F494582
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1528 | 595 | 1433 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10002383|Ga0105240_1000238315 |
| Length | 358 |
| Sequence | MSAILSKSANENVMEKSVTAAAKTTLSEKPKRGLGRGLDALFGDAEQKPAIRNEKIEALTSEISSTVSGLSSQGPRTLPITALIPTPFQPRKTFAVEDMTALVNSIRMHGILQPLIVRAAPGQDSKYEIIAGERRWRAAQQAQLHEVPVIIKSLDDRQTLEIALIENIQRADLTPIEEAEGYQRLMTEFGHTQEELSNIVGKSRSHMSNIMRLLQLPERVRDMVARGDLPAGAARILVGLDKAETIAQHALRKRMSVRQLERFVARLKRPPTLSPLKRMTPQKLNDRKRAKRDGGFSDIDYPMPKDADVLALEAEMGALLGLKIDIQSATDGSGVLGVYFSSLDQLDELLQKMAGVKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 5 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 6 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 7 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 8 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 9 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 10 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 11 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 12 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 13 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 14 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 15 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 16 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 17 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 18 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 19 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 20 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 21 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 22 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 23 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 24 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 25 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 26 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 27 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 28 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 29 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 30 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 31 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 32 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 33 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 34 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 35 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 36 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 37 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 38 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 39 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 40 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 41 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 42 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 43 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 44 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 45 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 46 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 47 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 48 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 49 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 50 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 51 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 52 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 53 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 54 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 55 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 56 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 57 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 58 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 59 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 60 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 61 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 62 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 63 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 64 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 65 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 66 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 67 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 68 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 69 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 70 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 71 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 72 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 73 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 74 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 75 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 76 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 77 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 78 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 79 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 80 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 81 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 82 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 83 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 84 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 85 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 86 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 87 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 88 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 89 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 90 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 91 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 92 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 93 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 94 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 95 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 96 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 97 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 98 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 99 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 100 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 101 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 102 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 103 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 104 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 105 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 106 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 107 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 108 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 109 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 116 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 119 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 139 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 144 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 145 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 146 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 149 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 150 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 152 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 157 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 159 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 160 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 161 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 163 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 164 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 165 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 166 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 167 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 168 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 169 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 170 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 171 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 172 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 173 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 174 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 175 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 177 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 178 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 179 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 180 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 181 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 182 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 184 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 185 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 186 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 187 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 188 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 189 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 190 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 191 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 192 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 193 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 195 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 196 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 197 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 226 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 229 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 230 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 231 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 233 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 234 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 235 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 236 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 238 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 239 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 240 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 242 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 245 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 248 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 315 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 322 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 323 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 327 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 328 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 329 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 330 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 331 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 332 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 333 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 334 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 335 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 336 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 337 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 338 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 339 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 340 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 341 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 342 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 343 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 344 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 345 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 346 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 347 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 348 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 349 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 350 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 351 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 352 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 353 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 354 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 355 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 356 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 357 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 358 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 359 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 360 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 361 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 362 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 363 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 365 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 366 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 367 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 368 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 369 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 370 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 371 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 372 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 373 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 374 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 375 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 376 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 377 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 378 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 379 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 380 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 381 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 382 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 383 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 384 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 385 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 386 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 387 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 388 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 389 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 390 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 391 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 392 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 393 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 394 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 395 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 396 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 397 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 398 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 399 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 400 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 401 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 402 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 403 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 404 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 405 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 406 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 407 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 408 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 409 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 410 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 411 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 412 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 413 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 414 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 415 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 416 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 417 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 418 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 419 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 420 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 421 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 422 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 423 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 424 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 425 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 426 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 481 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 482 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 483 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 484 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 485 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 486 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 487 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 488 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 489 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 490 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 491 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 492 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 493 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 494 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 495 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 496 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 497 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 498 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 499 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 500 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 501 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 502 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 503 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 504 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 505 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 506 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 529 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 533 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 534 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 535 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 538 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 539 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 540 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 547 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 548 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 549 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 552 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 555 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 556 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 557 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 558 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 559 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 560 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 561 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 562 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 563 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 564 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 565 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 566 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 567 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 568 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 569 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 570 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 571 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 572 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 573 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 574 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 575 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 576 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 577 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 578 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 579 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 580 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 581 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 582 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 583 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 584 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 587 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 588 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 589 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 590 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 591 | 8015556637 | Bdellovibrio reynosensis LBG001 | Isolate | Rhizosphere |
| 592 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 593 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 594 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 595 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.59 |
| Metatranscriptomes | 0.2 |
| Isolates | 6.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.07 |
| Bulb | 0 |
| Endosphere | 8.9 |
| Nodule | 1.64 |
| Rhizoplane | 3.27 |
| Rhizosphere | 76.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006249 | 3300001979 | Bacteria | 4954 |
| 2 | JGI24740J21852_10035217 | 3300001979 | Bacteria | 1567 |
| 3 | JGI24739J22299_10004554 | 3300001989 | Bacteria | 5300 |
| 4 | JGI24737J22298_10000027 | 3300001990 | Bacteria | 43503 |
| 5 | JGI24743J22301_10018467 | 3300001991 | Bacteria | 1318 |
| 6 | JGI24735J21928_10011843 | 3300002067 | Bacteria | 2760 |
| 7 | JGI24745J21846_1008512 | 3300002073 | Bacteria | 1157 |
| 8 | JGI24738J21930_10000290 | 3300002075 | Bacteria | 13746 |
| 9 | JGI25150J39212_1000067 | 3300002774 | Bacteria | 63491 |
| 10 | JGI25151J46595_10000088 | 3300003187 | Bacteria | 124209 |
| 11 | JGI25151J46595_10023969 | 3300003187 | Bacteria | 2504 |
| 12 | JGI25153J46596_10000125 | 3300003215 | Bacteria | 86065 |
| 13 | rootH2_10006857 | 3300003320 | Bacteria | 5272 |
| 14 | rootH2_10118832 | 3300003320 | Bacteria | 2220 |
| 15 | rootH2_10196566 | 3300003320 | Bacteria | 1809 |
| 16 | Ga0055526_1001485 | 3300003771 | Bacteria | 16637 |
| 17 | Ga0055537_1000989 | 3300003773 | Bacteria | 12883 |
| 18 | Ga0055524_1000399 | 3300003775 | Bacteria | 37137 |
| 19 | Ga0055524_1019185 | 3300003775 | Bacteria | 2346 |
| 20 | Ga0055524_1032968 | 3300003775 | Bacteria | 1458 |
| 21 | Ga0055536_1015229 | 3300003781 | Bacteria | 2646 |
| 22 | Ga0055536_1026679 | 3300003781 | Bacteria | 1615 |
| 23 | Ga0055534_1000307 | 3300003784 | Bacteria | 32970 |
| 24 | Ga0055534_1011959 | 3300003784 | Bacteria | 1740 |
| 25 | Ga0055528_1000402 | 3300003790 | Bacteria | 35107 |
| 26 | Ga0055530_10000735 | 3300003791 | Bacteria | 27312 |
| 27 | Ga0055530_10014468 | 3300003791 | Bacteria | 2626 |
| 28 | Ga0055531_10012552 | 3300003794 | Bacteria | 3975 |
| 29 | Ga0055531_10016237 | 3300003794 | Bacteria | 3223 |
| 30 | Ga0055531_10043335 | 3300003794 | Bacteria | 1274 |
| 31 | Ga0058692_1000003 | 3300003856 | Bacteria | 435295 |
| 32 | Ga0058692_1000004 | 3300003856 | Bacteria | 431119 |
| 33 | Ga0065165_1020124 | 3300005262 | Bacteria | 2361 |
| 34 | Ga0065165_1021928 | 3300005262 | Bacteria | 2205 |
| 35 | Ga0065703_1000145 | 3300005272 | Bacteria | 90784 |
| 36 | Ga0070658_10020917 | 3300005327 | Bacteria | 5241 |
| 37 | Ga0070658_10024326 | 3300005327 | Bacteria | 4859 |
| 38 | Ga0070658_10044630 | 3300005327 | Bacteria | 3583 |
| 39 | Ga0070658_10101204 | 3300005327 | Bacteria | 2382 |
| 40 | Ga0070658_10308606 | 3300005327 | Bacteria | 1350 |
| 41 | Ga0070676_10021382 | 3300005328 | Bacteria | 3623 |
| 42 | Ga0070676_10041747 | 3300005328 | Bacteria | 2661 |
| 43 | Ga0070683_100000479 | 3300005329 | Bacteria | 28115 |
| 44 | Ga0070690_100006566 | 3300005330 | Bacteria | 6605 |
| 45 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 46 | Ga0070670_100000004 | 3300005331 | Bacteria | 392110 |
| 47 | Ga0070670_100000594 | 3300005331 | Bacteria | 28632 |
| 48 | Ga0070670_100034634 | 3300005331 | Bacteria | 4345 |
| 49 | Ga0070670_100040649 | 3300005331 | Bacteria | 3997 |
| 50 | Ga0070670_100045694 | 3300005331 | Bacteria | 3765 |
| 51 | Ga0070677_10031905 | 3300005333 | Bacteria | 2017 |
| 52 | Ga0070677_10057510 | 3300005333 | Bacteria | 1594 |
| 53 | Ga0068869_100000085 | 3300005334 | Bacteria | 42599 |
| 54 | Ga0068869_100016059 | 3300005334 | Bacteria | 5040 |
| 55 | Ga0068869_100130623 | 3300005334 | Bacteria | 1930 |
| 56 | Ga0070666_10000196 | 3300005335 | Bacteria | 41189 |
| 57 | Ga0070666_10022684 | 3300005335 | Bacteria | 4079 |
| 58 | Ga0070666_10086933 | 3300005335 | Bacteria | 2142 |
| 59 | Ga0070666_10153050 | 3300005335 | Bacteria | 1609 |
| 60 | Ga0070680_100001064 | 3300005336 | Bacteria | 19679 |
| 61 | Ga0070680_100059100 | 3300005336 | Bacteria | 3136 |
| 62 | Ga0070680_100069759 | 3300005336 | Bacteria | 2886 |
| 63 | Ga0068868_100020324 | 3300005338 | Bacteria | 4986 |
| 64 | Ga0068868_100245841 | 3300005338 | Bacteria | 1504 |
| 65 | Ga0068868_100655641 | 3300005338 | Bacteria | 935 |
| 66 | Ga0070660_100000881 | 3300005339 | Bacteria | 20070 |
| 67 | Ga0070660_100002726 | 3300005339 | Bacteria | 12131 |
| 68 | Ga0070660_100036408 | 3300005339 | Bacteria | 3728 |
| 69 | Ga0070660_100173126 | 3300005339 | Bacteria | 1744 |
| 70 | Ga0070691_10000339 | 3300005341 | Bacteria | 16574 |
| 71 | Ga0070661_100000367 | 3300005344 | Bacteria | 35651 |
| 72 | Ga0070661_100004478 | 3300005344 | Bacteria | 9635 |
| 73 | Ga0070661_100087461 | 3300005344 | Bacteria | 2305 |
| 74 | Ga0070692_10010249 | 3300005345 | Bacteria | 4258 |
| 75 | Ga0070692_10019127 | 3300005345 | Bacteria | 3303 |
| 76 | Ga0070668_100001643 | 3300005347 | Bacteria | 16208 |
| 77 | Ga0070668_100002624 | 3300005347 | Bacteria | 13203 |
| 78 | Ga0070668_100002646 | 3300005347 | Bacteria | 13158 |
| 79 | Ga0070668_100007344 | 3300005347 | Bacteria | 8172 |
| 80 | Ga0070668_100029834 | 3300005347 | Bacteria | 4143 |
| 81 | Ga0070668_100037808 | 3300005347 | Bacteria | 3688 |
| 82 | Ga0070668_100045394 | 3300005347 | Bacteria | 3371 |
| 83 | Ga0070668_100059844 | 3300005347 | Bacteria | 2949 |
| 84 | Ga0070668_100089906 | 3300005347 | Bacteria | 2419 |
| 85 | Ga0070668_100550602 | 3300005347 | Bacteria | 1004 |
| 86 | Ga0070669_100000693 | 3300005353 | Bacteria | 24733 |
| 87 | Ga0070669_100012016 | 3300005353 | Bacteria | 6144 |
| 88 | Ga0070669_100085027 | 3300005353 | Bacteria | 2362 |
| 89 | Ga0070669_100096073 | 3300005353 | Bacteria | 2229 |
| 90 | Ga0070669_100128352 | 3300005353 | Bacteria | 1942 |
| 91 | Ga0070669_100344635 | 3300005353 | Bacteria | 1208 |
| 92 | Ga0070669_100382442 | 3300005353 | Bacteria | 1148 |
| 93 | Ga0070675_100000494 | 3300005354 | Bacteria | 26992 |
| 94 | Ga0070675_100007745 | 3300005354 | Bacteria | 8312 |
| 95 | Ga0070671_100000094 | 3300005355 | Bacteria | 55801 |
| 96 | Ga0070671_100001151 | 3300005355 | Bacteria | 19661 |
| 97 | Ga0070671_100018580 | 3300005355 | Bacteria | 5648 |
| 98 | Ga0070671_100036951 | 3300005355 | Bacteria | 4050 |
| 99 | Ga0070671_100037740 | 3300005355 | Bacteria | 4008 |
| 100 | Ga0070671_100241098 | 3300005355 | Bacteria | 1535 |
| 101 | Ga0070673_100000450 | 3300005364 | Bacteria | 21787 |
| 102 | Ga0070673_100001037 | 3300005364 | Bacteria | 15753 |
| 103 | Ga0070673_100415190 | 3300005364 | Bacteria | 1206 |
| 104 | Ga0070673_100583722 | 3300005364 | Bacteria | 1018 |
| 105 | Ga0070659_100000525 | 3300005366 | Bacteria | 28016 |
| 106 | Ga0070659_100005172 | 3300005366 | Bacteria | 9360 |
| 107 | Ga0070659_100008001 | 3300005366 | Bacteria | 7708 |
| 108 | Ga0070659_100101906 | 3300005366 | Bacteria | 2311 |
| 109 | Ga0070659_100179570 | 3300005366 | Bacteria | 1737 |
| 110 | Ga0070667_100000018 | 3300005367 | Bacteria | 226033 |
| 111 | Ga0070667_100000105 | 3300005367 | Bacteria | 106633 |
| 112 | Ga0070667_100017242 | 3300005367 | Bacteria | 5982 |
| 113 | Ga0070667_100042224 | 3300005367 | Bacteria | 3826 |
| 114 | Ga0070667_100070257 | 3300005367 | Bacteria | 2980 |
