_10001710
1612 Ga0055530_10013813
1613 Ga0055530_10014457
1614 Ga0055530_10019749
1615 Ga0055530_10026068
1616 Ga0055540_1000723
1617 Ga0055531_10002727
1618 Ga0055531_10012970
1619 Ga0055531_10025423
1620 Ga0055531_10025502
1621 Ga0055531_10032983
1622 Ga0055531_10034125
1623 Ga0055531_10041336
1624 JGI25405J52794_10009841
1625 Ga0055543_1014693
1626 Ga0065165_1015699
1627 Ga0065165_1069905
1628 Ga0065165_1094332
1629 Ga0065165_1167928
1630 Ga0065714_10315197
1631 Ga0065704_10278800
1632 Ga0065704_10314217
1633 Ga0065715_10782746
1634 Ga0065707_10000576
1635 Ga0065707_10091874
1636 Ga0065707_10211558
1637 Ga0065707_10274776
1638 Ga0065707_10452404
1639 Ga0070658_10001786
1640 Ga0070658_10010598
1641 Ga0070658_10293600
1642 Ga0070658_10340516
1643 Ga0070658_10441688
1644 Ga0070658_10517219
1645 Ga0070658_10661252
1646 Ga0070658_10829423
1647 Ga0070658_10947640
1648 Ga0070676_10209264
1649 Ga0070676_10323450
1650 Ga0070683_100204503
1651 Ga0070683_100277426
1652 Ga0070683_101594646
1653 Ga0070683_102166812
1654 Ga0070690_100000097
1655 Ga0070670_100000075
1656 Ga0070670_100000093
1657 Ga0070670_100010675
1658 Ga0070670_100093304
1659 Ga0070670_100687098
1660 Ga0070677_10069925
1661 Ga0070677_10083489
1662 Ga0068869_100000029
1663 Ga0068869_100056174
1664 Ga0068869_100556697
1665 Ga0068869_100619997
1666 Ga0068869_102032265
1667 Ga0070666_10000004
1668 Ga0070666_10150584
1669 Ga0070666_10514357
1670 Ga0070666_10788306
1671 Ga0070666_11000859
1672 Ga0070680_100021258
1673 Ga0070680_100933788
1674 Ga0070682_100076023
1675 Ga0070682_100710784
1676 Ga0068868_100003973
1677 Ga0068868_100501188
1678 Ga0068868_100841095
1679 Ga0068868_101749607
1680 Ga0070660_100016618
1681 Ga0070660_100061300
1682 Ga0070660_100125410
1683 Ga0070660_100173748
1684 Ga0070660_100240844
1685 Ga0070660_100286815
1686 Ga0070660_100559437
1687 Ga0070660_100594981
1688 Ga0070689_100050883
1689 Ga0070689_100919983
1690 Ga0070691_10456170
1691 Ga0070687_100420059
1692 Ga0070661_100020393
1693 Ga0070661_100031335
1694 Ga0070661_100230723
1695 Ga0070661_100377865
1696 Ga0070661_100808839
1697 Ga0070661_100862778
1698 Ga0070661_101126156
1699 Ga0070692_10841793
1700 Ga0070668_100000831
1701 Ga0070668_100017594
1702 Ga0070668_100719613
1703 Ga0070668_100732995
1704 Ga0070669_100000115
1705 Ga0070669_100000296
1706 Ga0070669_100854356
1707 Ga0070669_100934560
1708 Ga0070669_100991154
1709 Ga0070675_100098854
1710 Ga0070675_100126421
1711 Ga0070675_101302178
1712 Ga0070671_100024172
1713 Ga0070671_100145848
1714 Ga0070671_100287990
1715 Ga0070671_100436300
1716 Ga0070671_100488119
1717 Ga0070671_100615864
1718 Ga0070674_100058209
1719 Ga0070674_100829410
1720 Ga0070674_100861718
1721 Ga0070673_100000019
1722 Ga0070673_100286720
1723 Ga0070673_101102375
1724 Ga0070673_101841538
1725 Ga0070673_102297973
1726 Ga0070688_100004740
1727 Ga0070688_100955353
1728 Ga0070659_100095005
1729 Ga0070659_100140885
1730 Ga0070659_100221271
1731 Ga0070659_100222739
1732 Ga0070659_100246930
1733 Ga0070659_100704189
1734 Ga0070659_101377798
1735 Ga0070659_101819905
1736 Ga0070659_102069681
1737 Ga0070667_100000039
1738 Ga0070667_100013671
1739 Ga0070667_100044820
1740 Ga0070667_100188643
1741 Ga0070667_101768041
1742 Ga0070667_102150848
1743 Ga0070710_10640199
1744 Ga0070701_10673112
1745 Ga0070694_101003286
1746 Ga0070663_100081755
1747 Ga0070663_100148712
1748 Ga0070663_100225700
1749 Ga0070663_100420899
1750 Ga0070663_100669376
1751 Ga0070678_100006601
1752 Ga0070678_100040527
1753 Ga0070678_101189213
1754 Ga0070678_101574103
1755 Ga0070662_100020163
1756 Ga0070662_100024536
1757 Ga0070662_100044582
1758 Ga0070662_100358188
1759 Ga0070662_100377085
1760 Ga0070662_100436172
1761 Ga0070662_100519772
1762 Ga0070662_100811721
1763 Ga0070662_101285102
1764 Ga0070662_101615296
1765 Ga0070662_101777111
1766 Ga0070662_101986251
1767 Ga0070681_10078394
1768 Ga0070681_10131424
1769 Ga0068867_100000014
1770 Ga0068867_100083516
1771 Ga0068867_101459937
1772 Ga0070685_10000806
1773 Ga0070706_101846410
1774 Ga0070679_100000873
1775 Ga0070679_100651895
1776 Ga0070679_101959785
1777 Ga0070684_100136074
1778 Ga0070684_100204115
1779 Ga0070684_101536557
1780 Ga0068853_100000960
1781 Ga0068853_100202129
1782 Ga0068853_100282094
1783 Ga0068853_100306801
1784 Ga0068853_100337575
1785 Ga0068853_100618322
1786 Ga0068853_100656641
1787 Ga0068853_101091271
1788 Ga0068853_102037210
1789 Ga0070672_100182037
1790 Ga0070672_100534380
1791 Ga0070686_100000061
1792 Ga0070686_100006821
1793 Ga0070686_100561102