| 115 | Ga0070667_100077172 | 3300005367 | Bacteria | 2845 |
| 116 | Ga0070667_100371318 | 3300005367 | Bacteria | 1298 |
| 117 | Ga0070703_10023665 | 3300005406 | Bacteria | 1810 |
| 118 | Ga0070709_10000408 | 3300005434 | Bacteria | 26266 |
| 119 | Ga0070709_10076039 | 3300005434 | Bacteria | 2180 |
| 120 | Ga0070714_100001453 | 3300005435 | Bacteria | 17267 |
| 121 | Ga0070714_100029776 | 3300005435 | Bacteria | 4540 |
| 122 | Ga0070714_100093073 | 3300005435 | Bacteria | 2643 |
| 123 | Ga0070714_100120992 | 3300005435 | Bacteria | 2329 |
| 124 | Ga0070714_100140544 | 3300005435 | Bacteria | 2167 |
| 125 | Ga0070714_100152309 | 3300005435 | Bacteria | 2085 |
| 126 | Ga0070714_100315143 | 3300005435 | Bacteria | 1461 |
| 127 | Ga0070713_100000333 | 3300005436 | Bacteria | 30842 |
| 128 | Ga0070713_100065121 | 3300005436 | Bacteria | 3060 |
| 129 | Ga0070713_100343897 | 3300005436 | Bacteria | 1383 |
| 130 | Ga0070713_100439166 | 3300005436 | Bacteria | 1224 |
| 131 | Ga0070710_10056604 | 3300005437 | Bacteria | 2219 |
| 132 | Ga0070701_10003150 | 3300005438 | Bacteria | 6474 |
| 133 | Ga0070711_100000012 | 3300005439 | Bacteria | 162760 |
| 134 | Ga0070711_100020963 | 3300005439 | Bacteria | 4221 |
| 135 | Ga0070711_100040037 | 3300005439 | Bacteria | 3159 |
| 136 | Ga0070705_100010706 | 3300005440 | Bacteria | 4600 |
| 137 | Ga0070694_100014006 | 3300005444 | Bacteria | 5015 |
| 138 | Ga0070694_100073799 | 3300005444 | Bacteria | 2357 |
| 139 | Ga0070708_100038486 | 3300005445 | Bacteria | 4178 |
| 140 | Ga0070708_100102582 | 3300005445 | Bacteria | 2621 |
| 141 | Ga0070708_100320058 | 3300005445 | Bacteria | 1461 |
| 142 | Ga0070663_100012890 | 3300005455 | Bacteria | 5307 |
| 143 | Ga0070663_100016335 | 3300005455 | Bacteria | 4819 |
| 144 | Ga0070663_100033858 | 3300005455 | Bacteria | 3533 |
| 145 | Ga0070663_100090888 | 3300005455 | Bacteria | 2261 |
| 146 | Ga0070663_100098725 | 3300005455 | Bacteria | 2176 |
| 147 | Ga0070663_100175187 | 3300005455 | Bacteria | 1660 |
| 148 | Ga0070663_100205742 | 3300005455 | Bacteria | 1538 |
| 149 | Ga0070663_100533523 | 3300005455 | Bacteria | 979 |
| 150 | Ga0070678_100001072 | 3300005456 | Bacteria | 14312 |
| 151 | Ga0070662_100000337 | 3300005457 | Bacteria | 28132 |
| 152 | Ga0070662_100006493 | 3300005457 | Bacteria | 7543 |
| 153 | Ga0070662_100173389 | 3300005457 | Bacteria | 1695 |
| 154 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 155 | Ga0070681_10050441 | 3300005458 | Bacteria | 4152 |
| 156 | Ga0070681_10081458 | 3300005458 | Bacteria | 3192 |
| 157 | Ga0070681_10095301 | 3300005458 | Bacteria | 2925 |
| 158 | Ga0070681_10331300 | 3300005458 | Bacteria | 1432 |
| 159 | Ga0068867_100000661 | 3300005459 | Bacteria | 22832 |
| 160 | Ga0068867_100013925 | 3300005459 | Bacteria | 5693 |
| 161 | Ga0068867_100018820 | 3300005459 | Bacteria | 4913 |
| 162 | Ga0068867_100097947 | 3300005459 | Bacteria | 2235 |
| 163 | Ga0068867_100196206 | 3300005459 | Bacteria | 1614 |
| 164 | Ga0070685_10000001 | 3300005466 | Bacteria | 349867 |
| 165 | Ga0070707_100132587 | 3300005468 | Bacteria | 2423 |
| 166 | Ga0070707_100162041 | 3300005468 | Bacteria | 2179 |
| 167 | Ga0070699_100325758 | 3300005518 | Bacteria | 1381 |
| 168 | Ga0070679_100000393 | 3300005530 | Bacteria | 37212 |
| 169 | Ga0070679_100053554 | 3300005530 | Bacteria | 4016 |
| 170 | Ga0070679_100131470 | 3300005530 | Bacteria | 2484 |
| 171 | Ga0070679_100427856 | 3300005530 | Bacteria | 1269 |
| 172 | Ga0070679_100497223 | 3300005530 | Bacteria | 1163 |
| 173 | Ga0070684_100005553 | 3300005535 | Bacteria | 9679 |
| 174 | Ga0070684_100037546 | 3300005535 | Bacteria | 4156 |
| 175 | Ga0070697_100453361 | 3300005536 | Bacteria | 1117 |
| 176 | Ga0068853_100001563 | 3300005539 | Bacteria | 16668 |
| 177 | Ga0068853_100009596 | 3300005539 | Bacteria | 7798 |
| 178 | Ga0068853_100018318 | 3300005539 | Bacteria | 5794 |
| 179 | Ga0068853_100022918 | 3300005539 | Bacteria | 5221 |
| 180 | Ga0068853_100151898 | 3300005539 | Bacteria | 2085 |
| 181 | Ga0068853_100174136 | 3300005539 | Bacteria | 1948 |
| 182 | Ga0068853_100262942 | 3300005539 | Bacteria | 1587 |
| 183 | Ga0070672_100000296 | 3300005543 | Bacteria | 28119 |
| 184 | Ga0070672_100000476 | 3300005543 | Bacteria | 23318 |
| 185 | Ga0070672_100026242 | 3300005543 | Bacteria | 4332 |
| 186 | Ga0070672_100050260 | 3300005543 | Bacteria | 3247 |
| 187 | Ga0070672_100071046 | 3300005543 | Bacteria | 2768 |
| 188 | Ga0070696_100006623 | 3300005546 | Bacteria | 7738 |
| 189 | Ga0070693_100012809 | 3300005547 | Bacteria | 4255 |
| 190 | Ga0070693_100132027 | 3300005547 | Bacteria | 1562 |
| 191 | Ga0070665_100000198 | 3300005548 | Bacteria | 105999 |
| 192 | Ga0070665_100001194 | 3300005548 | Bacteria | 31673 |
| 193 | Ga0070665_100001860 | 3300005548 | Bacteria | 23948 |
| 194 | Ga0070665_100017715 | 3300005548 | Bacteria | 7152 |
| 195 | Ga0070665_100065392 | 3300005548 | Bacteria | 3648 |
| 196 | Ga0068855_100001289 | 3300005563 | Bacteria | 31088 |
| 197 | Ga0068855_100005557 | 3300005563 | Bacteria | 15384 |
| 198 | Ga0068855_100023996 | 3300005563 | Bacteria | 7301 |
| 199 | Ga0068855_100038242 | 3300005563 | Bacteria | 5702 |
| 200 | Ga0068855_100166484 | 3300005563 | Bacteria | 2498 |
| 201 | Ga0068855_100184752 | 3300005563 | Bacteria | 2355 |
| 202 | Ga0068855_100191262 | 3300005563 | Bacteria | 2308 |
| 203 | Ga0068855_100549981 | 3300005563 | Bacteria | 1250 |
| 204 | Ga0068855_100550001 | 3300005563 | Bacteria | 1250 |
| 205 | Ga0068855_100776242 | 3300005563 | Bacteria | 1020 |
| 206 | Ga0070664_100000600 | 3300005564 | Bacteria | 27546 |
| 207 | Ga0070664_100001724 | 3300005564 | Bacteria | 17517 |
| 208 | Ga0070664_100010937 | 3300005564 | Bacteria | 7359 |
| 209 | Ga0070664_100012159 | 3300005564 | Bacteria | 6993 |
| 210 | Ga0070664_100202865 | 3300005564 | Bacteria | 1770 |
| 211 | Ga0070664_100350159 | 3300005564 | Bacteria | 1343 |
| 212 | Ga0068857_100001000 | 3300005577 | Bacteria | 21722 |
| 213 | Ga0068857_100002588 | 3300005577 | Bacteria | 14836 |
| 214 | Ga0068857_100005605 | 3300005577 | Bacteria | 10728 |
| 215 | Ga0068857_100011431 | 3300005577 | Bacteria | 7724 |
| 216 | Ga0068857_100075772 | 3300005577 | Bacteria | 3000 |
| 217 | Ga0068857_100076319 | 3300005577 | Bacteria | 2988 |
| 218 | Ga0068857_100094324 | 3300005577 | Bacteria | 2680 |
| 219 | Ga0068857_100128607 | 3300005577 | Bacteria | 2283 |
| 220 | Ga0068854_100000173 | 3300005578 | Bacteria | 43694 |
| 221 | Ga0068854_100007111 | 3300005578 | Bacteria | 7146 |
| 222 | Ga0068854_100026474 | 3300005578 | Bacteria | 3987 |
| 223 | Ga0068854_100075177 | 3300005578 | Bacteria | 2480 |
| 224 | Ga0068854_100173356 | 3300005578 | Unclassified | 1680 |
| 225 | Ga0068854_100220678 | 3300005578 | Bacteria | 1500 |
| 226 | Ga0068854_100310618 | 3300005578 | Bacteria | 1278 |
| 227 | Ga0068856_100000601 | 3300005614 | Bacteria | 39402 |
| 228 | Ga0068856_100001518 | 3300005614 | Bacteria | 24335 |
| 229 | Ga0068856_100230290 | 3300005614 | Bacteria | 1868 |
| 230 | Ga0070702_100107149 | 3300005615 | Bacteria | 1725 |
| 231 | Ga0068852_100001015 | 3300005616 | Bacteria | 18527 |
| 232 | Ga0068852_100001638 | 3300005616 | Bacteria | 15290 |
| 233 | Ga0068852_100001646 | 3300005616 | Bacteria | 15247 |
| 234 | Ga0068852_100012767 | 3300005616 | Bacteria | 6397 |
| 235 | Ga0068852_100016058 | 3300005616 | Bacteria | 5830 |
| 236 | Ga0068852_100039171 | 3300005616 | Bacteria | 3989 |
| 237 | Ga0068852_100579662 | 3300005616 | Bacteria | 1124 |
| 238 | Ga0068859_100001231 | 3300005617 | Bacteria | 26157 |
| 239 | Ga0068859_100011216 | 3300005617 | Bacteria | 9013 |
| 240 | Ga0068859_100019995 | 3300005617 | Bacteria | 6723 |
| 241 | Ga0068859_100067314 | 3300005617 | Bacteria | 3616 |
| 242 | Ga0068859_100084896 | 3300005617 | Bacteria | 3211 |
| 243 | Ga0068859_100188938 | 3300005617 | Bacteria | 2144 |
| 244 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 245 | Ga0068864_100000082 | 3300005618 | Bacteria | 101182 |
| 246 | Ga0068864_100000106 | 3300005618 | Bacteria | 81202 |
| 247 | Ga0068864_100000953 | 3300005618 | Bacteria | 24235 |
| 248 | Ga0068864_100001870 | 3300005618 | Bacteria | 17284 |
| 249 | Ga0068864_100017157 | 3300005618 | Bacteria | 6038 |
| 250 | Ga0068866_10004891 | 3300005718 | Bacteria | 5504 |
| 251 | Ga0068861_100007289 | 3300005719 | Bacteria | 7580 |
| 252 | Ga0068861_100275365 | 3300005719 | Bacteria | 1447 |
| 253 | Ga0068851_10001580 | 3300005834 | Bacteria | 9997 |
| 254 | Ga0068851_10031422 | 3300005834 | Bacteria | 2637 |
| 255 | Ga0068870_10099198 | 3300005840 | Bacteria | 1643 |
| 256 | Ga0068863_100000079 | 3300005841 | Bacteria | 107383 |
| 257 | Ga0068863_100000560 | 3300005841 | Bacteria | 37696 |
| 258 | Ga0068863_100001401 | 3300005841 | Bacteria | 23908 |
| 259 | Ga0068863_100003508 | 3300005841 | Bacteria | 15478 |
| 260 | Ga0068863_100020113 | 3300005841 | Bacteria | 6386 |
| 261 | Ga0068863_100059457 | 3300005841 | Bacteria | 3615 |
| 262 | Ga0068863_100335835 | 3300005841 | Bacteria | 1469 |
| 263 | Ga0068863_100440106 | 3300005841 | Bacteria | 1278 |
| 264 | Ga0068858_100000006 | 3300005842 | Bacteria | 256011 |
| 265 | Ga0068858_100000561 | 3300005842 | Bacteria | 38777 |
| 266 | Ga0068858_100001052 | 3300005842 | Bacteria | 28522 |
| 267 | Ga0068858_100031660 | 3300005842 | Bacteria | 4914 |
| 268 | Ga0068858_100039178 | 3300005842 | Bacteria | 4395 |
| 269 | Ga0068858_100060498 | 3300005842 | Bacteria | 3501 |
| 270 | Ga0068858_100164293 | 3300005842 | Bacteria | 2091 |
| 271 | Ga0068858_100797493 | 3300005842 | Bacteria | 921 |
| 272 | Ga0068860_100000077 | 3300005843 | Bacteria | 171297 |
| 273 | Ga0068860_100005038 | 3300005843 | Bacteria | 13446 |
| 274 | Ga0068860_100005142 | 3300005843 | Bacteria | 13302 |
| 275 | Ga0068860_100005872 | 3300005843 | Bacteria | 12356 |
| 276 | Ga0068860_100017042 | 3300005843 | Bacteria | 7081 |
| 277 | Ga0068860_100020438 | 3300005843 | Bacteria | 6412 |
| 278 | Ga0068860_100099784 | 3300005843 | Bacteria | 2769 |
| 279 | Ga0068860_100212890 | 3300005843 | Bacteria | 1875 |
| 280 | Ga0068860_100321734 | 3300005843 | Bacteria | 1518 |
| 281 | Ga0068860_100474456 | 3300005843 | Bacteria | 1246 |
| 282 | Ga0068862_100000183 | 3300005844 | Bacteria | 68758 |
| 283 | Ga0068862_100006226 | 3300005844 | Bacteria | 9935 |
| 284 | Ga0068862_100022521 | 3300005844 | Bacteria | 5271 |
| 285 | Ga0068862_100023271 | 3300005844 | Bacteria | 5189 |
| 286 | Ga0068862_100024894 | 3300005844 | Bacteria | 5023 |
| 287 | Ga0068862_100026253 | 3300005844 | Bacteria | 4895 |
| 288 | Ga0068862_100026865 | 3300005844 | Bacteria | 4842 |
| 289 | Ga0068862_100038768 | 3300005844 | Bacteria | 4043 |
| 290 | Ga0068862_100135164 | 3300005844 | Bacteria | 2185 |
| 291 | Ga0068862_100203078 | 3300005844 | Bacteria | 1788 |
| 292 | Ga0081455_10001053 | 3300005937 | Bacteria | 34716 |
| 293 | Ga0081455_10001354 | 3300005937 | Bacteria | 30285 |
| 294 | Ga0081455_10010329 | 3300005937 | Bacteria | 9490 |
| 295 | Ga0081455_10034420 | 3300005937 | Bacteria | 4538 |
| 296 | Ga0081455_10034469 | 3300005937 | Bacteria | 4534 |
| 297 | Ga0081455_10042902 | 3300005937 | Bacteria | 3963 |
| 298 | Ga0081539_10003150 | 3300005985 | Bacteria | 20941 |
| 299 | Ga0081539_10010563 | 3300005985 | Bacteria | 7470 |
| 300 | Ga0081539_10013963 | 3300005985 | Bacteria | 5990 |
| 301 | Ga0070717_10099484 | 3300006028 | Bacteria | 2467 |
| 302 | Ga0075368_10045377 | 3300006042 | Bacteria | 1736 |
| 303 | Ga0075364_10000055 | 3300006051 | Bacteria | 41950 |
| 304 | Ga0075364_10001168 | 3300006051 | Bacteria | 14075 |
| 305 | Ga0075364_10072535 | 3300006051 | Bacteria | 2269 |
| 306 | Ga0075364_10084753 | 3300006051 | Bacteria | 2098 |
| 307 | Ga0070712_100000023 | 3300006175 | Bacteria | 80972 |
| 308 | Ga0070712_100000803 | 3300006175 | Bacteria | 18648 |
| 309 | Ga0070712_100077902 | 3300006175 | Bacteria | 2391 |
| 310 | Ga0070712_100139503 | 3300006175 | Bacteria | 1848 |
| 311 | Ga0070712_100331173 | 3300006175 | Bacteria | 1240 |
| 312 | Ga0075362_10015707 | 3300006177 | Bacteria | 3085 |
| 313 | Ga0075362_10052451 | 3300006177 | Bacteria | 1828 |
| 314 | Ga0075367_10051789 | 3300006178 | Bacteria | 2428 |
| 315 | Ga0075369_10074557 | 3300006186 | Bacteria | 1497 |
| 316 | Ga0097621_100002067 | 3300006237 | Bacteria | 13732 |
| 317 | Ga0097621_100366229 | 3300006237 | Bacteria | 1285 |
| 318 | Ga0075370_10257587 | 3300006353 | Bacteria | 1034 |
| 319 | Ga0068871_100001398 | 3300006358 | Bacteria | 16156 |
| 320 | Ga0068871_100164782 | 3300006358 | Bacteria | 1897 |
| 321 | Ga0075428_100022864 | 3300006844 | Bacteria | 6918 |
| 322 | Ga0075428_100235699 | 3300006844 | Bacteria | 1975 |
| 323 | Ga0075428_100308611 | 3300006844 | Bacteria | 1701 |
| 324 | Ga0075428_100421428 | 3300006844 | Bacteria | 1430 |
| 325 | Ga0075430_100072924 | 3300006846 | Bacteria | 2879 |
| 326 | Ga0075430_100180190 | 3300006846 | Bacteria | 1757 |
| 327 | Ga0075431_100018811 | 3300006847 | Bacteria | 7038 |
| 328 | Ga0075431_100151857 | 3300006847 | Bacteria | 2384 |
| 329 | Ga0075431_100232121 | 3300006847 | Bacteria | 1879 |
| 330 | Ga0075431_100410176 | 3300006847 | Bacteria | 1355 |
| 331 | Ga0075431_100658457 | 3300006847 | Bacteria | 1027 |
| 332 | Ga0075433_10007758 | 3300006852 | Bacteria | 8526 |
| 333 | Ga0075433_10055028 | 3300006852 | Bacteria | 3472 |
| 334 | Ga0075434_100027557 | 3300006871 | Bacteria | 5580 |
| 335 | Ga0075434_100090753 | 3300006871 | Bacteria | 3056 |
| 336 | Ga0075429_100059475 | 3300006880 | Bacteria | 3329 |
| 337 | Ga0068865_100000263 | 3300006881 | Bacteria | 28940 |
| 338 | Ga0068865_100116088 | 3300006881 | Bacteria | 1982 |
| 339 | Ga0075436_100000211 | 3300006914 | Bacteria | 36106 |
| 340 | Ga0075436_100000463 | 3300006914 | Bacteria | 26307 |
| 341 | Ga0075436_100032050 | 3300006914 | Bacteria | 3622 |
| 342 | Ga0075436_100035888 | 3300006914 | Bacteria | 3420 |
| 343 | Ga0097620_100001231 | 3300006931 | Bacteria | 26157 |
| 344 | Ga0097620_100011216 | 3300006931 | Bacteria | 9013 |
| 345 | Ga0097620_100019995 | 3300006931 | Bacteria | 6723 |
| 346 | Ga0097620_100067314 | 3300006931 | Bacteria | 3616 |
| 347 | Ga0097620_100084894 | 3300006931 | Bacteria | 3211 |
| 348 | Ga0097620_100188918 | 3300006931 | Bacteria | 2144 |
| 349 | Ga0079104_1000310 | 3300006946 | Bacteria | 61815 |
| 350 | Ga0075435_100002305 | 3300007076 | Bacteria | 12619 |
| 351 | Ga0075435_100077595 | 3300007076 | Bacteria | 2723 |
| 352 | Ga0075435_100160203 | 3300007076 | Unclassified | 1895 |
| 353 | Ga0099794_10080232 | 3300007265 | Bacteria | 1609 |
| 354 | Ga0105251_10019337 | 3300009011 | Bacteria | 3601 |
| 355 | Ga0105244_10026182 | 3300009036 | Bacteria | 3159 |
| 356 | Ga0105250_10030095 | 3300009092 | Bacteria | 2183 |
| 357 | Ga0105240_10000088 | 3300009093 | Bacteria | 186026 |
| 358 | Ga0105240_10000969 | 3300009093 | Bacteria | 51126 |
| 359 | Ga0105240_10001838 | 3300009093 | Bacteria | 35562 |
| 360 | Ga0105240_10002383 | 3300009093 | Bacteria | 30304 |
| 361 | Ga0105240_10003992 | 3300009093 | Bacteria | 22736 |
| 362 | Ga0105240_10007477 | 3300009093 | Bacteria | 15852 |
| 363 | Ga0105240_10027485 | 3300009093 | Bacteria | 7446 |
| 364 | Ga0105240_10066052 | 3300009093 | Bacteria | 4490 |
| 365 | Ga0105240_10135616 | 3300009093 | Bacteria | 2948 |
| 366 | Ga0111539_10119671 | 3300009094 | Bacteria | 3086 |
| 367 | Ga0105245_10000170 | 3300009098 | Bacteria | 61721 |
| 368 | Ga0105245_10277584 | 3300009098 | Bacteria | 1637 |
| 369 | Ga0105247_10000847 | 3300009101 | Bacteria | 23191 |
| 370 | Ga0105247_10031507 | 3300009101 | Bacteria | 3218 |
| 371 | Ga0105247_10216949 | 3300009101 | Bacteria | 1293 |
| 372 | Ga0114129_10000062 | 3300009147 | Bacteria | 96507 |
| 373 | Ga0114129_10055454 | 3300009147 | Bacteria | 5554 |
| 374 | Ga0114129_10143619 | 3300009147 | Bacteria | 3270 |
| 375 | Ga0114129_10222886 | 3300009147 | Bacteria | 2543 |
| 376 | Ga0105243_10000005 | 3300009148 | Bacteria | 576265 |
| 377 | Ga0105243_10011445 | 3300009148 | Bacteria | 6712 |
| 378 | Ga0105241_10390882 | 3300009174 | Bacteria | 1218 |
| 379 | Ga0105241_10540250 | 3300009174 | Bacteria | 1045 |
| 380 | Ga0105242_10002451 | 3300009176 | Bacteria | 14549 |
| 381 | Ga0105242_10327317 | 3300009176 | Bacteria | 1408 |
| 382 | Ga0105248_10000184 | 3300009177 | Bacteria | 72728 |
| 383 | Ga0105248_10000789 | 3300009177 | Bacteria | 35531 |
| 384 | Ga0105248_10002857 | 3300009177 | Bacteria | 19171 |
| 385 | Ga0105248_10005596 | 3300009177 | Bacteria | 13805 |
| 386 | Ga0105248_10011687 | 3300009177 | Bacteria | 9676 |
| 387 | Ga0105248_10013013 | 3300009177 | Bacteria | 9170 |
| 388 | Ga0105248_10014093 | 3300009177 | Bacteria | 8796 |
| 389 | Ga0105237_10054385 | 3300009545 | Bacteria | 4011 |
| 390 | Ga0105237_10061634 | 3300009545 | Bacteria | 3750 |
| 391 | Ga0105237_10185971 | 3300009545 | Bacteria | 2077 |
| 392 | Ga0105238_10001476 | 3300009551 | Bacteria | 23610 |
| 393 | Ga0105238_10002367 | 3300009551 | Bacteria | 18947 |
| 394 | Ga0105238_10232108 | 3300009551 | Bacteria | 1822 |
| 395 | Ga0105238_10283784 | 3300009551 | Bacteria | 1637 |
| 396 | Ga0105238_10402207 | 3300009551 | Bacteria | 1363 |
| 397 | Ga0105249_10000838 | 3300009553 | Bacteria | 27558 |
| 398 | Ga0105249_10014274 | 3300009553 | Bacteria | 7023 |
| 399 | Ga0105249_10015705 | 3300009553 | Bacteria | 6705 |
| 400 | Ga0105249_10042496 | 3300009553 | Bacteria | 4134 |
| 401 | Ga0105249_10100564 | 3300009553 | Bacteria | 2719 |
| 402 | Ga0105249_10170029 | 3300009553 | Bacteria | 2113 |
| 403 | Ga0105249_10408541 | 3300009553 | Bacteria | 1389 |
| 404 | Ga0105249_10598055 | 3300009553 | Bacteria | 1157 |
| 405 | Ga0105239_10001780 | 3300010375 | Bacteria | 28338 |
| 406 | Ga0105239_10014084 | 3300010375 | Bacteria | 8878 |
| 407 | Ga0105239_10039656 | 3300010375 | Bacteria | 5159 |
| 408 | Ga0105239_10056934 | 3300010375 | Bacteria | 4288 |
| 409 | Ga0105239_10080575 | 3300010375 | Bacteria | 3582 |
| 410 | Ga0105246_10007418 | 3300011119 | Bacteria | 6723 |
| 411 | Ga0105246_10037172 | 3300011119 | Bacteria | 3266 |
| 412 | Ga0157373_10001642 | 3300013100 | Bacteria | 17076 |
| 413 | Ga0157373_10097566 | 3300013100 | Bacteria | 2069 |
| 414 | Ga0157373_10123709 | 3300013100 | Bacteria | 1819 |
| 415 | Ga0157371_10002370 | 3300013102 | Bacteria | 18036 |
| 416 | Ga0157371_10002538 | 3300013102 | Bacteria | 17347 |
| 417 | Ga0157371_10100944 | 3300013102 | Bacteria | 2047 |
| 418 | Ga0157371_10106097 | 3300013102 | Bacteria | 1994 |
| 419 | Ga0157371_10167244 | 3300013102 | Bacteria | 1571 |
| 420 | Ga0157371_10365363 | 3300013102 | Bacteria | 1052 |
| 421 | Ga0157370_10005233 | 3300013104 | Bacteria | 14593 |
| 422 | Ga0157370_10013571 | 3300013104 | Bacteria | 8385 |
| 423 | Ga0157370_10029212 | 3300013104 | Bacteria | 5415 |
| 424 | Ga0157370_10093429 | 3300013104 | Bacteria | 2823 |
| 425 | Ga0157369_10016738 | 3300013105 | Bacteria | 8242 |
| 426 | Ga0157369_10053092 | 3300013105 | Bacteria | 4381 |
| 427 | Ga0157369_10087264 | 3300013105 | Bacteria | 3332 |
| 428 | Ga0157369_10180386 | 3300013105 | Bacteria | 2222 |
| 429 | Ga0157369_10752978 | 3300013105 | Bacteria | 1002 |
| 430 | Ga0157374_10000837 | 3300013296 | Bacteria | 26885 |
| 431 | Ga0157374_10031464 | 3300013296 | Bacteria | 4823 |
| 432 | Ga0157374_10082522 | 3300013296 | Bacteria | 3052 |
| 433 | Ga0157374_10475657 | 3300013296 | Unclassified | 1252 |
| 434 | Ga0157378_10000540 | 3300013297 | Bacteria | 35981 |
| 435 | Ga0157378_10001948 | 3300013297 | Bacteria | 18521 |
| 436 | Ga0157378_10010920 | 3300013297 | Bacteria | 7943 |
| 437 | Ga0157378_10294750 | 3300013297 | Bacteria | 1568 |
| 438 | Ga0157378_10424770 | 3300013297 | Bacteria | 1314 |
| 439 | Ga0157378_10465757 | 3300013297 | Bacteria | 1257 |
| 440 | Ga0163162_10006665 | 3300013306 | Bacteria | 11200 |
| 441 | Ga0163162_10027266 | 3300013306 | Bacteria | 5648 |
| 442 | Ga0163162_10032994 | 3300013306 | Bacteria | 5142 |
| 443 | Ga0163162_10049394 | 3300013306 | Bacteria | 4216 |
| 444 | Ga0163162_10238791 | 3300013306 | Bacteria | 1948 |
| 445 | Ga0163162_10244031 | 3300013306 | Bacteria | 1928 |
| 446 | Ga0163162_10253603 | 3300013306 | Bacteria | 1891 |
| 447 | Ga0163162_10412281 | 3300013306 | Bacteria | 1483 |
| 448 | Ga0163162_10618093 | 3300013306 | Bacteria | 1209 |
| 449 | Ga0157372_10033499 | 3300013307 | Bacteria | 5643 |
| 450 | Ga0157372_10065373 | 3300013307 | Bacteria | 4083 |
| 451 | Ga0157372_10071189 | 3300013307 | Bacteria | 3915 |
| 452 | Ga0157372_10148586 | 3300013307 | Bacteria | 2703 |
| 453 | Ga0157372_10222403 | 3300013307 | Bacteria | 2188 |
| 454 | Ga0157375_10000144 | 3300013308 | Bacteria | 70151 |
| 455 | Ga0157375_10002627 | 3300013308 | Bacteria | 15569 |
| 456 | Ga0157375_10266450 | 3300013308 | Bacteria | 1875 |
| 457 | Ga0163163_10000131 | 3300014325 | Bacteria | 76809 |
| 458 | Ga0163163_10000145 | 3300014325 | Bacteria | 74233 |
| 459 | Ga0163163_10008166 | 3300014325 | Bacteria | 9283 |
| 460 | Ga0163163_10017716 | 3300014325 | Bacteria | 6649 |
| 461 | Ga0163163_10194372 | 3300014325 | Bacteria | 2077 |
| 462 | Ga0163163_10656768 | 3300014325 | Bacteria | 1112 |
| 463 | Ga0163163_10725940 | 3300014325 | Bacteria | 1057 |
| 464 | Ga0157380_10072743 | 3300014326 | Bacteria | 2785 |
| 465 | Ga0157380_10110040 | 3300014326 | Bacteria | 2313 |
| 466 | Ga0157380_10134417 | 3300014326 | Bacteria | 2115 |
| 467 | Ga0182008_10000913 | 3300014497 | Bacteria | 20555 |
| 468 | Ga0182008_10006499 | 3300014497 | Bacteria | 6527 |
| 469 | Ga0182008_10049221 | 3300014497 | Bacteria | 2092 |
| 470 | Ga0157379_10002201 | 3300014968 | Bacteria | 16220 |
| 471 | Ga0157379_10004164 | 3300014968 | Bacteria | 12347 |
| 472 | Ga0157379_10004862 | 3300014968 | Bacteria | 11538 |
| 473 | Ga0157379_10007585 | 3300014968 | Bacteria | 9395 |
| 474 | Ga0157379_10018883 | 3300014968 | Bacteria | 6083 |
| 475 | Ga0157379_10066868 | 3300014968 | Bacteria | 3213 |
| 476 | Ga0157379_10083161 | 3300014968 | Bacteria | 2869 |
| 477 | Ga0157379_10123021 | 3300014968 | Bacteria | 2335 |
| 478 | Ga0157379_10162845 | 3300014968 | Bacteria | 2013 |
| 479 | Ga0157376_10004137 | 3300014969 | Bacteria | 10053 |
| 480 | Ga0157376_10130631 | 3300014969 | Bacteria | 2241 |
| 481 | Ga0157376_10543791 | 3300014969 | Bacteria | 1148 |
| 482 | Ga0182006_1050911 | 3300015261 | Bacteria | 1595 |
| 483 | Ga0182006_1052715 | 3300015261 | Bacteria | 1562 |
| 484 | Ga0182007_10000019 | 3300015262 | Bacteria | 194770 |
| 485 | Ga0182005_1000088 | 3300015265 | Bacteria | 69427 |
| 486 | Ga0163161_10001958 | 3300017792 | Bacteria | 14979 |
| 487 | Ga0163161_10020114 | 3300017792 | Bacteria | 4681 |
| 488 | Ga0213872_10001776 | 3300021361 | Bacteria | 13470 |
| 489 | Ga0213872_10072378 | 3300021361 | Bacteria | 1553 |
| 490 | Ga0213874_10004179 | 3300021377 | Bacteria | 3267 |
| 491 | Ga0213874_10043283 | 3300021377 | Bacteria | 1356 |
| 492 | Ga0213876_10008313 | 3300021384 | Bacteria | 5616 |
| 493 | Ga0213876_10065834 | 3300021384 | Bacteria | 1912 |
| 494 | Ga0213875_10003041 | 3300021388 | Bacteria | 9713 |
| 495 | Ga0213875_10073128 | 3300021388 | Bacteria | 1600 |
| 496 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 497 | Ga0209129_1000701 | 3300025258 | Bacteria | 21860 |
| 498 | Ga0209565_1000113 | 3300025263 | Bacteria | 116343 |
| 499 | Ga0209565_1000272 | 3300025263 | Bacteria | 52468 |
| 500 | Ga0209673_1000369 | 3300025273 | Bacteria | 81061 |
| 501 | Ga0209673_1013882 | 3300025273 | Bacteria | 3153 |
| 502 | Ga0209673_1019973 | 3300025273 | Bacteria | 2389 |
| 503 | Ga0209673_1028160 | 3300025273 | Bacteria | 1814 |
| 504 | Ga0209130_1005244 | 3300025284 | Bacteria | 4566 |
| 505 | Ga0209130_1017793 | 3300025284 | Bacteria | 1684 |
| 506 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 507 | Ga0209675_1000515 | 3300025291 | Bacteria | 28533 |
| 508 | Ga0209675_1005027 | 3300025291 | Bacteria | 5666 |
| 509 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 510 | Ga0209676_1000063 | 3300025292 | Bacteria | 322025 |
| 511 | Ga0209676_1000143 | 3300025292 | Bacteria | 175267 |
| 512 | Ga0209676_1001361 | 3300025292 | Bacteria | 24039 |
| 513 | Ga0209676_1001572 | 3300025292 | Bacteria | 20396 |
| 514 | Ga0209676_1001849 | 3300025292 | Bacteria | 17458 |
| 515 | Ga0209676_1005025 | 3300025292 | Bacteria | 7081 |
| 516 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 517 | Ga0209025_1000357 | 3300025294 | Bacteria | 98040 |
| 518 | Ga0209025_1001007 | 3300025294 | Bacteria | 41722 |
| 519 | Ga0209025_1001794 | 3300025294 | Bacteria | 25490 |
| 520 | Ga0209025_1004726 | 3300025294 | Bacteria | 11609 |
| 521 | Ga0209564_1000333 | 3300025295 | Bacteria | 91663 |
| 522 | Ga0209564_1001051 | 3300025295 | Bacteria | 33695 |
| 523 | Ga0209564_1026008 | 3300025295 | Bacteria | 1948 |
| 524 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 525 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 526 | Ga0209050_1000396 | 3300025298 | Bacteria | 81559 |
| 527 | Ga0209050_1001391 | 3300025298 | Bacteria | 26316 |
| 528 | Ga0209050_1001430 | 3300025298 | Bacteria | 25721 |
| 529 | Ga0209050_1021655 | 3300025298 | Bacteria | 2335 |
| 530 | Ga0209256_1000876 | 3300025299 | Bacteria | 37189 |
| 531 | Ga0209256_1002151 | 3300025299 | Bacteria | 17009 |
| 532 | Ga0209256_1005969 | 3300025299 | Bacteria | 6695 |
| 533 | Ga0209256_1008759 | 3300025299 | Bacteria | 4607 |
| 534 | Ga0207426_1012332 | 3300025302 | Bacteria | 3214 |
| 535 | Ga0209051_1000449 | 3300025303 | Bacteria | 54625 |
| 536 | Ga0209051_1000472 | 3300025303 | Bacteria | 52350 |
| 537 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 538 | Ga0209257_1000861 | 3300025304 | Bacteria | 43224 |
| 539 | Ga0209257_1001769 | 3300025304 | Bacteria | 23916 |
| 540 | Ga0209257_1002921 | 3300025304 | Bacteria | 15747 |
| 541 | Ga0209257_1003045 | 3300025304 | Bacteria | 15123 |
| 542 | Ga0209257_1003113 | 3300025304 | Bacteria | 14856 |
| 543 | Ga0209257_1004367 | 3300025304 | Bacteria | 11008 |
| 544 | Ga0209257_1006408 | 3300025304 | Bacteria | 7597 |
| 545 | Ga0209257_1008020 | 3300025304 | Bacteria | 6160 |
| 546 | Ga0209257_1018637 | 3300025304 | Bacteria | 2656 |
| 547 | Ga0209257_1049314 | 3300025304 | Bacteria | 1199 |
| 548 | Ga0207697_10000072 | 3300025315 | Bacteria | 43473 |
| 549 | Ga0207656_10002678 | 3300025321 | Bacteria | 6037 |
| 550 | Ga0207656_10007484 | 3300025321 | Bacteria | 3979 |
| 551 | Ga0207656_10062919 | 3300025321 | Bacteria | 1632 |
| 552 | Ga0207656_10186665 | 3300025321 | Bacteria | 997 |
| 553 | Ga0207696_1001081 | 3300025711 | Bacteria | 16071 |
| 554 | Ga0207713_1001002 | 3300025735 | Bacteria | 24653 |
| 555 | Ga0207713_1029091 | 3300025735 | Bacteria | 2481 |
| 556 | Ga0207653_10026429 | 3300025885 | Bacteria | 1861 |
| 557 | Ga0207710_10000172 | 3300025900 | Bacteria | 66486 |
| 558 | Ga0207710_10035391 | 3300025900 | Bacteria | 2197 |
| 559 | Ga0207688_10000289 | 3300025901 | Bacteria | 22999 |
| 560 | Ga0207688_10010619 | 3300025901 | Bacteria | 5008 |
| 561 | Ga0207688_10103231 | 3300025901 | Bacteria | 1649 |
| 562 | Ga0207680_10002281 | 3300025903 | Bacteria | 8944 |
| 563 | Ga0207680_10005098 | 3300025903 | Bacteria | 6260 |
| 564 | Ga0207680_10012307 | 3300025903 | Bacteria | 4353 |
| 565 | Ga0207680_10030887 | 3300025903 | Bacteria | 3028 |
| 566 | Ga0207647_10000629 | 3300025904 | Bacteria | 27446 |
| 567 | Ga0207647_10001021 | 3300025904 | Bacteria | 21752 |
| 568 | Ga0207699_10000280 | 3300025906 | Bacteria | 27852 |
| 569 | Ga0207699_10015404 | 3300025906 | Bacteria | 3970 |
| 570 | Ga0207645_10014382 | 3300025907 | Bacteria | 5296 |
| 571 | Ga0207645_10046819 | 3300025907 | Bacteria | 2762 |
| 572 | Ga0207645_10049484 | 3300025907 | Bacteria | 2683 |
| 573 | Ga0207643_10105795 | 3300025908 | Bacteria | 1654 |
| 574 | Ga0207705_10000105 | 3300025909 | Bacteria | 95742 |
| 575 | Ga0207705_10107496 | 3300025909 | Bacteria | 2058 |
| 576 | Ga0207705_10157555 | 3300025909 | Bacteria | 1704 |
| 577 | Ga0207705_10160957 | 3300025909 | Bacteria | 1686 |
| 578 | Ga0207705_10505294 | 3300025909 | Bacteria | 939 |
| 579 | Ga0207654_10333593 | 3300025911 | Bacteria | 1040 |
| 580 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 581 | Ga0207707_10032738 | 3300025912 | Bacteria | 4550 |
| 582 | Ga0207707_10108321 | 3300025912 | Bacteria | 2429 |
| 583 | Ga0207695_10000755 | 3300025913 | Bacteria | 62189 |
| 584 | Ga0207695_10000932 | 3300025913 | Bacteria | 52193 |
| 585 | Ga0207695_10002096 | 3300025913 | Bacteria | 30294 |
| 586 | Ga0207695_10017819 | 3300025913 | Bacteria | 8239 |
| 587 | Ga0207695_10038185 | 3300025913 | Bacteria | 5173 |
| 588 | Ga0207695_10127172 | 3300025913 | Bacteria | 2509 |
| 589 | Ga0207695_10197157 | 3300025913 | Bacteria | 1929 |
| 590 | Ga0207695_10256604 | 3300025913 | Bacteria | 1647 |
| 591 | Ga0207671_10040777 | 3300025914 | Bacteria | 3436 |
| 592 | Ga0207693_10000018 | 3300025915 | Bacteria | 138365 |
| 593 | Ga0207693_10000534 | 3300025915 | Bacteria | 34415 |
| 594 | Ga0207693_10274008 | 3300025915 | Bacteria | 1322 |
| 595 | Ga0207663_10000014 | 3300025916 | Bacteria | 164118 |
| 596 | Ga0207663_10025004 | 3300025916 | Bacteria | 3445 |
| 597 | Ga0207663_10075315 | 3300025916 | Bacteria | 2190 |
| 598 | Ga0207663_10107229 | 3300025916 | Bacteria | 1889 |
| 599 | Ga0207663_10140540 | 3300025916 | Bacteria | 1681 |
| 600 | Ga0207660_10004700 | 3300025917 | Bacteria | 8889 |
| 601 | Ga0207660_10031267 | 3300025917 | Bacteria | 3664 |
| 602 | Ga0207660_10045661 | 3300025917 | Bacteria | 3087 |
| 603 | Ga0207657_10001006 | 3300025919 | Bacteria | 29987 |
| 604 | Ga0207657_10009745 | 3300025919 | Bacteria | 9631 |
| 605 | Ga0207657_10038796 | 3300025919 | Bacteria | 4236 |
| 606 | Ga0207657_10041770 | 3300025919 | Bacteria | 4052 |
| 607 | Ga0207657_10045255 | 3300025919 | Bacteria | 3864 |
| 608 | Ga0207657_10059690 | 3300025919 | Bacteria | 3275 |
| 609 | Ga0207649_10044337 | 3300025920 | Bacteria | 2722 |
| 610 | Ga0207649_10056805 | 3300025920 | Bacteria | 2445 |
| 611 | Ga0207649_10060123 | 3300025920 | Bacteria | 2387 |
| 612 | Ga0207649_10122105 | 3300025920 | Bacteria | 1757 |
| 613 | Ga0207649_10240271 | 3300025920 | Bacteria | 1300 |
| 614 | Ga0207652_10000052 | 3300025921 | Bacteria | 119002 |
| 615 | Ga0207652_10002051 | 3300025921 | Bacteria | 17342 |
| 616 | Ga0207652_10005171 | 3300025921 | Bacteria | 10591 |
| 617 | Ga0207652_10098147 | 3300025921 | Bacteria | 2583 |
| 618 | Ga0207652_10427298 | 3300025921 | Bacteria | 1195 |
| 619 | Ga0207646_10029093 | 3300025922 | Bacteria | 5023 |
| 620 | Ga0207681_10006421 | 3300025923 | Bacteria | 7218 |
| 621 | Ga0207681_10083733 | 3300025923 | Bacteria | 2258 |
| 622 | Ga0207681_10093509 | 3300025923 | Bacteria | 2152 |
| 623 | Ga0207681_10109026 | 3300025923 | Bacteria | 2011 |
| 624 | Ga0207681_10132563 | 3300025923 | Bacteria | 1844 |
| 625 | Ga0207681_10188914 | 3300025923 | Bacteria | 1574 |
| 626 | Ga0207681_10193313 | 3300025923 | Bacteria | 1558 |
| 627 | Ga0207681_10291811 | 3300025923 | Bacteria | 1287 |
| 628 | Ga0207681_10318909 | 3300025923 | Bacteria | 1235 |
| 629 | Ga0207681_10412645 | 3300025923 | Bacteria | 1093 |
| 630 | Ga0207694_10000488 | 3300025924 | Bacteria | 35943 |
| 631 | Ga0207694_10294957 | 3300025924 | Bacteria | 1334 |
| 632 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 633 | Ga0207650_10000033 | 3300025925 | Bacteria | 226809 |
| 634 | Ga0207650_10001730 | 3300025925 | Bacteria | 15525 |
| 635 | Ga0207650_10015567 | 3300025925 | Bacteria | 5298 |
| 636 | Ga0207650_10058555 | 3300025925 | Bacteria | 2869 |
| 637 | Ga0207659_10001138 | 3300025926 | Bacteria | 15793 |
| 638 | Ga0207659_10004404 | 3300025926 | Bacteria | 8511 |
| 639 | Ga0207687_10001079 | 3300025927 | Bacteria | 18514 |
| 640 | Ga0207700_10000026 | 3300025928 | Bacteria | 139690 |
| 641 | Ga0207700_10017868 | 3300025928 | Bacteria | 4748 |
| 642 | Ga0207700_10028927 | 3300025928 | Bacteria | 3905 |
| 643 | Ga0207700_10061566 | 3300025928 | Bacteria | 2847 |
| 644 | Ga0207664_10006047 | 3300025929 | Bacteria | 8288 |
| 645 | Ga0207664_10011167 | 3300025929 | Bacteria | 6367 |
| 646 | Ga0207664_10014026 | 3300025929 | Bacteria | 5777 |
| 647 | Ga0207664_10030239 | 3300025929 | Bacteria | 4135 |
| 648 | Ga0207664_10089324 | 3300025929 | Bacteria | 2523 |
| 649 | Ga0207664_10161751 | 3300025929 | Bacteria | 1910 |
| 650 | Ga0207664_10203081 | 3300025929 | Bacteria | 1712 |
| 651 | Ga0207644_10000013 | 3300025931 | Bacteria | 185370 |
| 652 | Ga0207644_10001066 | 3300025931 | Bacteria | 17529 |
| 653 | Ga0207644_10010080 | 3300025931 | Bacteria | 6223 |
| 654 | Ga0207644_10024915 | 3300025931 | Bacteria | 4110 |
| 655 | Ga0207644_10083939 | 3300025931 | Bacteria | 2360 |
| 656 | Ga0207690_10003153 | 3300025932 | Bacteria | 9902 |
| 657 | Ga0207690_10022231 | 3300025932 | Bacteria | 3943 |
| 658 | Ga0207690_10030107 | 3300025932 | Bacteria | 3458 |
| 659 | Ga0207690_10073937 | 3300025932 | Bacteria | 2359 |
| 660 | Ga0207690_10086876 | 3300025932 | Bacteria | 2199 |
| 661 | Ga0207690_10286878 | 3300025932 | Bacteria | 1284 |
| 662 | Ga0207706_10000816 | 3300025933 | Bacteria | 32338 |
| 663 | Ga0207706_10016163 | 3300025933 | Bacteria | 6742 |
| 664 | Ga0207706_10017330 | 3300025933 | Bacteria | 6488 |
| 665 | Ga0207706_10022391 | 3300025933 | Bacteria | 5672 |
| 666 | Ga0207706_10139716 | 3300025933 | Bacteria | 2131 |
| 667 | Ga0207706_10200573 | 3300025933 | Bacteria | 1750 |
| 668 | Ga0207686_10057887 | 3300025934 | Bacteria | 2441 |
| 669 | Ga0207686_10074493 | 3300025934 | Bacteria | 2194 |
| 670 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 671 | Ga0207709_10000972 | 3300025935 | Bacteria | 21403 |
| 672 | Ga0207709_10022388 | 3300025935 | Bacteria | 3584 |
| 673 | Ga0207709_10127458 | 3300025935 | Bacteria | 1729 |
| 674 | Ga0207669_10182008 | 3300025937 | Bacteria | 1508 |
| 675 | Ga0207669_10230213 | 3300025937 | Bacteria | 1367 |
| 676 | Ga0207704_10000514 | 3300025938 | Bacteria | 17233 |
| 677 | Ga0207704_10013711 | 3300025938 | Bacteria | 4067 |
| 678 | Ga0207704_10264517 | 3300025938 | Bacteria | 1298 |
| 679 | Ga0207665_10066869 | 3300025939 | Bacteria | 2447 |
| 680 | Ga0207691_10000381 | 3300025940 | Bacteria | 44523 |
| 681 | Ga0207691_10001562 | 3300025940 | Bacteria | 22738 |
| 682 | Ga0207691_10015863 | 3300025940 | Bacteria | 7160 |
| 683 | Ga0207691_10049985 | 3300025940 | Bacteria | 3829 |
| 684 | Ga0207691_10062102 | 3300025940 | Bacteria | 3392 |
| 685 | Ga0207711_10000105 | 3300025941 | Bacteria | 90036 |
| 686 | Ga0207711_10000290 | 3300025941 | Bacteria | 53653 |
| 687 | Ga0207711_10000950 | 3300025941 | Bacteria | 27744 |
| 688 | Ga0207711_10002153 | 3300025941 | Bacteria | 17733 |
| 689 | Ga0207711_10003216 | 3300025941 | Bacteria | 14231 |
| 690 | Ga0207711_10003286 | 3300025941 | Bacteria | 14054 |
| 691 | Ga0207711_10004051 | 3300025941 | Bacteria | 12576 |
| 692 | Ga0207711_10007529 | 3300025941 | Bacteria | 9107 |
| 693 | Ga0207711_10035362 | 3300025941 | Bacteria | 4234 |
| 694 | Ga0207689_10000051 | 3300025942 | Bacteria | 88480 |
| 695 | Ga0207689_10005022 | 3300025942 | Bacteria | 11921 |
| 696 | Ga0207689_10016638 | 3300025942 | Bacteria | 6224 |
| 697 | Ga0207689_10215197 | 3300025942 | Bacteria | 1588 |
| 698 | Ga0207661_10114027 | 3300025944 | Bacteria | 2291 |
| 699 | Ga0207661_10322974 | 3300025944 | Bacteria | 1388 |
| 700 | Ga0207679_10003402 | 3300025945 | Bacteria | 9809 |
| 701 | Ga0207679_10007340 | 3300025945 | Bacteria | 6987 |
| 702 | Ga0207679_10010949 | 3300025945 | Bacteria | 5852 |
| 703 | Ga0207679_10171660 | 3300025945 | Bacteria | 1786 |
| 704 | Ga0207679_10318859 | 3300025945 | Bacteria | 1345 |
| 705 | Ga0207679_10363124 | 3300025945 | Bacteria | 1265 |
| 706 | Ga0207667_10009379 | 3300025949 | Bacteria | 11532 |
| 707 | Ga0207667_10013680 | 3300025949 | Bacteria | 9274 |
| 708 | Ga0207667_10024411 | 3300025949 | Bacteria | 6638 |
| 709 | Ga0207667_10120848 | 3300025949 | Bacteria | 2699 |
| 710 | Ga0207667_10193438 | 3300025949 | Bacteria | 2087 |
| 711 | Ga0207667_10464388 | 3300025949 | Bacteria | 1285 |
| 712 | Ga0207651_10001268 | 3300025960 | Bacteria | 11366 |
| 713 | Ga0207651_10038903 | 3300025960 | Bacteria | 3130 |
| 714 | Ga0207712_10000651 | 3300025961 | Bacteria | 27001 |
| 715 | Ga0207712_10000783 | 3300025961 | Bacteria | 23699 |
| 716 | Ga0207712_10009828 | 3300025961 | Bacteria | 6063 |
| 717 | Ga0207712_10321370 | 3300025961 | Bacteria | 1277 |
| 718 | Ga0207668_10000004 | 3300025972 | Bacteria | 201204 |
| 719 | Ga0207668_10000426 | 3300025972 | Bacteria | 26589 |
| 720 | Ga0207668_10001556 | 3300025972 | Bacteria | 13422 |
| 721 | Ga0207668_10016309 | 3300025972 | Bacteria | 4634 |
| 722 | Ga0207668_10034894 | 3300025972 | Bacteria | 3345 |
| 723 | Ga0207668_10072528 | 3300025972 | Bacteria | 2464 |
| 724 | Ga0207668_10141526 | 3300025972 | Bacteria | 1851 |
| 725 | Ga0207668_10194991 | 3300025972 | Bacteria | 1608 |
| 726 | Ga0207640_10003018 | 3300025981 | Bacteria | 9054 |
| 727 | Ga0207640_10103427 | 3300025981 | Bacteria | 2002 |
| 728 | Ga0207640_10269579 | 3300025981 | Bacteria | 1331 |
| 729 | Ga0207640_10298510 | 3300025981 | Bacteria | 1273 |
| 730 | Ga0207640_10482811 | 3300025981 | Bacteria | 1028 |
| 731 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 732 | Ga0207658_10000229 | 3300025986 | Bacteria | 58984 |
| 733 | Ga0207658_10001832 | 3300025986 | Bacteria | 15917 |
| 734 | Ga0207658_10004192 | 3300025986 | Bacteria | 10047 |
| 735 | Ga0207658_10016455 | 3300025986 | Bacteria | 5086 |
| 736 | Ga0207658_10031300 | 3300025986 | Bacteria | 3776 |
| 737 | Ga0207658_10039423 | 3300025986 | Bacteria | 3408 |
| 738 | Ga0207677_10001566 | 3300026023 | Bacteria | 12087 |
| 739 | Ga0207677_10005957 | 3300026023 | Bacteria | 6638 |
| 740 | Ga0207677_10017151 | 3300026023 | Bacteria | 4310 |
| 741 | Ga0207677_10228931 | 3300026023 | Bacteria | 1496 |
| 742 | Ga0207703_10000027 | 3300026035 | Bacteria | 209608 |
| 743 | Ga0207703_10002918 | 3300026035 | Bacteria | 14553 |
| 744 | Ga0207703_10006321 | 3300026035 | Bacteria | 9470 |
| 745 | Ga0207703_10010670 | 3300026035 | Bacteria | 7175 |
| 746 | Ga0207703_10016915 | 3300026035 | Bacteria | 5689 |
| 747 | Ga0207703_10027749 | 3300026035 | Bacteria | 4458 |
| 748 | Ga0207703_10041892 | 3300026035 | Bacteria | 3671 |
| 749 | Ga0207703_10070497 | 3300026035 | Bacteria | 2885 |
| 750 | Ga0207639_10002396 | 3300026041 | Bacteria | 12576 |
| 751 | Ga0207639_10004318 | 3300026041 | Bacteria | 9580 |
| 752 | Ga0207639_10009068 | 3300026041 | Bacteria | 6855 |
| 753 | Ga0207639_10010625 | 3300026041 | Bacteria | 6375 |
| 754 | Ga0207639_10027199 | 3300026041 | Bacteria | 4164 |
| 755 | Ga0207678_10000321 | 3300026067 | Bacteria | 43233 |
| 756 | Ga0207678_10021259 | 3300026067 | Bacteria | 5689 |
| 757 | Ga0207678_10026877 | 3300026067 | Bacteria | 5020 |
| 758 | Ga0207678_10036063 | 3300026067 | Bacteria | 4304 |
| 759 | Ga0207678_10052534 | 3300026067 | Bacteria | 3516 |
| 760 | Ga0207678_10085250 | 3300026067 | Bacteria | 2701 |
| 761 | Ga0207678_10110638 | 3300026067 | Bacteria | 2344 |
| 762 | Ga0207678_10193012 | 3300026067 | Bacteria | 1741 |
| 763 | Ga0207708_10165025 | 3300026075 | Bacteria | 1751 |
| 764 | Ga0207708_10208253 | 3300026075 | Bacteria | 1562 |
| 765 | Ga0207708_10258755 | 3300026075 | Bacteria | 1404 |
| 766 | Ga0207708_10376863 | 3300026075 | Bacteria | 1169 |
| 767 | Ga0207702_10000021 | 3300026078 | Bacteria | 196115 |
| 768 | Ga0207702_10001285 | 3300026078 | Bacteria | 25172 |
| 769 | Ga0207702_10001739 | 3300026078 | Bacteria | 21434 |
| 770 | Ga0207702_10157399 | 3300026078 | Bacteria | 2072 |
| 771 | Ga0207702_10224280 | 3300026078 | Bacteria | 1753 |
| 772 | Ga0207702_10297191 | 3300026078 | Bacteria | 1531 |
| 773 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 774 | Ga0207641_10000205 | 3300026088 | Bacteria | 78692 |
| 775 | Ga0207641_10001887 | 3300026088 | Bacteria | 20119 |
| 776 | Ga0207641_10002378 | 3300026088 | Bacteria | 17352 |
| 777 | Ga0207641_10016815 | 3300026088 | Bacteria | 5989 |
| 778 | Ga0207641_10057442 | 3300026088 | Bacteria | 3309 |
| 779 | Ga0207641_10073424 | 3300026088 | Bacteria | 2948 |
| 780 | Ga0207648_10000221 | 3300026089 | Bacteria | 61280 |
| 781 | Ga0207648_10029134 | 3300026089 | Bacteria | 4896 |
| 782 | Ga0207648_10096960 | 3300026089 | Bacteria | 2581 |
| 783 | Ga0207648_10131563 | 3300026089 | Bacteria | 2203 |
| 784 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 785 | Ga0207676_10000068 | 3300026095 | Bacteria | 104705 |
| 786 | Ga0207676_10000898 | 3300026095 | Bacteria | 23098 |
| 787 | Ga0207676_10007358 | 3300026095 | Bacteria | 7809 |
| 788 | Ga0207676_10130939 | 3300026095 | Bacteria | 2132 |
| 789 | Ga0207676_10143733 | 3300026095 | Bacteria | 2046 |
| 790 | Ga0207676_10192798 | 3300026095 | Bacteria | 1794 |
| 791 | Ga0207676_10241236 | 3300026095 | Bacteria | 1621 |
| 792 | Ga0207674_10000014 | 3300026116 | Bacteria | 183605 |
| 793 | Ga0207674_10000134 | 3300026116 | Bacteria | 86377 |
| 794 | Ga0207674_10001223 | 3300026116 | Bacteria | 33472 |
| 795 | Ga0207674_10021077 | 3300026116 | Bacteria | 7029 |
| 796 | Ga0207674_10113418 | 3300026116 | Bacteria | 2684 |
| 797 | Ga0207674_10157030 | 3300026116 | Bacteria | 2230 |
| 798 | Ga0207674_10185182 | 3300026116 | Bacteria | 2033 |
| 799 | Ga0207675_100009359 | 3300026118 | Bacteria | 9182 |
| 800 | Ga0207675_100063616 | 3300026118 | Bacteria | 3447 |
| 801 | Ga0207675_100337628 | 3300026118 | Bacteria | 1474 |
| 802 | Ga0207683_10001475 | 3300026121 | Bacteria | 21194 |
| 803 | Ga0207683_10074023 | 3300026121 | Bacteria | 3013 |
| 804 | Ga0207698_10001465 | 3300026142 | Bacteria | 13726 |
| 805 | Ga0207698_10014565 | 3300026142 | Bacteria | 5234 |
| 806 | Ga0207698_10018365 | 3300026142 | Bacteria | 4763 |
| 807 | Ga0207698_10038303 | 3300026142 | Bacteria | 3541 |
| 808 | Ga0207698_10307262 | 3300026142 | Bacteria | 1479 |
| 809 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 810 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 811 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 812 | Ga0209999_1001015 | 3300027543 | Bacteria | 4763 |
| 813 | Ga0209970_1004231 | 3300027614 | Bacteria | 2389 |
| 814 | Ga0209983_1000709 | 3300027665 | Bacteria | 7199 |
| 815 | Ga0209971_1001818 | 3300027682 | Bacteria | 5224 |
| 816 | Ga0209974_10005007 | 3300027876 | Bacteria | 4685 |
| 817 | Ga0207428_10269336 | 3300027907 | Unclassified | 1267 |
| 818 | Ga0265357_1000174 | 3300028023 | Bacteria | 2936 |
| 819 | Ga0268266_10000200 | 3300028379 | Bacteria | 104456 |
| 820 | Ga0268266_10001373 | 3300028379 | Bacteria | 29333 |
| 821 | Ga0268266_10004139 | 3300028379 | Bacteria | 14009 |
| 822 | Ga0268266_10047634 | 3300028379 | Bacteria | 3673 |
| 823 | Ga0268266_10058419 | 3300028379 | Bacteria | 3321 |
| 824 | Ga0268266_10119760 | 3300028379 | Bacteria | 2341 |
| 825 | Ga0268265_10001499 | 3300028380 | Bacteria | 19542 |
| 826 | Ga0268265_10002659 | 3300028380 | Bacteria | 13260 |
| 827 | Ga0268265_10004547 | 3300028380 | Bacteria | 9593 |
| 828 | Ga0268265_10007828 | 3300028380 | Bacteria | 7211 |
| 829 | Ga0268265_10013087 | 3300028380 | Bacteria | 5634 |
| 830 | Ga0268265_10031822 | 3300028380 | Bacteria | 3813 |
| 831 | Ga0268265_10108840 | 3300028380 | Bacteria | 2257 |
| 832 | Ga0268265_10123688 | 3300028380 | Bacteria | 2136 |
| 833 | Ga0268265_10216316 | 3300028380 | Bacteria | 1673 |
| 834 | Ga0268265_10226160 | 3300028380 | Bacteria | 1641 |
| 835 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 836 | Ga0268264_10000032 | 3300028381 | Bacteria | 408337 |
| 837 | Ga0268264_10001019 | 3300028381 | Bacteria | 28201 |
| 838 | Ga0268264_10005356 | 3300028381 | Bacteria | 10876 |
| 839 | Ga0268264_10006551 | 3300028381 | Bacteria | 9802 |
| 840 | Ga0268264_10040000 | 3300028381 | Bacteria | 3874 |
| 841 | Ga0268264_10065732 | 3300028381 | Bacteria | 3057 |
| 842 | Ga0268264_10131845 | 3300028381 | Bacteria | 2217 |
| 843 | Ga0265334_10000330 | 3300028573 | Bacteria | 25447 |
| 844 | Ga0265334_10011266 | 3300028573 | Bacteria | 3767 |
| 845 | Ga0265334_10043808 | 3300028573 | Bacteria | 1740 |
| 846 | Ga0265338_10018343 | 3300028800 | Bacteria | 7496 |
| 847 | Ga0265338_10023035 | 3300028800 | Bacteria | 6418 |
| 848 | Ga0265338_10158623 | 3300028800 | Bacteria | 1750 |
| 849 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 850 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 851 | Ga0316177_1170645 | 3300030731 | Bacteria | 1302 |
| 852 | Ga0316176_1026458 | 3300030732 | Bacteria | 4459 |
| 853 | Ga0314311_1183412 | 3300030733 | Bacteria | 3758 |
| 854 | Ga0316183_1047328 | 3300030742 | Bacteria | 4007 |
| 855 | Ga0316182_1155287 | 3300030745 | Bacteria | 4437 |
| 856 | Ga0265330_10084826 | 3300031235 | Bacteria | 1363 |
| 857 | Ga0265328_10000023 | 3300031239 | Bacteria | 123873 |
| 858 | Ga0265328_10000417 | 3300031239 | Bacteria | 19913 |
| 859 | Ga0265328_10002712 | 3300031239 | Bacteria | 7920 |
| 860 | Ga0265328_10062827 | 3300031239 | Bacteria | 1363 |
| 861 | Ga0265320_10000034 | 3300031240 | Bacteria | 141117 |
| 862 | Ga0265320_10004662 | 3300031240 | Bacteria | 8952 |
| 863 | Ga0265325_10015985 | 3300031241 | Bacteria | 4203 |
| 864 | Ga0265325_10041712 | 3300031241 | Bacteria | 2404 |
| 865 | Ga0265325_10042196 | 3300031241 | Bacteria | 2386 |
| 866 | Ga0265340_10014685 | 3300031247 | Bacteria | 4084 |
| 867 | Ga0265339_10000068 | 3300031249 | Bacteria | 91555 |
| 868 | Ga0265339_10011306 | 3300031249 | Bacteria | 5504 |
| 869 | Ga0265339_10018281 | 3300031249 | Bacteria | 4135 |
| 870 | Ga0265339_10027678 | 3300031249 | Bacteria | 3230 |
| 871 | Ga0265331_10000058 | 3300031250 | Bacteria | 175410 |
| 872 | Ga0265331_10001205 | 3300031250 | Bacteria | 19491 |
| 873 | Ga0265331_10001452 | 3300031250 | Bacteria | 17418 |
| 874 | Ga0265331_10015615 | 3300031250 | Bacteria | 4005 |
| 875 | Ga0265327_10010799 | 3300031251 | Bacteria | 6369 |
| 876 | Ga0265327_10027713 | 3300031251 | Bacteria | 3255 |
| 877 | Ga0265327_10131454 | 3300031251 | Bacteria | 1177 |
| 878 | Ga0265316_10000880 | 3300031344 | Bacteria | 32907 |
| 879 | Ga0307408_100189984 | 3300031548 | Bacteria | 1654 |
| 880 | Ga0307408_100284968 | 3300031548 | Bacteria | 1377 |
| 881 | Ga0265313_10000351 | 3300031595 | Bacteria | 50142 |
| 882 | Ga0265313_10004290 | 3300031595 | Bacteria | 11038 |
| 883 | Ga0265313_10006241 | 3300031595 | Bacteria | 8507 |
| 884 | Ga0307508_10063127 | 3300031616 | Bacteria | 3269 |
| 885 | Ga0316579_10001465 | 3300031691 | Bacteria | 8583 |
| 886 | Ga0316579_10082979 | 3300031691 | Bacteria | 1527 |
| 887 | Ga0265314_10008099 | 3300031711 | Bacteria | 9045 |
| 888 | Ga0265314_10012421 | 3300031711 | Bacteria | 6948 |
| 889 | Ga0265314_10031762 | 3300031711 | Bacteria | 3893 |
| 890 | Ga0265314_10032914 | 3300031711 | Bacteria | 3808 |
| 891 | Ga0265342_10198541 | 3300031712 | Bacteria | 1091 |
| 892 | Ga0307516_10065290 | 3300031730 | Bacteria | 3515 |
| 893 | Ga0307405_10065809 | 3300031731 | Bacteria | 2309 |
| 894 | Ga0307405_10070715 | 3300031731 | Bacteria | 2242 |
| 895 | Ga0316577_10072358 | 3300031733 | Bacteria | 1924 |
| 896 | Ga0307413_10036922 | 3300031824 | Bacteria | 2818 |
| 897 | Ga0307410_10178177 | 3300031852 | Bacteria | 1607 |
| 898 | Ga0307410_10262030 | 3300031852 | Bacteria | 1348 |
| 899 | Ga0307410_10374852 | 3300031852 | Bacteria | 1143 |
| 900 | Ga0307406_10042324 | 3300031901 | Bacteria | 2843 |
| 901 | Ga0307406_10056561 | 3300031901 | Bacteria | 2513 |
| 902 | Ga0307406_10184897 | 3300031901 | Bacteria | 1520 |
| 903 | Ga0307406_10248352 | 3300031901 | Bacteria | 1339 |
| 904 | Ga0307407_10104652 | 3300031903 | Bacteria | 1764 |
| 905 | Ga0307407_10121446 | 3300031903 | Bacteria | 1657 |
| 906 | Ga0307407_10299767 | 3300031903 | Bacteria | 1120 |
| 907 | Ga0307412_10050872 | 3300031911 | Bacteria | 2736 |
| 908 | Ga0307412_10168359 | 3300031911 | Bacteria | 1636 |
| 909 | Ga0307412_10285416 | 3300031911 | Bacteria | 1298 |
| 910 | Ga0307412_10416596 | 3300031911 | Bacteria | 1098 |
| 911 | Ga0307409_100047886 | 3300031995 | Unclassified | 3249 |
| 912 | Ga0307414_10000567 | 3300032004 | Bacteria | 19287 |
| 913 | Ga0307414_10012890 | 3300032004 | Bacteria | 4961 |
| 914 | Ga0307414_10044355 | 3300032004 | Bacteria | 3036 |
| 915 | Ga0307414_10077134 | 3300032004 | Bacteria | 2424 |
| 916 | Ga0307414_10091042 | 3300032004 | Bacteria | 2265 |
| 917 | Ga0307414_10131878 | 3300032004 | Bacteria | 1941 |
| 918 | Ga0307414_10167325 | 3300032004 | Bacteria | 1753 |
| 919 | Ga0307414_10333679 | 3300032004 | Bacteria | 1295 |
| 920 | Ga0307411_10036861 | 3300032005 | Bacteria | 3069 |
| 921 | Ga0307411_10154099 | 3300032005 | Bacteria | 1712 |
| 922 | Ga0307411_10434930 | 3300032005 | Bacteria | 1093 |
| 923 | Ga0307415_100011926 | 3300032126 | Bacteria | 5002 |
| 924 | Ga0316583_10035116 | 3300032133 | Bacteria | 1779 |
| 925 | Ga0316585_10079882 | 3300032137 | Bacteria | 1065 |
| 926 | Ga0316593_10000644 | 3300032168 | Bacteria | 6684 |
| 927 | Ga0316593_10000719 | 3300032168 | Bacteria | 6494 |
| 928 | Ga0316593_10033869 | 3300032168 | Bacteria | 1674 |
| 929 | Ga0307510_10039096 | 3300033180 | Bacteria | 5234 |
| 930 | Ga0307510_10230928 | 3300033180 | Bacteria | 1353 |
| 931 | Ga0373928_0019327 | 3300035084 | Bacteria | 1420 |
| 932 | Ga0373940_0011289 | 3300035088 | Bacteria | 2119 |
| 933 | Ga0373923_0030373 | 3300035111 | Bacteria | 2173 |
| 934 | Ga0373923_0067422 | 3300035111 | Bacteria | 1531 |
| 935 | Ga0373923_0162889 | 3300035111 | Bacteria | 1018 |
| 936 | Ga0373936_0010479 | 3300035113 | Bacteria | 3497 |
| 937 | Ga0373945_0038698 | 3300035116 | Bacteria | 1716 |
| 938 | Ga0373953_0003803 | 3300035117 | Bacteria | 4750 |
| 939 | Ga0373953_0016807 | 3300035117 | Bacteria | 2678 |
| 940 | Ga0373954_0012077 | 3300035118 | Bacteria | 3837 |
| 941 | Ga0373956_0023567 | 3300035119 | Bacteria | 2643 |
| 942 | Ga0373957_0241285 | 3300035120 | Bacteria | 759 |
| 943 | Ga0373943_0000193 | 3300035170 | Bacteria | 24677 |
| 944 | Ga0373943_0253135 | 3300035170 | Bacteria | 990 |
| 945 | Ga0373946_0003060 | 3300035171 | Bacteria | 5920 |
| 946 | Ga0373955_0014392 | 3300035172 | Bacteria | 3847 |
| 947 | Ga0373955_0014552 | 3300035172 | Bacteria | 3830 |
| 948 | Ga0373955_0160721 | 3300035172 | Bacteria | 1326 |
| 949 | Ga0316574_0118771 | 3300035398 | Bacteria | 1697 |
| 950 | Ga0373924_0001157 | 3300035410 | Bacteria | 8463 |
| 951 | Ga0373931_0107602 | 3300035691 | Bacteria | 1577 |
| 952 | Ga0373935_0011008 | 3300035692 | Bacteria | 5434 |
| 953 | Ga0373935_0016783 | 3300035692 | Bacteria | 4432 |
| 954 | Ga0373935_0101921 | 3300035692 | Bacteria | 1894 |
| 955 | Ga0373927_0000001 | 3300035695 | Bacteria | 1082160 |
| 956 | Ga0373927_0003709 | 3300035695 | Bacteria | 10858 |
| 957 | Ga0373927_0061084 | 3300035695 | Bacteria | 2438 |
| 958 | Ga0373927_0064367 | 3300035695 | Bacteria | 2372 |
| 959 | Ga0373933_0000565 | 3300035724 | Bacteria | 23136 |
| 960 | Ga0373933_0050041 | 3300035724 | Bacteria | 2493 |
| 961 | Ga0373933_0114563 | 3300035724 | Bacteria | 1684 |
| 962 | Ga0373947_0000076 | 3300035725 | Bacteria | 49938 |
| 963 | Ga0373947_0018642 | 3300035725 | Bacteria | 3996 |
| 964 | Ga0373947_0099948 | 3300035725 | Bacteria | 1822 |
| 965 | Ga0373947_0202870 | 3300035725 | Bacteria | 1298 |
| 966 | Ga0373947_0267870 | 3300035725 | Bacteria | 1133 |
| 967 | Ga0373937_0001232 | 3300036401 | Bacteria | 21520 |
| 968 | Ga0373937_0006584 | 3300036401 | Bacteria | 10030 |
| 969 | Ga0373937_0010393 | 3300036401 | Bacteria | 8128 |
| 970 | Ga0373937_0159581 | 3300036401 | Bacteria | 2114 |
| 971 | Ga0373937_0239939 | 3300036401 | Bacteria | 1708 |
| 972 | Ga0316582_0025101 | 3300036647 | Bacteria | 3574 |
| 973 | Ga0316582_0030009 | 3300036647 | Bacteria | 3308 |
| 974 | Ga0316582_0212929 | 3300036647 | Bacteria | 1320 |
| 975 | Ga0316582_0387086 | 3300036647 | Bacteria | 963 |
| 976 | Ga0316584_0012487 | 3300036712 | Bacteria | 5990 |
| 977 | Ga0316584_0042160 | 3300036712 | Bacteria | 3403 |
| 978 | Ga0316584_0064388 | 3300036712 | Bacteria | 2745 |
| 979 | Ga0316584_0173226 | 3300036712 | Bacteria | 1599 |
| 980 | Ga0373925_0005607 | 3300037068 | Bacteria | 9345 |
| 981 | Ga0373925_0017823 | 3300037068 | Bacteria | 5153 |
| 982 | Ga0373925_0021045 | 3300037068 | Bacteria | 4753 |
| 983 | Ga0373925_0155169 | 3300037068 | Bacteria | 1800 |
| 984 | Ga0395899_0159725 | 3300037312 | Bacteria | 1593 |
| 985 | Ga0395899_0188808 | 3300037312 | Bacteria | 1443 |
| 986 | Ga0395900_0001243 | 3300037418 | Bacteria | 31304 |
| 987 | Ga0395900_0042203 | 3300037418 | Bacteria | 4699 |
| 988 | Ga0395900_0277031 | 3300037418 | Bacteria | 1671 |
| 989 | Ga0395898_0081810 | 3300037466 | Bacteria | 3113 |
| 990 | Ga0395898_0454764 | 3300037466 | Bacteria | 1219 |
| 991 | Ga0395905_0042939 | 3300037471 | Bacteria | 4242 |
| 992 | Ga0395905_0109855 | 3300037471 | Bacteria | 2589 |
| 993 | Ga0395905_0199967 | 3300037471 | Bacteria | 1874 |
| 994 | Ga0316581_0034830 | 3300037588 | Bacteria | 1524 |
| 995 | Ga0436364_0697377 | 3300037853 | Bacteria | 6625 |
| 996 | Ga0436364_0958902 | 3300037853 | Bacteria | 1745 |
| 997 | Ga0436364_0964747 | 3300037853 | Bacteria | 1281 |
| 998 | Ga0436364_1554086 | 3300037853 | Bacteria | 6462 |
| 999 | Ga0395901_0030728 | 3300038443 | Bacteria | 5534 |
| 1000 | Ga0395901_0118952 | 3300038443 | Bacteria | 2776 |
| 1001 | Ga0395901_0464238 | 3300038443 | Bacteria | 1293 |
| 1002 | Ga0400490_33215 | 3300038726 | Bacteria | 2971 |
| 1003 | Ga0400488_63061 | 3300038741 | Bacteria | 2010 |
| 1004 | Ga0400486_00542 | 3300038742 | Bacteria | 1919 |
| 1005 | Ga0400486_10450 | 3300038742 | Bacteria | 2193 |
| 1006 | Ga0242420_018134 | 3300038996 | Bacteria | 1237 |
| 1007 | Ga0400483_015557 | 3300039062 | Bacteria | 3618 |
| 1008 | Ga0400483_133234 | 3300039062 | Bacteria | 6082 |
| 1009 | Ga0400483_135634 | 3300039062 | Bacteria | 1285 |
| 1010 | Ga0400483_227477 | 3300039062 | Bacteria | 1094 |
| 1011 | Ga0400483_244091 | 3300039062 | Bacteria | 5162 |
| 1012 | Ga0400483_252524 | 3300039062 | Bacteria | 5370 |
| 1013 | Ga0400489_67955 | 3300039093 | Bacteria | 1877 |
| 1014 | Ga0400489_73156 | 3300039093 | Bacteria | 1804 |
| 1015 | Ga0436365_0138950 | 3300039437 | Bacteria | 10189 |
| 1016 | Ga0436365_0733541 | 3300039437 | Bacteria | 1181 |
| 1017 | Ga0436365_0942406 | 3300039437 | Bacteria | 3117 |
| 1018 | Ga0436365_0961511 | 3300039437 | Bacteria | 5073 |
| 1019 | Ga0436365_1501840 | 3300039437 | Unclassified | 2773 |
| 1020 | Ga0436365_1906591 | 3300039437 | Bacteria | 89846 |
| 1021 | Ga0436360_0438284 | 3300039438 | Bacteria | 2643 |
| 1022 | Ga0436360_0831553 | 3300039438 | Bacteria | 5639 |
| 1023 | Ga0436360_0955023 | 3300039438 | Bacteria | 1069 |