1794 Ga0070686_101857804
1795 Ga0070693_100211135
1796 Ga0070693_100435491
1797 Ga0070693_100802929
1798 Ga0070665_100000004
1799 Ga0070665_100000109
1800 Ga0070665_100001527
1801 Ga0070665_100010005
1802 Ga0070665_100126607
1803 Ga0070665_100255203
1804 Ga0070665_100429143
1805 Ga0070665_101247662
1806 Ga0068855_100010206
1807 Ga0068855_100237795
1808 Ga0068855_100361015
1809 Ga0068855_100456541
1810 Ga0068855_100491032
1811 Ga0068855_100508392
1812 Ga0068855_100822833
1813 Ga0068855_100855046
1814 Ga0068855_101257490
1815 Ga0068855_102579830
1816 Ga0070664_100063876
1817 Ga0070664_100145529
1818 Ga0070664_100698762
1819 Ga0070664_101529857
1820 Ga0070664_101765256
1821 Ga0068857_100055851
1822 Ga0068857_100060023
1823 Ga0068857_100066375
1824 Ga0068857_100167943
1825 Ga0068857_100233827
1826 Ga0068857_101240083
1827 Ga0068857_101884696
1828 Ga0068854_100031424
1829 Ga0068854_100051084
1830 Ga0068854_100074235
1831 Ga0068854_100092457
1832 Ga0068854_100410357
1833 Ga0068854_100465647
1834 Ga0068854_100845579
1835 Ga0068854_101759412
1836 Ga0068856_100060779
1837 Ga0068856_100262174
1838 Ga0068856_100338965
1839 Ga0068856_100372649
1840 Ga0068856_100443696
1841 Ga0068856_100480227
1842 Ga0068856_100620097
1843 Ga0068852_100098053
1844 Ga0068852_100185948
1845 Ga0068852_100239696
1846 Ga0068852_100262271
1847 Ga0068852_100443711
1848 Ga0068852_101031550
1849 Ga0068852_101812706
1850 Ga0068852_102499611
1851 Ga0068852_102720078
1852 Ga0068859_100001416
1853 Ga0068859_100009835
1854 Ga0068859_100058681
1855 Ga0068859_100166281
1856 Ga0068859_100173979
1857 Ga0068859_100505472
1858 Ga0068859_100798469
1859 Ga0068864_100000016
1860 Ga0068864_100000087
1861 Ga0068864_100002567
1862 Ga0068864_102434270
1863 Ga0068866_11085482
1864 Ga0068861_100000040
1865 Ga0068861_100006640
1866 Ga0068861_100635023
1867 Ga0068861_101939186
1868 Ga0068861_102125254
1869 Ga0068851_10010412
1870 Ga0068851_10056665
1871 Ga0068851_10329818
1872 Ga0068851_11038818
1873 Ga0068870_10096183
1874 Ga0068870_10558785
1875 Ga0068863_100000013
1876 Ga0068863_100000017
1877 Ga0068863_100000033
1878 Ga0068863_100008320
1879 Ga0068863_100140643
1880 Ga0068863_100234419
1881 Ga0068863_100358661
1882 Ga0068858_100000664
1883 Ga0068858_100004566
1884 Ga0068858_100708504
1885 Ga0068858_102283401
1886 Ga0068860_100000009
1887 Ga0068860_100028829
1888 Ga0068860_100053483
1889 Ga0068860_100264367
1890 Ga0068862_100000032
1891 Ga0068862_100000040
1892 Ga0068862_100000466
1893 Ga0068862_100001446
1894 Ga0068862_100105127
1895 Ga0068862_101080627
1896 Ga0081455_10000215
1897 Ga0081540_1013216
1898 Ga0075364_10001520
1899 Ga0075364_11177761
1900 Ga0075362_10167624
1901 Ga0075369_10031638
1902 Ga0075369_10084853
1903 Ga0075369_10116166
1904 Ga0075369_10337703
1905 Ga0075366_10130637
1906 Ga0075366_10182388
1907 Ga0075366_10233689
1908 Ga0075366_10759202
1909 Ga0075366_11042173
1910 Ga0097621_100240098
1911 Ga0097621_101343528
1912 Ga0097621_101467576
1913 Ga0097621_101723020
1914 Ga0097621_101868557
1915 Ga0097621_102103718
1916 Ga0075370_10008629
1917 Ga0075370_10023057
1918 Ga0075370_10412683
1919 Ga0075370_10664875
1920 Ga0075370_10676786
1921 Ga0068871_100261117
1922 Ga0068871_100587711
1923 Ga0068871_101186315
1924 Ga0075430_101078196
1925 Ga0075434_100255877
1926 Ga0068865_100000018
1927 Ga0097620_100001416
1928 Ga0097620_100009835
1929 Ga0097620_100058681
1930 Ga0097620_100166292
1931 Ga0097620_100173972
1932 Ga0097620_100505473
1933 Ga0097620_100798483
1934 Ga0105251_10004716
1935 Ga0105251_10155260
1936 Ga0105244_10297884
1937 Ga0105240_10001116
1938 Ga0105240_10024394
1939 Ga0105240_10191747
1940 Ga0105240_10610797
1941 Ga0105240_10749955
1942 Ga0105240_12393971
1943 Ga0105240_12490842
1944 Ga0105245_10002967
1945 Ga0105245_10005275
1946 Ga0105245_10406216
1947 Ga0105245_11568913
1948 Ga0105247_10018821
1949 Ga0105247_10086839
1950 Ga0105247_10091941
1951 Ga0114129_12342286
1952 Ga0105243_10000076
1953 Ga0105243_10003106
1954 Ga0105243_10358718
1955 Ga0105243_10522486
1956 Ga0105243_10693651
1957 Ga0105243_11675996
1958 Ga0105243_11796911
1959 Ga0105243_13135099
1960 Ga0105241_10004308
1961 Ga0105241_10090211
1962 Ga0105241_10407073
1963 Ga0105241_10417038
1964 Ga0105241_11874660
1965 Ga0105241_11879984
1966 Ga0105242_10009804
1967 Ga0105242_11353886
1968 Ga0105248_10000021
1969 Ga0105248_10003987
1970 Ga0105248_10006062
1971 Ga0105248_10008689
1972 Ga0105248_10255282
1973 Ga0105248_10504523
1974 Ga0105237_10002858
1975 Ga0105237_10011259