| 1024 | Ga0436361_0095589 | 3300039447 | Bacteria | 1584 |
| 1025 | Ga0436361_0103120 | 3300039447 | Bacteria | 123137 |
| 1026 | Ga0436361_0416901 | 3300039447 | Bacteria | 8194 |
| 1027 | Ga0436361_0534303 | 3300039447 | Bacteria | 1591 |
| 1028 | Ga0436361_0602414 | 3300039447 | Bacteria | 1718 |
| 1029 | Ga0436361_0810226 | 3300039447 | Bacteria | 2010 |
| 1030 | Ga0436363_0214837 | 3300039450 | Unclassified | 1309 |
| 1031 | Ga0436363_0485340 | 3300039450 | Bacteria | 6324 |
| 1032 | Ga0436363_0715275 | 3300039450 | Bacteria | 14881 |
| 1033 | Ga0436363_1032809 | 3300039450 | Bacteria | 11767 |
| 1034 | Ga0436363_1408746 | 3300039450 | Bacteria | 1661 |
| 1035 | Ga0436363_1461336 | 3300039450 | Bacteria | 1670 |
| 1036 | Ga0436362_0020367 | 3300039453 | Bacteria | 10410 |
| 1037 | Ga0436362_0865405 | 3300039453 | Bacteria | 1308 |
| 1038 | Ga0436362_1301339 | 3300039453 | Bacteria | 980 |
| 1039 | Ga0439436_0001101 | 3300041404 | Bacteria | 7628 |
| 1040 | Ga0439465_0000821 | 3300041413 | Bacteria | 9761 |
| 1041 | Ga0439465_0033501 | 3300041413 | Bacteria | 1643 |
| 1042 | Ga0451789_0915396 | 3300041443 | Bacteria | 1588 |
| 1043 | Ga0451802_1915534 | 3300041460 | Bacteria | 1717 |
| 1044 | Ga0451837_0019715 | 3300041494 | Bacteria | 1576 |
| 1045 | Ga0451837_1224968 | 3300041494 | Bacteria | 4091 |
| 1046 | Ga0451843_0505550 | 3300041509 | Bacteria | 2252 |
| 1047 | Ga0451843_0997273 | 3300041509 | Bacteria | 1732 |
| 1048 | Ga0439432_008299 | 3300042006 | Bacteria | 3650 |
| 1049 | Ga0439449_0000005 | 3300042007 | Bacteria | 81904 |
| 1050 | Ga0451577_0013406 | 3300042876 | Bacteria | 7672 |
| 1051 | Ga0466972_0153146 | 3300044658 | Bacteria | 1084 |
| 1052 | Ga0453683_0003598 | 3300044673 | Bacteria | 11378 |
| 1053 | Ga0466965_0038749 | 3300044683 | Bacteria | 2342 |
| 1054 | Ga0466965_0225824 | 3300044683 | Bacteria | 999 |
| 1055 | Ga0466961_0190624 | 3300044693 | Bacteria | 1271 |
| 1056 | Ga0466963_0024247 | 3300044694 | Bacteria | 3861 |
| 1057 | Ga0453684_0004122 | 3300044712 | Bacteria | 31493 |
| 1058 | Ga0453684_0141280 | 3300044712 | Bacteria | 2875 |
| 1059 | Ga0453684_0265723 | 3300044712 | Bacteria | 1963 |
| 1060 | Ga0466957_0058893 | 3300044842 | Bacteria | 2353 |
| 1061 | Ga0466960_0050556 | 3300044901 | Bacteria | 2005 |
| 1062 | Ga0466959_0106995 | 3300045049 | Bacteria | 1999 |
| 1063 | Ga0451576_0000153 | 3300045051 | Bacteria | 175596 |
| 1064 | Ga0451576_0000479 | 3300045051 | Bacteria | 89703 |
| 1065 | Ga0451576_0067762 | 3300045051 | Bacteria | 3715 |
| 1066 | Ga0466967_0018227 | 3300045976 | Bacteria | 5602 |
| 1067 | Ga0466967_0240015 | 3300045976 | Bacteria | 1728 |
| 1068 | Ga0495592_0025358 | 3300046454 | Bacteria | 4501 |
| 1069 | Ga0495592_0064784 | 3300046454 | Bacteria | 2677 |
| 1070 | Ga0495592_0102487 | 3300046454 | Bacteria | 2038 |
| 1071 | Ga0495592_0313330 | 3300046454 | Bacteria | 1016 |
| 1072 | Ga0495603_0108960 | 3300046455 | Bacteria | 1616 |
| 1073 | Ga0495629_0001993 | 3300046459 | Bacteria | 15861 |
| 1074 | Ga0495629_0129774 | 3300046459 | Bacteria | 1756 |
| 1075 | Ga0495638_0023663 | 3300046460 | Bacteria | 4014 |
| 1076 | Ga0495638_0066815 | 3300046460 | Bacteria | 2209 |
| 1077 | Ga0495651_0000136 | 3300046462 | Bacteria | 54665 |
| 1078 | Ga0495653_0001743 | 3300046463 | Bacteria | 17165 |
| 1079 | Ga0495582_0058999 | 3300046473 | Bacteria | 2117 |
| 1080 | Ga0495582_0139231 | 3300046473 | Bacteria | 1375 |
| 1081 | Ga0495662_0020350 | 3300046476 | Bacteria | 3209 |
| 1082 | Ga0495662_0128760 | 3300046476 | Bacteria | 1244 |
| 1083 | Ga0495664_0008491 | 3300046477 | Bacteria | 5730 |
| 1084 | Ga0495594_0033264 | 3300046499 | Bacteria | 2802 |
| 1085 | Ga0495594_0168784 | 3300046499 | Bacteria | 1245 |
| 1086 | Ga0495596_0074009 | 3300046500 | Bacteria | 1323 |
| 1087 | Ga0495607_0042991 | 3300046501 | Bacteria | 2675 |
| 1088 | Ga0495608_0000282 | 3300046511 | Bacteria | 35820 |
| 1089 | Ga0495610_0013350 | 3300046512 | Bacteria | 4886 |
| 1090 | Ga0495610_0105931 | 3300046512 | Bacteria | 1252 |
| 1091 | Ga0495618_0007700 | 3300046514 | Bacteria | 6513 |
| 1092 | Ga0495628_0000643 | 3300046516 | Bacteria | 31928 |
| 1093 | Ga0495628_0008875 | 3300046516 | Bacteria | 8601 |
| 1094 | Ga0495630_0008243 | 3300046517 | Bacteria | 7485 |
| 1095 | Ga0495630_0019912 | 3300046517 | Bacteria | 4939 |
| 1096 | Ga0495630_0089419 | 3300046517 | Bacteria | 2326 |
| 1097 | Ga0495630_0284291 | 3300046517 | Bacteria | 1264 |
| 1098 | Ga0495643_0001375 | 3300046522 | Bacteria | 22762 |
| 1099 | Ga0495643_0170031 | 3300046522 | Bacteria | 1066 |
| 1100 | Ga0495663_0022197 | 3300046525 | Bacteria | 1832 |
| 1101 | Ga0495663_0024795 | 3300046525 | Bacteria | 1745 |
| 1102 | Ga0495666_0008457 | 3300046526 | Bacteria | 5162 |
| 1103 | Ga0495666_0051634 | 3300046526 | Bacteria | 1975 |
| 1104 | Ga0495652_0005586 | 3300046529 | Bacteria | 11817 |
| 1105 | Ga0495652_0039570 | 3300046529 | Bacteria | 4077 |
| 1106 | Ga0495654_0000143 | 3300046530 | Bacteria | 74495 |
| 1107 | Ga0495654_0105984 | 3300046530 | Bacteria | 1288 |
| 1108 | Ga0495640_0001369 | 3300046533 | Bacteria | 19192 |
| 1109 | Ga0495640_0006577 | 3300046533 | Bacteria | 9182 |
| 1110 | Ga0495640_0090849 | 3300046533 | Bacteria | 2015 |
| 1111 | Ga0495640_0090966 | 3300046533 | Bacteria | 2013 |
| 1112 | Ga0495640_0136858 | 3300046533 | Bacteria | 1581 |
| 1113 | Ga0495587_0001140 | 3300046536 | Bacteria | 17405 |
| 1114 | Ga0495621_0069355 | 3300046539 | Bacteria | 1295 |
| 1115 | Ga0495645_0020607 | 3300046543 | Bacteria | 4761 |
| 1116 | Ga0495645_0117245 | 3300046543 | Bacteria | 1878 |
| 1117 | Ga0495645_0308464 | 3300046543 | Bacteria | 1031 |
| 1118 | Ga0495622_0006793 | 3300046557 | Bacteria | 5309 |
| 1119 | Ga0495622_0049152 | 3300046557 | Bacteria | 1958 |
| 1120 | Ga0495633_0057288 | 3300046558 | Bacteria | 1830 |
| 1121 | Ga0495633_0068945 | 3300046558 | Bacteria | 1651 |
| 1122 | Ga0495667_0000392 | 3300046559 | Bacteria | 27924 |
| 1123 | Ga0495656_0006815 | 3300046615 | Bacteria | 4016 |
| 1124 | Ga0495668_0009231 | 3300046616 | Bacteria | 6069 |
| 1125 | Ga0495668_0012789 | 3300046616 | Bacteria | 4969 |
| 1126 | Ga0495668_0028753 | 3300046616 | Bacteria | 3143 |
| 1127 | Ga0495634_0005388 | 3300046642 | Bacteria | 9857 |
| 1128 | Ga0495634_0012404 | 3300046642 | Bacteria | 6169 |
| 1129 | Ga0495625_0008016 | 3300046660 | Bacteria | 9067 |
| 1130 | Ga0495625_0083478 | 3300046660 | Bacteria | 2221 |
| 1131 | Ga0495625_0166393 | 3300046660 | Bacteria | 1474 |
| 1132 | Ga0495635_0001645 | 3300046663 | Bacteria | 15067 |
| 1133 | Ga0495657_0002613 | 3300046675 | Bacteria | 15065 |
| 1134 | Ga0495623_0001489 | 3300046679 | Bacteria | 15874 |
| 1135 | Ga0495646_0008281 | 3300046680 | Bacteria | 6610 |
| 1136 | Ga0495647_0027602 | 3300046681 | Bacteria | 2087 |
| 1137 | Ga0495658_0095703 | 3300046683 | Bacteria | 1765 |
| 1138 | Ga0495613_0046126 | 3300046689 | Bacteria | 3223 |
| 1139 | Ga0495613_0242997 | 3300046689 | Bacteria | 1258 |
| 1140 | Ga0495624_0026171 | 3300046690 | Bacteria | 3823 |
| 1141 | Ga0495624_0225483 | 3300046690 | Bacteria | 1136 |
| 1142 | Ga0495671_0007336 | 3300046692 | Bacteria | 6295 |
| 1143 | Ga0495600_0034397 | 3300046809 | Bacteria | 3289 |
| 1144 | Ga0495600_0037198 | 3300046809 | Bacteria | 3164 |
| 1145 | Ga0495581_0022861 | 3300047315 | Bacteria | 3622 |
| 1146 | Ga0495581_0029748 | 3300047315 | Bacteria | 3165 |
| 1147 | Ga0495604_0000168 | 3300047317 | Bacteria | 57429 |
| 1148 | Ga0495674_0000573 | 3300047319 | Bacteria | 34362 |
| 1149 | Ga0495674_0065302 | 3300047319 | Bacteria | 3161 |
| 1150 | Ga0495674_0283028 | 3300047319 | Bacteria | 1358 |
| 1151 | Ga0495672_0001550 | 3300047320 | Bacteria | 22485 |
| 1152 | Ga0495680_0000285 | 3300047322 | Bacteria | 56843 |
| 1153 | Ga0495675_0008016 | 3300047444 | Bacteria | 6534 |
| 1154 | Ga0495684_0043330 | 3300047471 | Bacteria | 3446 |
| 1155 | Ga0495686_0006050 | 3300047472 | Bacteria | 9385 |
| 1156 | Ga0495686_0011750 | 3300047472 | Bacteria | 6164 |
| 1157 | Ga0495593_0069627 | 3300047673 | Bacteria | 1829 |
| 1158 | Ga0495602_0002627 | 3300048088 | Bacteria | 18358 |
| 1159 | Ga0495626_0073853 | 3300048091 | Bacteria | 1527 |
| 1160 | Ga0496100_0056476 | 3300048903 | Bacteria | 2568 |
| 1161 | Ga0496101_0003911 | 3300048904 | Bacteria | 9310 |
| 1162 | Ga0496101_0025843 | 3300048904 | Bacteria | 4077 |
| 1163 | Ga0496102_0007555 | 3300048905 | Bacteria | 9292 |
| 1164 | Ga0496102_0081113 | 3300048905 | Bacteria | 2990 |
| 1165 | Ga0496102_0132876 | 3300048905 | Bacteria | 2331 |
| 1166 | Ga0496104_0000005 | 3300048907 | Bacteria | 620360 |
| 1167 | Ga0496104_0000118 | 3300048907 | Bacteria | 74158 |
| 1168 | Ga0496104_0006870 | 3300048907 | Bacteria | 10032 |
| 1169 | Ga0496104_0048705 | 3300048907 | Bacteria | 3995 |
| 1170 | Ga0496104_0108307 | 3300048907 | Bacteria | 2663 |
| 1171 | Ga0496105_0000018 | 3300048908 | Bacteria | 197208 |
| 1172 | Ga0496105_0000056 | 3300048908 | Bacteria | 88217 |
| 1173 | Ga0496105_0100718 | 3300048908 | Bacteria | 2385 |
| 1174 | Ga0496106_0004357 | 3300048909 | Bacteria | 10513 |
| 1175 | Ga0496106_0199361 | 3300048909 | Bacteria | 1593 |
| 1176 | Ga0496107_0355488 | 3300048910 | Bacteria | 1090 |
| 1177 | Ga0496108_0002873 | 3300048911 | Bacteria | 13816 |
| 1178 | Ga0496108_0004829 | 3300048911 | Bacteria | 10877 |
| 1179 | Ga0496108_0008681 | 3300048911 | Bacteria | 8239 |
| 1180 | Ga0496108_0181635 | 3300048911 | Bacteria | 1822 |
| 1181 | Ga0496108_0300871 | 3300048911 | Bacteria | 1397 |
| 1182 | Ga0496109_0000015 | 3300048912 | Bacteria | 214913 |
| 1183 | Ga0496109_0003174 | 3300048912 | Bacteria | 13700 |
| 1184 | Ga0496109_0034975 | 3300048912 | Bacteria | 4529 |
| 1185 | Ga0496109_0043607 | 3300048912 | Bacteria | 4066 |
| 1186 | Ga0496110_0000751 | 3300048913 | Bacteria | 22417 |
| 1187 | Ga0496110_0002553 | 3300048913 | Bacteria | 13681 |
| 1188 | Ga0496110_0100090 | 3300048913 | Bacteria | 2598 |
| 1189 | Ga0496110_0186041 | 3300048913 | Bacteria | 1886 |
| 1190 | Ga0496110_0211139 | 3300048913 | Bacteria | 1765 |
| 1191 | Ga0496110_0307893 | 3300048913 | Bacteria | 1443 |
| 1192 | Ga0496111_0004928 | 3300048914 | Bacteria | 8477 |
| 1193 | Ga0496111_0022272 | 3300048914 | Bacteria | 4433 |
| 1194 | Ga0496111_0094540 | 3300048914 | Bacteria | 2192 |
| 1195 | Ga0496111_0155426 | 3300048914 | Bacteria | 1697 |
| 1196 | Ga0496112_0008091 | 3300048915 | Bacteria | 9389 |
| 1197 | Ga0496112_0018667 | 3300048915 | Bacteria | 6536 |
| 1198 | Ga0496112_0032012 | 3300048915 | Bacteria | 5105 |
| 1199 | Ga0496113_0054754 | 3300048916 | Bacteria | 2987 |
| 1200 | Ga0496114_0022877 | 3300048917 | Bacteria | 5094 |
| 1201 | Ga0496114_0110570 | 3300048917 | Bacteria | 2354 |
| 1202 | Ga0496114_0129275 | 3300048917 | Bacteria | 2179 |
| 1203 | Ga0496114_0315008 | 3300048917 | Bacteria | 1382 |
| 1204 | Ga0496115_0000002 | 3300048918 | Bacteria | 365286 |
| 1205 | Ga0496115_0001166 | 3300048918 | Bacteria | 18830 |
| 1206 | Ga0496115_0085271 | 3300048918 | Bacteria | 2576 |
| 1207 | Ga0496116_0110403 | 3300048919 | Bacteria | 1618 |
| 1208 | Ga0496117_0002847 | 3300048920 | Bacteria | 21034 |
| 1209 | Ga0496117_0003923 | 3300048920 | Bacteria | 16846 |
| 1210 | Ga0496117_0008418 | 3300048920 | Bacteria | 9802 |
| 1211 | Ga0496117_0043010 | 3300048920 | Bacteria | 3290 |
| 1212 | Ga0496117_0059598 | 3300048920 | Bacteria | 2635 |
| 1213 | Ga0496118_0003155 | 3300048921 | Bacteria | 21078 |
| 1214 | Ga0496118_0004179 | 3300048921 | Bacteria | 17387 |
| 1215 | Ga0496118_0070407 | 3300048921 | Bacteria | 2525 |
| 1216 | Ga0496118_0095014 | 3300048921 | Bacteria | 2036 |
| 1217 | Ga0496119_0000206 | 3300048922 | Bacteria | 83950 |
| 1218 | Ga0496119_0000787 | 3300048922 | Bacteria | 42365 |
| 1219 | Ga0496119_0116713 | 3300048922 | Bacteria | 1473 |
| 1220 | Ga0496120_0000776 | 3300048923 | Bacteria | 46146 |
| 1221 | Ga0496120_0057469 | 3300048923 | Bacteria | 2189 |
| 1222 | Ga0496120_0070467 | 3300048923 | Bacteria | 1923 |
| 1223 | Ga0496121_0000042 | 3300048924 | Bacteria | 342304 |
| 1224 | Ga0496121_0000888 | 3300048924 | Bacteria | 53958 |
| 1225 | Ga0496121_0009225 | 3300048924 | Bacteria | 11395 |
| 1226 | Ga0496121_0017687 | 3300048924 | Bacteria | 7256 |
| 1227 | Ga0496121_0266545 | 3300048924 | Bacteria | 1179 |
| 1228 | Ga0496122_0000308 | 3300048925 | Bacteria | 107960 |
| 1229 | Ga0496122_0000355 | 3300048925 | Bacteria | 98786 |
| 1230 | Ga0496122_0054111 | 3300048925 | Bacteria | 3017 |
| 1231 | Ga0496123_0000066 | 3300048926 | Bacteria | 210327 |
| 1232 | Ga0496123_0001332 | 3300048926 | Bacteria | 34880 |
| 1233 | Ga0496123_0016366 | 3300048926 | Bacteria | 6028 |
| 1234 | Ga0496123_0137232 | 3300048926 | Bacteria | 1344 |
| 1235 | Ga0496123_0243229 | 3300048926 | Bacteria | 892 |
| 1236 | Ga0496124_0000001 | 3300048927 | Bacteria | 1747840 |
| 1237 | Ga0496124_0001215 | 3300048927 | Bacteria | 39879 |
| 1238 | Ga0496124_0003077 | 3300048927 | Bacteria | 20780 |
| 1239 | Ga0496124_0031164 | 3300048927 | Bacteria | 4723 |
| 1240 | Ga0496124_0035735 | 3300048927 | Bacteria | 4344 |
| 1241 | Ga0496124_0164115 | 3300048927 | Bacteria | 1728 |
| 1242 | Ga0496124_0164347 | 3300048927 | Bacteria | 1726 |
| 1243 | Ga0496124_0229599 | 3300048927 | Bacteria | 1389 |
| 1244 | Ga0496125_0000288 | 3300048928 | Bacteria | 99681 |
| 1245 | Ga0496125_0000486 | 3300048928 | Bacteria | 69727 |
| 1246 | Ga0496125_0013801 | 3300048928 | Bacteria | 7914 |
| 1247 | Ga0496125_0030723 | 3300048928 | Bacteria | 4799 |
| 1248 | Ga0496125_0057135 | 3300048928 | Bacteria | 3163 |
| 1249 | Ga0496125_0064968 | 3300048928 | Bacteria | 2895 |
| 1250 | Ga0496125_0068259 | 3300048928 | Bacteria | 2798 |
| 1251 | Ga0496126_0000052 | 3300048929 | Bacteria | 312383 |
| 1252 | Ga0496126_0000258 | 3300048929 | Bacteria | 113843 |
| 1253 | Ga0496126_0000463 | 3300048929 | Bacteria | 80860 |
| 1254 | Ga0496126_0002494 | 3300048929 | Bacteria | 24732 |
| 1255 | Ga0496126_0054046 | 3300048929 | Bacteria | 3640 |
| 1256 | Ga0501031_0229664 | 3300049568 | Bacteria | 1208 |
| 1257 | Ga0501032_0038915 | 3300049569 | Bacteria | 3237 |
| 1258 | Ga0501032_0076687 | 3300049569 | Bacteria | 2226 |
| 1259 | Ga0501033_0000847 | 3300049570 | Bacteria | 27913 |
| 1260 | Ga0501033_0035656 | 3300049570 | Bacteria | 3729 |
| 1261 | Ga0501034_0000127 | 3300049571 | Bacteria | 142181 |
| 1262 | Ga0501034_0020559 | 3300049571 | Bacteria | 6742 |
| 1263 | Ga0501034_0139427 | 3300049571 | Bacteria | 2405 |
| 1264 | Ga0501036_0020667 | 3300049572 | Bacteria | 5530 |
| 1265 | Ga0501036_0081034 | 3300049572 | Bacteria | 2743 |
| 1266 | Ga0501037_0040316 | 3300049573 | Bacteria | 3437 |
| 1267 | Ga0501037_0060985 | 3300049573 | Bacteria | 2751 |
| 1268 | Ga0501037_0192011 | 3300049573 | Bacteria | 1446 |
| 1269 | Ga0501038_0048130 | 3300049574 | Bacteria | 3691 |
| 1270 | Ga0501039_0045660 | 3300049575 | Bacteria | 3385 |
| 1271 | Ga0501039_0082758 | 3300049575 | Bacteria | 2499 |
| 1272 | Ga0501039_0095165 | 3300049575 | Bacteria | 2322 |
| 1273 | Ga0501039_0255762 | 3300049575 | Bacteria | 1377 |
| 1274 | Ga0501041_0103385 | 3300049577 | Bacteria | 1764 |
| 1275 | Ga0501043_0002614 | 3300049579 | Bacteria | 15190 |
| 1276 | Ga0501043_0092471 | 3300049579 | Bacteria | 2378 |
| 1277 | Ga0501046_0023123 | 3300049580 | Bacteria | 5118 |
| 1278 | Ga0501046_0147781 | 3300049580 | Bacteria | 1774 |
| 1279 | Ga0501047_0001549 | 3300049581 | Bacteria | 22497 |
| 1280 | Ga0501047_0031025 | 3300049581 | Bacteria | 5153 |
| 1281 | Ga0501047_0088599 | 3300049581 | Bacteria | 2972 |
| 1282 | Ga0501047_0095958 | 3300049581 | Bacteria | 2844 |
| 1283 | Ga0501047_0191635 | 3300049581 | Bacteria | 1907 |
| 1284 | Ga0501047_0229776 | 3300049581 | Bacteria | 1709 |
| 1285 | Ga0501048_0058628 | 3300049582 | Bacteria | 2729 |
| 1286 | Ga0501048_0212185 | 3300049582 | Bacteria | 1373 |
| 1287 | Ga0501067_0006256 | 3300049583 | Bacteria | 6604 |
| 1288 | Ga0501067_0039185 | 3300049583 | Bacteria | 2631 |
| 1289 | Ga0501067_0087584 | 3300049583 | Bacteria | 1728 |
| 1290 | Ga0501067_0175796 | 3300049583 | Bacteria | 1192 |
| 1291 | Ga0501069_0005097 | 3300049585 | Bacteria | 6818 |
| 1292 | Ga0501069_0054289 | 3300049585 | Bacteria | 2232 |
| 1293 | Ga0501069_0091881 | 3300049585 | Bacteria | 1717 |
| 1294 | Ga0501070_0000014 | 3300049586 | Bacteria | 180454 |
| 1295 | Ga0501070_0004919 | 3300049586 | Bacteria | 11407 |
| 1296 | Ga0501070_0017142 | 3300049586 | Bacteria | 6079 |
| 1297 | Ga0501071_0147329 | 3300049587 | Bacteria | 1755 |
| 1298 | Ga0501072_0007477 | 3300049588 | Bacteria | 8290 |
| 1299 | Ga0501072_0353350 | 3300049588 | Bacteria | 1167 |
| 1300 | Ga0501073_0012747 | 3300049589 | Bacteria | 6132 |
| 1301 | Ga0501073_0078675 | 3300049589 | Bacteria | 2295 |
| 1302 | Ga0501073_0084159 | 3300049589 | Bacteria | 2213 |
| 1303 | Ga0501075_0016391 | 3300049591 | Bacteria | 5338 |
| 1304 | Ga0501075_0205994 | 3300049591 | Bacteria | 1500 |
| 1305 | Ga0501075_0242130 | 3300049591 | Bacteria | 1375 |
| 1306 | Ga0501076_0102896 | 3300049592 | Bacteria | 2303 |
| 1307 | Ga0501076_0104362 | 3300049592 | Bacteria | 2287 |
| 1308 | Ga0501076_0167532 | 3300049592 | Bacteria | 1791 |
| 1309 | Ga0501077_0018120 | 3300049593 | Bacteria | 4452 |
| 1310 | Ga0501077_0024462 | 3300049593 | Bacteria | 3836 |
| 1311 | Ga0501225_0003136 | 3300049705 | Bacteria | 5052 |
| 1312 | Ga0501079_0016314 | 3300049741 | Bacteria | 5676 |
| 1313 | Ga0501079_0022269 | 3300049741 | Bacteria | 4858 |
| 1314 | Ga0501079_0091010 | 3300049741 | Bacteria | 2364 |
| 1315 | Ga0501079_0115133 | 3300049741 | Bacteria | 2090 |
| 1316 | Ga0501079_0203617 | 3300049741 | Bacteria | 1546 |
| 1317 | Ga0501079_0443806 | 3300049741 | Bacteria | 1019 |
| 1318 | Ga0501080_0001520 | 3300049742 | Bacteria | 19580 |
| 1319 | Ga0501080_0002117 | 3300049742 | Bacteria | 17234 |
| 1320 | Ga0501080_0058128 | 3300049742 | Bacteria | 3600 |
| 1321 | Ga0501080_0164166 | 3300049742 | Bacteria | 2050 |
| 1322 | Ga0501080_0266857 | 3300049742 | Bacteria | 1558 |
| 1323 | Ga0501081_0069884 | 3300049743 | Bacteria | 2447 |
| 1324 | Ga0501081_0270494 | 3300049743 | Bacteria | 1243 |
| 1325 | Ga0501083_0013821 | 3300049744 | Bacteria | 5644 |
| 1326 | Ga0501083_0119473 | 3300049744 | Bacteria | 1729 |
| 1327 | Ga0501275_000135 | 3300049772 | Bacteria | 8249 |
| 1328 | Ga0501280_004984 | 3300049776 | Bacteria | 1918 |
| 1329 | Ga0501035_0002615 | 3300049822 | Bacteria | 17557 |
| 1330 | Ga0501035_0035293 | 3300049822 | Bacteria | 4538 |
| 1331 | Ga0501035_0131333 | 3300049822 | Bacteria | 2183 |
| 1332 | Ga0501044_0002945 | 3300049823 | Bacteria | 19364 |
| 1333 | Ga0501044_0003065 | 3300049823 | Bacteria | 18912 |
| 1334 | Ga0501044_0013291 | 3300049823 | Bacteria | 8912 |
| 1335 | Ga0501044_0054322 | 3300049823 | Bacteria | 4118 |
| 1336 | Ga0501044_0080832 | 3300049823 | Bacteria | 3291 |
| 1337 | Ga0501044_0184563 | 3300049823 | Bacteria | 2051 |
| 1338 | Ga0501044_0218052 | 3300049823 | Bacteria | 1859 |
| 1339 | Ga0501044_0262528 | 3300049823 | Bacteria | 1665 |
| 1340 | Ga0501044_0410061 | 3300049823 | Bacteria | 1266 |
| 1341 | nmdc:mga03683_120193_c1 | 3300050489 | Bacteria | 1168 |
| 1342 | nmdc:mga00v17_16575_c1 | 3300050491 | Bacteria | 4154 |
| 1343 | nmdc:mga00v17_200_c1 | 3300050491 | Bacteria | 36047 |
| 1344 | nmdc:mga00v17_431_c1 | 3300050491 | Bacteria | 23635 |
| 1345 | nmdc:mga00v17_69366_c1 | 3300050491 | Bacteria | 2182 |
| 1346 | nmdc:mga07m45_143022_c1 | 3300050496 | Bacteria | 1386 |
| 1347 | nmdc:mga05p37_26796_c1 | 3300050507 | Bacteria | 7010 |
| 1348 | nmdc:mga09592_141809_c1 | 3300050508 | Bacteria | 2071 |
| 1349 | nmdc:mga0qj67_58745_c1 | 3300050509 | Bacteria | 3049 |
| 1350 | nmdc:mga06r32_113267_c1 | 3300050510 | Unclassified | 2670 |
| 1351 | nmdc:mga06r32_228695_c1 | 3300050510 | Bacteria | 1848 |
| 1352 | nmdc:mga06r32_35890_c1 | 3300050510 | Bacteria | 4679 |
| 1353 | nmdc:mga06r32_37824_c1 | 3300050510 | Bacteria | 4566 |
| 1354 | nmdc:mga06r32_639927_c1 | 3300050510 | Bacteria | 1032 |
| 1355 | nmdc:mga08y16_6650_c1 | 3300050511 | Bacteria | 12128 |
| 1356 | nmdc:mga08y16_91877_c1 | 3300050511 | Bacteria | 3163 |
| 1357 | nmdc:mga0n895_146730_c1 | 3300050512 | Bacteria | 2389 |
| 1358 | nmdc:mga0n895_228599_c1 | 3300050512 | Bacteria | 1888 |
| 1359 | nmdc:mga0n895_49045_c1 | 3300050512 | Bacteria | 4135 |
| 1360 | nmdc:mga0rr50_141603_c1 | 3300050513 | Unclassified | 1935 |
| 1361 | nmdc:mga0rr50_78248_c1 | 3300050513 | Bacteria | 2544 |
| 1362 | nmdc:mga0rr50_87687_c1 | 3300050513 | Bacteria | 2416 |
| 1363 | nmdc:mga08x19_19_c1 | 3300050514 | Bacteria | 315774 |
| 1364 | nmdc:mga08x19_54_c1 | 3300050514 | Bacteria | 121662 |
| 1365 | nmdc:mga08x19_58705_c1 | 3300050514 | Plasmid | 2490 |
| 1366 | nmdc:mga08x19_89320_c1 | 3300050514 | Bacteria | 2032 |
| 1367 | nmdc:mga0a205_20211_c1 | 3300050515 | Bacteria | 6281 |
| 1368 | nmdc:mga0a205_4289_c1 | 3300050515 | Bacteria | 12798 |
| 1369 | Ga0495601_0007011 | 3300053077 | Bacteria | 6603 |
| 1370 | Ga0495601_0021116 | 3300053077 | Bacteria | 3984 |
| 1371 | Ga0495601_0143245 | 3300053077 | Bacteria | 1559 |
| 1372 | Ga0495612_0017182 | 3300053078 | Bacteria | 2898 |
| 1373 | Ga0500635_0000051 | 3300053080 | Bacteria | 76510 |
| 1374 | Ga0495595_0000996 | 3300053084 | Bacteria | 10935 |
| 1375 | Ga0495619_0000309 | 3300053085 | Bacteria | 34322 |
| 1376 | Ga0500643_000336 | 3300053087 | Bacteria | 37374 |
| 1377 | Ga0500643_004409 | 3300053087 | Bacteria | 6379 |
| 1378 | Ga0500644_0028801 | 3300053088 | Bacteria | 1740 |
| 1379 | Ga0500646_0006695 | 3300053090 | Bacteria | 2931 |
| 1380 | Ga0500646_0016547 | 3300053090 | Bacteria | 1926 |
| 1381 | Ga0500647_0048848 | 3300053091 | Bacteria | 2034 |
| 1382 | Ga0500651_0007702 | 3300053093 | Bacteria | 6298 |
| 1383 | Ga0500650_0000116 | 3300053098 | Bacteria | 21863 |
| 1384 | Ga0500555_002713 | 3300053103 | Bacteria | 5089 |
| 1385 | Ga0500555_005686 | 3300053103 | Bacteria | 3536 |
| 1386 | Ga0500555_031233 | 3300053103 | Bacteria | 1509 |
| 1387 | Ga0500556_0000092 | 3300053104 | Bacteria | 83297 |
| 1388 | Ga0500556_0000217 | 3300053104 | Bacteria | 46762 |
| 1389 | Ga0500556_0009403 | 3300053104 | Bacteria | 2840 |
| 1390 | Ga0500556_0017250 | 3300053104 | Bacteria | 2260 |
| 1391 | Ga0500556_0025337 | 3300053104 | Bacteria | 1959 |
| 1392 | Ga0500562_043309 | 3300053108 | Bacteria | 1198 |
| 1393 | Ga0500594_0000636 | 3300053118 | Bacteria | 7492 |
| 1394 | Ga0500595_004828 | 3300053119 | Bacteria | 5964 |
| 1395 | Ga0500608_070504 | 3300053122 | Bacteria | 1661 |
| 1396 | Ga0500618_001619 | 3300053125 | Bacteria | 9745 |
| 1397 | Ga0500621_056389 | 3300053126 | Bacteria | 1589 |
| 1398 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 1399 | Ga0500652_000234 | 3300053131 | Bacteria | 21234 |
| 1400 | Ga0500658_0000032 | 3300053134 | Bacteria | 90863 |
| 1401 | Ga0500568_0005603 | 3300053139 | Bacteria | 6464 |
| 1402 | Ga0500568_0044678 | 3300053139 | Bacteria | 1766 |
| 1403 | Ga0500588_0004975 | 3300053146 | Bacteria | 2919 |
| 1404 | Ga0500588_0122988 | 3300053146 | Bacteria | 917 |
| 1405 | Ga0500603_028516 | 3300053150 | Bacteria | 1425 |
| 1406 | Ga0500616_0063108 | 3300053153 | Bacteria | 1911 |
| 1407 | Ga0500620_001156 | 3300053155 | Bacteria | 4692 |
| 1408 | Ga0500622_0000441 | 3300053156 | Bacteria | 39445 |
| 1409 | Ga0500622_0165105 | 3300053156 | Bacteria | 1035 |
| 1410 | Ga0500624_000003 | 3300053157 | Bacteria | 253364 |
| 1411 | Ga0500624_002262 | 3300053157 | Bacteria | 2645 |
| 1412 | Ga0500627_0002598 | 3300053158 | Bacteria | 5399 |
| 1413 | Ga0500638_014263 | 3300053162 | Bacteria | 3622 |
| 1414 | Ga0500636_0070510 | 3300053177 | Bacteria | 2027 |
| 1415 | Ga0500637_0000073 | 3300053178 | Bacteria | 35884 |
| 1416 | Ga0500637_0001628 | 3300053178 | Bacteria | 9633 |
| 1417 | Ga0500637_0006080 | 3300053178 | Bacteria | 5907 |
| 1418 | Ga0500657_082053 | 3300053728 | Bacteria | 1382 |
| 1419 | Ga0500645_000148 | 3300053730 | Bacteria | 54683 |
| 1420 | Ga0500645_000539 | 3300053730 | Bacteria | 25211 |
| 1421 | Ga0500645_004116 | 3300053730 | Bacteria | 5682 |
| 1422 | Ga0501084_0011075 | 3300054114 | Bacteria | 7468 |
| 1423 | Ga0501084_0046313 | 3300054114 | Bacteria | 3643 |
| 1424 | Ga0501084_0076623 | 3300054114 | Bacteria | 2803 |
| 1425 | Ga0501084_0266968 | 3300054114 | Bacteria | 1445 |
| 1426 | Ga0501084_0314573 | 3300054114 | Bacteria | 1322 |
| 1427 | Ga0501084_0393253 | 3300054114 | Bacteria | 1171 |
| 1428 | Ga0501082_0001851 | 3300060353 | Bacteria | 18631 |
| 1429 | Ga0501082_0075828 | 3300060353 | Bacteria | 2897 |
| 1430 | Ga0501082_0240774 | 3300060353 | Bacteria | 1574 |
| 1431 | Ga0530510_0101822 | 3300061734 | Bacteria | 2100 |
| 1432 | Ga0530510_0112660 | 3300061734 | Bacteria | 1993 |
| 1433 | Ga0530510_0172039 | 3300061734 | Bacteria | 1604 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006914 | Ga0075436_100035888 | Ga0075436_1000358882 | 221 |
| 2 | 3300026075 | Ga0207708_10376863 | Ga0207708_103768631 | 222 |
| 3 | 3300009174 | Ga0105241_10540250 | Ga0105241_105402501 | 226 |
| 4 | 3300013306 | Ga0163162_10412281 | Ga0163162_104122813 | 227 |
| 5 | 3300045976 | Ga0466967_0018227 | Ga0466967_0018227_2818_3750 | 227 |
| 6 | 3300035120 | Ga0373957_0241285 | Ga0373957_0241285_11_736 | 232 |
| 7 | 3300038726 | Ga0400490_33215 | Ga0400490_33215_1214_2098 | 232 |
| 8 | 3300039062 | Ga0400483_252524 | Ga0400483_252524_4018_4902 | 232 |
| 9 | 3300013307 | Ga0157372_10065373 | Ga0157372_100653733 | 233 |
| 10 | 3300032004 | Ga0307414_10077134 | Ga0307414_100771341 | 234 |
| 11 | 3300046558 | Ga0495633_0057288 | Ga0495633_0057288_671_1594 | 234 |
| 12 | 3300030745 | Ga0316182_1155287 | Ga0316182_11552873 | 235 |
| 13 | 3300009148 | Ga0105243_10011445 | Ga0105243_100114455 | 238 |
| 14 | 3300005563 | Ga0068855_100191262 | Ga0068855_1001912622 | 239 |
| 15 | 3300009093 | Ga0105240_10066052 | Ga0105240_100660524 | 239 |
| 16 | 3300025913 | Ga0207695_10256604 | Ga0207695_102566042 | 239 |
| 17 | 3300025949 | Ga0207667_10120848 | Ga0207667_101208482 | 239 |
| 18 | 3300049573 | Ga0501037_0192011 | Ga0501037_0192011_411_1286 | 240 |
| 19 | 3300049575 | Ga0501039_0095165 | Ga0501039_0095165_14_889 | 240 |
| 20 | 3300049577 | Ga0501041_0103385 | Ga0501041_0103385_359_1234 | 240 |
| 21 | 3300049582 | Ga0501048_0212185 | Ga0501048_0212185_149_1024 | 240 |
| 22 | 3300049591 | Ga0501075_0242130 | Ga0501075_0242130_348_1223 | 240 |
| 23 | 3300049592 | Ga0501076_0167532 | Ga0501076_0167532_769_1644 | 240 |
| 24 | 3300049741 | Ga0501079_0091010 | Ga0501079_0091010_1349_2224 | 240 |
| 25 | 3300049743 | Ga0501081_0069884 | Ga0501081_0069884_50_925 | 240 |
| 26 | 3300013306 | Ga0163162_10618093 | Ga0163162_106180932 | 242 |
| 27 | 3300025933 | Ga0207706_10139716 | Ga0207706_101397163 | 242 |
| 28 | 3300026067 | Ga0207678_10193012 | Ga0207678_101930121 | 245 |
| 29 | 3300035725 | Ga0373947_0202870 | Ga0373947_0202870_194_1114 | 245 |
| 30 | 3300037312 | Ga0395899_0188808 | Ga0395899_0188808_30_842 | 245 |
| 31 | 3300049582 | Ga0501048_0058628 | Ga0501048_0058628_11_775 | 245 |
| 32 | 3300049741 | Ga0501079_0443806 | Ga0501079_0443806_15_779 | 245 |
| 33 | 3300005327 | Ga0070658_10020917 | Ga0070658_100209175 | 246 |
| 34 | 3300009551 | Ga0105238_10283784 | Ga0105238_102837842 | 246 |
| 35 | 3300025909 | Ga0207705_10107496 | Ga0207705_101074963 | 246 |
| 36 | 3300013104 | Ga0157370_10093429 | Ga0157370_100934292 | 248 |
| 37 | 3300046522 | Ga0495643_0170031 | Ga0495643_0170031_35_802 | 248 |
| 38 | 3300009147 | Ga0114129_10222886 | Ga0114129_102228861 | 249 |
| 39 | 3300031911 | Ga0307412_10285416 | Ga0307412_102854162 | 249 |
| 40 | 3300039437 | Ga0436365_1501840 | Ga0436365_1501840_480_1298 | 249 |
| 41 | 3300048926 | Ga0496123_0243229 | Ga0496123_0243229_11_772 | 249 |
| 42 | 3300005438 | Ga0070701_10003150 | Ga0070701_100031507 | 250 |
| 43 | 3300005440 | Ga0070705_100010706 | Ga0070705_1000107064 | 250 |
| 44 | 3300005842 | Ga0068858_100039178 | Ga0068858_1000391784 | 250 |
| 45 | 3300009101 | Ga0105247_10216949 | Ga0105247_102169492 | 250 |
| 46 | 3300014968 | Ga0157379_10002201 | Ga0157379_100022018 | 250 |
| 47 | 3300026035 | Ga0207703_10027749 | Ga0207703_100277494 | 250 |
| 48 | 3300039450 | Ga0436363_0214837 | Ga0436363_0214837_27_815 | 250 |
| 49 | 3300041443 | Ga0451789_0915396 | Ga0451789_0915396_769_1578 | 250 |
| 50 | 3300053077 | Ga0495601_0143245 | Ga0495601_0143245_762_1538 | 250 |
| 51 | 3300053131 | Ga0500652_000234 | Ga0500652_000234_10164_11093 | 250 |
| 52 | 3300028380 | Ga0268265_10226160 | Ga0268265_102261602 | 251 |
| 53 | 3300048903 | Ga0496100_0056476 | Ga0496100_0056476_1602_2417 | 251 |
| 54 | 3300048904 | Ga0496101_0003911 | Ga0496101_0003911_6789_7604 | 251 |
| 55 | 3300048905 | Ga0496102_0007555 | Ga0496102_0007555_1557_2372 | 251 |
| 56 | 3300048907 | Ga0496104_0006870 | Ga0496104_0006870_1043_1858 | 251 |
| 57 | 3300048907 | Ga0496104_0048705 | Ga0496104_0048705_3120_3935 | 251 |
| 58 | 3300048909 | Ga0496106_0004357 | Ga0496106_0004357_8954_9769 | 251 |
| 59 | 3300048911 | Ga0496108_0002873 | Ga0496108_0002873_6845_7660 | 251 |
| 60 | 3300048911 | Ga0496108_0300871 | Ga0496108_0300871_256_1071 | 251 |
| 61 | 3300048912 | Ga0496109_0003174 | Ga0496109_0003174_3025_3840 | 251 |
| 62 | 3300048912 | Ga0496109_0043607 | Ga0496109_0043607_1873_2688 | 251 |
| 63 | 3300048913 | Ga0496110_0002553 | Ga0496110_0002553_11719_12534 | 251 |
| 64 | 3300048914 | Ga0496111_0004928 | Ga0496111_0004928_6158_6973 | 251 |
| 65 | 3300048914 | Ga0496111_0022272 | Ga0496111_0022272_1864_2679 | 251 |
| 66 | 3300048915 | Ga0496112_0032012 | Ga0496112_0032012_3204_4019 | 251 |
| 67 | 3300048918 | Ga0496115_0085271 | Ga0496115_0085271_1347_2162 | 251 |
| 68 | 3300049583 | Ga0501067_0087584 | Ga0501067_0087584_148_963 | 251 |
| 69 | 3300053146 | Ga0500588_0122988 | Ga0500588_0122988_13_825 | 251 |
| 70 | 3300005347 | Ga0070668_100550602 | Ga0070668_1005506021 | 252 |
| 71 | 3300031911 | Ga0307412_10416596 | Ga0307412_104165962 | 252 |
| 72 | 3300039437 | Ga0436365_0138950 | Ga0436365_0138950_6966_7784 | 252 |
| 73 | 3300048927 | Ga0496124_0000001 | Ga0496124_0000001_904536_905567 | 252 |
| 74 | 3300049776 | Ga0501280_004984 | Ga0501280_004984_32_817 | 252 |
| 75 | 3300014325 | Ga0163163_10017716 | Ga0163163_100177165 | 253 |
| 76 | 3300037466 | Ga0395898_0454764 | Ga0395898_0454764_175_999 | 253 |
| 77 | 3300048923 | Ga0496120_0057469 | Ga0496120_0057469_1345_2175 | 253 |
| 78 | 3300025292 | Ga0209676_1000063 | Ga0209676_100006382 | 254 |
| 79 | 3300025916 | Ga0207663_10140540 | Ga0207663_101405402 | 254 |
| 80 | 3300039447 | Ga0436361_0534303 | Ga0436361_0534303_305_1243 | 254 |
| 81 | 3300041494 | Ga0451837_0019715 | Ga0451837_0019715_54_980 | 254 |
| 82 | 3300048928 | Ga0496125_0068259 | Ga0496125_0068259_1408_2334 | 254 |
| 83 | 3300021377 | Ga0213874_10004179 | Ga0213874_100041793 | 255 |
| 84 | 3300035117 | Ga0373953_0016807 | Ga0373953_0016807_729_1556 | 255 |
| 85 | 3300035172 | Ga0373955_0014552 | Ga0373955_0014552_1842_2669 | 255 |
| 86 | 3300036401 | Ga0373937_0001232 | Ga0373937_0001232_7432_8259 | 255 |
| 87 | 3300039450 | Ga0436363_0485340 | Ga0436363_0485340_3420_4304 | 255 |
| 88 | 3300046533 | Ga0495640_0136858 | Ga0495640_0136858_642_1469 | 255 |
| 89 | 3300046689 | Ga0495613_0242997 | Ga0495613_0242997_101_928 | 255 |
| 90 | 3300039447 | Ga0436361_0416901 | Ga0436361_0416901_1358_2188 | 256 |
| 91 | 3300003775 | Ga0055524_1032968 | Ga0055524_10329682 | 257 |
| 92 | 3300003781 | Ga0055536_1015229 | Ga0055536_10152292 | 257 |
| 93 | 3300003791 | Ga0055530_10000735 | Ga0055530_1000073523 | 257 |
| 94 | 3300003794 | Ga0055531_10016237 | Ga0055531_100162374 | 257 |
| 95 | 3300003794 | Ga0055531_10043335 | Ga0055531_100433352 | 257 |
| 96 | 3300005455 | Ga0070663_100012890 | Ga0070663_1000128905 | 257 |
| 97 | 3300005539 | Ga0068853_100262942 | Ga0068853_1002629422 | 257 |
| 98 | 3300005563 | Ga0068855_100005557 | Ga0068855_1000055575 | 257 |
| 99 | 3300005615 | Ga0070702_100107149 | Ga0070702_1001071492 | 257 |
| 100 | 3300006844 | Ga0075428_100235699 | Ga0075428_1002356992 | 257 |
| 101 | 3300009093 | Ga0105240_10027485 | Ga0105240_100274852 | 257 |
| 102 | 3300009147 | Ga0114129_10055454 | Ga0114129_100554545 | 257 |
| 103 | 3300025273 | Ga0209673_1019973 | Ga0209673_10199733 | 257 |
| 104 | 3300025284 | Ga0209130_1005244 | Ga0209130_10052444 | 257 |
| 105 | 3300025291 | Ga0209675_1005027 | Ga0209675_10050273 | 257 |
| 106 | 3300025294 | Ga0209025_1001794 | Ga0209025_10017949 | 257 |
| 107 | 3300025298 | Ga0209050_1001391 | Ga0209050_10013916 | 257 |
| 108 | 3300025299 | Ga0209256_1002151 | Ga0209256_10021515 | 257 |
| 109 | 3300025304 | Ga0209257_1000861 | Ga0209257_100086111 | 257 |
| 110 | 3300025304 | Ga0209257_1002921 | Ga0209257_100292115 | 257 |
| 111 | 3300025304 | Ga0209257_1004367 | Ga0209257_10043676 | 257 |
| 112 | 3300025304 | Ga0209257_1008020 | Ga0209257_10080202 | 257 |
| 113 | 3300025913 | Ga0207695_10017819 | Ga0207695_100178192 | 257 |
| 114 | 3300025932 | Ga0207690_10286878 | Ga0207690_102868781 | 257 |
| 115 | 3300025949 | Ga0207667_10009379 | Ga0207667_100093798 | 257 |
| 116 | 3300026067 | Ga0207678_10026877 | Ga0207678_100268775 | 257 |
| 117 | 3300026075 | Ga0207708_10165025 | Ga0207708_101650253 | 257 |
| 118 | 3300044842 | Ga0466957_0058893 | Ga0466957_0058893_641_1525 | 257 |
| 119 | 3300045049 | Ga0466959_0106995 | Ga0466959_0106995_997_1881 | 257 |
| 120 | 3300046517 | Ga0495630_0008243 | Ga0495630_0008243_952_1824 | 257 |
| 121 | 3300048912 | Ga0496109_0000015 | Ga0496109_0000015_16781_17617 | 257 |
| 122 | 3300049579 | Ga0501043_0002614 | Ga0501043_0002614_3142_4050 | 257 |
| 123 | 3300050507 | nmdc:mga05p37_26796_c1 | nmdc:mga05p37_26796_c1_5308_6147 | 257 |
| 124 | 3300050510 | nmdc:mga06r32_113267_c1 | nmdc:mga06r32_113267_c1_27_866 | 257 |
| 125 | 3300050510 | nmdc:mga06r32_35890_c1 | nmdc:mga06r32_35890_c1_2287_3126 | 257 |
| 126 | 3300050511 | nmdc:mga08y16_6650_c1 | nmdc:mga08y16_6650_c1_1951_2790 | 257 |
| 127 | 3300050512 | nmdc:mga0n895_49045_c1 | nmdc:mga0n895_49045_c1_1349_2188 | 257 |
| 128 | 3300050515 | nmdc:mga0a205_20211_c1 | nmdc:mga0a205_20211_c1_5111_5950 | 257 |
| 129 | 3300053080 | Ga0500635_0000051 | Ga0500635_0000051_48337_49212 | 257 |
| 130 | 3300053091 | Ga0500647_0048848 | Ga0500647_0048848_678_1553 | 257 |
| 131 | 3300053146 | Ga0500588_0004975 | Ga0500588_0004975_1781_2707 | 257 |
| 132 | 3300053150 | Ga0500603_028516 | Ga0500603_028516_309_1184 | 257 |
| 133 | 3300053157 | Ga0500624_002262 | Ga0500624_002262_1594_2469 | 257 |
| 134 | 3300053162 | Ga0500638_014263 | Ga0500638_014263_817_1692 | 257 |
| 135 | 3300053177 | Ga0500636_0070510 | Ga0500636_0070510_691_1566 | 257 |
| 136 | 3300053178 | Ga0500637_0001628 | Ga0500637_0001628_7919_8794 | 257 |
| 137 | 3300054114 | Ga0501084_0314573 | Ga0501084_0314573_361_1200 | 257 |
| 138 | 3300041509 | Ga0451843_0997273 | Ga0451843_0997273_805_1704 | 258 |
| 139 | 3300005347 | Ga0070668_100059844 | Ga0070668_1000598443 | 259 |
| 140 | 3300005353 | Ga0070669_100344635 | Ga0070669_1003446351 | 259 |
| 141 | 3300005459 | Ga0068867_100196206 | Ga0068867_1001962062 | 259 |
| 142 | 3300005543 | Ga0070672_100050260 | Ga0070672_1000502604 | 259 |
| 143 | 3300005577 | Ga0068857_100011431 | Ga0068857_1000114313 | 259 |
| 144 | 3300009545 | Ga0105237_10185971 | Ga0105237_101859712 | 259 |
| 145 | 3300013102 | Ga0157371_10106097 | Ga0157371_101060972 | 259 |
| 146 | 3300021377 | Ga0213874_10043283 | Ga0213874_100432832 | 259 |
| 147 | 3300025907 | Ga0207645_10049484 | Ga0207645_100494842 | 259 |
| 148 | 3300025940 | Ga0207691_10049985 | Ga0207691_100499854 | 259 |
| 149 | 3300025942 | Ga0207689_10215197 | Ga0207689_102151972 | 259 |
| 150 | 3300026116 | Ga0207674_10157030 | Ga0207674_101570302 | 259 |
| 151 | 3300039062 | Ga0400483_133234 | Ga0400483_133234_1759_2658 | 259 |
| 152 | 3300039450 | Ga0436363_1408746 | Ga0436363_1408746_221_1105 | 259 |
| 153 | 3300049580 | Ga0501046_0023123 | Ga0501046_0023123_864_1763 | 259 |
| 154 | 3300049588 | Ga0501072_0353350 | Ga0501072_0353350_211_1122 | 259 |
| 155 | 3300050491 | nmdc:mga00v17_16575_c1 | nmdc:mga00v17_16575_c1_99_1031 | 259 |
| 156 | 3300050491 | nmdc:mga00v17_69366_c1 | nmdc:mga00v17_69366_c1_1152_2084 | 259 |
| 157 | 3300005334 | Ga0068869_100016059 | Ga0068869_1000160595 | 260 |
| 158 | 3300005435 | Ga0070714_100315143 | Ga0070714_1003151431 | 260 |
| 159 | 3300005539 | Ga0068853_100001563 | Ga0068853_1000015636 | 260 |
| 160 | 3300005617 | Ga0068859_100188938 | Ga0068859_1001889383 | 260 |
| 161 | 3300005841 | Ga0068863_100003508 | Ga0068863_10000350811 | 260 |
| 162 | 3300005843 | Ga0068860_100017042 | Ga0068860_1000170426 | 260 |
| 163 | 3300006881 | Ga0068865_100116088 | Ga0068865_1001160882 | 260 |
| 164 | 3300006931 | Ga0097620_100188918 | Ga0097620_1001889183 | 260 |
| 165 | 3300009176 | Ga0105242_10002451 | Ga0105242_1000245110 | 260 |
| 166 | 3300010375 | Ga0105239_10001780 | Ga0105239_1000178013 | 260 |
| 167 | 3300013102 | Ga0157371_10167244 | Ga0157371_101672442 | 260 |
| 168 | 3300013306 | Ga0163162_10027266 | Ga0163162_100272667 | 260 |
| 169 | 3300013306 | Ga0163162_10253603 | Ga0163162_102536032 | 260 |
| 170 | 3300013308 | Ga0157375_10000144 | Ga0157375_1000014431 | 260 |
| 171 | 3300014325 | Ga0163163_10008166 | Ga0163163_1000816610 | 260 |
| 172 | 3300014968 | Ga0157379_10004862 | Ga0157379_100048628 | 260 |
| 173 | 3300014969 | Ga0157376_10004137 | Ga0157376_1000413711 | 260 |
| 174 | 3300025916 | Ga0207663_10107229 | Ga0207663_101072292 | 260 |
| 175 | 3300025929 | Ga0207664_10203081 | Ga0207664_102030812 | 260 |
| 176 | 3300025934 | Ga0207686_10057887 | Ga0207686_100578873 | 260 |
| 177 | 3300025938 | Ga0207704_10013711 | Ga0207704_100137113 | 260 |
| 178 | 3300025938 | Ga0207704_10264517 | Ga0207704_102645172 | 260 |
| 179 | 3300026041 | Ga0207639_10009068 | Ga0207639_100090684 | 260 |
| 180 | 3300026088 | Ga0207641_10016815 | Ga0207641_100168153 | 260 |
| 181 | 3300026121 | Ga0207683_10074023 | Ga0207683_100740233 | 260 |
| 182 | 3300028379 | Ga0268266_10119760 | Ga0268266_101197602 | 260 |
| 183 | 3300028381 | Ga0268264_10040000 | Ga0268264_100400001 | 260 |
| 184 | 3300031730 | Ga0307516_10065290 | Ga0307516_100652903 | 260 |
| 185 | 3300041460 | Ga0451802_1915534 | Ga0451802_1915534_214_1113 | 260 |
| 186 | 3300041494 | Ga0451837_1224968 | Ga0451837_1224968_3087_3986 | 260 |
| 187 | 3300048907 | Ga0496104_0000005 | Ga0496104_0000005_524987_525853 | 260 |
| 188 | 3300048908 | Ga0496105_0000018 | Ga0496105_0000018_90572_91438 | 260 |
| 189 | 3300049571 | Ga0501034_0000127 | Ga0501034_0000127_128781_129689 | 260 |
| 190 | 3300049742 | Ga0501080_0001520 | Ga0501080_0001520_1803_2654 | 260 |
| 191 | 3300005618 | Ga0068864_100000106 | Ga0068864_10000010649 | 261 |
| 192 | 3300005841 | Ga0068863_100000079 | Ga0068863_100000079104 | 261 |
| 193 | 3300005842 | Ga0068858_100000006 | Ga0068858_100000006103 | 261 |
| 194 | 3300009092 | Ga0105250_10030095 | Ga0105250_100300951 | 261 |
| 195 | 3300009177 | Ga0105248_10000789 | Ga0105248_100007898 | 261 |
| 196 | 3300009177 | Ga0105248_10011687 | Ga0105248_100116879 | 261 |
| 197 | 3300010375 | Ga0105239_10080575 | Ga0105239_100805752 | 261 |
| 198 | 3300021384 | Ga0213876_10008313 | Ga0213876_100083135 | 261 |
| 199 | 3300025941 | Ga0207711_10003286 | Ga0207711_1000328611 | 261 |
| 200 | 3300025941 | Ga0207711_10004051 | Ga0207711_100040514 | 261 |
| 201 | 3300026035 | Ga0207703_10000027 | Ga0207703_1000002730 | 261 |
| 202 | 3300026088 | Ga0207641_10000003 | Ga0207641_10000003344 | 261 |
| 203 | 3300026095 | Ga0207676_10007358 | Ga0207676_100073584 | 261 |
| 204 | 3300028573 | Ga0265334_10043808 | Ga0265334_100438082 | 261 |
| 205 | 3300031240 | Ga0265320_10004662 | Ga0265320_100046626 | 261 |
| 206 | 3300031712 | Ga0265342_10198541 | Ga0265342_101985411 | 261 |
| 207 | 3300037471 | Ga0395905_0042939 | Ga0395905_0042939_1455_2336 | 261 |
| 208 | 3300038741 | Ga0400488_63061 | Ga0400488_63061_618_1523 | 261 |
| 209 | 3300039062 | Ga0400483_135634 | Ga0400483_135634_368_1273 | 261 |
| 210 | 3300039062 | Ga0400483_227477 | Ga0400483_227477_142_1047 | 261 |
| 211 | 3300039437 | Ga0436365_0961511 | Ga0436365_0961511_570_1475 | 261 |
| 212 | 3300039447 | Ga0436361_0095589 | Ga0436361_0095589_115_999 | 261 |
| 213 | 3300044693 | Ga0466961_0190624 | Ga0466961_0190624_326_1201 | 261 |
| 214 | 3300046516 | Ga0495628_0008875 | Ga0495628_0008875_6794_7678 | 261 |
| 215 | 3300046517 | Ga0495630_0019912 | Ga0495630_0019912_1183_2067 | 261 |
| 216 | 3300048917 | Ga0496114_0110570 | Ga0496114_0110570_975_1847 | 261 |
| 217 | 3300048918 | Ga0496115_0000002 | Ga0496115_0000002_289250_290122 | 261 |
| 218 | 3300048920 | Ga0496117_0059598 | Ga0496117_0059598_1667_2575 | 261 |
| 219 | 3300048921 | Ga0496118_0095014 | Ga0496118_0095014_719_1627 | 261 |
| 220 | 3300048924 | Ga0496121_0000042 | Ga0496121_0000042_158889_159797 | 261 |
| 221 | 3300048929 | Ga0496126_0000052 | Ga0496126_0000052_236421_237293 | 261 |
| 222 | 3300049570 | Ga0501033_0035656 | Ga0501033_0035656_1475_2371 | 261 |
| 223 | 3300049575 | Ga0501039_0255762 | Ga0501039_0255762_287_1183 | 261 |
| 224 | 3300049823 | Ga0501044_0054322 | Ga0501044_0054322_766_1662 | 261 |
| 225 | 3300005578 | Ga0068854_100220678 | Ga0068854_1002206781 | 262 |
| 226 | 3300005843 | Ga0068860_100321734 | Ga0068860_1003217342 | 262 |
| 227 | 3300005937 | Ga0081455_10034420 | Ga0081455_100344203 | 262 |
| 228 | 3300013105 | Ga0157369_10087264 | Ga0157369_100872644 | 262 |
| 229 | 3300031995 | Ga0307409_100047886 | Ga0307409_1000478863 | 262 |
| 230 | 3300035692 | Ga0373935_0101921 | Ga0373935_0101921_517_1395 | 262 |
| 231 | 3300037312 | Ga0395899_0159725 | Ga0395899_0159725_497_1444 | 262 |
| 232 | 3300037466 | Ga0395898_0081810 | Ga0395898_0081810_1052_1999 | 262 |
| 233 | 3300038443 | Ga0395901_0030728 | Ga0395901_0030728_837_1784 | 262 |
| 234 | 3300038742 | Ga0400486_10450 | Ga0400486_10450_412_1368 | 262 |
| 235 | 3300046455 | Ga0495603_0108960 | Ga0495603_0108960_41_934 | 262 |
| 236 | 3300046499 | Ga0495594_0033264 | Ga0495594_0033264_342_1235 | 262 |
| 237 | 3300046516 | Ga0495628_0000643 | Ga0495628_0000643_1558_2424 | 262 |
| 238 | 3300046530 | Ga0495654_0105984 | Ga0495654_0105984_109_1020 | 262 |
| 239 | 3300046557 | Ga0495622_0006793 | Ga0495622_0006793_3754_4647 | 262 |
| 240 | 3300048091 | Ga0495626_0073853 | Ga0495626_0073853_450_1343 | 262 |
| 241 | 3300053090 | Ga0500646_0016547 | Ga0500646_0016547_570_1463 | 262 |
| 242 | 3300053103 | Ga0500555_002713 | Ga0500555_002713_3553_4455 | 262 |
| 243 | 3300053178 | Ga0500637_0006080 | Ga0500637_0006080_4577_5470 | 262 |
| 244 | iso_pu_bacteria | 2551306352 | 2552749139 | 262 |
| 245 | iso_pu_bacteria | 2639762793 | 2640734086 | 262 |
| 246 | iso_pu_bacteria | 2675903507 | 2678231061 | 262 |
| 247 | iso_pu_bacteria | 2744054655 | 2745160185 | 262 |
| 248 | iso_pu_bacteria | 2773857761 | 2774388390 | 262 |
| 249 | iso_pu_bacteria | 2773857770 | 2774437592 | 262 |
| 250 | iso_pu_bacteria | 2883354860 | 2883359923 | 262 |
| 251 | iso_pu_bacteria | 2916699645 | 2916702072 | 262 |
| 252 | iso_pu_bacteria | 2919182534 | 2919183973 | 262 |
| 253 | iso_pu_bacteria | 2919506607 | 2919507821 | 262 |
| 254 | iso_pu_bacteria | 8015556637 | 8015559062 | 262 |
| 255 | iso_pu_bacteria | 8033232454 | 8033232747 | 262 |
| 256 | 3300005331 | Ga0070670_100000002 | Ga0070670_10000000285 | 263 |
| 257 | 3300005331 | Ga0070670_100000004 | Ga0070670_100000004125 | 263 |
| 258 | 3300005335 | Ga0070666_10022684 | Ga0070666_100226844 | 263 |
| 259 | 3300005335 | Ga0070666_10153050 | Ga0070666_101530501 | 263 |
| 260 | 3300005347 | Ga0070668_100001643 | Ga0070668_1000016439 | 263 |
| 261 | 3300005353 | Ga0070669_100096073 | Ga0070669_1000960732 | 263 |
| 262 | 3300005355 | Ga0070671_100000094 | Ga0070671_10000009447 | 263 |
| 263 | 3300005367 | Ga0070667_100000018 | Ga0070667_10000001884 | 263 |
| 264 | 3300005367 | Ga0070667_100000105 | Ga0070667_10000010512 | 263 |
| 265 | 3300005466 | Ga0070685_10000001 | Ga0070685_10000001299 | 263 |
| 266 | 3300005548 | Ga0070665_100001194 | Ga0070665_10000119425 | 263 |
| 267 | 3300005563 | Ga0068855_100776242 | Ga0068855_1007762421 | 263 |
| 268 | 3300005577 | Ga0068857_100094324 | Ga0068857_1000943242 | 263 |
| 269 | 3300005617 | Ga0068859_100019995 | Ga0068859_1000199953 | 263 |
| 270 | 3300005617 | Ga0068859_100067314 | Ga0068859_1000673144 | 263 |
| 271 | 3300005618 | Ga0068864_100000003 | Ga0068864_10000000386 | 263 |
| 272 | 3300005618 | Ga0068864_100000082 | Ga0068864_100000082106 | 263 |
| 273 | 3300005841 | Ga0068863_100000560 | Ga0068863_10000056029 | 263 |
| 274 | 3300005842 | Ga0068858_100031660 | Ga0068858_1000316607 | 263 |
| 275 | 3300005842 | Ga0068858_100060498 | Ga0068858_1000604984 | 263 |
| 276 | 3300005843 | Ga0068860_100000077 | Ga0068860_100000077125 | 263 |
| 277 | 3300005843 | Ga0068860_100005872 | Ga0068860_10000587211 | 263 |
| 278 | 3300005843 | Ga0068860_100474456 | Ga0068860_1004744562 | 263 |
| 279 | 3300005844 | Ga0068862_100000183 | Ga0068862_1000001834 | 263 |
| 280 | 3300005844 | Ga0068862_100006226 | Ga0068862_1000062263 | 263 |
| 281 | 3300005844 | Ga0068862_100022521 | Ga0068862_1000225213 | 263 |
| 282 | 3300006175 | Ga0070712_100139503 | Ga0070712_1001395031 | 263 |
| 283 | 3300006931 | Ga0097620_100019995 | Ga0097620_1000199953 | 263 |
| 284 | 3300006931 | Ga0097620_100067314 | Ga0097620_1000673142 | 263 |
| 285 | 3300009094 | Ga0111539_10119671 | Ga0111539_101196714 | 263 |
| 286 | 3300009101 | Ga0105247_10031507 | Ga0105247_100315074 | 263 |
| 287 | 3300009147 | Ga0114129_10143619 | Ga0114129_101436192 | 263 |
| 288 | 3300009177 | Ga0105248_10014093 | Ga0105248_100140931 | 263 |
| 289 | 3300009553 | Ga0105249_10000838 | Ga0105249_100008382 | 263 |
| 290 | 3300009553 | Ga0105249_10015705 | Ga0105249_100157054 | 263 |
| 291 | 3300009553 | Ga0105249_10100564 | Ga0105249_101005643 | 263 |
| 292 | 3300013306 | Ga0163162_10238791 | Ga0163162_102387912 | 263 |
| 293 | 3300014325 | Ga0163163_10000145 | Ga0163163_1000014520 | 263 |
| 294 | 3300014325 | Ga0163163_10656768 | Ga0163163_106567681 | 263 |
| 295 | 3300014968 | Ga0157379_10018883 | Ga0157379_100188835 | 263 |
| 296 | 3300014968 | Ga0157379_10123021 | Ga0157379_101230212 | 263 |
| 297 | 3300025900 | Ga0207710_10035391 | Ga0207710_100353914 | 263 |
| 298 | 3300025903 | Ga0207680_10005098 | Ga0207680_100050984 | 263 |
| 299 | 3300025903 | Ga0207680_10012307 | Ga0207680_100123075 | 263 |
| 300 | 3300025912 | Ga0207707_10032738 | Ga0207707_100327382 | 263 |
| 301 | 3300025913 | Ga0207695_10197157 | Ga0207695_101971572 | 263 |
| 302 | 3300025923 | Ga0207681_10083733 | Ga0207681_100837332 | 263 |
| 303 | 3300025923 | Ga0207681_10132563 | Ga0207681_101325633 | 263 |
| 304 | 3300025925 | Ga0207650_10000003 | Ga0207650_10000003640 | 263 |
| 305 | 3300025925 | Ga0207650_10000033 | Ga0207650_10000033219 | 263 |
| 306 | 3300025931 | Ga0207644_10000013 | Ga0207644_100000133 | 263 |
| 307 | 3300025941 | Ga0207711_10000290 | Ga0207711_1000029020 | 263 |
| 308 | 3300025941 | Ga0207711_10000950 | Ga0207711_1000095013 | 263 |
| 309 | 3300025941 | Ga0207711_10035362 | Ga0207711_100353624 | 263 |
| 310 | 3300025949 | Ga0207667_10464388 | Ga0207667_104643881 | 263 |
| 311 | 3300025961 | Ga0207712_10000651 | Ga0207712_100006512 | 263 |
| 312 | 3300025961 | Ga0207712_10009828 | Ga0207712_100098284 | 263 |
| 313 | 3300025972 | Ga0207668_10000426 | Ga0207668_100004268 | 263 |
| 314 | 3300025986 | Ga0207658_10000004 | Ga0207658_1000000487 | 263 |
| 315 | 3300025986 | Ga0207658_10000229 | Ga0207658_1000022962 | 263 |
| 316 | 3300026035 | Ga0207703_10041892 | Ga0207703_100418924 | 263 |
| 317 | 3300026035 | Ga0207703_10070497 | Ga0207703_100704973 | 263 |
| 318 | 3300026088 | Ga0207641_10001887 | Ga0207641_100018878 | 263 |
| 319 | 3300026095 | Ga0207676_10000003 | Ga0207676_10000003455 | 263 |
| 320 | 3300026095 | Ga0207676_10000068 | Ga0207676_1000006889 | 263 |
| 321 | 3300028379 | Ga0268266_10004139 | Ga0268266_100041398 | 263 |
| 322 | 3300028379 | Ga0268266_10047634 | Ga0268266_100476342 | 263 |
| 323 | 3300028380 | Ga0268265_10001499 | Ga0268265_100014996 | 263 |
| 324 | 3300028380 | Ga0268265_10004547 | Ga0268265_100045475 | 263 |
| 325 | 3300028380 | Ga0268265_10013087 | Ga0268265_100130877 | 263 |
| 326 | 3300028381 | Ga0268264_10000009 | Ga0268264_1000000931 | 263 |
| 327 | 3300028381 | Ga0268264_10000032 | Ga0268264_10000032290 | 263 |
| 328 | 3300031251 | Ga0265327_10010799 | Ga0265327_100107997 | 263 |
| 329 | 3300031903 | Ga0307407_10299767 | Ga0307407_102997672 | 263 |
| 330 | 3300035695 | Ga0373927_0000001 | Ga0373927_0000001_8944_9816 | 263 |
| 331 | 3300046530 | Ga0495654_0000143 | Ga0495654_0000143_48912_49790 | 263 |
| 332 | 3300046539 | Ga0495621_0069355 | Ga0495621_0069355_415_1278 | 263 |
| 333 | 3300047315 | Ga0495581_0022861 | Ga0495581_0022861_2635_3537 | 263 |
| 334 | 3300048905 | Ga0496102_0081113 | Ga0496102_0081113_1317_2222 | 263 |
| 335 | 3300048927 | Ga0496124_0164347 | Ga0496124_0164347_806_1693 | 263 |
| 336 | 3300049772 | Ga0501275_000135 | Ga0501275_000135_5152_6063 | 263 |
| 337 | 3300050508 | nmdc:mga09592_141809_c1 | nmdc:mga09592_141809_c1_1068_1937 | 263 |
| 338 | 3300050511 | nmdc:mga08y16_91877_c1 | nmdc:mga08y16_91877_c1_168_1052 | 263 |
| 339 | iso_pu_bacteria | 2643221581 | 2643914476 | 263 |
| 340 | iso_pu_bacteria | 2671180139 | 2671693604 | 263 |
| 341 | iso_pu_bacteria | 2883291878 | 2883297141 | 263 |
| 342 | iso_pu_bacteria | 2984568884 | 2984570164 | 263 |
| 343 | 3300005347 | Ga0070668_100002624 | Ga0070668_1000026247 | 264 |
| 344 | 3300005435 | Ga0070714_100029776 | Ga0070714_1000297763 | 264 |
| 345 | 3300005439 | Ga0070711_100000012 | Ga0070711_100000012113 | 264 |
| 346 | 3300005439 | Ga0070711_100040037 | Ga0070711_1000400373 | 264 |
| 347 | 3300005458 | Ga0070681_10050441 | Ga0070681_100504413 | 264 |
| 348 | 3300005530 | Ga0070679_100131470 | Ga0070679_1001314702 | 264 |
| 349 | 3300005548 | Ga0070665_100000198 | Ga0070665_10000019831 | 264 |
| 350 | 3300005578 | Ga0068854_100173356 | Ga0068854_1001733562 | 264 |
| 351 | 3300005842 | Ga0068858_100797493 | Ga0068858_1007974931 | 264 |
| 352 | 3300006914 | Ga0075436_100000463 | Ga0075436_10000046313 | 264 |
| 353 | 3300007076 | Ga0075435_100160203 | Ga0075435_1001602032 | 264 |
| 354 | 3300014969 | Ga0157376_10543791 | Ga0157376_105437912 | 264 |
| 355 | 3300025909 | Ga0207705_10505294 | Ga0207705_105052941 | 264 |
| 356 | 3300025912 | Ga0207707_10108321 | Ga0207707_101083211 | 264 |
| 357 | 3300025916 | Ga0207663_10000014 | Ga0207663_10000014111 | 264 |
| 358 | 3300025928 | Ga0207700_10061566 | Ga0207700_100615663 | 264 |
| 359 | 3300025929 | Ga0207664_10006047 | Ga0207664_100060473 | 264 |
| 360 | 3300025929 | Ga0207664_10014026 | Ga0207664_100140266 | 264 |
| 361 | 3300025972 | Ga0207668_10000004 | Ga0207668_1000000492 | 264 |
| 362 | 3300025986 | Ga0207658_10039423 | Ga0207658_100394234 | 264 |
| 363 | 3300028379 | Ga0268266_10001373 | Ga0268266_100013737 | 264 |
| 364 | 3300028380 | Ga0268265_10108840 | Ga0268265_101088402 | 264 |
| 365 | 3300028573 | Ga0265334_10011266 | Ga0265334_100112663 | 264 |
| 366 | 3300028800 | Ga0265338_10023035 | Ga0265338_100230357 | 264 |
| 367 | 3300030731 | Ga0316177_1170645 | Ga0316177_11706452 | 264 |
| 368 | 3300030733 | Ga0314311_1183412 | Ga0314311_11834124 | 264 |
| 369 | 3300031595 | Ga0265313_10004290 | Ga0265313_100042905 | 264 |
| 370 | 3300031691 | Ga0316579_10082979 | Ga0316579_100829791 | 264 |
| 371 | 3300031733 | Ga0316577_10072358 | Ga0316577_100723582 | 264 |
| 372 | 3300031901 | Ga0307406_10184897 | Ga0307406_101848972 | 264 |
| 373 | 3300032137 | Ga0316585_10079882 | Ga0316585_100798822 | 264 |
| 374 | 3300032168 | Ga0316593_10000719 | Ga0316593_100007195 | 264 |
| 375 | 3300035725 | Ga0373947_0267870 | Ga0373947_0267870_245_1099 | 264 |
| 376 | 3300036647 | Ga0316582_0025101 | Ga0316582_0025101_286_1164 | 264 |
| 377 | 3300036712 | Ga0316584_0173226 | Ga0316584_0173226_499_1377 | 264 |
| 378 | 3300037418 | Ga0395900_0001243 | Ga0395900_0001243_27233_28105 | 264 |
| 379 | 3300039438 | Ga0436360_0438284 | Ga0436360_0438284_1726_2610 | 264 |
| 380 | 3300041413 | Ga0439465_0000821 | Ga0439465_0000821_8605_9519 | 264 |
| 381 | 3300041509 | Ga0451843_0505550 | Ga0451843_0505550_784_1701 | 264 |
| 382 | 3300042007 | Ga0439449_0000005 | Ga0439449_0000005_6507_7406 | 264 |
| 383 | 3300042876 | Ga0451577_0013406 | Ga0451577_0013406_5265_6179 | 264 |
| 384 | 3300044712 | Ga0453684_0265723 | Ga0453684_0265723_231_1145 | 264 |
| 385 | 3300046533 | Ga0495640_0090849 | Ga0495640_0090849_1000_1851 | 264 |
| 386 | 3300049705 | Ga0501225_0003136 | Ga0501225_0003136_3561_4460 | 264 |
| 387 | 3300050513 | nmdc:mga0rr50_141603_c1 | nmdc:mga0rr50_141603_c1_174_1040 | 264 |
| 388 | 3300050514 | nmdc:mga08x19_19_c1 | nmdc:mga08x19_19_c1_229363_230223 | 264 |
| 389 | 3300050514 | nmdc:mga08x19_58705_c1 | nmdc:mga08x19_58705_c1_277_1143 | 264 |
| 390 | 3300053104 | Ga0500556_0017250 | Ga0500556_0017250_263_1162 | 264 |
| 391 | iso_pu_bacteria | 8002869464 | 8002870509 | 264 |
| 392 | iso_pu_bacteria | 8054563764 | 8054566031 | 264 |
| 393 | 3300003794 | Ga0055531_10012552 | Ga0055531_100125524 | 265 |
| 394 | 3300005327 | Ga0070658_10044630 | Ga0070658_100446304 | 265 |
| 395 | 3300005328 | Ga0070676_10041747 | Ga0070676_100417473 | 265 |
| 396 | 3300005329 | Ga0070683_100000479 | Ga0070683_10000047912 | 265 |
| 397 | 3300005331 | Ga0070670_100000594 | Ga0070670_10000059414 | 265 |
| 398 | 3300005334 | Ga0068869_100130623 | Ga0068869_1001306232 | 265 |
| 399 | 3300005336 | Ga0070680_100059100 | Ga0070680_1000591003 | 265 |
| 400 | 3300005344 | Ga0070661_100000367 | Ga0070661_1000003672 | 265 |
| 401 | 3300005347 | Ga0070668_100037808 | Ga0070668_1000378082 | 265 |
| 402 | 3300005354 | Ga0070675_100000494 | Ga0070675_10000049411 | 265 |
| 403 | 3300005355 | Ga0070671_100001151 | Ga0070671_1000011514 | 265 |
| 404 | 3300005355 | Ga0070671_100037740 | Ga0070671_1000377404 | 265 |
| 405 | 3300005364 | Ga0070673_100001037 | Ga0070673_1000010379 | 265 |
| 406 | 3300005366 | Ga0070659_100008001 | Ga0070659_1000080014 | 265 |
| 407 | 3300005435 | Ga0070714_100001453 | Ga0070714_1000014535 | 265 |
| 408 | 3300005439 | Ga0070711_100020963 | Ga0070711_1000209633 | 265 |
| 409 | 3300005445 | Ga0070708_100038486 | Ga0070708_1000384864 | 265 |
| 410 | 3300005456 | Ga0070678_100001072 | Ga0070678_1000010723 | 265 |
| 411 | 3300005458 | Ga0070681_10081458 | Ga0070681_100814583 | 265 |
| 412 | 3300005459 | Ga0068867_100013925 | Ga0068867_1000139257 | 265 |
| 413 | 3300005459 | Ga0068867_100018820 | Ga0068867_1000188202 | 265 |
| 414 | 3300005468 | Ga0070707_100132587 | Ga0070707_1001325872 | 265 |
| 415 | 3300005530 | Ga0070679_100497223 | Ga0070679_1004972231 | 265 |