1976 Ga0105237_10045964
1977 Ga0105237_10082257
1978 Ga0105237_10114196
1979 Ga0105237_10200169
1980 Ga0105237_10469740
1981 Ga0105237_11204749
1982 Ga0105237_11486404
1983 Ga0105237_12270548
1984 Ga0105238_10103849
1985 Ga0105238_10108749
1986 Ga0105238_10138886
1987 Ga0105238_10157495
1988 Ga0105238_10214234
1989 Ga0105238_10373621
1990 Ga0105238_10421717
1991 Ga0105238_10521037
1992 Ga0105238_10541365
1993 Ga0105238_10843372
1994 Ga0105238_11477082
1995 Ga0105238_12385496
1996 Ga0105238_12416452
1997 Ga0105238_12548021
1998 Ga0105238_12971625
1999 Ga0105249_10000006
2000 Ga0105249_10000017
2001 Ga0105249_10001881
2002 Ga0105249_10203829
2003 Ga0105249_10249779
2004 Ga0105249_12218491
2005 Ga0105239_10000546
2006 Ga0105239_10070988
2007 Ga0105239_10379102
2008 Ga0105239_11008231
2009 Ga0105239_11166215
2010 Ga0105239_12076595
2011 Ga0105239_12764741
2012 Ga0105239_13631876
2013 Ga0105246_10161931
2014 Ga0105246_10588517
2015 Ga0105246_10851547
2016 Ga0105246_11219958
2017 Ga0157317_1023388
2018 Ga0157315_1007765
2019 Ga0157326_1079519
2020 Ga0157373_10081148
2021 Ga0157373_10565416
2022 Ga0157373_10660838
2023 Ga0157373_10662801
2024 Ga0157373_10798128
2025 Ga0157373_11528879
2026 Ga0157371_10000059
2027 Ga0157371_10089328
2028 Ga0157371_10342701
2029 Ga0157371_10606382
2030 Ga0157371_11339788
2031 Ga0157370_10327199
2032 Ga0157370_10370331
2033 Ga0157370_10415992
2034 Ga0157370_10545838
2035 Ga0157370_11249102
2036 Ga0157369_10073353
2037 Ga0157369_10083235
2038 Ga0157369_10211906
2039 Ga0157369_10281167
2040 Ga0157369_10298220
2041 Ga0157369_10312143
2042 Ga0157369_10444995
2043 Ga0157369_10840300
2044 Ga0157369_11229243
2045 Ga0157369_11658669
2046 Ga0157369_12017709
2047 Ga0157369_12583312
2048 Ga0157374_10412425
2049 Ga0157378_10000504
2050 Ga0157378_10107742
2051 Ga0157378_10539715
2052 Ga0157378_10950271
2053 Ga0157378_11480740
2054 Ga0157378_11587366
2055 Ga0163162_10092290
2056 Ga0163162_10421093
2057 Ga0163162_11521886
2058 Ga0163162_12218841
2059 Ga0157372_10084779
2060 Ga0157372_10573559
2061 Ga0157372_11126859
2062 Ga0157372_11317178
2063 Ga0157372_11994999
2064 Ga0157372_12178074
2065 Ga0157375_10082591
2066 Ga0157375_10446526
2067 Ga0157375_11409902
2068 Ga0157375_13608339
2069 Ga0163163_10465584
2070 Ga0163163_11563685
2071 Ga0163163_11777425
2072 Ga0163163_12645250
2073 Ga0157380_10000157
2074 Ga0157380_10002166
2075 Ga0157380_10006678
2076 Ga0157380_10812507
2077 Ga0157380_11992912
2078 Ga0182008_10166668
2079 Ga0157377_10082035
2080 Ga0157377_10180500
2081 Ga0157377_10583524
2082 Ga0157379_10001735
2083 Ga0157379_10051816
2084 Ga0157379_11466984
2085 Ga0157379_12505109
2086 Ga0157376_10000092
2087 Ga0157376_10492886
2088 Ga0157376_10716193
2089 Ga0157376_11441483
2090 Ga0157376_11622424
2091 Ga0183360_10368
2092 Ga0183363_1006
2093 Ga0163161_10000208
2094 Ga0163161_10144828
2095 Ga0163161_10167645
2096 Ga0163161_10541954
2097 Ga0163161_10943367
2098 Ga0197907_10274206
2099 Ga0206356_10317151
2100 Ga0206349_1668694
2101 Ga0206353_11808888
2102 Ga0213876_10016636
2103 Ga0213875_10001626
2104 Ga0209674_101560
2105 Ga0209563_100030
2106 Ga0207427_104026
2107 Ga0209437_123370
2108 Ga0207425_1000049
2109 Ga0207425_1011898
2110 Ga0209646_1020951
2111 Ga0209646_1031500
2112 Ga0209026_1000352
2113 Ga0209026_1013989
2114 Ga0209026_1031029
2115 Ga0209677_105325
2116 Ga0209148_1000011
2117 Ga0209148_1000243
2118 Ga0209148_1005193
2119 Ga0209129_1000471
2120 Ga0209233_1000003
2121 Ga0209233_1000065
2122 Ga0209233_1006188
2123 Ga0209565_1000008
2124 Ga0209565_1000985
2125 Ga0209455_1000006
2126 Ga0209455_1002555
2127 Ga0209455_1031389
2128 Ga0209673_1004450
2129 Ga0209673_1023801
2130 Ga0209675_1000104
2131 Ga0209676_1000512
2132 Ga0209676_1000807
2133 Ga0209676_1001199
2134 Ga0209676_1009827
2135 Ga0209676_1021566
2136 Ga0209676_1029229
2137 Ga0209025_1000068
2138 Ga0209025_1011083
2139 Ga0209025_1050489
2140 Ga0209564_1000335
2141 Ga0209564_1016953
2142 Ga0209564_1085619
2143 Ga0209758_1000001
2144 Ga0209758_1000004
2145 Ga0209758_1017731
2146 Ga0209758_1169594
2147 Ga0209050_1000001
2148 Ga0209050_1000286
2149 Ga0209050_1002774
2150 Ga0209050_1003389
2151 Ga0209050_1035962
2152 Ga0209256_1000009
2153 Ga0209256_1000010
2154 Ga0207426_1140179
2155 Ga0209051_1000191
2156 Ga0209051_1038886
2157 Ga0209257_1000245
2158 Ga0209257_1000321
2159 Ga0209257_1000577
2160 Ga0209257_1000597
2161 Ga0209257_1003551
2162 Ga0209257_1004959
2163 Ga0209257_1016465
2164 Ga0209257_1026884
2165 Ga0209257_1028408
2166 Ga0209257_1035933