| 416 | 3300005535 | Ga0070684_100005553 | Ga0070684_10000555311 | 265 |
| 417 | 3300005535 | Ga0070684_100037546 | Ga0070684_1000375461 | 265 |
| 418 | 3300005539 | Ga0068853_100151898 | Ga0068853_1001518982 | 265 |
| 419 | 3300005543 | Ga0070672_100000296 | Ga0070672_10000029615 | 265 |
| 420 | 3300005564 | Ga0070664_100000600 | Ga0070664_10000060011 | 265 |
| 421 | 3300005564 | Ga0070664_100001724 | Ga0070664_10000172410 | 265 |
| 422 | 3300005577 | Ga0068857_100002588 | Ga0068857_10000258818 | 265 |
| 423 | 3300005578 | Ga0068854_100007111 | Ga0068854_1000071112 | 265 |
| 424 | 3300005578 | Ga0068854_100026474 | Ga0068854_1000264745 | 265 |
| 425 | 3300005614 | Ga0068856_100230290 | Ga0068856_1002302901 | 265 |
| 426 | 3300005616 | Ga0068852_100001015 | Ga0068852_10000101515 | 265 |
| 427 | 3300005616 | Ga0068852_100001646 | Ga0068852_10000164616 | 265 |
| 428 | 3300005618 | Ga0068864_100017157 | Ga0068864_1000171572 | 265 |
| 429 | 3300005719 | Ga0068861_100007289 | Ga0068861_1000072892 | 265 |
| 430 | 3300005834 | Ga0068851_10031422 | Ga0068851_100314222 | 265 |
| 431 | 3300005840 | Ga0068870_10099198 | Ga0068870_100991982 | 265 |
| 432 | 3300005841 | Ga0068863_100020113 | Ga0068863_1000201131 | 265 |
| 433 | 3300005844 | Ga0068862_100026865 | Ga0068862_1000268651 | 265 |
| 434 | 3300005844 | Ga0068862_100135164 | Ga0068862_1001351642 | 265 |
| 435 | 3300005844 | Ga0068862_100203078 | Ga0068862_1002030782 | 265 |
| 436 | 3300005937 | Ga0081455_10001053 | Ga0081455_100010537 | 265 |
| 437 | 3300005937 | Ga0081455_10034469 | Ga0081455_100344694 | 265 |
| 438 | 3300005985 | Ga0081539_10003150 | Ga0081539_1000315020 | 265 |
| 439 | 3300006051 | Ga0075364_10001168 | Ga0075364_100011685 | 265 |
| 440 | 3300006237 | Ga0097621_100002067 | Ga0097621_10000206714 | 265 |
| 441 | 3300006358 | Ga0068871_100001398 | Ga0068871_10000139813 | 265 |
| 442 | 3300006844 | Ga0075428_100022864 | Ga0075428_1000228647 | 265 |
| 443 | 3300006844 | Ga0075428_100308611 | Ga0075428_1003086112 | 265 |
| 444 | 3300006846 | Ga0075430_100072924 | Ga0075430_1000729243 | 265 |
| 445 | 3300006847 | Ga0075431_100018811 | Ga0075431_1000188114 | 265 |
| 446 | 3300006847 | Ga0075431_100151857 | Ga0075431_1001518572 | 265 |
| 447 | 3300006847 | Ga0075431_100658457 | Ga0075431_1006584571 | 265 |
| 448 | 3300006852 | Ga0075433_10055028 | Ga0075433_100550282 | 265 |
| 449 | 3300006880 | Ga0075429_100059475 | Ga0075429_1000594752 | 265 |
| 450 | 3300009093 | Ga0105240_10007477 | Ga0105240_1000747718 | 265 |
| 451 | 3300009545 | Ga0105237_10054385 | Ga0105237_100543853 | 265 |
| 452 | 3300009551 | Ga0105238_10002367 | Ga0105238_100023672 | 265 |
| 453 | 3300013104 | Ga0157370_10013571 | Ga0157370_1001357110 | 265 |
| 454 | 3300013105 | Ga0157369_10016738 | Ga0157369_1001673810 | 265 |
| 455 | 3300013296 | Ga0157374_10475657 | Ga0157374_104756571 | 265 |
| 456 | 3300013297 | Ga0157378_10010920 | Ga0157378_100109203 | 265 |
| 457 | 3300013297 | Ga0157378_10465757 | Ga0157378_104657572 | 265 |
| 458 | 3300014326 | Ga0157380_10072743 | Ga0157380_100727433 | 265 |
| 459 | 3300014968 | Ga0157379_10066868 | Ga0157379_100668683 | 265 |
| 460 | 3300025292 | Ga0209676_1001849 | Ga0209676_100184917 | 265 |
| 461 | 3300025294 | Ga0209025_1004726 | Ga0209025_100472611 | 265 |
| 462 | 3300025295 | Ga0209564_1026008 | Ga0209564_10260082 | 265 |
| 463 | 3300025304 | Ga0209257_1001769 | Ga0209257_100176918 | 265 |
| 464 | 3300025321 | Ga0207656_10007484 | Ga0207656_100074845 | 265 |
| 465 | 3300025321 | Ga0207656_10186665 | Ga0207656_101866651 | 265 |
| 466 | 3300025901 | Ga0207688_10010619 | Ga0207688_100106194 | 265 |
| 467 | 3300025909 | Ga0207705_10160957 | Ga0207705_101609572 | 265 |
| 468 | 3300025916 | Ga0207663_10025004 | Ga0207663_100250042 | 265 |
| 469 | 3300025917 | Ga0207660_10045661 | Ga0207660_100456612 | 265 |
| 470 | 3300025920 | Ga0207649_10044337 | Ga0207649_100443372 | 265 |
| 471 | 3300025921 | Ga0207652_10005171 | Ga0207652_1000517112 | 265 |
| 472 | 3300025922 | Ga0207646_10029093 | Ga0207646_100290936 | 265 |
| 473 | 3300025924 | Ga0207694_10000488 | Ga0207694_100004884 | 265 |
| 474 | 3300025925 | Ga0207650_10001730 | Ga0207650_100017309 | 265 |
| 475 | 3300025926 | Ga0207659_10001138 | Ga0207659_100011384 | 265 |
| 476 | 3300025929 | Ga0207664_10011167 | Ga0207664_100111679 | 265 |
| 477 | 3300025931 | Ga0207644_10001066 | Ga0207644_1000106615 | 265 |
| 478 | 3300025931 | Ga0207644_10010080 | Ga0207644_100100803 | 265 |
| 479 | 3300025932 | Ga0207690_10030107 | Ga0207690_100301073 | 265 |
| 480 | 3300025933 | Ga0207706_10017330 | Ga0207706_100173307 | 265 |
| 481 | 3300025940 | Ga0207691_10000381 | Ga0207691_1000038124 | 265 |
| 482 | 3300025944 | Ga0207661_10114027 | Ga0207661_101140272 | 265 |
| 483 | 3300025945 | Ga0207679_10003402 | Ga0207679_1000340211 | 265 |
| 484 | 3300025945 | Ga0207679_10010949 | Ga0207679_100109494 | 265 |
| 485 | 3300025972 | Ga0207668_10016309 | Ga0207668_100163093 | 265 |
| 486 | 3300026023 | Ga0207677_10001566 | Ga0207677_1000156611 | 265 |
| 487 | 3300026078 | Ga0207702_10001739 | Ga0207702_1000173923 | 265 |
| 488 | 3300026089 | Ga0207648_10029134 | Ga0207648_100291342 | 265 |
| 489 | 3300026089 | Ga0207648_10096960 | Ga0207648_100969603 | 265 |
| 490 | 3300026095 | Ga0207676_10192798 | Ga0207676_101927983 | 265 |
| 491 | 3300026116 | Ga0207674_10000014 | Ga0207674_10000014130 | 265 |
| 492 | 3300026118 | Ga0207675_100009359 | Ga0207675_1000093592 | 265 |
| 493 | 3300026121 | Ga0207683_10001475 | Ga0207683_1000147514 | 265 |
| 494 | 3300026142 | Ga0207698_10001465 | Ga0207698_100014655 | 265 |
| 495 | 3300027907 | Ga0207428_10269336 | Ga0207428_102693362 | 265 |
| 496 | 3300028380 | Ga0268265_10216316 | Ga0268265_102163162 | 265 |
| 497 | 3300028573 | Ga0265334_10000330 | Ga0265334_1000033012 | 265 |
| 498 | 3300028800 | Ga0265338_10158623 | Ga0265338_101586232 | 265 |
| 499 | 3300031241 | Ga0265325_10015985 | Ga0265325_100159853 | 265 |
| 500 | 3300031595 | Ga0265313_10000351 | Ga0265313_1000035131 | 265 |
| 501 | 3300031691 | Ga0316579_10001465 | Ga0316579_100014656 | 265 |
| 502 | 3300032133 | Ga0316583_10035116 | Ga0316583_100351162 | 265 |
| 503 | 3300032168 | Ga0316593_10000644 | Ga0316593_100006443 | 265 |
| 504 | 3300035691 | Ga0373931_0107602 | Ga0373931_0107602_277_1140 | 265 |
| 505 | 3300035695 | Ga0373927_0064367 | Ga0373927_0064367_579_1442 | 265 |
| 506 | 3300035724 | Ga0373933_0050041 | Ga0373933_0050041_323_1198 | 265 |
| 507 | 3300035724 | Ga0373933_0114563 | Ga0373933_0114563_376_1239 | 265 |
| 508 | 3300035725 | Ga0373947_0099948 | Ga0373947_0099948_122_1000 | 265 |
| 509 | 3300036401 | Ga0373937_0010393 | Ga0373937_0010393_7178_8041 | 265 |
| 510 | 3300036401 | Ga0373937_0159581 | Ga0373937_0159581_144_1019 | 265 |
| 511 | 3300036647 | Ga0316582_0030009 | Ga0316582_0030009_63_947 | 265 |
| 512 | 3300036647 | Ga0316582_0387086 | Ga0316582_0387086_19_924 | 265 |
| 513 | 3300036712 | Ga0316584_0012487 | Ga0316584_0012487_1108_2013 | 265 |
| 514 | 3300036712 | Ga0316584_0064388 | Ga0316584_0064388_443_1381 | 265 |
| 515 | 3300037068 | Ga0373925_0017823 | Ga0373925_0017823_2754_3617 | 265 |
| 516 | 3300037418 | Ga0395900_0277031 | Ga0395900_0277031_67_1071 | 265 |
| 517 | 3300037588 | Ga0316581_0034830 | Ga0316581_0034830_355_1239 | 265 |
| 518 | 3300038742 | Ga0400486_00542 | Ga0400486_00542_293_1180 | 265 |
| 519 | 3300039093 | Ga0400489_67955 | Ga0400489_67955_85_969 | 265 |
| 520 | 3300039093 | Ga0400489_73156 | Ga0400489_73156_224_1108 | 265 |
| 521 | 3300039450 | Ga0436363_1461336 | Ga0436363_1461336_589_1461 | 265 |
| 522 | 3300041404 | Ga0439436_0001101 | Ga0439436_0001101_284_1186 | 265 |
| 523 | 3300044673 | Ga0453683_0003598 | Ga0453683_0003598_800_1741 | 265 |
| 524 | 3300044712 | Ga0453684_0141280 | Ga0453684_0141280_788_1729 | 265 |
| 525 | 3300045051 | Ga0451576_0000479 | Ga0451576_0000479_3775_4716 | 265 |
| 526 | 3300046454 | Ga0495592_0064784 | Ga0495592_0064784_959_1837 | 265 |
| 527 | 3300046543 | Ga0495645_0308464 | Ga0495645_0308464_155_1018 | 265 |
| 528 | 3300046615 | Ga0495656_0006815 | Ga0495656_0006815_1757_2665 | 265 |
| 529 | 3300047319 | Ga0495674_0283028 | Ga0495674_0283028_457_1329 | 265 |
| 530 | 3300048907 | Ga0496104_0000118 | Ga0496104_0000118_8980_9846 | 265 |
| 531 | 3300048908 | Ga0496105_0000056 | Ga0496105_0000056_8980_9846 | 265 |
| 532 | 3300048908 | Ga0496105_0100718 | Ga0496105_0100718_506_1369 | 265 |
| 533 | 3300048915 | Ga0496112_0018667 | Ga0496112_0018667_2698_3561 | 265 |
| 534 | 3300048916 | Ga0496113_0054754 | Ga0496113_0054754_1970_2833 | 265 |
| 535 | 3300048917 | Ga0496114_0022877 | Ga0496114_0022877_491_1357 | 265 |
| 536 | 3300048922 | Ga0496119_0000206 | Ga0496119_0000206_55653_56519 | 265 |
| 537 | 3300048922 | Ga0496119_0116713 | Ga0496119_0116713_38_901 | 265 |
| 538 | 3300050491 | nmdc:mga00v17_200_c1 | nmdc:mga00v17_200_c1_8721_9647 | 265 |
| 539 | 3300050509 | nmdc:mga0qj67_58745_c1 | nmdc:mga0qj67_58745_c1_1780_2661 | 265 |
| 540 | 3300050510 | nmdc:mga06r32_37824_c1 | nmdc:mga06r32_37824_c1_1719_2600 | 265 |
| 541 | 3300053103 | Ga0500555_031233 | Ga0500555_031233_84_956 | 265 |
| 542 | iso_pu_bacteria | 2643221559 | 2643817966 | 265 |
| 543 | iso_pu_bacteria | 2643221586 | 2643937624 | 265 |
| 544 | iso_pu_bacteria | 2643221612 | 2644078538 | 265 |
| 545 | iso_pu_bacteria | 2643221727 | 2644693315 | 265 |
| 546 | iso_pu_bacteria | 2987605356 | 2987606915 | 265 |
| 547 | iso_pu_bacteria | 8003014200 | 8003017885 | 265 |
| 548 | 3300003856 | Ga0058692_1000003 | Ga0058692_1000003105 | 266 |
| 549 | 3300005272 | Ga0065703_1000145 | Ga0065703_100014568 | 266 |
| 550 | 3300005335 | Ga0070666_10000196 | Ga0070666_100001966 | 266 |
| 551 | 3300005336 | Ga0070680_100001064 | Ga0070680_10000106420 | 266 |
| 552 | 3300005338 | Ga0068868_100655641 | Ga0068868_1006556411 | 266 |
| 553 | 3300005341 | Ga0070691_10000339 | Ga0070691_1000033911 | 266 |
| 554 | 3300005347 | Ga0070668_100045394 | Ga0070668_1000453941 | 266 |
| 555 | 3300005353 | Ga0070669_100012016 | Ga0070669_1000120164 | 266 |
| 556 | 3300005434 | Ga0070709_10000408 | Ga0070709_100004084 | 266 |
| 557 | 3300005434 | Ga0070709_10076039 | Ga0070709_100760392 | 266 |
| 558 | 3300005436 | Ga0070713_100000333 | Ga0070713_1000003339 | 266 |
| 559 | 3300005437 | Ga0070710_10056604 | Ga0070710_100566043 | 266 |
| 560 | 3300005444 | Ga0070694_100073799 | Ga0070694_1000737992 | 266 |
| 561 | 3300005458 | Ga0070681_10000002 | Ga0070681_10000002760 | 266 |
| 562 | 3300005530 | Ga0070679_100000393 | Ga0070679_1000003939 | 266 |
| 563 | 3300005539 | Ga0068853_100022918 | Ga0068853_1000229184 | 266 |
| 564 | 3300005547 | Ga0070693_100012809 | Ga0070693_1000128094 | 266 |
| 565 | 3300005563 | Ga0068855_100038242 | Ga0068855_1000382424 | 266 |
| 566 | 3300005563 | Ga0068855_100166484 | Ga0068855_1001664842 | 266 |
| 567 | 3300005564 | Ga0070664_100202865 | Ga0070664_1002028652 | 266 |
| 568 | 3300005577 | Ga0068857_100005605 | Ga0068857_1000056054 | 266 |
| 569 | 3300005614 | Ga0068856_100000601 | Ga0068856_10000060130 | 266 |
| 570 | 3300005614 | Ga0068856_100001518 | Ga0068856_1000015184 | 266 |
| 571 | 3300005616 | Ga0068852_100039171 | Ga0068852_1000391714 | 266 |
| 572 | 3300005937 | Ga0081455_10010329 | Ga0081455_100103296 | 266 |
| 573 | 3300005937 | Ga0081455_10042902 | Ga0081455_100429022 | 266 |
| 574 | 3300006051 | Ga0075364_10072535 | Ga0075364_100725352 | 266 |
| 575 | 3300006051 | Ga0075364_10084753 | Ga0075364_100847532 | 266 |
| 576 | 3300006175 | Ga0070712_100000023 | Ga0070712_10000002373 | 266 |
| 577 | 3300006175 | Ga0070712_100000803 | Ga0070712_1000008033 | 266 |
| 578 | 3300006175 | Ga0070712_100331173 | Ga0070712_1003311732 | 266 |
| 579 | 3300006177 | Ga0075362_10015707 | Ga0075362_100157074 | 266 |
| 580 | 3300006237 | Ga0097621_100366229 | Ga0097621_1003662292 | 266 |
| 581 | 3300006871 | Ga0075434_100027557 | Ga0075434_1000275575 | 266 |
| 582 | 3300006914 | Ga0075436_100000211 | Ga0075436_10000021122 | 266 |
| 583 | 3300006914 | Ga0075436_100032050 | Ga0075436_1000320502 | 266 |
| 584 | 3300007076 | Ga0075435_100002305 | Ga0075435_10000230511 | 266 |
| 585 | 3300009093 | Ga0105240_10001838 | Ga0105240_1000183835 | 266 |
| 586 | 3300009093 | Ga0105240_10003992 | Ga0105240_100039924 | 266 |
| 587 | 3300009101 | Ga0105247_10000847 | Ga0105247_1000084717 | 266 |
| 588 | 3300009148 | Ga0105243_10000005 | Ga0105243_10000005180 | 266 |
| 589 | 3300009177 | Ga0105248_10013013 | Ga0105248_100130138 | 266 |
| 590 | 3300009545 | Ga0105237_10061634 | Ga0105237_100616342 | 266 |
| 591 | 3300009551 | Ga0105238_10001476 | Ga0105238_100014767 | 266 |
| 592 | 3300010375 | Ga0105239_10014084 | Ga0105239_100140845 | 266 |
| 593 | 3300010375 | Ga0105239_10039656 | Ga0105239_100396564 | 266 |
| 594 | 3300013100 | Ga0157373_10001642 | Ga0157373_1000164217 | 266 |
| 595 | 3300013104 | Ga0157370_10029212 | Ga0157370_100292124 | 266 |
| 596 | 3300013105 | Ga0157369_10053092 | Ga0157369_100530924 | 266 |
| 597 | 3300013296 | Ga0157374_10031464 | Ga0157374_100314643 | 266 |
| 598 | 3300013297 | Ga0157378_10294750 | Ga0157378_102947502 | 266 |
| 599 | 3300013307 | Ga0157372_10148586 | Ga0157372_101485863 | 266 |
| 600 | 3300014325 | Ga0163163_10194372 | Ga0163163_101943722 | 266 |
| 601 | 3300014326 | Ga0157380_10110040 | Ga0157380_101100402 | 266 |
| 602 | 3300014968 | Ga0157379_10007585 | Ga0157379_100075855 | 266 |
| 603 | 3300014968 | Ga0157379_10083161 | Ga0157379_100831613 | 266 |
| 604 | 3300021361 | Ga0213872_10001776 | Ga0213872_100017761 | 266 |
| 605 | 3300025711 | Ga0207696_1001081 | Ga0207696_100108113 | 266 |
| 606 | 3300025735 | Ga0207713_1001002 | Ga0207713_10010025 | 266 |
| 607 | 3300025900 | Ga0207710_10000172 | Ga0207710_1000017229 | 266 |
| 608 | 3300025903 | Ga0207680_10002281 | Ga0207680_100022817 | 266 |
| 609 | 3300025906 | Ga0207699_10000280 | Ga0207699_1000028027 | 266 |
| 610 | 3300025906 | Ga0207699_10015404 | Ga0207699_100154044 | 266 |
| 611 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002198 | 266 |
| 612 | 3300025913 | Ga0207695_10038185 | Ga0207695_100381854 | 266 |
| 613 | 3300025914 | Ga0207671_10040777 | Ga0207671_100407773 | 266 |
| 614 | 3300025915 | Ga0207693_10000018 | Ga0207693_10000018136 | 266 |
| 615 | 3300025915 | Ga0207693_10000534 | Ga0207693_100005343 | 266 |
| 616 | 3300025916 | Ga0207663_10075315 | Ga0207663_100753153 | 266 |
| 617 | 3300025917 | Ga0207660_10031267 | Ga0207660_100312672 | 266 |
| 618 | 3300025921 | Ga0207652_10000052 | Ga0207652_1000005247 | 266 |
| 619 | 3300025923 | Ga0207681_10188914 | Ga0207681_101889142 | 266 |
| 620 | 3300025928 | Ga0207700_10000026 | Ga0207700_1000002657 | 266 |
| 621 | 3300025928 | Ga0207700_10017868 | Ga0207700_100178685 | 266 |
| 622 | 3300025929 | Ga0207664_10161751 | Ga0207664_101617512 | 266 |
| 623 | 3300025935 | Ga0207709_10000001 | Ga0207709_100000011247 | 266 |
| 624 | 3300025941 | Ga0207711_10007529 | Ga0207711_100075298 | 266 |
| 625 | 3300025944 | Ga0207661_10322974 | Ga0207661_103229742 | 266 |
| 626 | 3300025945 | Ga0207679_10171660 | Ga0207679_101716601 | 266 |
| 627 | 3300025960 | Ga0207651_10001268 | Ga0207651_100012689 | 266 |
| 628 | 3300026041 | Ga0207639_10004318 | Ga0207639_100043188 | 266 |
| 629 | 3300026078 | Ga0207702_10000021 | Ga0207702_10000021190 | 266 |
| 630 | 3300026078 | Ga0207702_10001285 | Ga0207702_1000128517 | 266 |
| 631 | 3300026116 | Ga0207674_10000134 | Ga0207674_1000013428 | 266 |
| 632 | 3300026142 | Ga0207698_10307262 | Ga0207698_103072622 | 266 |
| 633 | 3300027312 | Ga0209371_1000006 | Ga0209371_1000006399 | 266 |
| 634 | 3300030500 | Ga0268256_1000007 | Ga0268256_1000007399 | 266 |
| 635 | 3300031247 | Ga0265340_10014685 | Ga0265340_100146852 | 266 |
| 636 | 3300031731 | Ga0307405_10065809 | Ga0307405_100658093 | 266 |
| 637 | 3300032005 | Ga0307411_10154099 | Ga0307411_101540992 | 266 |
| 638 | 3300035084 | Ga0373928_0019327 | Ga0373928_0019327_150_1064 | 266 |
| 639 | 3300035111 | Ga0373923_0162889 | Ga0373923_0162889_29_895 | 266 |
| 640 | 3300035172 | Ga0373955_0160721 | Ga0373955_0160721_155_1021 | 266 |
| 641 | 3300035398 | Ga0316574_0118771 | Ga0316574_0118771_334_1248 | 266 |
| 642 | 3300036401 | Ga0373937_0239939 | Ga0373937_0239939_225_1082 | 266 |
| 643 | 3300037471 | Ga0395905_0199967 | Ga0395905_0199967_566_1471 | 266 |
| 644 | 3300039437 | Ga0436365_1906591 | Ga0436365_1906591_44491_45369 | 266 |
| 645 | 3300039447 | Ga0436361_0103120 | Ga0436361_0103120_104282_105193 | 266 |
| 646 | 3300039450 | Ga0436363_1032809 | Ga0436363_1032809_10603_11481 | 266 |
| 647 | 3300039453 | Ga0436362_0865405 | Ga0436362_0865405_264_1142 | 266 |
| 648 | 3300046454 | Ga0495592_0313330 | Ga0495592_0313330_90_947 | 266 |
| 649 | 3300046517 | Ga0495630_0284291 | Ga0495630_0284291_11_868 | 266 |
| 650 | 3300046525 | Ga0495663_0024795 | Ga0495663_0024795_721_1635 | 266 |
| 651 | 3300046809 | Ga0495600_0037198 | Ga0495600_0037198_2270_3124 | 266 |
| 652 | 3300048910 | Ga0496107_0355488 | Ga0496107_0355488_117_983 | 266 |
| 653 | 3300048925 | Ga0496122_0000355 | Ga0496122_0000355_12498_13412 | 266 |
| 654 | 3300048926 | Ga0496123_0001332 | Ga0496123_0001332_21473_22387 | 266 |
| 655 | 3300049569 | Ga0501032_0038915 | Ga0501032_0038915_1572_2450 | 266 |
| 656 | 3300049571 | Ga0501034_0020559 | Ga0501034_0020559_3226_4104 | 266 |
| 657 | 3300049572 | Ga0501036_0020667 | Ga0501036_0020667_1735_2613 | 266 |
| 658 | 3300049581 | Ga0501047_0031025 | Ga0501047_0031025_3053_3931 | 266 |
| 659 | 3300049581 | Ga0501047_0095958 | Ga0501047_0095958_586_1455 | 266 |
| 660 | 3300049581 | Ga0501047_0229776 | Ga0501047_0229776_768_1652 | 266 |
| 661 | 3300049583 | Ga0501067_0039185 | Ga0501067_0039185_1408_2286 | 266 |
| 662 | 3300049585 | Ga0501069_0005097 | Ga0501069_0005097_2142_3020 | 266 |
| 663 | 3300049586 | Ga0501070_0017142 | Ga0501070_0017142_4350_5228 | 266 |
| 664 | 3300049589 | Ga0501073_0012747 | Ga0501073_0012747_3914_4819 | 266 |
| 665 | 3300049741 | Ga0501079_0022269 | Ga0501079_0022269_1464_2342 | 266 |
| 666 | 3300049742 | Ga0501080_0164166 | Ga0501080_0164166_1135_2040 | 266 |
| 667 | 3300049742 | Ga0501080_0266857 | Ga0501080_0266857_454_1332 | 266 |
| 668 | 3300049744 | Ga0501083_0013821 | Ga0501083_0013821_3582_4466 | 266 |
| 669 | 3300049822 | Ga0501035_0035293 | Ga0501035_0035293_1557_2435 | 266 |
| 670 | 3300050512 | nmdc:mga0n895_146730_c1 | nmdc:mga0n895_146730_c1_734_1600 | 266 |
| 671 | 3300050513 | nmdc:mga0rr50_87687_c1 | nmdc:mga0rr50_87687_c1_609_1475 | 266 |
| 672 | 3300050514 | nmdc:mga08x19_54_c1 | nmdc:mga08x19_54_c1_68739_69605 | 266 |
| 673 | 3300050514 | nmdc:mga08x19_89320_c1 | nmdc:mga08x19_89320_c1_699_1565 | 266 |
| 674 | 3300054114 | Ga0501084_0011075 | Ga0501084_0011075_1658_2542 | 266 |
| 675 | 3300054114 | Ga0501084_0393253 | Ga0501084_0393253_23_901 | 266 |
| 676 | 3300060353 | Ga0501082_0075828 | Ga0501082_0075828_1486_2391 | 266 |
| 677 | iso_pu_bacteria | 2821123053 | 2821129208 | 266 |
| 678 | iso_pu_bacteria | 2838736955 | 2838742225 | 266 |
| 679 | iso_pu_bacteria | 2841840854 | 2841846081 | 266 |
| 680 | iso_pu_bacteria | 2842140634 | 2842145785 | 266 |
| 681 | iso_pu_bacteria | 2857531043 | 2857536149 | 266 |
| 682 | iso_pu_bacteria | 2891088606 | 2891090219 | 266 |
| 683 | iso_pu_bacteria | 2996336353 | 2996341623 | 266 |
| 684 | 3300003320 | rootH2_10006857 | rootH2_100068574 | 267 |
| 685 | 3300003320 | rootH2_10118832 | rootH2_101188322 | 267 |
| 686 | 3300003856 | Ga0058692_1000004 | Ga0058692_1000004374 | 267 |
| 687 | 3300005262 | Ga0065165_1021928 | Ga0065165_10219281 | 267 |
| 688 | 3300005336 | Ga0070680_100069759 | Ga0070680_1000697593 | 267 |
| 689 | 3300005339 | Ga0070660_100002726 | Ga0070660_1000027264 | 267 |
| 690 | 3300005347 | Ga0070668_100002646 | Ga0070668_1000026467 | 267 |
| 691 | 3300005435 | Ga0070714_100120992 | Ga0070714_1001209923 | 267 |
| 692 | 3300005455 | Ga0070663_100033858 | Ga0070663_1000338584 | 267 |
| 693 | 3300005455 | Ga0070663_100090888 | Ga0070663_1000908882 | 267 |
| 694 | 3300005548 | Ga0070665_100017715 | Ga0070665_1000177155 | 267 |
| 695 | 3300005563 | Ga0068855_100184752 | Ga0068855_1001847522 | 267 |
| 696 | 3300005578 | Ga0068854_100075177 | Ga0068854_1000751773 | 267 |
| 697 | 3300005985 | Ga0081539_10010563 | Ga0081539_100105636 | 267 |
| 698 | 3300009098 | Ga0105245_10277584 | Ga0105245_102775842 | 267 |
| 699 | 3300011119 | Ga0105246_10037172 | Ga0105246_100371725 | 267 |
| 700 | 3300013102 | Ga0157371_10100944 | Ga0157371_101009442 | 267 |
| 701 | 3300013105 | Ga0157369_10752978 | Ga0157369_107529782 | 267 |
| 702 | 3300013296 | Ga0157374_10000837 | Ga0157374_1000083710 | 267 |
| 703 | 3300013297 | Ga0157378_10001948 | Ga0157378_100019487 | 267 |
| 704 | 3300013306 | Ga0163162_10006665 | Ga0163162_100066657 | 267 |
| 705 | 3300013307 | Ga0157372_10033499 | Ga0157372_100334995 | 267 |
| 706 | 3300013307 | Ga0157372_10222403 | Ga0157372_102224032 | 267 |
| 707 | 3300013308 | Ga0157375_10002627 | Ga0157375_100026274 | 267 |
| 708 | 3300014326 | Ga0157380_10134417 | Ga0157380_101344173 | 267 |
| 709 | 3300014969 | Ga0157376_10130631 | Ga0157376_101306313 | 267 |
| 710 | 3300025292 | Ga0209676_1000143 | Ga0209676_1000143158 | 267 |
| 711 | 3300025909 | Ga0207705_10000105 | Ga0207705_1000010542 | 267 |
| 712 | 3300025917 | Ga0207660_10004700 | Ga0207660_1000470010 | 267 |
| 713 | 3300025919 | Ga0207657_10001006 | Ga0207657_1000100634 | 267 |
| 714 | 3300025921 | Ga0207652_10002051 | Ga0207652_100020512 | 267 |
| 715 | 3300025929 | Ga0207664_10089324 | Ga0207664_100893243 | 267 |
| 716 | 3300025935 | Ga0207709_10000972 | Ga0207709_100009725 | 267 |
| 717 | 3300025935 | Ga0207709_10022388 | Ga0207709_100223883 | 267 |
| 718 | 3300025937 | Ga0207669_10230213 | Ga0207669_102302132 | 267 |
| 719 | 3300025949 | Ga0207667_10193438 | Ga0207667_101934382 | 267 |
| 720 | 3300025972 | Ga0207668_10001556 | Ga0207668_100015567 | 267 |
| 721 | 3300025981 | Ga0207640_10103427 | Ga0207640_101034271 | 267 |
| 722 | 3300026067 | Ga0207678_10036063 | Ga0207678_100360634 | 267 |
| 723 | 3300026067 | Ga0207678_10052534 | Ga0207678_100525344 | 267 |
| 724 | 3300027312 | Ga0209371_1000018 | Ga0209371_100001829 | 267 |
| 725 | 3300028379 | Ga0268266_10058419 | Ga0268266_100584193 | 267 |
| 726 | 3300028800 | Ga0265338_10018343 | Ga0265338_100183434 | 267 |
| 727 | 3300030500 | Ga0268256_1000016 | Ga0268256_100001629 | 267 |
| 728 | 3300031240 | Ga0265320_10000034 | Ga0265320_10000034142 | 267 |
| 729 | 3300031241 | Ga0265325_10041712 | Ga0265325_100417123 | 267 |
| 730 | 3300031249 | Ga0265339_10011306 | Ga0265339_100113062 | 267 |
| 731 | 3300031249 | Ga0265339_10018281 | Ga0265339_100182812 | 267 |
| 732 | 3300031250 | Ga0265331_10015615 | Ga0265331_100156154 | 267 |
| 733 | 3300031711 | Ga0265314_10008099 | Ga0265314_100080994 | 267 |
| 734 | 3300031711 | Ga0265314_10012421 | Ga0265314_100124215 | 267 |
| 735 | 3300031711 | Ga0265314_10031762 | Ga0265314_100317622 | 267 |
| 736 | 3300031824 | Ga0307413_10036922 | Ga0307413_100369223 | 267 |
| 737 | 3300032126 | Ga0307415_100011926 | Ga0307415_1000119264 | 267 |
| 738 | 3300035113 | Ga0373936_0010479 | Ga0373936_0010479_1819_2679 | 267 |
| 739 | 3300035170 | Ga0373943_0000193 | Ga0373943_0000193_7733_8593 | 267 |
| 740 | 3300035171 | Ga0373946_0003060 | Ga0373946_0003060_1843_2703 | 267 |
| 741 | 3300035692 | Ga0373935_0011008 | Ga0373935_0011008_687_1547 | 267 |
| 742 | 3300035695 | Ga0373927_0003709 | Ga0373927_0003709_1843_2703 | 267 |
| 743 | 3300035725 | Ga0373947_0000076 | Ga0373947_0000076_29366_30226 | 267 |
| 744 | 3300037068 | Ga0373925_0005607 | Ga0373925_0005607_2233_3093 | 267 |
| 745 | 3300037418 | Ga0395900_0042203 | Ga0395900_0042203_3568_4449 | 267 |
| 746 | 3300037471 | Ga0395905_0109855 | Ga0395905_0109855_1180_2061 | 267 |
| 747 | 3300038443 | Ga0395901_0464238 | Ga0395901_0464238_262_1143 | 267 |
| 748 | 3300039062 | Ga0400483_015557 | Ga0400483_015557_382_1293 | 267 |
| 749 | 3300039062 | Ga0400483_244091 | Ga0400483_244091_280_1191 | 267 |
| 750 | 3300044694 | Ga0466963_0024247 | Ga0466963_0024247_2657_3505 | 267 |
| 751 | 3300044712 | Ga0453684_0004122 | Ga0453684_0004122_1308_2279 | 267 |
| 752 | 3300045051 | Ga0451576_0000153 | Ga0451576_0000153_102865_103836 | 267 |
| 753 | 3300045051 | Ga0451576_0067762 | Ga0451576_0067762_1869_2819 | 267 |
| 754 | 3300045976 | Ga0466967_0240015 | Ga0466967_0240015_868_1716 | 267 |
| 755 | 3300046499 | Ga0495594_0168784 | Ga0495594_0168784_106_987 | 267 |
| 756 | 3300046526 | Ga0495666_0008457 | Ga0495666_0008457_1469_2329 | 267 |
| 757 | 3300046616 | Ga0495668_0009231 | Ga0495668_0009231_3151_4017 | 267 |
| 758 | 3300046660 | Ga0495625_0166393 | Ga0495625_0166393_28_894 | 267 |
| 759 | 3300046681 | Ga0495647_0027602 | Ga0495647_0027602_1105_1965 | 267 |
| 760 | 3300046690 | Ga0495624_0026171 | Ga0495624_0026171_2769_3629 | 267 |
| 761 | 3300047471 | Ga0495684_0043330 | Ga0495684_0043330_1831_2691 | 267 |
| 762 | 3300047472 | Ga0495686_0011750 | Ga0495686_0011750_1287_2153 | 267 |
| 763 | 3300048904 | Ga0496101_0025843 | Ga0496101_0025843_2087_2956 | 267 |
| 764 | 3300048907 | Ga0496104_0108307 | Ga0496104_0108307_1722_2591 | 267 |
| 765 | 3300048911 | Ga0496108_0008681 | Ga0496108_0008681_3618_4487 | 267 |
| 766 | 3300048912 | Ga0496109_0034975 | Ga0496109_0034975_1950_2819 | 267 |
| 767 | 3300048913 | Ga0496110_0000751 | Ga0496110_0000751_9426_10295 | 267 |
| 768 | 3300048914 | Ga0496111_0094540 | Ga0496111_0094540_417_1286 | 267 |
| 769 | 3300048917 | Ga0496114_0129275 | Ga0496114_0129275_497_1366 | 267 |
| 770 | 3300049569 | Ga0501032_0076687 | Ga0501032_0076687_945_1835 | 267 |
| 771 | 3300049573 | Ga0501037_0040316 | Ga0501037_0040316_98_988 | 267 |
| 772 | 3300049574 | Ga0501038_0048130 | Ga0501038_0048130_1111_2001 | 267 |
| 773 | 3300049581 | Ga0501047_0088599 | Ga0501047_0088599_470_1366 | 267 |
| 774 | 3300049585 | Ga0501069_0091881 | Ga0501069_0091881_390_1280 | 267 |
| 775 | 3300049586 | Ga0501070_0000014 | Ga0501070_0000014_164722_165612 | 267 |
| 776 | 3300049591 | Ga0501075_0205994 | Ga0501075_0205994_116_1027 | 267 |
| 777 | 3300049592 | Ga0501076_0104362 | Ga0501076_0104362_1279_2190 | 267 |
| 778 | 3300049593 | Ga0501077_0024462 | Ga0501077_0024462_1728_2663 | 267 |
| 779 | 3300049742 | Ga0501080_0002117 | Ga0501080_0002117_14495_15385 | 267 |
| 780 | 3300049822 | Ga0501035_0002615 | Ga0501035_0002615_6790_7680 | 267 |
| 781 | 3300049823 | Ga0501044_0002945 | Ga0501044_0002945_8255_9151 | 267 |
| 782 | 3300049823 | Ga0501044_0003065 | Ga0501044_0003065_1972_2862 | 267 |
| 783 | 3300049823 | Ga0501044_0184563 | Ga0501044_0184563_1096_1986 | 267 |
| 784 | 3300049823 | Ga0501044_0410061 | Ga0501044_0410061_39_935 | 267 |
| 785 | 3300053093 | Ga0500651_0007702 | Ga0500651_0007702_454_1320 | 267 |
| 786 | 3300053098 | Ga0500650_0000116 | Ga0500650_0000116_14513_15442 | 267 |
| 787 | 3300053119 | Ga0500595_004828 | Ga0500595_004828_2295_3176 | 267 |
| 788 | 3300053730 | Ga0500645_000539 | Ga0500645_000539_11167_12033 | 267 |
| 789 | 3300054114 | Ga0501084_0266968 | Ga0501084_0266968_104_1015 | 267 |
| 790 | iso_pu_bacteria | 2547132130 | 2547502644 | 267 |
| 791 | iso_pu_bacteria | 2643221551 | 2643777314 | 267 |
| 792 | iso_pu_bacteria | 2643221555 | 2643795762 | 267 |
| 793 | iso_pu_bacteria | 2747842428 | 2747949812 | 267 |
| 794 | iso_pu_bacteria | 2765235840 | 2765581114 | 267 |
| 795 | iso_pu_bacteria | 2816332141 | 2816517904 | 267 |
| 796 | iso_pu_bacteria | 2842391507 | 2842394134 | 267 |
| 797 | iso_pu_bacteria | 2874220319 | 2874223756 | 267 |
| 798 | iso_pu_bacteria | 2919089067 | 2919089307 | 267 |
| 799 | iso_pu_bacteria | 2919134579 | 2919136453 | 267 |
| 800 | iso_pu_bacteria | 2919513703 | 2919516064 | 267 |
| 801 | iso_pu_bacteria | 2919675420 | 2919677880 | 267 |
| 802 | iso_pu_bacteria | 2928496128 | 2928499312 | 267 |
| 803 | iso_pu_bacteria | 2931380184 | 2931382844 | 267 |
| 804 | iso_pu_bacteria | 2937610967 | 2937613770 | 267 |
| 805 | iso_pu_bacteria | 2939626828 | 2939628482 | 267 |
| 806 | iso_pu_bacteria | 2961047084 | 2961050520 | 267 |
| 807 | iso_pu_bacteria | 2961064222 | 2961064329 | 267 |
| 808 | 3300003187 | JGI25151J46595_10000088 | JGI25151J46595_1000008840 | 268 |
| 809 | 3300003773 | Ga0055537_1000989 | Ga0055537_100098910 | 268 |
| 810 | 3300003775 | Ga0055524_1019185 | Ga0055524_10191852 | 268 |
| 811 | 3300003784 | Ga0055534_1000307 | Ga0055534_100030715 | 268 |
| 812 | 3300003790 | Ga0055528_1000402 | Ga0055528_100040216 | 268 |
| 813 | 3300005331 | Ga0070670_100045694 | Ga0070670_1000456941 | 268 |
| 814 | 3300005406 | Ga0070703_10023665 | Ga0070703_100236652 | 268 |
| 815 | 3300005435 | Ga0070714_100152309 | Ga0070714_1001523092 | 268 |
| 816 | 3300005436 | Ga0070713_100065121 | Ga0070713_1000651211 | 268 |
| 817 | 3300005445 | Ga0070708_100102582 | Ga0070708_1001025822 | 268 |
| 818 | 3300005445 | Ga0070708_100320058 | Ga0070708_1003200582 | 268 |
| 819 | 3300005468 | Ga0070707_100162041 | Ga0070707_1001620412 | 268 |
| 820 | 3300005518 | Ga0070699_100325758 | Ga0070699_1003257581 | 268 |
| 821 | 3300005530 | Ga0070679_100427856 | Ga0070679_1004278562 | 268 |
| 822 | 3300005536 | Ga0070697_100453361 | Ga0070697_1004533611 | 268 |
| 823 | 3300005617 | Ga0068859_100084896 | Ga0068859_1000848963 | 268 |
| 824 | 3300005937 | Ga0081455_10001354 | Ga0081455_100013542 | 268 |
| 825 | 3300006042 | Ga0075368_10045377 | Ga0075368_100453772 | 268 |
| 826 | 3300006178 | Ga0075367_10051789 | Ga0075367_100517893 | 268 |
| 827 | 3300006871 | Ga0075434_100090753 | Ga0075434_1000907533 | 268 |
| 828 | 3300006931 | Ga0097620_100084894 | Ga0097620_1000848943 | 268 |
| 829 | 3300007076 | Ga0075435_100077595 | Ga0075435_1000775953 | 268 |
| 830 | 3300007265 | Ga0099794_10080232 | Ga0099794_100802321 | 268 |
| 831 | 3300009011 | Ga0105251_10019337 | Ga0105251_100193372 | 268 |
| 832 | 3300009036 | Ga0105244_10026182 | Ga0105244_100261822 | 268 |
| 833 | 3300009093 | Ga0105240_10000088 | Ga0105240_100000883 | 268 |
| 834 | 3300013100 | Ga0157373_10097566 | Ga0157373_100975662 | 268 |
| 835 | 3300013102 | Ga0157371_10002370 | Ga0157371_1000237017 | 268 |
| 836 | 3300013104 | Ga0157370_10005233 | Ga0157370_1000523310 | 268 |
| 837 | 3300014497 | Ga0182008_10000913 | Ga0182008_100009139 | 268 |
| 838 | 3300014497 | Ga0182008_10006499 | Ga0182008_100064997 | 268 |
| 839 | 3300015261 | Ga0182006_1050911 | Ga0182006_10509112 | 268 |
| 840 | 3300015261 | Ga0182006_1052715 | Ga0182006_10527152 | 268 |
| 841 | 3300015262 | Ga0182007_10000019 | Ga0182007_100000198 | 268 |
| 842 | 3300015265 | Ga0182005_1000088 | Ga0182005_100008863 | 268 |
| 843 | 3300017792 | Ga0163161_10001958 | Ga0163161_1000195814 | 268 |
| 844 | 3300017792 | Ga0163161_10020114 | Ga0163161_100201144 | 268 |
| 845 | 3300021361 | Ga0213872_10072378 | Ga0213872_100723782 | 268 |
| 846 | 3300025263 | Ga0209565_1000113 | Ga0209565_100011357 | 268 |
| 847 | 3300025273 | Ga0209673_1000369 | Ga0209673_100036931 | 268 |
| 848 | 3300025284 | Ga0209130_1017793 | Ga0209130_10177932 | 268 |
| 849 | 3300025291 | Ga0209675_1000007 | Ga0209675_100000745 | 268 |
| 850 | 3300025292 | Ga0209676_1000018 | Ga0209676_1000018500 | 268 |
| 851 | 3300025292 | Ga0209676_1001361 | Ga0209676_10013619 | 268 |
| 852 | 3300025292 | Ga0209676_1001572 | Ga0209676_10015728 | 268 |
| 853 | 3300025295 | Ga0209564_1000333 | Ga0209564_100033344 | 268 |
| 854 | 3300025298 | Ga0209050_1000396 | Ga0209050_100039640 | 268 |
| 855 | 3300025298 | Ga0209050_1001430 | Ga0209050_100143011 | 268 |
| 856 | 3300025299 | Ga0209256_1005969 | Ga0209256_10059696 | 268 |
| 857 | 3300025299 | Ga0209256_1008759 | Ga0209256_10087596 | 268 |
| 858 | 3300025303 | Ga0209051_1000449 | Ga0209051_100044916 | 268 |
| 859 | 3300025304 | Ga0209257_1000035 | Ga0209257_1000035500 | 268 |
| 860 | 3300025304 | Ga0209257_1006408 | Ga0209257_10064081 | 268 |
| 861 | 3300025735 | Ga0207713_1029091 | Ga0207713_10290912 | 268 |
| 862 | 3300025885 | Ga0207653_10026429 | Ga0207653_100264291 | 268 |
| 863 | 3300025913 | Ga0207695_10000755 | Ga0207695_1000075557 | 268 |
| 864 | 3300025921 | Ga0207652_10427298 | Ga0207652_104272981 | 268 |
| 865 | 3300025923 | Ga0207681_10109026 | Ga0207681_101090262 | 268 |
| 866 | 3300025925 | Ga0207650_10015567 | Ga0207650_100155674 | 268 |
| 867 | 3300025939 | Ga0207665_10066869 | Ga0207665_100668694 | 268 |
| 868 | 3300027543 | Ga0209999_1001015 | Ga0209999_10010152 | 268 |
| 869 | 3300027614 | Ga0209970_1004231 | Ga0209970_10042313 | 268 |
| 870 | 3300027665 | Ga0209983_1000709 | Ga0209983_10007098 | 268 |
| 871 | 3300027682 | Ga0209971_1001818 | Ga0209971_10018183 | 268 |
| 872 | 3300030732 | Ga0316176_1026458 | Ga0316176_10264585 | 268 |
| 873 | 3300030742 | Ga0316183_1047328 | Ga0316183_10473282 | 268 |
| 874 | 3300031731 | Ga0307405_10070715 | Ga0307405_100707152 | 268 |
| 875 | 3300031903 | Ga0307407_10121446 | Ga0307407_101214461 | 268 |
| 876 | 3300031911 | Ga0307412_10050872 | Ga0307412_100508722 | 268 |
| 877 | 3300032004 | Ga0307414_10131878 | Ga0307414_101318782 | 268 |
| 878 | 3300032004 | Ga0307414_10333679 | Ga0307414_103336792 | 268 |
| 879 | 3300032005 | Ga0307411_10036861 | Ga0307411_100368614 | 268 |
| 880 | 3300035170 | Ga0373943_0253135 | Ga0373943_0253135_17_883 | 268 |
| 881 | 3300038996 | Ga0242420_018134 | Ga0242420_018134_152_1027 | 268 |
| 882 | 3300039447 | Ga0436361_0810226 | Ga0436361_0810226_920_1792 | 268 |
| 883 | 3300042006 | Ga0439432_008299 | Ga0439432_008299_2415_3338 | 268 |
| 884 | 3300046460 | Ga0495638_0066815 | Ga0495638_0066815_957_1880 | 268 |
| 885 | 3300046512 | Ga0495610_0013350 | Ga0495610_0013350_2258_3181 | 268 |
| 886 | 3300046522 | Ga0495643_0001375 | Ga0495643_0001375_7857_8780 | 268 |
| 887 | 3300046525 | Ga0495663_0022197 | Ga0495663_0022197_588_1511 | 268 |
| 888 | 3300047320 | Ga0495672_0001550 | Ga0495672_0001550_13651_14574 | 268 |
| 889 | 3300047472 | Ga0495686_0006050 | Ga0495686_0006050_1836_2759 | 268 |
| 890 | 3300048911 | Ga0496108_0181635 | Ga0496108_0181635_496_1365 | 268 |
| 891 | 3300048913 | Ga0496110_0100090 | Ga0496110_0100090_131_1006 | 268 |
| 892 | 3300048913 | Ga0496110_0186041 | Ga0496110_0186041_344_1213 | 268 |
| 893 | 3300048915 | Ga0496112_0008091 | Ga0496112_0008091_6518_7387 | 268 |
| 894 | 3300048920 | Ga0496117_0002847 | Ga0496117_0002847_13752_14675 | 268 |
| 895 | 3300048920 | Ga0496117_0003923 | Ga0496117_0003923_15600_16523 | 268 |
| 896 | 3300048920 | Ga0496117_0043010 | Ga0496117_0043010_1965_2888 | 268 |
| 897 | 3300048921 | Ga0496118_0003155 | Ga0496118_0003155_6374_7297 | 268 |
| 898 | 3300048921 | Ga0496118_0004179 | Ga0496118_0004179_15600_16523 | 268 |
| 899 | 3300048921 | Ga0496118_0070407 | Ga0496118_0070407_334_1257 | 268 |
| 900 | 3300048922 | Ga0496119_0000787 | Ga0496119_0000787_37991_38914 | 268 |
| 901 | 3300048923 | Ga0496120_0000776 | Ga0496120_0000776_7054_7977 | 268 |
| 902 | 3300048924 | Ga0496121_0009225 | Ga0496121_0009225_4684_5607 | 268 |
| 903 | 3300048924 | Ga0496121_0266545 | Ga0496121_0266545_46_969 | 268 |
| 904 | 3300048925 | Ga0496122_0054111 | Ga0496122_0054111_849_1772 | 268 |
| 905 | 3300048926 | Ga0496123_0016366 | Ga0496123_0016366_3455_4378 | 268 |
| 906 | 3300048927 | Ga0496124_0003077 | Ga0496124_0003077_5951_6874 | 268 |
| 907 | 3300048927 | Ga0496124_0031164 | Ga0496124_0031164_3525_4448 | 268 |
| 908 | 3300048927 | Ga0496124_0035735 | Ga0496124_0035735_1024_1947 | 268 |
| 909 | 3300048928 | Ga0496125_0000486 | Ga0496125_0000486_68384_69307 | 268 |
| 910 | 3300048928 | Ga0496125_0013801 | Ga0496125_0013801_1208_2131 | 268 |
| 911 | 3300048928 | Ga0496125_0030723 | Ga0496125_0030723_3625_4548 | 268 |
| 912 | 3300048929 | Ga0496126_0000463 | Ga0496126_0000463_34484_35356 | 268 |
| 913 | 3300048929 | Ga0496126_0002494 | Ga0496126_0002494_16778_17701 | 268 |
| 914 | 3300049568 | Ga0501031_0229664 | Ga0501031_0229664_66_989 | 268 |
| 915 | 3300049570 | Ga0501033_0000847 | Ga0501033_0000847_7647_8570 | 268 |
| 916 | 3300049575 | Ga0501039_0082758 | Ga0501039_0082758_1040_1909 | 268 |
| 917 | 3300049581 | Ga0501047_0001549 | Ga0501047_0001549_13555_14442 | 268 |
| 918 | 3300049583 | Ga0501067_0006256 | Ga0501067_0006256_548_1435 | 268 |
| 919 | 3300049587 | Ga0501071_0147329 | Ga0501071_0147329_20_889 | 268 |
| 920 | 3300049588 | Ga0501072_0007477 | Ga0501072_0007477_1875_2762 | 268 |
| 921 | 3300049589 | Ga0501073_0084159 | Ga0501073_0084159_1284_2171 | 268 |
| 922 | 3300049741 | Ga0501079_0115133 | Ga0501079_0115133_920_1789 | 268 |
| 923 | 3300049741 | Ga0501079_0203617 | Ga0501079_0203617_526_1413 | 268 |
| 924 | 3300049743 | Ga0501081_0270494 | Ga0501081_0270494_243_1112 | 268 |
| 925 | 3300050510 | nmdc:mga06r32_639927_c1 | nmdc:mga06r32_639927_c1_144_1013 | 268 |
| 926 | 3300050513 | nmdc:mga0rr50_78248_c1 | nmdc:mga0rr50_78248_c1_294_1166 | 268 |
| 927 | 3300053104 | Ga0500556_0000092 | Ga0500556_0000092_1765_2640 | 268 |
| 928 | 3300054114 | Ga0501084_0046313 | Ga0501084_0046313_1309_2196 | 268 |
| 929 | 3300060353 | Ga0501082_0240774 | Ga0501082_0240774_162_1031 | 268 |
| 930 | 3300061734 | Ga0530510_0101822 | Ga0530510_0101822_672_1541 | 268 |
| 931 | 3300061734 | Ga0530510_0112660 | Ga0530510_0112660_606_1475 | 268 |
| 932 | 3300061734 | Ga0530510_0172039 | Ga0530510_0172039_440_1309 | 268 |
| 933 | iso_pu_bacteria | 2508501050 | 2508734607 | 268 |
| 934 | iso_pu_bacteria | 2576861471 | 2578456403 | 268 |
| 935 | iso_pu_bacteria | 2600254933 | 2600377441 | 268 |
| 936 | iso_pu_bacteria | 2643221653 | 2644299689 | 268 |
| 937 | iso_pu_bacteria | 2643221719 | 2644657917 | 268 |
| 938 | iso_pu_bacteria | 2775506901 | 2776257482 | 268 |
| 939 | iso_pu_bacteria | 2818991272 | 2819244465 | 268 |
| 940 | iso_pu_bacteria | 2818991461 | 2819688362 | 268 |
| 941 | iso_pu_bacteria | 2835312727 | 2835318255 | 268 |
| 942 | iso_pu_bacteria | 2852649853 | 2852651652 | 268 |
| 943 | iso_pu_bacteria | 2857442823 | 2857444611 | 268 |
| 944 | iso_pu_bacteria | 2884298095 | 2884298379 | 268 |
| 945 | iso_pu_bacteria | 2891373044 | 2891377792 | 268 |
| 946 | iso_pu_bacteria | 2894232714 | 2894235778 | 268 |
| 947 | iso_pu_bacteria | 2939589442 | 2939590354 | 268 |
| 948 | iso_pu_bacteria | 2939622612 | 2939626559 | 268 |
| 949 | iso_pu_bacteria | 2941475908 | 2941479566 | 268 |
| 950 | iso_pu_bacteria | 2974307012 | 2974307066 | 268 |
| 951 | iso_pu_bacteria | 2977247770 | 2977247810 | 268 |
| 952 | iso_pu_bacteria | 2989349275 | 2989355073 | 268 |
| 953 | iso_pu_bacteria | 2989771324 | 2989771758 | 268 |
| 954 | iso_pu_bacteria | 2989776772 | 2989780250 | 268 |
| 955 | iso_pu_bacteria | 3003930520 | 3003931141 | 268 |
| 956 | 3300005333 | Ga0070677_10057510 | Ga0070677_100575102 | 269 |
| 957 | 3300005339 | Ga0070660_100173126 | Ga0070660_1001731262 | 269 |
| 958 | 3300005347 | Ga0070668_100007344 | Ga0070668_1000073448 | 269 |
| 959 | 3300005355 | Ga0070671_100241098 | Ga0070671_1002410982 | 269 |
| 960 | 3300005436 | Ga0070713_100439166 | Ga0070713_1004391662 | 269 |
| 961 | 3300005530 | Ga0070679_100053554 | Ga0070679_1000535543 | 269 |
| 962 | 3300005841 | Ga0068863_100440106 | Ga0068863_1004401062 | 269 |
| 963 | 3300005844 | Ga0068862_100024894 | Ga0068862_1000248942 | 269 |
| 964 | 3300006353 | Ga0075370_10257587 | Ga0075370_102575871 | 269 |
| 965 | 3300009174 | Ga0105241_10390882 | Ga0105241_103908822 | 269 |
| 966 | 3300009176 | Ga0105242_10327317 | Ga0105242_103273172 | 269 |
| 967 | 3300014325 | Ga0163163_10725940 | Ga0163163_107259401 | 269 |
| 968 | 3300021388 | Ga0213875_10073128 | Ga0213875_100731282 | 269 |
| 969 | 3300025915 | Ga0207693_10274008 | Ga0207693_102740081 | 269 |
| 970 | 3300025919 | Ga0207657_10038796 | Ga0207657_100387965 | 269 |
| 971 | 3300025920 | Ga0207649_10240271 | Ga0207649_102402711 | 269 |
| 972 | 3300025921 | Ga0207652_10098147 | Ga0207652_100981473 | 269 |
| 973 | 3300025972 | Ga0207668_10194991 | Ga0207668_101949912 | 269 |
| 974 | 3300026023 | Ga0207677_10017151 | Ga0207677_100171512 | 269 |
| 975 | 3300026078 | Ga0207702_10224280 | Ga0207702_102242802 | 269 |
| 976 | 3300031239 | Ga0265328_10000417 | Ga0265328_100004175 | 269 |
| 977 | 3300031711 | Ga0265314_10032914 | Ga0265314_100329144 | 269 |
| 978 | 3300031901 | Ga0307406_10248352 | Ga0307406_102483522 | 269 |
| 979 | 3300035088 | Ga0373940_0011289 | Ga0373940_0011289_194_1087 | 269 |
| 980 | 3300044683 | Ga0466965_0225824 | Ga0466965_0225824_30_896 | 269 |
| 981 | 3300046473 | Ga0495582_0139231 | Ga0495582_0139231_356_1216 | 269 |
| 982 | 3300046690 | Ga0495624_0225483 | Ga0495624_0225483_215_1075 | 269 |
| 983 | 3300049580 | Ga0501046_0147781 | Ga0501046_0147781_308_1204 | 269 |
| 984 | 3300049581 | Ga0501047_0191635 | Ga0501047_0191635_570_1466 | 269 |
| 985 | 3300049586 | Ga0501070_0004919 | Ga0501070_0004919_4759_5655 | 269 |
| 986 | 3300049742 | Ga0501080_0058128 | Ga0501080_0058128_105_1001 | 269 |
| 987 | 3300049823 | Ga0501044_0013291 | Ga0501044_0013291_6920_7816 | 269 |
| 988 | 3300050496 | nmdc:mga07m45_143022_c1 | nmdc:mga07m45_143022_c1_350_1237 | 269 |
| 989 | 3300053077 | Ga0495601_0021116 | Ga0495601_0021116_658_1518 | 269 |
| 990 | 3300053078 | Ga0495612_0017182 | Ga0495612_0017182_43_903 | 269 |
| 991 | iso_pu_bacteria | 2508501114 | 2509075020 | 269 |
| 992 | iso_pu_bacteria | 2508501127 | 2509143088 | 269 |
| 993 | iso_pu_bacteria | 2597489875 | 2597810841 | 269 |
| 994 | iso_pu_bacteria | 2841734538 | 2841736579 | 269 |
| 995 | iso_pu_bacteria | 2842757796 | 2842761236 | 269 |
| 996 | iso_pu_bacteria | 2856342000 | 2856348128 | 269 |
| 997 | iso_pu_bacteria | 2871474448 | 2871478565 | 269 |
| 998 | iso_pu_bacteria | 2888343758 | 2888344553 | 269 |
| 999 | iso_pu_bacteria | 2924754689 | 2924762014 | 269 |
| 1000 | iso_pu_bacteria | 2937836603 | 2937838838 | 269 |
| 1001 | iso_pu_bacteria | 2958071322 | 2958072357 | 269 |
| 1002 | iso_pu_bacteria | 2970524798 | 2970526274 | 269 |
| 1003 | iso_pu_bacteria | 2970540015 | 2970541098 | 269 |
| 1004 | iso_pu_bacteria | 8004395343 | 8004399918 | 269 |
| 1005 | iso_pu_bacteria | 8004633249 | 8004639890 | 269 |
| 1006 | iso_pu_bacteria | 8055617313 | 8055618131 | 269 |
| 1007 | 3300005364 | Ga0070673_100583722 | Ga0070673_1005837222 | 270 |
| 1008 | 3300005548 | Ga0070665_100065392 | Ga0070665_1000653924 | 270 |
| 1009 | 3300006175 | Ga0070712_100077902 | Ga0070712_1000779022 | 270 |
| 1010 | 3300006186 | Ga0075369_10074557 | Ga0075369_100745572 | 270 |
| 1011 | 3300006847 | Ga0075431_100410176 | Ga0075431_1004101761 | 270 |
| 1012 | 3300006946 | Ga0079104_1000310 | Ga0079104_100031032 | 270 |
| 1013 | 3300009177 | Ga0105248_10000184 | Ga0105248_1000018416 | 270 |
| 1014 | 3300009553 | Ga0105249_10042496 | Ga0105249_100424962 | 270 |
| 1015 | 3300013306 | Ga0163162_10032994 | Ga0163162_100329942 | 270 |
| 1016 | 3300013306 | Ga0163162_10244031 | Ga0163162_102440312 | 270 |
| 1017 | 3300014325 | Ga0163163_10000131 | Ga0163163_100001318 | 270 |
| 1018 | 3300014968 | Ga0157379_10004164 | Ga0157379_100041642 | 270 |
| 1019 | 3300014968 | Ga0157379_10162845 | Ga0157379_101628452 | 270 |
| 1020 | 3300025945 | Ga0207679_10318859 | Ga0207679_103188591 | 270 |
| 1021 | 3300026075 | Ga0207708_10258755 | Ga0207708_102587552 | 270 |
| 1022 | 3300026095 | Ga0207676_10143733 | Ga0207676_101437333 | 270 |
| 1023 | 3300027111 | Ga0209281_1000028 | Ga0209281_1000028251 | 270 |
| 1024 | 3300031239 | Ga0265328_10000023 | Ga0265328_1000002379 | 270 |
| 1025 | 3300031239 | Ga0265328_10002712 | Ga0265328_100027123 | 270 |
| 1026 | 3300031250 | Ga0265331_10000058 | Ga0265331_1000005855 | 270 |
| 1027 | 3300031250 | Ga0265331_10001452 | Ga0265331_1000145210 | 270 |
| 1028 | 3300031251 | Ga0265327_10027713 | Ga0265327_100277134 | 270 |
| 1029 | 3300031251 | Ga0265327_10131454 | Ga0265327_101314541 | 270 |
| 1030 | 3300031344 | Ga0265316_10000880 | Ga0265316_1000088013 | 270 |
| 1031 | 3300035692 | Ga0373935_0016783 | Ga0373935_0016783_2721_3593 | 270 |
| 1032 | 3300037068 | Ga0373925_0021045 | Ga0373925_0021045_3412_4284 | 270 |
| 1033 | 3300038443 | Ga0395901_0118952 | Ga0395901_0118952_490_1335 | 270 |
| 1034 | 3300044658 | Ga0466972_0153146 | Ga0466972_0153146_16_897 | 270 |
| 1035 | 3300046459 | Ga0495629_0129774 | Ga0495629_0129774_245_1117 | 270 |
| 1036 | 3300046460 | Ga0495638_0023663 | Ga0495638_0023663_711_1586 | 270 |
| 1037 | 3300046476 | Ga0495662_0128760 | Ga0495662_0128760_93_965 | 270 |
| 1038 | 3300046512 | Ga0495610_0105931 | Ga0495610_0105931_166_1044 | 270 |
| 1039 | 3300046533 | Ga0495640_0006577 | Ga0495640_0006577_7333_8205 | 270 |
| 1040 | 3300046660 | Ga0495625_0083478 | Ga0495625_0083478_26_871 | 270 |
| 1041 | 3300048917 | Ga0496114_0315008 | Ga0496114_0315008_178_1050 | 270 |
| 1042 | 3300048924 | Ga0496121_0017687 | Ga0496121_0017687_5745_6623 | 270 |
| 1043 | 3300048926 | Ga0496123_0137232 | Ga0496123_0137232_41_916 | 270 |
| 1044 | 3300048927 | Ga0496124_0164115 | Ga0496124_0164115_168_1046 | 270 |
| 1045 | 3300049585 | Ga0501069_0054289 | Ga0501069_0054289_819_1694 | 270 |
| 1046 | 3300050489 | nmdc:mga03683_120193_c1 | nmdc:mga03683_120193_c1_236_1117 | 270 |
| 1047 | 3300053087 | Ga0500643_004409 | Ga0500643_004409_1149_2024 | 270 |
| 1048 | 3300053088 | Ga0500644_0028801 | Ga0500644_0028801_730_1605 | 270 |
| 1049 | 3300053090 | Ga0500646_0006695 | Ga0500646_0006695_444_1319 | 270 |
| 1050 | 3300053103 | Ga0500555_005686 | Ga0500555_005686_2352_3227 | 270 |
| 1051 | 3300053122 | Ga0500608_070504 | Ga0500608_070504_229_1104 | 270 |
| 1052 | 3300053125 | Ga0500618_001619 | Ga0500618_001619_3823_4701 | 270 |
| 1053 | 3300053126 | Ga0500621_056389 | Ga0500621_056389_50_925 | 270 |
| 1054 | 3300053153 | Ga0500616_0063108 | Ga0500616_0063108_580_1470 | 270 |
| 1055 | 3300053156 | Ga0500622_0000441 | Ga0500622_0000441_7787_8662 | 270 |
| 1056 | 3300053158 | Ga0500627_0002598 | Ga0500627_0002598_2005_2880 | 270 |
| 1057 | 3300053730 | Ga0500645_004116 | Ga0500645_004116_462_1337 | 270 |
| 1058 | iso_pu_bacteria | 2643221595 | 2643985965 | 270 |
| 1059 | iso_pu_bacteria | 2844002411 | 2844003249 | 270 |
| 1060 | iso_pu_bacteria | 2871466892 | 2871473497 | 270 |
| 1061 | iso_pu_bacteria | 2894414249 | 2894417682 | 270 |
| 1062 | iso_pu_bacteria | 2906378014 | 2906379158 | 270 |
| 1063 | 3300003771 | Ga0055526_1001485 | Ga0055526_100148514 | 271 |
| 1064 | 3300003775 | Ga0055524_1000399 | Ga0055524_100039927 | 271 |
| 1065 | 3300003784 | Ga0055534_1011959 | Ga0055534_10119592 | 271 |
| 1066 | 3300005458 | Ga0070681_10095301 | Ga0070681_100953011 | 271 |
| 1067 | 3300006846 | Ga0075430_100180190 | Ga0075430_1001801903 | 271 |
| 1068 | 3300009147 | Ga0114129_10000062 | Ga0114129_1000006214 | 271 |
| 1069 | 3300021388 | Ga0213875_10003041 | Ga0213875_100030417 | 271 |
| 1070 | 3300025273 | Ga0209673_1013882 | Ga0209673_10138822 | 271 |
| 1071 | 3300025291 | Ga0209675_1000515 | Ga0209675_10005154 | 271 |
| 1072 | 3300025294 | Ga0209025_1000357 | Ga0209025_100035729 | 271 |
| 1073 | 3300025295 | Ga0209564_1001051 | Ga0209564_100105114 | 271 |
| 1074 | 3300025299 | Ga0209256_1000876 | Ga0209256_100087628 | 271 |
| 1075 | 3300025304 | Ga0209257_1049314 | Ga0209257_10493141 | 271 |
| 1076 | 3300031239 | Ga0265328_10062827 | Ga0265328_100628272 | 271 |
| 1077 | 3300031250 | Ga0265331_10001205 | Ga0265331_1000120515 | 271 |
| 1078 | 3300032168 | Ga0316593_10033869 | Ga0316593_100338692 | 271 |
| 1079 | 3300036647 | Ga0316582_0212929 | Ga0316582_0212929_124_1008 | 271 |
| 1080 | 3300036712 | Ga0316584_0042160 | Ga0316584_0042160_635_1519 | 271 |
| 1081 | 3300037853 | Ga0436364_0697377 | Ga0436364_0697377_4895_5776 | 271 |
| 1082 | 3300037853 | Ga0436364_0964747 | Ga0436364_0964747_223_1098 | 271 |
| 1083 | 3300039437 | Ga0436365_0733541 | Ga0436365_0733541_33_908 | 271 |
| 1084 | 3300044683 | Ga0466965_0038749 | Ga0466965_0038749_297_1178 | 271 |
| 1085 | 3300048928 | Ga0496125_0057135 | Ga0496125_0057135_1571_2458 | 271 |
| 1086 | 3300053104 | Ga0500556_0025337 | Ga0500556_0025337_684_1637 | 271 |
| 1087 | 3300053156 | Ga0500622_0165105 | Ga0500622_0165105_17_895 | 271 |
| 1088 | 3300005436 | Ga0070713_100343897 | Ga0070713_1003438971 | 272 |
| 1089 | 3300006051 | Ga0075364_10000055 | Ga0075364_100000552 | 272 |
| 1090 | 3300013100 | Ga0157373_10123709 | Ga0157373_101237092 | 272 |
| 1091 | 3300013105 | Ga0157369_10180386 | Ga0157369_101803862 | 272 |
| 1092 | 3300021384 | Ga0213876_10065834 | Ga0213876_100658342 | 272 |
| 1093 | 3300025294 | Ga0209025_1000042 | Ga0209025_100004294 | 272 |
| 1094 | 3300025972 | Ga0207668_10034894 | Ga0207668_100348944 | 272 |
| 1095 | 3300031235 | Ga0265330_10084826 | Ga0265330_100848262 | 272 |
| 1096 | 3300031249 | Ga0265339_10027678 | Ga0265339_100276783 | 272 |
| 1097 | 3300031852 | Ga0307410_10178177 | Ga0307410_101781772 | 272 |
| 1098 | 3300031901 | Ga0307406_10056561 | Ga0307406_100565613 | 272 |
| 1099 | 3300037853 | Ga0436364_1554086 | Ga0436364_1554086_709_1593 | 272 |
| 1100 | 3300039437 | Ga0436365_0942406 | Ga0436365_0942406_58_966 | 272 |
| 1101 | 3300039438 | Ga0436360_0831553 | Ga0436360_0831553_1663_2547 | 272 |
| 1102 | 3300039438 | Ga0436360_0955023 | Ga0436360_0955023_72_962 | 272 |
| 1103 | 3300039447 | Ga0436361_0602414 | Ga0436361_0602414_740_1630 | 272 |
| 1104 | 3300039450 | Ga0436363_0715275 | Ga0436363_0715275_8250_9146 | 272 |
| 1105 | 3300039453 | Ga0436362_0020367 | Ga0436362_0020367_3478_4362 | 272 |
| 1106 | 3300039453 | Ga0436362_1301339 | Ga0436362_1301339_25_909 | 272 |
| 1107 | 3300041413 | Ga0439465_0033501 | Ga0439465_0033501_338_1222 | 272 |
| 1108 | 3300046500 | Ga0495596_0074009 | Ga0495596_0074009_408_1286 | 272 |
| 1109 | 3300046501 | Ga0495607_0042991 | Ga0495607_0042991_340_1218 | 272 |
| 1110 | 3300046642 | Ga0495634_0012404 | Ga0495634_0012404_4175_5074 | 272 |
| 1111 | 3300047315 | Ga0495581_0029748 | Ga0495581_0029748_1412_2311 | 272 |
| 1112 | 3300047673 | Ga0495593_0069627 | Ga0495593_0069627_548_1447 | 272 |
| 1113 | 3300048919 | Ga0496116_0110403 | Ga0496116_0110403_432_1322 | 272 |
| 1114 | 3300048920 | Ga0496117_0008418 | Ga0496117_0008418_3375_4265 | 272 |
| 1115 | 3300048924 | Ga0496121_0000888 | Ga0496121_0000888_5375_6256 | 272 |
| 1116 | 3300048925 | Ga0496122_0000308 | Ga0496122_0000308_75130_76020 | 272 |
| 1117 | 3300048926 | Ga0496123_0000066 | Ga0496123_0000066_74897_75787 | 272 |
| 1118 | 3300048927 | Ga0496124_0001215 | Ga0496124_0001215_26321_27211 | 272 |
| 1119 | 3300048927 | Ga0496124_0229599 | Ga0496124_0229599_466_1347 | 272 |
| 1120 | 3300048928 | Ga0496125_0000288 | Ga0496125_0000288_66868_67758 | 272 |
| 1121 | 3300048928 | Ga0496125_0064968 | Ga0496125_0064968_1704_2594 | 272 |
| 1122 | 3300048929 | Ga0496126_0000258 | Ga0496126_0000258_74127_75017 | 272 |
| 1123 | 3300048929 | Ga0496126_0054046 | Ga0496126_0054046_287_1177 | 272 |
| 1124 | 3300049571 | Ga0501034_0139427 | Ga0501034_0139427_524_1414 | 272 |
| 1125 | 3300049572 | Ga0501036_0081034 | Ga0501036_0081034_1579_2460 | 272 |
| 1126 | 3300049573 | Ga0501037_0060985 | Ga0501037_0060985_494_1375 | 272 |
| 1127 | 3300049575 | Ga0501039_0045660 | Ga0501039_0045660_1744_2625 | 272 |
| 1128 | 3300049579 | Ga0501043_0092471 | Ga0501043_0092471_164_1054 | 272 |
| 1129 | 3300049589 | Ga0501073_0078675 | Ga0501073_0078675_1023_1904 | 272 |
| 1130 | 3300049591 | Ga0501075_0016391 | Ga0501075_0016391_1401_2282 | 272 |
| 1131 | 3300049592 | Ga0501076_0102896 | Ga0501076_0102896_151_1032 | 272 |
| 1132 | 3300049593 | Ga0501077_0018120 | Ga0501077_0018120_1334_2215 | 272 |
| 1133 | 3300049741 | Ga0501079_0016314 | Ga0501079_0016314_3891_4772 | 272 |
| 1134 | 3300049744 | Ga0501083_0119473 | Ga0501083_0119473_227_1108 | 272 |
| 1135 | 3300049822 | Ga0501035_0131333 | Ga0501035_0131333_951_1832 | 272 |
| 1136 | 3300049823 | Ga0501044_0080832 | Ga0501044_0080832_1091_1972 | 272 |
| 1137 | 3300049823 | Ga0501044_0218052 | Ga0501044_0218052_302_1192 | 272 |
| 1138 | 3300049823 | Ga0501044_0262528 | Ga0501044_0262528_213_1136 | 272 |
| 1139 | 3300050491 | nmdc:mga00v17_431_c1 | nmdc:mga00v17_431_c1_294_1175 | 272 |
| 1140 | 3300053104 | Ga0500556_0009403 | Ga0500556_0009403_1110_1988 | 272 |
| 1141 | 3300053108 | Ga0500562_043309 | Ga0500562_043309_101_1003 | 272 |
| 1142 | 3300054114 | Ga0501084_0076623 | Ga0501084_0076623_1842_2723 | 272 |
| 1143 | 3300060353 | Ga0501082_0001851 | Ga0501082_0001851_13736_14617 | 272 |
| 1144 | iso_pu_bacteria | 2896429255 | 2896431799 | 272 |
| 1145 | 3300002774 | JGI25150J39212_1000067 | JGI25150J39212_10000675 | 273 |
| 1146 | 3300003187 | JGI25151J46595_10023969 | JGI25151J46595_100239691 | 273 |
| 1147 | 3300003215 | JGI25153J46596_10000125 | JGI25153J46596_1000012580 | 273 |
| 1148 | 3300003320 | rootH2_10196566 | rootH2_101965662 | 273 |
| 1149 | 3300003781 | Ga0055536_1026679 | Ga0055536_10266792 | 273 |
| 1150 | 3300003791 | Ga0055530_10014468 | Ga0055530_100144682 | 273 |
| 1151 | 3300005262 | Ga0065165_1020124 | Ga0065165_10201243 | 273 |
| 1152 | 3300005985 | Ga0081539_10013963 | Ga0081539_100139634 | 273 |
| 1153 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005833 | 273 |
| 1154 | 3300025258 | Ga0209129_1000701 | Ga0209129_100070123 | 273 |
| 1155 | 3300025263 | Ga0209565_1000272 | Ga0209565_100027258 | 273 |
| 1156 | 3300025273 | Ga0209673_1028160 | Ga0209673_10281602 | 273 |
| 1157 | 3300025292 | Ga0209676_1005025 | Ga0209676_10050253 | 273 |
| 1158 | 3300025294 | Ga0209025_1001007 | Ga0209025_100100736 | 273 |
| 1159 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002512 | 273 |
| 1160 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001462 | 273 |
| 1161 | 3300025298 | Ga0209050_1021655 | Ga0209050_10216553 | 273 |
| 1162 | 3300025302 | Ga0207426_1012332 | Ga0207426_10123324 | 273 |
| 1163 | 3300025303 | Ga0209051_1000472 | Ga0209051_100047242 | 273 |
| 1164 | 3300025304 | Ga0209257_1003045 | Ga0209257_10030454 | 273 |
| 1165 | 3300025304 | Ga0209257_1003113 | Ga0209257_10031134 | 273 |
| 1166 | 3300025937 | Ga0207669_10182008 | Ga0207669_101820082 | 273 |
| 1167 | 3300026075 | Ga0207708_10208253 | Ga0207708_102082532 | 273 |
| 1168 | 3300028023 | Ga0265357_1000174 | Ga0265357_10001743 | 273 |
| 1169 | 3300031616 | Ga0307508_10063127 | Ga0307508_100631273 | 273 |
| 1170 | 3300032004 | Ga0307414_10000567 | Ga0307414_1000056722 | 273 |
| 1171 | 3300033180 | Ga0307510_10039096 | Ga0307510_100390963 | 273 |
| 1172 | 3300033180 | Ga0307510_10230928 | Ga0307510_102309282 | 273 |
| 1173 | 3300037853 | Ga0436364_0958902 | Ga0436364_0958902_374_1255 | 273 |
| 1174 | 3300046557 | Ga0495622_0049152 | Ga0495622_0049152_791_1729 | 273 |
| 1175 | 3300046558 | Ga0495633_0068945 | Ga0495633_0068945_664_1602 | 273 |
| 1176 | 3300046692 | Ga0495671_0007336 | Ga0495671_0007336_2212_3150 | 273 |
| 1177 | 3300048905 | Ga0496102_0132876 | Ga0496102_0132876_1182_2069 | 273 |
| 1178 | 3300048913 | Ga0496110_0211139 | Ga0496110_0211139_394_1278 | 273 |
| 1179 | 3300048918 | Ga0496115_0001166 | Ga0496115_0001166_896_1777 | 273 |
| 1180 | 3300053087 | Ga0500643_000336 | Ga0500643_000336_21353_22273 | 273 |