2167 Ga0207656_10004180
2168 Ga0207656_10023916
2169 Ga0207656_10229427
2170 Ga0207656_10302528
2171 Ga0207682_10001453
2172 Ga0207682_10407906
2173 Ga0207682_10474015
2174 Ga0207692_10992207
2175 Ga0207642_10869034
2176 Ga0207710_10004955
2177 Ga0207710_10008017
2178 Ga0207710_10066752
2179 Ga0207688_10302991
2180 Ga0207688_10449418
2181 Ga0207688_11080046
2182 Ga0207680_10000010
2183 Ga0207680_10559990
2184 Ga0207680_10775750
2185 Ga0207680_10792934
2186 Ga0207680_11343394
2187 Ga0207647_10000069
2188 Ga0207647_10009251
2189 Ga0207647_10035876
2190 Ga0207647_10068151
2191 Ga0207647_10137710
2192 Ga0207647_10168495
2193 Ga0207645_10014111
2194 Ga0207645_10021253
2195 Ga0207645_10372006
2196 Ga0207705_10000084
2197 Ga0207705_10000243
2198 Ga0207705_10000511
2199 Ga0207705_10002954
2200 Ga0207705_10049162
2201 Ga0207705_10841844
2202 Ga0207705_10862539
2203 Ga0207705_11032938
2204 Ga0207684_11444845
2205 Ga0207654_10000796
2206 Ga0207654_10000810
2207 Ga0207654_10195143
2208 Ga0207707_10045078
2209 Ga0207695_10000288
2210 Ga0207695_10003496
2211 Ga0207695_10006167
2212 Ga0207695_10095035
2213 Ga0207695_10103895
2214 Ga0207695_10171402
2215 Ga0207671_10002884
2216 Ga0207671_10003173
2217 Ga0207671_10003747
2218 Ga0207671_10022700
2219 Ga0207671_10182611
2220 Ga0207671_10552124
2221 Ga0207660_10001492
2222 Ga0207660_11185096
2223 Ga0207662_11065466
2224 Ga0207657_10028620
2225 Ga0207657_10028866
2226 Ga0207657_10028985
2227 Ga0207657_10048886
2228 Ga0207657_10085735
2229 Ga0207657_10139728
2230 Ga0207657_10214187
2231 Ga0207657_10232634
2232 Ga0207657_10276144
2233 Ga0207657_10495134
2234 Ga0207657_10506335
2235 Ga0207657_10632222
2236 Ga0207649_10000212
2237 Ga0207649_10003617
2238 Ga0207649_10103905
2239 Ga0207649_10197129
2240 Ga0207649_10395053
2241 Ga0207649_11186539
2242 Ga0207652_10000008
2243 Ga0207652_10502029
2244 Ga0207681_10000005
2245 Ga0207681_10000197
2246 Ga0207681_10684161
2247 Ga0207681_11150961
2248 Ga0207694_10002782
2249 Ga0207694_10016018
2250 Ga0207694_10049198
2251 Ga0207694_10124310
2252 Ga0207694_10363345
2253 Ga0207694_10382618
2254 Ga0207694_10659746
2255 Ga0207694_11014525
2256 Ga0207694_11894867
2257 Ga0207650_10000004
2258 Ga0207650_10000069
2259 Ga0207650_10068635
2260 Ga0207650_10208243
2261 Ga0207650_10218925
2262 Ga0207659_10009064
2263 Ga0207659_10396469
2264 Ga0207659_11003722
2265 Ga0207659_11019975
2266 Ga0207687_10003114
2267 Ga0207687_10079745
2268 Ga0207687_10236428
2269 Ga0207687_11118299
2270 Ga0207644_10000145
2271 Ga0207644_10058536
2272 Ga0207644_10163232
2273 Ga0207644_10312997
2274 Ga0207644_10611291
2275 Ga0207690_10004341
2276 Ga0207690_10066595
2277 Ga0207690_10075431
2278 Ga0207690_10480941
2279 Ga0207690_10666319
2280 Ga0207690_10725464
2281 Ga0207690_11366109
2282 Ga0207690_11450002
2283 Ga0207706_10022259
2284 Ga0207706_10041508
2285 Ga0207706_10180514
2286 Ga0207706_10181057
2287 Ga0207706_10229574
2288 Ga0207706_10310239
2289 Ga0207706_10344241
2290 Ga0207706_10361163
2291 Ga0207706_10702569
2292 Ga0207706_10946056
2293 Ga0207706_11181552
2294 Ga0207686_10004287
2295 Ga0207686_10156000
2296 Ga0207686_11396709
2297 Ga0207709_10000114
2298 Ga0207709_10000246
2299 Ga0207709_10462012
2300 Ga0207709_10550523
2301 Ga0207709_10703101
2302 Ga0207670_10017586
2303 Ga0207670_11740647
2304 Ga0207669_10005822
2305 Ga0207669_10017734
2306 Ga0207669_10629947
2307 Ga0207669_10946787
2308 Ga0207704_10000008
2309 Ga0207691_10125275
2310 Ga0207691_10473191
2311 Ga0207691_10492740
2312 Ga0207691_11152377
2313 Ga0207691_11629418
2314 Ga0207711_10000025
2315 Ga0207711_10001472
2316 Ga0207711_10005846
2317 Ga0207711_10006762
2318 Ga0207711_10015720
2319 Ga0207689_10000608
2320 Ga0207689_10099854
2321 Ga0207689_10280169
2322 Ga0207689_10392332
2323 Ga0207689_10716978
2324 Ga0207661_10236839
2325 Ga0207661_10536130
2326 Ga0207661_10638479
2327 Ga0207661_11430975
2328 Ga0207679_10050964
2329 Ga0207679_10157897
2330 Ga0207679_10378715
2331 Ga0207679_11301270
2332 Ga0207679_11432425
2333 Ga0207667_10000002
2334 Ga0207667_10000024
2335 Ga0207667_10004183
2336 Ga0207667_10206634
2337 Ga0207667_10491059
2338 Ga0207667_10553369
2339 Ga0207667_10686476
2340 Ga0207667_11598959
2341 Ga0207651_10000008
2342 Ga0207651_10486602
2343 Ga0207651_11659456
2344 Ga0207651_11838274
2345 Ga0207712_10000012
2346 Ga0207712_10000014
2347 Ga0207712_10005054
2348 Ga0207712_10074681
2349 Ga0207712_10124290
2350 Ga0207668_10000113
2351 Ga0207668_10017274
2352 Ga0207668_10817192
2353 Ga0207668_11440424
2354 Ga0207668_11921966
2355 Ga0207640_10002027
2356 Ga0207640_10013183
2357 Ga0207640_10036573
2358 Ga0207640_10100085
2359 Ga0207640_10440941
2360 Ga0207640_10608503
2361 Ga0207640_10998134
2362 Ga0207640_11205523
2363 Ga0207658_10000428
2364 Ga0207658_10009141
2365 Ga0207658_10010246
2366 Ga0207658_11843379
2367 Ga0207677_10000091
2368 Ga0207677_11302107
2369 Ga0207677_11497990
2370 Ga0207703_10002426
2371 Ga0207703_10003828
2372 Ga0207703_10994092
2373 Ga0207639_10003616
2374 Ga0207639_10013397
2375 Ga0207639_10020428
2376 Ga0207639_10020539
2377 Ga0207639_10041198
2378 Ga0207639_10119130
2379 Ga0207639_10200720
2380 Ga0207639_10272272
2381 Ga0207639_10307772
2382 Ga0207639_11098996
2383 Ga0207639_11296198
2384 Ga0207678_10004876
2385 Ga0207678_10016489
2386 Ga0207678_10175338
2387 Ga0207678_10301146
2388 Ga0207678_10703703
2389 Ga0207678_10909510
2390 Ga0207702_10003021
2391 Ga0207702_10005062
2392 Ga0207702_10006302
2393 Ga0207702_10153725
2394 Ga0207702_10192692
2395 Ga0207702_10210284
2396 Ga0207702_10274235
2397 Ga0207641_10000002
2398 Ga0207641_10000036
2399 Ga0207641_10000099
2400 Ga0207641_10006011
2401 Ga0207641_10112331
2402 Ga0207641_10223420
2403 Ga0207641_11260024
2404 Ga0207648_10000009
2405 Ga0207648_10014717
2406 Ga0207648_10603009
2407 Ga0207648_10787837
2408 Ga0207676_10000006
2409 Ga0207676_10000044
2410 Ga0207676_10001345
2411 Ga0207676_10922563
2412 Ga0207676_12417247
2413 Ga0207674_10017839
2414 Ga0207674_10050570
2415 Ga0207674_10066644
2416 Ga0207674_10095821
2417 Ga0207674_10197887
2418 Ga0207674_10423883
2419 Ga0207674_10536182
2420 Ga0207674_11775389
2421 Ga0207674_12056820
2422 Ga0207675_100000157
2423 Ga0207675_100001117
2424 Ga0207675_100015082
2425 Ga0207675_100318652
2426 Ga0207675_102043211
2427 Ga0207683_10004633
2428 Ga0207683_10006500
2429 Ga0207683_10701972
2430 Ga0207683_11689544
2431 Ga0207698_10000496
2432 Ga0207698_10002491
2433 Ga0207698_10005844
2434 Ga0207698_10215161
2435 Ga0207698_10235827
2436 Ga0207698_10308204
2437 Ga0207698_10579932
2438 Ga0207698_10826820
2439 Ga0207698_11144138
2440 Ga0209998_10068929
2441 Ga0209974_10058972
2442 Ga0268266_10000009
2443 Ga0268266_10000015
2444 Ga0268266_10000560
2445 Ga0268266_10008365
2446 Ga0268266_10157745
2447 Ga0268266_10553148
2448 Ga0268266_11113731
2449 Ga0268266_11854022
2450 Ga0268265_10000001
2451 Ga0268265_10000003
2452 Ga0268265_10000047
2453 Ga0268265_10000125
2454 Ga0268265_10231745
2455 Ga0268265_12333057
2456 Ga0268264_10000023
2457 Ga0268264_10014193
2458 Ga0268264_10074867
2459 Ga0268264_10205367
2460 Ga0268264_11672397
2461 Ga0307515_10341363
2462 Ga0265338_10170208
2463 Ga0314311_1129629
2464 Ga0316183_1101809
2465 Ga0307513_10032777
2466 Ga0307513_10259144
2467 Ga0307513_10504297
2468 Ga0307513_10691202
2469 Ga0307513_10745609
2470 Ga0307408_100002738
2471 Ga0307408_100999629
2472 Ga0307408_101455450
2473 Ga0307508_10004384
2474 Ga0307405_10045306
2475 Ga0307405_10064746
2476 Ga0307405_10341476
2477 Ga0307405_10464188
2478 Ga0307405_10912860
2479 Ga0307405_11445527
2480 Ga0307405_11717863
2481 Ga0307405_11939894
2482 Ga0307413_10074350
2483 Ga0307413_10267957
2484 Ga0307413_10876998
2485 Ga0307413_10923106
2486 Ga0307413_10989766
2487 Ga0307413_11491805
2488 Ga0307410_10020800
2489 Ga0307410_10182426
2490 Ga0307410_10757338
2491 Ga0307410_11125492
2492 Ga0307406_10022639
2493 Ga0307406_10040041
2494 Ga0307406_10047398
2495 Ga0307406_10198586
2496 Ga0307406_10271505
2497 Ga0307406_10409954
2498 Ga0307406_10431566
2499 Ga0307406_10900703
2500 Ga0307406_11616058
2501 Ga0307407_10050253
2502 Ga0307407_10202991
2503 Ga0307412_10000330
2504 Ga0307412_10002114
2505 Ga0307412_10005437
2506 Ga0307412_10031479
2507 Ga0307412_10032820
2508 Ga0307412_10063499
2509 Ga0307412_10069509
2510 Ga0307412_10133634
2511 Ga0307412_10731022
2512 Ga0307409_100075828
2513 Ga0307409_101074060
2514 Ga0307409_101444973
2515 Ga0307416_100013642
2516 Ga0307416_100024455
2517 Ga0307416_100056646
2518 Ga0307416_100228529
2519 Ga0307416_100296789
2520 Ga0307416_101661728
2521 Ga0307416_101971073
2522 Ga0307414_10000117
2523 Ga0307414_10000371
2524 Ga0307414_10031754
2525 Ga0307414_10036610
2526 Ga0307414_10115431
2527 Ga0307414_10342652
2528 Ga0307414_10344197
2529 Ga0307414_10449790
2530 Ga0307414_10922789
2531 Ga0307414_11157305
2532 Ga0307414_12074244
2533 Ga0307411_10069400
2534 Ga0307411_10182421
2535 Ga0307411_10227412
2536 Ga0307411_10249025
2537 Ga0307411_10877007
2538 Ga0307415_100135597
2539 Ga0307415_100208297
2540 Ga0307415_101494312
2541 Ga0307415_101576380
2542 Ga0307510_10127422
2543 Ga0307510_10608921
2544 Ga0373954_0204433
2545 Ga0373931_0061226
2546 Ga0373935_0588072
2547 Ga0373927_0041187
2548 Ga0373925_0449014
2549 Ga0395899_0116591
2550 Ga0395899_0134214
2551 Ga0395900_0232480
2552 Ga0395900_0265355
2553 Ga0395900_0549404
2554 Ga0395898_0804277
2555 Ga0395905_0257057
2556 Ga0395905_0501499
2557 Ga0395905_0520966
2558 Ga0395905_1136521
2559 Ga0436364_0957806
2560 Ga0436364_1065372
2561 Ga0436364_1253875
2562 Ga0395901_0318284
2563 Ga0395901_0617526
2564 Ga0395901_0863371
2565 Ga0237819_00478
2566 Ga0237816_01697
2567 Ga0436365_1056819
2568 Ga0436365_1234023
2569 Ga0436365_1437704
2570 Ga0436365_1495591
2571 Ga0436362_0379666
2572 Ga0439436_0104422
2573 Ga0439436_0166421
2574 Ga0439439_0019879
2575 Ga0439461_0003935
2576 Ga0439461_0096709
2577 Ga0439465_0004239
2578 Ga0439465_0005674
2579 Ga0439465_0042157
2580 Ga0451789_0548732
2581 Ga0451790_23905
2582 Ga0451791_0198074
2583 Ga0451791_0638383
2584 Ga0451791_0752784
2585 Ga0451791_0863431
2586 Ga0451797_1153188
2587 Ga0451795_0712337
2588 Ga0451795_1707330
2589 Ga0451795_1714707
2590 Ga0451800_0368767
2591 Ga0451802_0283989
2592 Ga0451802_0673154
2593 Ga0451802_1024104
2594 Ga0451802_2140950
2595 Ga0451805_129527
2596 Ga0451806_203876
2597 Ga0451806_592453
2598 Ga0451806_758294
2599 Ga0451804_0246643
2600 Ga0451804_0292217
2601 Ga0451804_0477757
2602 Ga0451807_0470631
2603 Ga0451807_1170541
2604 Ga0451807_1532452
2605 Ga0451807_2302565
2606 Ga0451807_2545728
2607 Ga0451807_2637162
2608 Ga0451833_1456891
2609 Ga0451837_0903713
2610 Ga0451837_1313285
2611 Ga0451841_1289656
2612 Ga0451845_0647259
2613 Ga0451843_0561276
2614 Ga0451843_0868889
2615 Ga0451855_0464587
2616 Ga0451853_1470546
2617 Ga0451853_1927772
2618 Ga0451853_1977551
2619 Ga0439431_0003098
2620 Ga0439431_0139411
2621 Ga0439445_0001259
2622 Ga0439445_0046001
2623 Ga0439445_0057073
2624 Ga0439445_0064378
2625 Ga0439445_0077090
2626 Ga0439448_0001965
2627 Ga0439448_0021597
2628 Ga0439448_0034484
2629 Ga0439432_006259
2630 Ga0439450_143599
2631 Ga0439452_041030
2632 Ga0439455_0003944
2633 Ga0439455_0064401
2634 Ga0439462_0004404
2635 Ga0439462_0004785
2636 Ga0450894_038137
2637 Ga0439446_0019699
2638 Ga0439458_0001028
2639 Ga0439458_0004227
2640 Ga0439434_0000103
2641 Ga0439434_0075974
2642 Ga0439464_0179423
2643 Ga0450893_0027173
2644 Ga0466972_0022049
2645 Ga0466966_0224862
2646 Ga0466961_0076990
2647 Ga0466963_0015793
2648 Ga0466964_0641459
2649 Ga0466971_0041189
2650 Ga0466971_0531987
2651 Ga0466968_0457697
2652 Ga0466970_0075472
2653 Ga0466957_0608401
2654 Ga0466957_0732249
2655 Ga0466957_1334854
2656 Ga0466960_0887854
2657 Ga0466959_0030393
2658 Ga0466958_0020347
2659 Ga0466958_0298961
2660 Ga0466958_0655830
2661 Ga0466967_1115467
2662 Ga0466967_2500056
2663 Ga0495627_084823
2664 Ga0495627_099887
2665 Ga0495590_0364510
2666 Ga0495629_0842767
2667 Ga0495638_0004617
2668 Ga0495638_0038151
2669 Ga0495638_0054219
2670 Ga0495638_0502409
2671 Ga0495638_0560184
2672 Ga0495650_0001317
2673 Ga0495639_0309034
2674 Ga0495584_0111019
2675 Ga0495585_0133334
2676 Ga0495585_0277392
2677 Ga0495585_0341219
2678 Ga0495585_0588467
2679 Ga0495596_0175517
2680 Ga0495607_0408716
2681 Ga0495583_0000766
2682 Ga0495583_0007683
2683 Ga0495583_0063474
2684 Ga0495583_0078340
2685 Ga0495583_0082064
2686 Ga0495583_0278645
2687 Ga0495606_0023498
2688 Ga0495606_0042086
2689 Ga0495606_0097880
2690 Ga0495606_0214158
2691 Ga0495606_0545327
2692 Ga0495610_0371230
2693 Ga0495616_0129000
2694 Ga0495616_0373886
2695 Ga0495620_0132850
2696 Ga0495631_0046334
2697 Ga0495631_0474017
2698 Ga0495632_0206744
2699 Ga0495632_0367474
2700 Ga0495632_0462517
2701 Ga0495637_0118426
2702 Ga0495637_0123343
2703 Ga0495643_0008456
2704 Ga0495643_0011725
2705 Ga0495643_0057255
2706 Ga0495643_0449081
2707 Ga0495643_0460848
2708 Ga0495648_0000507
2709 Ga0495648_0166532
2710 Ga0495648_0338835
2711 Ga0495663_0002619
2712 Ga0495663_0123542
2713 Ga0495642_0431045
2714 Ga0495652_0326049
2715 Ga0495654_0004604
2716 Ga0495654_0036570
2717 Ga0495654_0131481
2718 Ga0495654_0342787
2719 Ga0495654_0447958
2720 Ga0495598_0008568
2721 Ga0495609_0423917
2722 Ga0495597_0063768
2723 Ga0495597_0193287
2724 Ga0495597_0425513
2725 Ga0495622_0048141
2726 Ga0495633_0028185
2727 Ga0495633_0070471
2728 Ga0495668_0000015
2729 Ga0495668_0000016
2730 Ga0495668_0019898
2731 Ga0495668_0033266
2732 Ga0495668_0311375
2733 Ga0495668_0440036
2734 Ga0495668_0556016
2735 Ga0495668_0652397
2736 Ga0495611_0020624
2737 Ga0495611_0158187
2738 Ga0495611_0296985
2739 Ga0495611_0314971
2740 Ga0495625_0000072
2741 Ga0495625_0004430
2742 Ga0495625_0007474
2743 Ga0495625_0075318
2744 Ga0495625_0169691
2745 Ga0495625_0265515
2746 Ga0495625_0269124
2747 Ga0495625_0402133
2748 Ga0495625_0555976
2749 Ga0495625_0591105
2750 Ga0495625_0665985
2751 Ga0495661_0011622
2752 Ga0495661_0116274
2753 Ga0495661_0572121
2754 Ga0495669_0000529
2755 Ga0495613_0831096
2756 Ga0495670_0000015
2757 Ga0495670_0008829
2758 Ga0495670_0015640
2759 Ga0495670_0467011
2760 Ga0495671_0063051
2761 Ga0495649_0148846
2762 Ga0495649_0249991
2763 Ga0495649_0425440
2764 Ga0495589_0133912
2765 Ga0495600_0009109
2766 Ga0495660_0430779
2767 Ga0495683_0116301
2768 Ga0495683_0122323
2769 Ga0495687_000649
2770 Ga0495687_004871
2771 Ga0495687_062746
2772 Ga0495677_0021122
2773 Ga0495677_0036383
2774 Ga0495673_0019216
2775 Ga0495681_0011958
2776 Ga0495681_0041622
2777 Ga0495681_0309730
2778 Ga0495686_0000530
2779 Ga0495686_0000723
2780 Ga0495686_0001008
2781 Ga0495686_0024914
2782 Ga0495686_0070575
2783 Ga0495686_0182374
2784 Ga0495686_0279442
2785 Ga0495686_0659667
2786 Ga0496100_0561651
2787 Ga0496101_0915559
2788 Ga0496102_0003035
2789 Ga0496102_0003155
2790 Ga0496102_0757323
2791 Ga0496102_1378167
2792 Ga0496102_1627729
2793 Ga0496103_0000903
2794 Ga0496103_0001742
2795 Ga0496104_0082332
2796 Ga0496105_0005151
2797 Ga0496105_0197990
2798 Ga0496106_0182822
2799 Ga0496107_0194779
2800 Ga0496107_0580837
2801 Ga0496108_0519986
2802 Ga0496108_1257974
2803 Ga0496109_0296717
2804 Ga0496109_0882846
2805 Ga0496110_0774142
2806 Ga0496111_0009790
2807 Ga0496111_0129586
2808 Ga0496111_1045338
2809 Ga0496112_1451392
2810 Ga0496113_0811620
2811 Ga0496113_1336816
2812 Ga0496114_0007549
2813 Ga0496115_0002111
2814 Ga0496115_0002506
2815 Ga0496116_0024085
2816 Ga0496116_0091775
2817 Ga0496116_0483207
2818 Ga0496117_0000324
2819 Ga0496117_0005438
2820 Ga0496117_0034695
2821 Ga0496117_0062804
2822 Ga0496117_0117705
2823 Ga0496118_0002151
2824 Ga0496118_0004152
2825 Ga0496118_0017136
2826 Ga0496118_0019807
2827 Ga0496118_0117741
2828 Ga0496119_0006610
2829 Ga0496119_0047821
2830 Ga0496119_0329689
2831 Ga0496120_0093468
2832 Ga0496120_0275078
2833 Ga0496120_0439828
2834 Ga0496121_0001314
2835 Ga0496121_0002794
2836 Ga0496121_0038248
2837 Ga0496121_0040520
2838 Ga0496121_0050670
2839 Ga0496121_0052395
2840 Ga0496121_0276551
2841 Ga0496122_0001531
2842 Ga0496122_0055074
2843 Ga0496122_0112139
2844 Ga0496122_0256430
2845 Ga0496122_0360994
2846 Ga0496123_0001418
2847 Ga0496123_0016952
2848 Ga0496123_0022246
2849 Ga0496123_0070087
2850 Ga0496123_0176423
2851 Ga0496123_0294026
2852 Ga0496123_0431617
2853 Ga0496124_0000351
2854 Ga0496124_0005829
2855 Ga0496124_0014083
2856 Ga0496124_0040538
2857 Ga0496124_0052819
2858 Ga0496124_0085511
2859 Ga0496124_0744331
2860 Ga0496125_0003470
2861 Ga0496125_0198394
2862 Ga0496125_0729088
2863 Ga0496126_0002155
2864 Ga0496126_0127852
2865 Ga0496126_0304599
2866 Ga0496126_0542348
2867 Ga0496126_0609894
2868 Ga0496126_0855323
2869 Ga0496126_0886973
2870 Ga0496126_1093170
2871 Ga0496126_1276051
2872 Ga0501306_063096
2873 Ga0501308_086036
2874 Ga0495678_068202
2875 Ga0495678_088048
2876 Ga0495682_0008950
2877 Ga0501290_000352
2878 Ga0501290_006382
2879 Ga0501292_000088
2880 Ga0501294_000241
2881 Ga0501299_092320
2882 Ga0501300_003094
2883 Ga0501300_006532
2884 Ga0501314_000002
2885 Ga0501314_013552
2886 Ga0501315_002307
2887 Ga0501315_012821
2888 Ga0501315_051550
2889 Ga0501317_001577
2890 Ga0501317_018595
2891 Ga0501318_029866
2892 Ga0501321_068786
2893 Ga0501323_001589
2894 Ga0501324_027655
2895 Ga0501333_008957
2896 Ga0501334_14279
2897 Ga0501335_038136
2898 Ga0501335_047919
2899 Ga0501338_09186
2900 Ga0501338_12382
2901 Ga0501031_0035501
2902 Ga0501032_0011615
2903 Ga0501032_0901662
2904 Ga0501033_0133191
2905 Ga0501033_0649458
2906 Ga0501034_0007538
2907 Ga0501034_0027253
2908 Ga0501034_0082782
2909 Ga0501034_0647934
2910 Ga0501034_0982730
2911 Ga0501036_0050187
2912 Ga0501036_1539549
2913 Ga0501037_0046965
2914 Ga0501038_0052443
2915 Ga0501039_0005639
2916 Ga0501043_0075885
2917 Ga0501043_0885135
2918 Ga0501046_0389609
2919 Ga0501047_0032215
2920 Ga0501047_0144807
2921 Ga0501047_0427174
2922 Ga0501047_0850754
2923 Ga0501048_0109379
2924 Ga0501069_0035055
2925 Ga0501070_0027529
2926 Ga0501071_1605970
2927 Ga0501206_000112
2928 Ga0501222_000376
2929 Ga0501223_002540
2930 Ga0501223_019504
2931 Ga0501223_036026
2932 Ga0501224_000009
2933 Ga0501224_000219
2934 Ga0501227_008045
2935 Ga0501233_000279
2936 Ga0501235_000736
2937 Ga0501235_002385
2938 Ga0501257_000052
2939 Ga0501261_000417
2940 Ga0501225_0000094
2941 Ga0501241_025197
2942 Ga0501276_009720
2943 Ga0501279_000074
2944 Ga0501280_000191
2945 Ga0501280_012759
2946 Ga0501281_00081
2947 Ga0501282_000381
2948 Ga0501282_001529
2949 Ga0501035_0013966
2950 Ga0501035_0492686
2951 Ga0501035_0886643
2952 Ga0501035_1498850
2953 Ga0501044_0055624
2954 Ga0501044_0102207
2955 Ga0501044_0324206
2956 Ga0501044_0633561
2957 Ga0501045_0671437
2958 Ga0501226_000076
2959 nmdc:mga03683_313206_c1
2960 nmdc:mga00v17_3387_c2
2961 nmdc:mga00v17_538492_c1
2962 nmdc:mga00v17_784798_c1
2963 nmdc:mga0yw44_1193152_c1
2964 nmdc:mga0k408_30694_c1
2965 nmdc:mga0k408_398724_c1
2966 nmdc:mga0k408_501721_c1
2967 nmdc:mga0k408_748769_c1
2968 nmdc:mga07m45_16117_c1
2969 nmdc:mga07m45_186221_c1
2970 nmdc:mga07m45_84920_c1
2971 nmdc:mga05p37_847024_c1
2972 nmdc:mga0qj67_1518855_c1
2973 nmdc:mga0n895_418106_c1
2974 nmdc:mga0n895_823850_c1
2975 nmdc:mga0sz30_105445_c1
2976 nmdc:mga0sz30_99383_c1
2977 Ga0500610_0000216
2978 Ga0500643_000134
2979 Ga0500643_003488
2980 Ga0500643_005556
2981 Ga0500643_026980
2982 Ga0500643_088711
2983 Ga0500643_088712
2984 Ga0500643_137458
2985 Ga0500644_0260304
2986 Ga0500646_0091936
2987 Ga0500647_0213226
2988 Ga0500651_0120217
2989 Ga0500651_0352155
2990 Ga0500566_0039514
2991 Ga0500555_001780
2992 Ga0500556_0246324
2993 Ga0500556_0315331
2994 Ga0500592_001405
2995 Ga0500592_001411
2996 Ga0500592_010909
2997 Ga0500592_054166
2998 Ga0500595_017021
2999 Ga0500618_017029
3000 Ga0500655_000265
3001 Ga0500658_0004652
3002 Ga0500658_0036311
3003 Ga0500658_0070509
3004 Ga0500658_0503432
3005 Ga0500559_0343820
3006 Ga0500568_0013737
3007 Ga0500568_0022667
3008 Ga0500568_0033063
3009 Ga0500573_0000559
3010 Ga0500573_0327745
3011 Ga0500573_0409230
3012 Ga0500573_0456536
3013 Ga0500577_0504599
3014 Ga0500590_004805
3015 Ga0500604_0000014
3016 Ga0500604_0017943
3017 Ga0500604_0299102
3018 Ga0500604_0315302
3019 Ga0500616_0000591
3020 Ga0500616_0030468
3021 Ga0500616_0083831
3022 Ga0500619_136027
3023 Ga0500627_0000009
3024 Ga0500627_0000899
3025 Ga0500627_0027229
3026 Ga0500627_0042078
3027 Ga0500627_0378000
3028 Ga0500636_0047080
3029 Ga0500636_0539332
3030 Ga0500645_000002
3031 Ga0500645_162740
3032 Ga0587084_022267
3033 Ga0587084_041804
3034 Ga0587070_116903
3035 Ga0587077_060294
3036 Ga0587077_085234
3037 Ga0587077_106908
3038 Ga0587077_188520
3039 Ga0587090_135625
3040 Ga0587098_014146
3041 Ga0587106_030729
3042 Ga0587101_102335
3043 Ga0587062_043481
3044 Ga0587069_047511
3045 Ga0587072_051597
3046 Ga0587076_052651
3047 Ga0587078_042375
3048 Ga0587102_016703
3049 Ga0587107_030945
3050 Ga0587108_025880
3051 Ga0587071_088394
3052 Ga0587111_0148151
3053 Ga0587111_0211339
3054 Ga0587111_0275893
3055 Ga0501082_1880845
3056 Ga0466962_0357974

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

4

54

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6enu-assembly1.cif.gz_Z polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) 0.9811 1 58
7ac7-assembly1.cif.gz_Z structure of accomodated trans-translation complex on e. coli stalled ribosome. 0.9794 4 58
8g34-assembly1.cif.gz_Z time-resolved cryo-em study of the 70s recycling by the hflx:1st intermediate 0.9768 1 58
7nhn-assembly1.cif.gz_3 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9758 4 58
5kpw-assembly1.cif.gz_Y structure of rela bound to ribosome in presence of a/r trna (structure iii) 0.9752 1 58
ID Description Score Start End Superfamily
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9767 2 58 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9712 2 58 3.30.1390.20
4tomZ00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.969 1 58 3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9684 2 58 3.30.1390.20
af_P9WHA3_1_65_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9655 1 57 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A7Y6YUC8-F1-model_v4 Large ribosomal subunit protein uL30 1.008 2 58 GO:0003735
GO:0006412
GO:0022625
AF-A0A212RIZ1-F1-model_v4 Large ribosomal subunit protein uL30 1.007 2 58 GO:0003735
GO:0006412
GO:0022625
AF-Q98N39-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 1.006 3 58 GO:0003735
GO:0006412
GO:0022625
AF-A0A849I581-F1-model_v4 Large ribosomal subunit protein uL30 1.006 2 57 GO:0003735
GO:0006412
GO:0022625
AF-V4NU65-F1-model_v4 Large ribosomal subunit protein uL30 1.005 2 58 GO:0003735
GO:0006412
GO:0022625

Map