| 1181 | 3300053118 | Ga0500594_0000636 | Ga0500594_0000636_201_1139 | 273 |
| 1182 | 3300005435 | Ga0070714_100093073 | Ga0070714_1000930733 | 274 |
| 1183 | 3300005455 | Ga0070663_100533523 | Ga0070663_1005335231 | 274 |
| 1184 | 3300006177 | Ga0075362_10052451 | Ga0075362_100524511 | 274 |
| 1185 | 3300013297 | Ga0157378_10424770 | Ga0157378_104247701 | 274 |
| 1186 | 3300014497 | Ga0182008_10049221 | Ga0182008_100492212 | 274 |
| 1187 | 3300025928 | Ga0207700_10028927 | Ga0207700_100289273 | 274 |
| 1188 | 3300025929 | Ga0207664_10030239 | Ga0207664_100302394 | 274 |
| 1189 | 3300027876 | Ga0209974_10005007 | Ga0209974_100050072 | 274 |
| 1190 | 3300035111 | Ga0373923_0067422 | Ga0373923_0067422_350_1252 | 274 |
| 1191 | 3300035725 | Ga0373947_0018642 | Ga0373947_0018642_2308_3210 | 274 |
| 1192 | 3300046454 | Ga0495592_0102487 | Ga0495592_0102487_375_1277 | 274 |
| 1193 | 3300046476 | Ga0495662_0020350 | Ga0495662_0020350_807_1709 | 274 |
| 1194 | 3300046477 | Ga0495664_0008491 | Ga0495664_0008491_4096_4998 | 274 |
| 1195 | 3300046517 | Ga0495630_0089419 | Ga0495630_0089419_567_1469 | 274 |
| 1196 | 3300046529 | Ga0495652_0039570 | Ga0495652_0039570_1464_2366 | 274 |
| 1197 | 3300046533 | Ga0495640_0090966 | Ga0495640_0090966_517_1419 | 274 |
| 1198 | 3300046543 | Ga0495645_0117245 | Ga0495645_0117245_199_1101 | 274 |
| 1199 | 3300046616 | Ga0495668_0028753 | Ga0495668_0028753_1254_2144 | 274 |
| 1200 | 3300046642 | Ga0495634_0005388 | Ga0495634_0005388_961_1863 | 274 |
| 1201 | 3300047319 | Ga0495674_0065302 | Ga0495674_0065302_677_1579 | 274 |
| 1202 | 3300048923 | Ga0496120_0070467 | Ga0496120_0070467_382_1269 | 274 |
| 1203 | 3300053155 | Ga0500620_001156 | Ga0500620_001156_352_1239 | 274 |
| 1204 | 3300053728 | Ga0500657_082053 | Ga0500657_082053_87_989 | 274 |
| 1205 | 3300005435 | Ga0070714_100140544 | Ga0070714_1001405442 | 275 |
| 1206 | 3300006028 | Ga0070717_10099484 | Ga0070717_100994843 | 275 |
| 1207 | 3300031911 | Ga0307412_10168359 | Ga0307412_101683592 | 275 |
| 1208 | 3300035116 | Ga0373945_0038698 | Ga0373945_0038698_279_1187 | 275 |
| 1209 | 3300053139 | Ga0500568_0005603 | Ga0500568_0005603_4578_5507 | 275 |
| 1210 | 3300009553 | Ga0105249_10598055 | Ga0105249_105980551 | 276 |
| 1211 | 3300025304 | Ga0209257_1018637 | Ga0209257_10186372 | 276 |
| 1212 | 3300031241 | Ga0265325_10042196 | Ga0265325_100421963 | 276 |
| 1213 | 3300031249 | Ga0265339_10000068 | Ga0265339_1000006865 | 276 |
| 1214 | 3300031595 | Ga0265313_10006241 | Ga0265313_100062418 | 276 |
| 1215 | 3300031852 | Ga0307410_10262030 | Ga0307410_102620302 | 276 |
| 1216 | 3300031852 | Ga0307410_10374852 | Ga0307410_103748522 | 276 |
| 1217 | 3300031903 | Ga0307407_10104652 | Ga0307407_101046522 | 276 |
| 1218 | 3300032004 | Ga0307414_10012890 | Ga0307414_100128904 | 276 |
| 1219 | 3300032004 | Ga0307414_10044355 | Ga0307414_100443552 | 276 |
| 1220 | 3300032004 | Ga0307414_10091042 | Ga0307414_100910422 | 276 |
| 1221 | 3300032004 | Ga0307414_10167325 | Ga0307414_101673252 | 276 |
| 1222 | 3300032005 | Ga0307411_10434930 | Ga0307411_104349301 | 276 |
| 1223 | 3300035111 | Ga0373923_0030373 | Ga0373923_0030373_1164_2084 | 276 |
| 1224 | 3300035117 | Ga0373953_0003803 | Ga0373953_0003803_1660_2580 | 276 |
| 1225 | 3300035118 | Ga0373954_0012077 | Ga0373954_0012077_1387_2307 | 276 |
| 1226 | 3300035119 | Ga0373956_0023567 | Ga0373956_0023567_1057_1977 | 276 |
| 1227 | 3300035172 | Ga0373955_0014392 | Ga0373955_0014392_1060_1980 | 276 |
| 1228 | 3300035410 | Ga0373924_0001157 | Ga0373924_0001157_7452_8372 | 276 |
| 1229 | 3300035695 | Ga0373927_0061084 | Ga0373927_0061084_339_1259 | 276 |
| 1230 | 3300035724 | Ga0373933_0000565 | Ga0373933_0000565_20170_21090 | 276 |
| 1231 | 3300036401 | Ga0373937_0006584 | Ga0373937_0006584_3470_4390 | 276 |
| 1232 | 3300037068 | Ga0373925_0155169 | Ga0373925_0155169_191_1111 | 276 |
| 1233 | 3300046454 | Ga0495592_0025358 | Ga0495592_0025358_1709_2629 | 276 |
| 1234 | 3300046459 | Ga0495629_0001993 | Ga0495629_0001993_10934_11854 | 276 |
| 1235 | 3300046462 | Ga0495651_0000136 | Ga0495651_0000136_15370_16290 | 276 |
| 1236 | 3300046463 | Ga0495653_0001743 | Ga0495653_0001743_7698_8618 | 276 |
| 1237 | 3300046473 | Ga0495582_0058999 | Ga0495582_0058999_969_1889 | 276 |
| 1238 | 3300046511 | Ga0495608_0000282 | Ga0495608_0000282_33315_34235 | 276 |
| 1239 | 3300046514 | Ga0495618_0007700 | Ga0495618_0007700_1586_2506 | 276 |
| 1240 | 3300046526 | Ga0495666_0051634 | Ga0495666_0051634_912_1832 | 276 |
| 1241 | 3300046529 | Ga0495652_0005586 | Ga0495652_0005586_6270_7190 | 276 |
| 1242 | 3300046533 | Ga0495640_0001369 | Ga0495640_0001369_10610_11530 | 276 |
| 1243 | 3300046536 | Ga0495587_0001140 | Ga0495587_0001140_5830_6750 | 276 |
| 1244 | 3300046543 | Ga0495645_0020607 | Ga0495645_0020607_1042_1962 | 276 |
| 1245 | 3300046559 | Ga0495667_0000392 | Ga0495667_0000392_20379_21299 | 276 |
| 1246 | 3300046660 | Ga0495625_0008016 | Ga0495625_0008016_1623_2564 | 276 |
| 1247 | 3300046663 | Ga0495635_0001645 | Ga0495635_0001645_7720_8640 | 276 |
| 1248 | 3300046675 | Ga0495657_0002613 | Ga0495657_0002613_8026_8946 | 276 |
| 1249 | 3300046679 | Ga0495623_0001489 | Ga0495623_0001489_7372_8292 | 276 |
| 1250 | 3300046680 | Ga0495646_0008281 | Ga0495646_0008281_3560_4480 | 276 |
| 1251 | 3300046683 | Ga0495658_0095703 | Ga0495658_0095703_158_1078 | 276 |
| 1252 | 3300046689 | Ga0495613_0046126 | Ga0495613_0046126_1115_2035 | 276 |
| 1253 | 3300046809 | Ga0495600_0034397 | Ga0495600_0034397_115_1035 | 276 |
| 1254 | 3300047317 | Ga0495604_0000168 | Ga0495604_0000168_1030_1950 | 276 |
| 1255 | 3300047319 | Ga0495674_0000573 | Ga0495674_0000573_9712_10632 | 276 |
| 1256 | 3300047322 | Ga0495680_0000285 | Ga0495680_0000285_20298_21218 | 276 |
| 1257 | 3300047444 | Ga0495675_0008016 | Ga0495675_0008016_3560_4480 | 276 |
| 1258 | 3300048088 | Ga0495602_0002627 | Ga0495602_0002627_8637_9557 | 276 |
| 1259 | 3300053077 | Ga0495601_0007011 | Ga0495601_0007011_4443_5363 | 276 |
| 1260 | 3300053084 | Ga0495595_0000996 | Ga0495595_0000996_8703_9623 | 276 |
| 1261 | 3300053085 | Ga0495619_0000309 | Ga0495619_0000309_15897_16817 | 276 |
| 1262 | 3300053104 | Ga0500556_0000217 | Ga0500556_0000217_7155_8096 | 276 |
| 1263 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_442652_443593 | 276 |
| 1264 | 3300053139 | Ga0500568_0044678 | Ga0500568_0044678_382_1317 | 276 |
| 1265 | 3300053730 | Ga0500645_000148 | Ga0500645_000148_4549_5484 | 276 |
| 1266 | iso_pu_bacteria | 8057101203 | 8057105391 | 276 |
| 1267 | 3300005344 | Ga0070661_100004478 | Ga0070661_1000044784 | 277 |
| 1268 | 3300005345 | Ga0070692_10010249 | Ga0070692_100102494 | 277 |
| 1269 | 3300005366 | Ga0070659_100101906 | Ga0070659_1001019063 | 277 |
| 1270 | 3300005367 | Ga0070667_100371318 | Ga0070667_1003713182 | 277 |
| 1271 | 3300005455 | Ga0070663_100016335 | Ga0070663_1000163352 | 277 |
| 1272 | 3300005539 | Ga0068853_100174136 | Ga0068853_1001741362 | 277 |
| 1273 | 3300005564 | Ga0070664_100350159 | Ga0070664_1003501592 | 277 |
| 1274 | 3300005616 | Ga0068852_100016058 | Ga0068852_1000160585 | 277 |
| 1275 | 3300009093 | Ga0105240_10000969 | Ga0105240_1000096947 | 277 |
| 1276 | 3300009093 | Ga0105240_10002383 | Ga0105240_1000238315 | 277 |
| 1277 | 3300013296 | Ga0157374_10082522 | Ga0157374_100825223 | 277 |
| 1278 | 3300025913 | Ga0207695_10000932 | Ga0207695_100009325 | 277 |
| 1279 | 3300025913 | Ga0207695_10002096 | Ga0207695_1000209615 | 277 |
| 1280 | 3300025919 | Ga0207657_10059690 | Ga0207657_100596904 | 277 |
| 1281 | 3300025920 | Ga0207649_10122105 | Ga0207649_101221052 | 277 |
| 1282 | 3300025932 | Ga0207690_10073937 | Ga0207690_100739373 | 277 |
| 1283 | 3300025945 | Ga0207679_10363124 | Ga0207679_103631241 | 277 |
| 1284 | 3300025981 | Ga0207640_10482811 | Ga0207640_104828111 | 277 |
| 1285 | 3300026067 | Ga0207678_10000321 | Ga0207678_1000032134 | 277 |
| 1286 | 3300026142 | Ga0207698_10038303 | Ga0207698_100383032 | 277 |
| 1287 | 3300053157 | Ga0500624_000003 | Ga0500624_000003_79916_80800 | 277 |
| 1288 | 3300053178 | Ga0500637_0000073 | Ga0500637_0000073_11108_11992 | 277 |
| 1289 | 3300005367 | Ga0070667_100077172 | Ga0070667_1000771723 | 278 |
| 1290 | 3300005458 | Ga0070681_10331300 | Ga0070681_103313001 | 278 |
| 1291 | 3300005843 | Ga0068860_100212890 | Ga0068860_1002128902 | 278 |
| 1292 | 3300009177 | Ga0105248_10005596 | Ga0105248_1000559611 | 278 |
| 1293 | 3300025941 | Ga0207711_10003216 | Ga0207711_100032165 | 278 |
| 1294 | 3300025986 | Ga0207658_10016455 | Ga0207658_100164555 | 278 |
| 1295 | 3300026035 | Ga0207703_10016915 | Ga0207703_100169153 | 278 |
| 1296 | 3300028381 | Ga0268264_10065732 | Ga0268264_100657323 | 278 |
| 1297 | 3300031548 | Ga0307408_100284968 | Ga0307408_1002849682 | 278 |
| 1298 | 3300031901 | Ga0307406_10042324 | Ga0307406_100423244 | 278 |
| 1299 | 3300048909 | Ga0496106_0199361 | Ga0496106_0199361_394_1272 | 278 |
| 1300 | 3300048913 | Ga0496110_0307893 | Ga0496110_0307893_478_1356 | 278 |
| 1301 | 3300048914 | Ga0496111_0155426 | Ga0496111_0155426_22_900 | 278 |
| 1302 | 3300049583 | Ga0501067_0175796 | Ga0501067_0175796_214_1086 | 278 |
| 1303 | 3300001979 | JGI24740J21852_10035217 | JGI24740J21852_100352172 | 279 |
| 1304 | 3300002067 | JGI24735J21928_10011843 | JGI24735J21928_100118433 | 279 |
| 1305 | 3300005327 | Ga0070658_10024326 | Ga0070658_100243262 | 279 |
| 1306 | 3300005327 | Ga0070658_10101204 | Ga0070658_101012042 | 279 |
| 1307 | 3300005335 | Ga0070666_10086933 | Ga0070666_100869331 | 279 |
| 1308 | 3300005339 | Ga0070660_100036408 | Ga0070660_1000364082 | 279 |
| 1309 | 3300005345 | Ga0070692_10019127 | Ga0070692_100191272 | 279 |
| 1310 | 3300005347 | Ga0070668_100029834 | Ga0070668_1000298344 | 279 |
| 1311 | 3300005353 | Ga0070669_100128352 | Ga0070669_1001283522 | 279 |
| 1312 | 3300005364 | Ga0070673_100415190 | Ga0070673_1004151902 | 279 |
| 1313 | 3300005366 | Ga0070659_100005172 | Ga0070659_1000051728 | 279 |
| 1314 | 3300005366 | Ga0070659_100179570 | Ga0070659_1001795702 | 279 |
| 1315 | 3300005444 | Ga0070694_100014006 | Ga0070694_1000140062 | 279 |
| 1316 | 3300005455 | Ga0070663_100175187 | Ga0070663_1001751872 | 279 |
| 1317 | 3300005457 | Ga0070662_100006493 | Ga0070662_1000064934 | 279 |
| 1318 | 3300005539 | Ga0068853_100018318 | Ga0068853_1000183184 | 279 |
| 1319 | 3300005543 | Ga0070672_100026242 | Ga0070672_1000262422 | 279 |
| 1320 | 3300005543 | Ga0070672_100071046 | Ga0070672_1000710462 | 279 |
| 1321 | 3300005563 | Ga0068855_100023996 | Ga0068855_1000239964 | 279 |
| 1322 | 3300005563 | Ga0068855_100549981 | Ga0068855_1005499812 | 279 |
| 1323 | 3300005563 | Ga0068855_100550001 | Ga0068855_1005500012 | 279 |
| 1324 | 3300005577 | Ga0068857_100075772 | Ga0068857_1000757724 | 279 |
| 1325 | 3300005577 | Ga0068857_100128607 | Ga0068857_1001286073 | 279 |
| 1326 | 3300005578 | Ga0068854_100310618 | Ga0068854_1003106182 | 279 |
| 1327 | 3300005616 | Ga0068852_100579662 | Ga0068852_1005796621 | 279 |
| 1328 | 3300005719 | Ga0068861_100275365 | Ga0068861_1002753651 | 279 |
| 1329 | 3300005841 | Ga0068863_100059457 | Ga0068863_1000594572 | 279 |
| 1330 | 3300005842 | Ga0068858_100164293 | Ga0068858_1001642932 | 279 |
| 1331 | 3300005843 | Ga0068860_100020438 | Ga0068860_1000204385 | 279 |
| 1332 | 3300005844 | Ga0068862_100026253 | Ga0068862_1000262532 | 279 |
| 1333 | 3300006844 | Ga0075428_100421428 | Ga0075428_1004214282 | 279 |
| 1334 | 3300006847 | Ga0075431_100232121 | Ga0075431_1002321212 | 279 |
| 1335 | 3300006852 | Ga0075433_10007758 | Ga0075433_100077588 | 279 |
| 1336 | 3300009093 | Ga0105240_10135616 | Ga0105240_101356164 | 279 |
| 1337 | 3300009553 | Ga0105249_10014274 | Ga0105249_100142744 | 279 |
| 1338 | 3300009553 | Ga0105249_10170029 | Ga0105249_101700293 | 279 |
| 1339 | 3300010375 | Ga0105239_10056934 | Ga0105239_100569342 | 279 |
| 1340 | 3300013102 | Ga0157371_10365363 | Ga0157371_103653632 | 279 |
| 1341 | 3300013306 | Ga0163162_10049394 | Ga0163162_100493943 | 279 |
| 1342 | 3300025321 | Ga0207656_10062919 | Ga0207656_100629191 | 279 |
| 1343 | 3300025901 | Ga0207688_10103231 | Ga0207688_101032312 | 279 |
| 1344 | 3300025904 | Ga0207647_10001021 | Ga0207647_1000102119 | 279 |
| 1345 | 3300025909 | Ga0207705_10157555 | Ga0207705_101575552 | 279 |
| 1346 | 3300025911 | Ga0207654_10333593 | Ga0207654_103335932 | 279 |
| 1347 | 3300025913 | Ga0207695_10127172 | Ga0207695_101271723 | 279 |
| 1348 | 3300025919 | Ga0207657_10041770 | Ga0207657_100417705 | 279 |
| 1349 | 3300025919 | Ga0207657_10045255 | Ga0207657_100452552 | 279 |
| 1350 | 3300025920 | Ga0207649_10056805 | Ga0207649_100568053 | 279 |
| 1351 | 3300025923 | Ga0207681_10291811 | Ga0207681_102918112 | 279 |
| 1352 | 3300025923 | Ga0207681_10412645 | Ga0207681_104126452 | 279 |
| 1353 | 3300025932 | Ga0207690_10022231 | Ga0207690_100222314 | 279 |
| 1354 | 3300025932 | Ga0207690_10086876 | Ga0207690_100868762 | 279 |
| 1355 | 3300025933 | Ga0207706_10016163 | Ga0207706_100161634 | 279 |
| 1356 | 3300025933 | Ga0207706_10022391 | Ga0207706_100223912 | 279 |
| 1357 | 3300025934 | Ga0207686_10074493 | Ga0207686_100744932 | 279 |
| 1358 | 3300025935 | Ga0207709_10127458 | Ga0207709_101274582 | 279 |
| 1359 | 3300025940 | Ga0207691_10015863 | Ga0207691_100158637 | 279 |
| 1360 | 3300025940 | Ga0207691_10062102 | Ga0207691_100621024 | 279 |
| 1361 | 3300025942 | Ga0207689_10005022 | Ga0207689_1000502211 | 279 |
| 1362 | 3300025949 | Ga0207667_10024411 | Ga0207667_100244115 | 279 |
| 1363 | 3300025961 | Ga0207712_10000783 | Ga0207712_100007839 | 279 |
| 1364 | 3300025972 | Ga0207668_10141526 | Ga0207668_101415262 | 279 |
| 1365 | 3300025981 | Ga0207640_10298510 | Ga0207640_102985102 | 279 |
| 1366 | 3300026035 | Ga0207703_10010670 | Ga0207703_100106706 | 279 |
| 1367 | 3300026041 | Ga0207639_10010625 | Ga0207639_100106254 | 279 |
| 1368 | 3300026067 | Ga0207678_10021259 | Ga0207678_100212593 | 279 |
| 1369 | 3300026067 | Ga0207678_10085250 | Ga0207678_100852504 | 279 |
| 1370 | 3300026078 | Ga0207702_10297191 | Ga0207702_102971912 | 279 |
| 1371 | 3300026088 | Ga0207641_10073424 | Ga0207641_100734244 | 279 |
| 1372 | 3300026116 | Ga0207674_10113418 | Ga0207674_101134182 | 279 |
| 1373 | 3300026116 | Ga0207674_10185182 | Ga0207674_101851822 | 279 |
| 1374 | 3300026118 | Ga0207675_100337628 | Ga0207675_1003376282 | 279 |
| 1375 | 3300028380 | Ga0268265_10123688 | Ga0268265_101236882 | 279 |
| 1376 | 3300028381 | Ga0268264_10005356 | Ga0268264_100053564 | 279 |
| 1377 | 3300031548 | Ga0307408_100189984 | Ga0307408_1001899842 | 279 |
| 1378 | 3300044901 | Ga0466960_0050556 | Ga0466960_0050556_322_1218 | 279 |
| 1379 | 3300048911 | Ga0496108_0004829 | Ga0496108_0004829_1292_2173 | 279 |
| 1380 | 3300050510 | nmdc:mga06r32_228695_c1 | nmdc:mga06r32_228695_c1_471_1355 | 279 |
| 1381 | 3300050512 | nmdc:mga0n895_228599_c1 | nmdc:mga0n895_228599_c1_362_1246 | 279 |
| 1382 | 3300050515 | nmdc:mga0a205_4289_c1 | nmdc:mga0a205_4289_c1_989_1873 | 279 |
| 1383 | 3300001979 | JGI24740J21852_10006249 | JGI24740J21852_100062495 | 280 |
| 1384 | 3300001989 | JGI24739J22299_10004554 | JGI24739J22299_100045545 | 280 |
| 1385 | 3300001990 | JGI24737J22298_10000027 | JGI24737J22298_1000002721 | 280 |
| 1386 | 3300001991 | JGI24743J22301_10018467 | JGI24743J22301_100184671 | 280 |
| 1387 | 3300002073 | JGI24745J21846_1008512 | JGI24745J21846_10085122 | 280 |
| 1388 | 3300002075 | JGI24738J21930_10000290 | JGI24738J21930_100002902 | 280 |
| 1389 | 3300005327 | Ga0070658_10308606 | Ga0070658_103086062 | 280 |
| 1390 | 3300005328 | Ga0070676_10021382 | Ga0070676_100213823 | 280 |
| 1391 | 3300005330 | Ga0070690_100006566 | Ga0070690_1000065665 | 280 |
| 1392 | 3300005331 | Ga0070670_100034634 | Ga0070670_1000346344 | 280 |
| 1393 | 3300005331 | Ga0070670_100040649 | Ga0070670_1000406492 | 280 |
| 1394 | 3300005333 | Ga0070677_10031905 | Ga0070677_100319052 | 280 |
| 1395 | 3300005334 | Ga0068869_100000085 | Ga0068869_10000008527 | 280 |
| 1396 | 3300005338 | Ga0068868_100020324 | Ga0068868_1000203244 | 280 |
| 1397 | 3300005338 | Ga0068868_100245841 | Ga0068868_1002458412 | 280 |
| 1398 | 3300005339 | Ga0070660_100000881 | Ga0070660_10000088112 | 280 |
| 1399 | 3300005344 | Ga0070661_100087461 | Ga0070661_1000874613 | 280 |
| 1400 | 3300005347 | Ga0070668_100089906 | Ga0070668_1000899062 | 280 |
| 1401 | 3300005353 | Ga0070669_100000693 | Ga0070669_10000069310 | 280 |
| 1402 | 3300005353 | Ga0070669_100085027 | Ga0070669_1000850272 | 280 |
| 1403 | 3300005353 | Ga0070669_100382442 | Ga0070669_1003824422 | 280 |
| 1404 | 3300005354 | Ga0070675_100007745 | Ga0070675_1000077453 | 280 |
| 1405 | 3300005355 | Ga0070671_100018580 | Ga0070671_1000185802 | 280 |
| 1406 | 3300005355 | Ga0070671_100036951 | Ga0070671_1000369513 | 280 |
| 1407 | 3300005364 | Ga0070673_100000450 | Ga0070673_10000045016 | 280 |
| 1408 | 3300005366 | Ga0070659_100000525 | Ga0070659_10000052520 | 280 |
| 1409 | 3300005367 | Ga0070667_100017242 | Ga0070667_1000172421 | 280 |
| 1410 | 3300005367 | Ga0070667_100042224 | Ga0070667_1000422243 | 280 |
| 1411 | 3300005367 | Ga0070667_100070257 | Ga0070667_1000702572 | 280 |
| 1412 | 3300005455 | Ga0070663_100098725 | Ga0070663_1000987252 | 280 |
| 1413 | 3300005455 | Ga0070663_100205742 | Ga0070663_1002057422 | 280 |
| 1414 | 3300005457 | Ga0070662_100000337 | Ga0070662_10000033716 | 280 |
| 1415 | 3300005457 | Ga0070662_100173389 | Ga0070662_1001733892 | 280 |
| 1416 | 3300005459 | Ga0068867_100000661 | Ga0068867_10000066110 | 280 |
| 1417 | 3300005459 | Ga0068867_100097947 | Ga0068867_1000979473 | 280 |
| 1418 | 3300005539 | Ga0068853_100009596 | Ga0068853_1000095963 | 280 |
| 1419 | 3300005543 | Ga0070672_100000476 | Ga0070672_10000047611 | 280 |
| 1420 | 3300005546 | Ga0070696_100006623 | Ga0070696_1000066234 | 280 |
| 1421 | 3300005547 | Ga0070693_100132027 | Ga0070693_1001320272 | 280 |
| 1422 | 3300005548 | Ga0070665_100001860 | Ga0070665_10000186010 | 280 |
| 1423 | 3300005563 | Ga0068855_100001289 | Ga0068855_10000128921 | 280 |
| 1424 | 3300005564 | Ga0070664_100010937 | Ga0070664_1000109375 | 280 |
| 1425 | 3300005564 | Ga0070664_100012159 | Ga0070664_1000121592 | 280 |
| 1426 | 3300005577 | Ga0068857_100001000 | Ga0068857_10000100021 | 280 |
| 1427 | 3300005577 | Ga0068857_100076319 | Ga0068857_1000763194 | 280 |
| 1428 | 3300005578 | Ga0068854_100000173 | Ga0068854_10000017321 | 280 |
| 1429 | 3300005616 | Ga0068852_100001638 | Ga0068852_1000016384 | 280 |
| 1430 | 3300005616 | Ga0068852_100012767 | Ga0068852_1000127673 | 280 |
| 1431 | 3300005617 | Ga0068859_100001231 | Ga0068859_10000123127 | 280 |
| 1432 | 3300005617 | Ga0068859_100011216 | Ga0068859_1000112165 | 280 |
| 1433 | 3300005618 | Ga0068864_100000953 | Ga0068864_1000009532 | 280 |
| 1434 | 3300005618 | Ga0068864_100001870 | Ga0068864_10000187016 | 280 |
| 1435 | 3300005718 | Ga0068866_10004891 | Ga0068866_100048912 | 280 |
| 1436 | 3300005834 | Ga0068851_10001580 | Ga0068851_100015808 | 280 |
| 1437 | 3300005841 | Ga0068863_100001401 | Ga0068863_10000140120 | 280 |
| 1438 | 3300005841 | Ga0068863_100335835 | Ga0068863_1003358352 | 280 |
| 1439 | 3300005842 | Ga0068858_100000561 | Ga0068858_10000056136 | 280 |
| 1440 | 3300005842 | Ga0068858_100001052 | Ga0068858_10000105221 | 280 |
| 1441 | 3300005843 | Ga0068860_100005038 | Ga0068860_1000050383 | 280 |
| 1442 | 3300005843 | Ga0068860_100005142 | Ga0068860_10000514213 | 280 |
| 1443 | 3300005843 | Ga0068860_100099784 | Ga0068860_1000997842 | 280 |
| 1444 | 3300005844 | Ga0068862_100023271 | Ga0068862_1000232714 | 280 |
| 1445 | 3300005844 | Ga0068862_100038768 | Ga0068862_1000387684 | 280 |
| 1446 | 3300006358 | Ga0068871_100164782 | Ga0068871_1001647822 | 280 |
| 1447 | 3300006881 | Ga0068865_100000263 | Ga0068865_10000026313 | 280 |
| 1448 | 3300006931 | Ga0097620_100001231 | Ga0097620_1000012314 | 280 |
| 1449 | 3300006931 | Ga0097620_100011216 | Ga0097620_1000112165 | 280 |
| 1450 | 3300009098 | Ga0105245_10000170 | Ga0105245_1000017067 | 280 |
| 1451 | 3300009177 | Ga0105248_10002857 | Ga0105248_1000285711 | 280 |
| 1452 | 3300009551 | Ga0105238_10232108 | Ga0105238_102321082 | 280 |
| 1453 | 3300009551 | Ga0105238_10402207 | Ga0105238_104022072 | 280 |
| 1454 | 3300009553 | Ga0105249_10408541 | Ga0105249_104085412 | 280 |
| 1455 | 3300011119 | Ga0105246_10007418 | Ga0105246_100074184 | 280 |
| 1456 | 3300013102 | Ga0157371_10002538 | Ga0157371_1000253812 | 280 |
| 1457 | 3300013297 | Ga0157378_10000540 | Ga0157378_100005404 | 280 |
| 1458 | 3300013307 | Ga0157372_10071189 | Ga0157372_100711894 | 280 |
| 1459 | 3300013308 | Ga0157375_10266450 | Ga0157375_102664502 | 280 |
| 1460 | 3300025315 | Ga0207697_10000072 | Ga0207697_1000007227 | 280 |
| 1461 | 3300025321 | Ga0207656_10002678 | Ga0207656_100026784 | 280 |
| 1462 | 3300025901 | Ga0207688_10000289 | Ga0207688_1000028919 | 280 |
| 1463 | 3300025903 | Ga0207680_10030887 | Ga0207680_100308872 | 280 |
| 1464 | 3300025904 | Ga0207647_10000629 | Ga0207647_1000062915 | 280 |
| 1465 | 3300025907 | Ga0207645_10014382 | Ga0207645_100143824 | 280 |
| 1466 | 3300025907 | Ga0207645_10046819 | Ga0207645_100468194 | 280 |
| 1467 | 3300025908 | Ga0207643_10105795 | Ga0207643_101057952 | 280 |
| 1468 | 3300025919 | Ga0207657_10009745 | Ga0207657_100097452 | 280 |
| 1469 | 3300025920 | Ga0207649_10060123 | Ga0207649_100601233 | 280 |
| 1470 | 3300025923 | Ga0207681_10006421 | Ga0207681_100064213 | 280 |
| 1471 | 3300025923 | Ga0207681_10093509 | Ga0207681_100935093 | 280 |
| 1472 | 3300025923 | Ga0207681_10193313 | Ga0207681_101933132 | 280 |
| 1473 | 3300025923 | Ga0207681_10318909 | Ga0207681_103189092 | 280 |
| 1474 | 3300025924 | Ga0207694_10294957 | Ga0207694_102949572 | 280 |
| 1475 | 3300025925 | Ga0207650_10058555 | Ga0207650_100585554 | 280 |
| 1476 | 3300025926 | Ga0207659_10004404 | Ga0207659_100044043 | 280 |
| 1477 | 3300025927 | Ga0207687_10001079 | Ga0207687_100010794 | 280 |
| 1478 | 3300025931 | Ga0207644_10024915 | Ga0207644_100249153 | 280 |
| 1479 | 3300025931 | Ga0207644_10083939 | Ga0207644_100839393 | 280 |
| 1480 | 3300025932 | Ga0207690_10003153 | Ga0207690_100031535 | 280 |
| 1481 | 3300025933 | Ga0207706_10000816 | Ga0207706_1000081621 | 280 |
| 1482 | 3300025933 | Ga0207706_10200573 | Ga0207706_102005732 | 280 |
| 1483 | 3300025938 | Ga0207704_10000514 | Ga0207704_1000051413 | 280 |
| 1484 | 3300025940 | Ga0207691_10001562 | Ga0207691_1000156211 | 280 |
| 1485 | 3300025941 | Ga0207711_10000105 | Ga0207711_1000010597 | 280 |
| 1486 | 3300025941 | Ga0207711_10002153 | Ga0207711_100021539 | 280 |
| 1487 | 3300025942 | Ga0207689_10000051 | Ga0207689_1000005121 | 280 |
| 1488 | 3300025942 | Ga0207689_10016638 | Ga0207689_100166382 | 280 |
| 1489 | 3300025945 | Ga0207679_10007340 | Ga0207679_100073404 | 280 |
| 1490 | 3300025949 | Ga0207667_10013680 | Ga0207667_100136804 | 280 |
| 1491 | 3300025960 | Ga0207651_10038903 | Ga0207651_100389034 | 280 |
| 1492 | 3300025961 | Ga0207712_10321370 | Ga0207712_103213702 | 280 |
| 1493 | 3300025972 | Ga0207668_10072528 | Ga0207668_100725283 | 280 |
| 1494 | 3300025981 | Ga0207640_10003018 | Ga0207640_100030184 | 280 |
| 1495 | 3300025981 | Ga0207640_10269579 | Ga0207640_102695792 | 280 |
| 1496 | 3300025986 | Ga0207658_10001832 | Ga0207658_1000183213 | 280 |
| 1497 | 3300025986 | Ga0207658_10004192 | Ga0207658_100041924 | 280 |
| 1498 | 3300025986 | Ga0207658_10031300 | Ga0207658_100313004 | 280 |
| 1499 | 3300026023 | Ga0207677_10005957 | Ga0207677_100059575 | 280 |
| 1500 | 3300026023 | Ga0207677_10228931 | Ga0207677_102289312 | 280 |
| 1501 | 3300026035 | Ga0207703_10002918 | Ga0207703_100029185 | 280 |
| 1502 | 3300026035 | Ga0207703_10006321 | Ga0207703_100063212 | 280 |
| 1503 | 3300026041 | Ga0207639_10002396 | Ga0207639_1000239611 | 280 |
| 1504 | 3300026041 | Ga0207639_10027199 | Ga0207639_100271993 | 280 |
| 1505 | 3300026067 | Ga0207678_10110638 | Ga0207678_101106382 | 280 |
| 1506 | 3300026078 | Ga0207702_10157399 | Ga0207702_101573992 | 280 |
| 1507 | 3300026088 | Ga0207641_10000205 | Ga0207641_1000020580 | 280 |
| 1508 | 3300026088 | Ga0207641_10002378 | Ga0207641_1000237813 | 280 |
| 1509 | 3300026088 | Ga0207641_10057442 | Ga0207641_100574422 | 280 |
| 1510 | 3300026089 | Ga0207648_10000221 | Ga0207648_1000022121 | 280 |
| 1511 | 3300026089 | Ga0207648_10131563 | Ga0207648_101315632 | 280 |
| 1512 | 3300026095 | Ga0207676_10000898 | Ga0207676_1000089814 | 280 |
| 1513 | 3300026095 | Ga0207676_10130939 | Ga0207676_101309392 | 280 |
| 1514 | 3300026095 | Ga0207676_10241236 | Ga0207676_102412362 | 280 |
| 1515 | 3300026116 | Ga0207674_10001223 | Ga0207674_1000122318 | 280 |
| 1516 | 3300026116 | Ga0207674_10021077 | Ga0207674_100210771 | 280 |
| 1517 | 3300026118 | Ga0207675_100063616 | Ga0207675_1000636162 | 280 |
| 1518 | 3300026142 | Ga0207698_10014565 | Ga0207698_100145654 | 280 |
| 1519 | 3300026142 | Ga0207698_10018365 | Ga0207698_100183654 | 280 |
| 1520 | 3300028379 | Ga0268266_10000200 | Ga0268266_1000020062 | 280 |
| 1521 | 3300028380 | Ga0268265_10002659 | Ga0268265_100026594 | 280 |
| 1522 | 3300028380 | Ga0268265_10007828 | Ga0268265_100078289 | 280 |
| 1523 | 3300028380 | Ga0268265_10031822 | Ga0268265_100318223 | 280 |
| 1524 | 3300028381 | Ga0268264_10001019 | Ga0268264_1000101916 | 280 |
| 1525 | 3300028381 | Ga0268264_10006551 | Ga0268264_100065514 | 280 |
| 1526 | 3300028381 | Ga0268264_10131845 | Ga0268264_101318452 | 280 |
| 1527 | 3300046616 | Ga0495668_0012789 | Ga0495668_0012789_801_1679 | 280 |
| 1528 | 3300053134 | Ga0500658_0000032 | Ga0500658_0000032_11090_11968 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s6h-assembly1.cif.gz_A | crystal structure of the dna binding domain of the chromosome-partitioning protein parb complexed to the centromeric pars site | 0.9274 | 107 | 211 |
| 6t1f-assembly2.cif.gz_D | crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site | 0.911 | 24 | 212 |
| 6y93-assembly1.cif.gz_A | crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) | 0.9035 | 118 | 218 |
| 6t1f-assembly2.cif.gz_D | crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site | 0.8973 | 24 | 212 |
| 6y93-assembly1.cif.gz_B | crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) | 0.8969 | 109 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vz0A01 | Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; | 0.987 | 44 | 98 | 3.90.1530.30 |
| af_P9WIJ9_142_255_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9609 | 109 | 209 | 1.10.10.2830 |
| af_Q2FUQ5_107_218_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9576 | 101 | 209 | 1.10.10.2830 |
| 1vz0D02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.936 | 101 | 213 | 1.10.10.2830 |
| af_Q2FUQ5_43_106_3.90.1530.30 | Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; | 0.9345 | 37 | 98 | 3.90.1530.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T4RMR3-F1-model_v4 | deleted | 0.9491 | 107 | 215 |
|
| AF-A0A523DAK4-F1-model_v4 | ParB/RepB/Spo0J family partition protein | 0.9479 | 21 | 212 |
GO:0003677
GO:0005694 GO:0007059 |
| AF-A0A7C4ZXV3-F1-model_v4 | ParB/RepB/Spo0J family partition protein | 0.9434 | 99 | 222 |
GO:0003677
GO:0005694 GO:0007059 |
| AF-A0A357Z1L7-F1-model_v4 | Nucleoid occlusion protein | 0.9416 | 23 | 120 |
GO:0003677
GO:0005694 GO:0007059 |
| AF-A0A375HEQ9-F1-model_v4 | Partitioning protein | 0.9372 | 23 | 209 |
GO:0005694
GO:0007059 GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar