F494582

General Info

Members Datasets Scaffolds Average Seq Length
1528 595 1433 292

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10002383|Ga0105240_1000238315
Length 358
Sequence MSAILSKSANENVMEKSVTAAAKTTLSEKPKRGLGRGLDALFGDAEQKPAIRNEKIEALTSEISSTVSGLSSQGPRTLPITALIPTPFQPRKTFAVEDMTALVNSIRMHGILQPLIVRAAPGQDSKYEIIAGERRWRAAQQAQLHEVPVIIKSLDDRQTLEIALIENIQRADLTPIEEAEGYQRLMTEFGHTQEELSNIVGKSRSHMSNIMRLLQLPERVRDMVARGDLPAGAARILVGLDKAETIAQHALRKRMSVRQLERFVARLKRPPTLSPLKRMTPQKLNDRKRAKRDGGFSDIDYPMPKDADVLALEAEMGALLGLKIDIQSATDGSGVLGVYFSSLDQLDELLQKMAGVKG

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
5 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
6 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
7 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
8 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
9 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
10 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
11 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
12 2643221559 Lysobacter sp. Root559 Isolate Unclassified
13 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
14 2643221586 Lysobacter sp. Root667 Isolate Unclassified
15 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
16 2643221612 Lysobacter sp. Root76 Isolate Unclassified
17 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
18 2643221719 Rhizobium sp. Root274 Isolate Unclassified
19 2643221727 Lysobacter sp. Root96 Isolate Unclassified
20 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
21 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
22 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
23 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
24 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
25 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
26 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
27 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
28 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
29 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
30 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
31 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
32 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
33 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
34 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
35 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
36 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
37 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
38 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
39 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
40 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
41 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
42 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
43 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
44 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
45 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
46 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
47 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
48 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
49 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
50 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
51 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
52 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
53 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
54 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
55 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
56 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
57 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
58 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
59 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
60 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
61 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
62 2919513703 Luteimonas sp. 3794 Isolate Unclassified
63 2919675420 Luteimonas terrae 4099 Isolate Unclassified
64 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
65 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
66 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
67 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
68 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
69 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
70 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
71 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
72 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
73 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
74 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
75 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
76 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
77 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
78 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
79 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
80 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
81 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
82 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
83 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
84 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
85 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
86 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
87 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
88 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
89 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
90 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
91 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
92 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
93 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
94 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
95 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
96 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
97 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
98 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
99 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
100 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
101 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
102 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
103 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
104 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
105 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
106 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
107 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
108 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
109 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
110 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
111 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
112 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
113 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
114 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
115 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
116 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
117 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
118 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
119 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
120 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
121 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
122 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
123 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
124 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
125 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
126 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
127 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
128 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
129 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
130 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
131 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
132 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
133 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
134 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
135 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
136 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
137 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
138 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
139 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
140 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
141 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
142 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
143 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
144 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
145 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
146 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
147 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
148 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
149 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
150 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
151 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
152 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
153 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
154 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
157 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
158 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
159 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
160 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
161 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
162 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
163 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
164 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
165 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
166 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
167 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
168 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
169 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
170 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
171 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
172 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
173 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
174 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
175 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
176 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
177 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
178 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
179 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
180 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
181 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
182 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
184 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
185 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
186 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
187 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
188 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
189 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
190 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
191 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
192 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
193 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
194 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
195 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
196 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
197 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
198 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
199 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
200 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
201 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
202 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
203 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
204 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
205 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
206 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
207 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
208 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
209 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
210 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
211 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
212 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
213 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
214 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
215 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
216 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
217 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
218 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
219 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
220 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
221 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
222 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
223 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
224 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
225 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
226 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
227 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
228 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
229 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
230 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
231 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
232 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
233 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
234 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
235 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
236 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
237 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
238 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
241 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
244 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
246 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
249 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
315 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
322 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
323 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
327 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
328 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
329 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
330 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
331 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
332 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
333 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
334 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
335 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
336 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
337 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
338 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
339 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
340 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
341 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
342 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
343 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
344 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
345 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
346 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
347 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
348 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
349 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
350 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
351 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
352 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
353 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
354 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
355 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
356 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
357 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
358 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
359 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
360 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
361 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
362 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
363 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
365 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
366 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
367 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
368 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
369 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
370 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
371 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
372 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
373 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
374 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
375 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
376 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
377 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
378 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
379 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
380 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
381 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
382 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
383 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
384 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
385 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
386 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
387 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
388 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
389 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
390 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
391 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
392 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
393 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
394 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
395 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
396 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
397 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
398 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
399 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
400 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
401 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
402 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
403 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
404 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
405 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
406 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
407 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
408 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
409 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
410 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
411 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
412 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
413 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
414 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
415 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
416 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
417 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
418 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
419 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
420 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
421 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
422 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
423 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
424 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
425 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
426 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
427 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
428 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
429 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
430 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
431 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
432 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
433 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
434 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
435 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
436 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
437 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
438 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
439 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
440 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
441 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
442 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
443 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
444 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
445 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
446 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
447 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
448 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
449 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
450 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
451 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
452 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
453 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
454 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
455 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
459 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
460 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
461 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
462 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
463 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
464 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
465 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
466 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
467 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
468 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
469 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
470 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
471 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
472 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
473 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
474 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
475 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
476 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
477 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
478 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
479 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
480 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
481 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
482 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
483 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
484 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
485 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
486 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
487 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
488 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
489 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
490 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
491 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
492 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
493 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
494 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
495 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
496 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
497 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
498 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
499 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
500 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
501 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
502 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
503 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
504 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
505 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
506 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
520 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
521 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
522 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
523 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
524 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
525 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
526 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
527 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
528 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
529 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
530 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
531 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
532 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
533 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
534 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
535 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
537 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
538 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
539 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
540 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
541 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
542 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
543 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
544 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
545 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
546 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
547 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
548 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
549 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
550 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
551 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
552 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
553 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
554 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
555 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
556 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
557 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
558 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
559 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
560 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
561 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
562 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
563 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
564 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
565 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
566 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
567 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
568 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
569 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
570 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
571 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
572 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
573 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
574 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
575 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
576 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
577 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
578 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
579 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
580 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
581 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
582 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
583 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
584 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
585 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
586 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
587 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
588 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
589 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
590 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
591 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
592 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
593 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
594 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
595 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.59
Metatranscriptomes 0.2
Isolates 6.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 8.9
Nodule 1.64
Rhizoplane 3.27
Rhizosphere 76.9
Stem 0
Stem Tuber 0
Unclassified 9.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006249 3300001979 Bacteria 4954
2 JGI24740J21852_10035217 3300001979 Bacteria 1567
3 JGI24739J22299_10004554 3300001989 Bacteria 5300
4 JGI24737J22298_10000027 3300001990 Bacteria 43503
5 JGI24743J22301_10018467 3300001991 Bacteria 1318
6 JGI24735J21928_10011843 3300002067 Bacteria 2760
7 JGI24745J21846_1008512 3300002073 Bacteria 1157
8 JGI24738J21930_10000290 3300002075 Bacteria 13746
9 JGI25150J39212_1000067 3300002774 Bacteria 63491
10 JGI25151J46595_10000088 3300003187 Bacteria 124209
11 JGI25151J46595_10023969 3300003187 Bacteria 2504
12 JGI25153J46596_10000125 3300003215 Bacteria 86065
13 rootH2_10006857 3300003320 Bacteria 5272
14 rootH2_10118832 3300003320 Bacteria 2220
15 rootH2_10196566 3300003320 Bacteria 1809
16 Ga0055526_1001485 3300003771 Bacteria 16637
17 Ga0055537_1000989 3300003773 Bacteria 12883
18 Ga0055524_1000399 3300003775 Bacteria 37137
19 Ga0055524_1019185 3300003775 Bacteria 2346
20 Ga0055524_1032968 3300003775 Bacteria 1458
21 Ga0055536_1015229 3300003781 Bacteria 2646
22 Ga0055536_1026679 3300003781 Bacteria 1615
23 Ga0055534_1000307 3300003784 Bacteria 32970
24 Ga0055534_1011959 3300003784 Bacteria 1740
25 Ga0055528_1000402 3300003790 Bacteria 35107
26 Ga0055530_10000735 3300003791 Bacteria 27312
27 Ga0055530_10014468 3300003791 Bacteria 2626
28 Ga0055531_10012552 3300003794 Bacteria 3975
29 Ga0055531_10016237 3300003794 Bacteria 3223
30 Ga0055531_10043335 3300003794 Bacteria 1274
31 Ga0058692_1000003 3300003856 Bacteria 435295
32 Ga0058692_1000004 3300003856 Bacteria 431119
33 Ga0065165_1020124 3300005262 Bacteria 2361
34 Ga0065165_1021928 3300005262 Bacteria 2205
35 Ga0065703_1000145 3300005272 Bacteria 90784
36 Ga0070658_10020917 3300005327 Bacteria 5241
37 Ga0070658_10024326 3300005327 Bacteria 4859
38 Ga0070658_10044630 3300005327 Bacteria 3583
39 Ga0070658_10101204 3300005327 Bacteria 2382
40 Ga0070658_10308606 3300005327 Bacteria 1350
41 Ga0070676_10021382 3300005328 Bacteria 3623
42 Ga0070676_10041747 3300005328 Bacteria 2661
43 Ga0070683_100000479 3300005329 Bacteria 28115
44 Ga0070690_100006566 3300005330 Bacteria 6605
45 Ga0070670_100000002 3300005331 Bacteria 568775
46 Ga0070670_100000004 3300005331 Bacteria 392110
47 Ga0070670_100000594 3300005331 Bacteria 28632
48 Ga0070670_100034634 3300005331 Bacteria 4345
49 Ga0070670_100040649 3300005331 Bacteria 3997
50 Ga0070670_100045694 3300005331 Bacteria 3765
51 Ga0070677_10031905 3300005333 Bacteria 2017
52 Ga0070677_10057510 3300005333 Bacteria 1594
53 Ga0068869_100000085 3300005334 Bacteria 42599
54 Ga0068869_100016059 3300005334 Bacteria 5040
55 Ga0068869_100130623 3300005334 Bacteria 1930
56 Ga0070666_10000196 3300005335 Bacteria 41189
57 Ga0070666_10022684 3300005335 Bacteria 4079
58 Ga0070666_10086933 3300005335 Bacteria 2142
59 Ga0070666_10153050 3300005335 Bacteria 1609
60 Ga0070680_100001064 3300005336 Bacteria 19679
61 Ga0070680_100059100 3300005336 Bacteria 3136
62 Ga0070680_100069759 3300005336 Bacteria 2886
63 Ga0068868_100020324 3300005338 Bacteria 4986
64 Ga0068868_100245841 3300005338 Bacteria 1504
65 Ga0068868_100655641 3300005338 Bacteria 935
66 Ga0070660_100000881 3300005339 Bacteria 20070
67 Ga0070660_100002726 3300005339 Bacteria 12131
68 Ga0070660_100036408 3300005339 Bacteria 3728
69 Ga0070660_100173126 3300005339 Bacteria 1744
70 Ga0070691_10000339 3300005341 Bacteria 16574
71 Ga0070661_100000367 3300005344 Bacteria 35651
72 Ga0070661_100004478 3300005344 Bacteria 9635
73 Ga0070661_100087461 3300005344 Bacteria 2305
74 Ga0070692_10010249 3300005345 Bacteria 4258
75 Ga0070692_10019127 3300005345 Bacteria 3303
76 Ga0070668_100001643 3300005347 Bacteria 16208
77 Ga0070668_100002624 3300005347 Bacteria 13203
78 Ga0070668_100002646 3300005347 Bacteria 13158
79 Ga0070668_100007344 3300005347 Bacteria 8172
80 Ga0070668_100029834 3300005347 Bacteria 4143
81 Ga0070668_100037808 3300005347 Bacteria 3688
82 Ga0070668_100045394 3300005347 Bacteria 3371
83 Ga0070668_100059844 3300005347 Bacteria 2949
84 Ga0070668_100089906 3300005347 Bacteria 2419
85 Ga0070668_100550602 3300005347 Bacteria 1004
86 Ga0070669_100000693 3300005353 Bacteria 24733
87 Ga0070669_100012016 3300005353 Bacteria 6144
88 Ga0070669_100085027 3300005353 Bacteria 2362
89 Ga0070669_100096073 3300005353 Bacteria 2229
90 Ga0070669_100128352 3300005353 Bacteria 1942
91 Ga0070669_100344635 3300005353 Bacteria 1208
92 Ga0070669_100382442 3300005353 Bacteria 1148
93 Ga0070675_100000494 3300005354 Bacteria 26992
94 Ga0070675_100007745 3300005354 Bacteria 8312
95 Ga0070671_100000094 3300005355 Bacteria 55801
96 Ga0070671_100001151 3300005355 Bacteria 19661
97 Ga0070671_100018580 3300005355 Bacteria 5648
98 Ga0070671_100036951 3300005355 Bacteria 4050
99 Ga0070671_100037740 3300005355 Bacteria 4008
100 Ga0070671_100241098 3300005355 Bacteria 1535
101 Ga0070673_100000450 3300005364 Bacteria 21787
102 Ga0070673_100001037 3300005364 Bacteria 15753
103 Ga0070673_100415190 3300005364 Bacteria 1206
104 Ga0070673_100583722 3300005364 Bacteria 1018
105 Ga0070659_100000525 3300005366 Bacteria 28016
106 Ga0070659_100005172 3300005366 Bacteria 9360
107 Ga0070659_100008001 3300005366 Bacteria 7708
108 Ga0070659_100101906 3300005366 Bacteria 2311
109 Ga0070659_100179570 3300005366 Bacteria 1737
110 Ga0070667_100000018 3300005367 Bacteria 226033
111 Ga0070667_100000105 3300005367 Bacteria 106633
112 Ga0070667_100017242 3300005367 Bacteria 5982
113 Ga0070667_100042224 3300005367 Bacteria 3826
114 Ga0070667_100070257 3300005367 Bacteria 2980
115 Ga0070667_100077172 3300005367 Bacteria 2845
116 Ga0070667_100371318 3300005367 Bacteria 1298
117 Ga0070703_10023665 3300005406 Bacteria 1810
118 Ga0070709_10000408 3300005434 Bacteria 26266
119 Ga0070709_10076039 3300005434 Bacteria 2180
120 Ga0070714_100001453 3300005435 Bacteria 17267
121 Ga0070714_100029776 3300005435 Bacteria 4540
122 Ga0070714_100093073 3300005435 Bacteria 2643
123 Ga0070714_100120992 3300005435 Bacteria 2329
124 Ga0070714_100140544 3300005435 Bacteria 2167
125 Ga0070714_100152309 3300005435 Bacteria 2085
126 Ga0070714_100315143 3300005435 Bacteria 1461
127 Ga0070713_100000333 3300005436 Bacteria 30842
128 Ga0070713_100065121 3300005436 Bacteria 3060
129 Ga0070713_100343897 3300005436 Bacteria 1383
130 Ga0070713_100439166 3300005436 Bacteria 1224
131 Ga0070710_10056604 3300005437 Bacteria 2219
132 Ga0070701_10003150 3300005438 Bacteria 6474
133 Ga0070711_100000012 3300005439 Bacteria 162760
134 Ga0070711_100020963 3300005439 Bacteria 4221
135 Ga0070711_100040037 3300005439 Bacteria 3159
136 Ga0070705_100010706 3300005440 Bacteria 4600
137 Ga0070694_100014006 3300005444 Bacteria 5015
138 Ga0070694_100073799 3300005444 Bacteria 2357
139 Ga0070708_100038486 3300005445 Bacteria 4178
140 Ga0070708_100102582 3300005445 Bacteria 2621
141 Ga0070708_100320058 3300005445 Bacteria 1461
142 Ga0070663_100012890 3300005455 Bacteria 5307
143 Ga0070663_100016335 3300005455 Bacteria 4819
144 Ga0070663_100033858 3300005455 Bacteria 3533
145 Ga0070663_100090888 3300005455 Bacteria 2261
146 Ga0070663_100098725 3300005455 Bacteria 2176
147 Ga0070663_100175187 3300005455 Bacteria 1660
148 Ga0070663_100205742 3300005455 Bacteria 1538
149 Ga0070663_100533523 3300005455 Bacteria 979
150 Ga0070678_100001072 3300005456 Bacteria 14312
151 Ga0070662_100000337 3300005457 Bacteria 28132
152 Ga0070662_100006493 3300005457 Bacteria 7543
153 Ga0070662_100173389 3300005457 Bacteria 1695
154 Ga0070681_10000002 3300005458 Bacteria 821814
155 Ga0070681_10050441 3300005458 Bacteria 4152
156 Ga0070681_10081458 3300005458 Bacteria 3192
157 Ga0070681_10095301 3300005458 Bacteria 2925
158 Ga0070681_10331300 3300005458 Bacteria 1432
159 Ga0068867_100000661 3300005459 Bacteria 22832
160 Ga0068867_100013925 3300005459 Bacteria 5693
161 Ga0068867_100018820 3300005459 Bacteria 4913
162 Ga0068867_100097947 3300005459 Bacteria 2235
163 Ga0068867_100196206 3300005459 Bacteria 1614
164 Ga0070685_10000001 3300005466 Bacteria 349867
165 Ga0070707_100132587 3300005468 Bacteria 2423
166 Ga0070707_100162041 3300005468 Bacteria 2179
167 Ga0070699_100325758 3300005518 Bacteria 1381
168 Ga0070679_100000393 3300005530 Bacteria 37212
169 Ga0070679_100053554 3300005530 Bacteria 4016
170 Ga0070679_100131470 3300005530 Bacteria 2484
171 Ga0070679_100427856 3300005530 Bacteria 1269
172 Ga0070679_100497223 3300005530 Bacteria 1163
173 Ga0070684_100005553 3300005535 Bacteria 9679
174 Ga0070684_100037546 3300005535 Bacteria 4156
175 Ga0070697_100453361 3300005536 Bacteria 1117
176 Ga0068853_100001563 3300005539 Bacteria 16668
177 Ga0068853_100009596 3300005539 Bacteria 7798
178 Ga0068853_100018318 3300005539 Bacteria 5794
179 Ga0068853_100022918 3300005539 Bacteria 5221
180 Ga0068853_100151898 3300005539 Bacteria 2085
181 Ga0068853_100174136 3300005539 Bacteria 1948
182 Ga0068853_100262942 3300005539 Bacteria 1587
183 Ga0070672_100000296 3300005543 Bacteria 28119
184 Ga0070672_100000476 3300005543 Bacteria 23318
185 Ga0070672_100026242 3300005543 Bacteria 4332
186 Ga0070672_100050260 3300005543 Bacteria 3247
187 Ga0070672_100071046 3300005543 Bacteria 2768
188 Ga0070696_100006623 3300005546 Bacteria 7738
189 Ga0070693_100012809 3300005547 Bacteria 4255
190 Ga0070693_100132027 3300005547 Bacteria 1562
191 Ga0070665_100000198 3300005548 Bacteria 105999
192 Ga0070665_100001194 3300005548 Bacteria 31673
193 Ga0070665_100001860 3300005548 Bacteria 23948
194 Ga0070665_100017715 3300005548 Bacteria 7152
195 Ga0070665_100065392 3300005548 Bacteria 3648
196 Ga0068855_100001289 3300005563 Bacteria 31088
197 Ga0068855_100005557 3300005563 Bacteria 15384
198 Ga0068855_100023996 3300005563 Bacteria 7301
199 Ga0068855_100038242 3300005563 Bacteria 5702
200 Ga0068855_100166484 3300005563 Bacteria 2498
201 Ga0068855_100184752 3300005563 Bacteria 2355
202 Ga0068855_100191262 3300005563 Bacteria 2308
203 Ga0068855_100549981 3300005563 Bacteria 1250
204 Ga0068855_100550001 3300005563 Bacteria 1250
205 Ga0068855_100776242 3300005563 Bacteria 1020
206 Ga0070664_100000600 3300005564 Bacteria 27546
207 Ga0070664_100001724 3300005564 Bacteria 17517
208 Ga0070664_100010937 3300005564 Bacteria 7359
209 Ga0070664_100012159 3300005564 Bacteria 6993
210 Ga0070664_100202865 3300005564 Bacteria 1770
211 Ga0070664_100350159 3300005564 Bacteria 1343
212 Ga0068857_100001000 3300005577 Bacteria 21722
213 Ga0068857_100002588 3300005577 Bacteria 14836
214 Ga0068857_100005605 3300005577 Bacteria 10728
215 Ga0068857_100011431 3300005577 Bacteria 7724
216 Ga0068857_100075772 3300005577 Bacteria 3000
217 Ga0068857_100076319 3300005577 Bacteria 2988
218 Ga0068857_100094324 3300005577 Bacteria 2680
219 Ga0068857_100128607 3300005577 Bacteria 2283
220 Ga0068854_100000173 3300005578 Bacteria 43694
221 Ga0068854_100007111 3300005578 Bacteria 7146
222 Ga0068854_100026474 3300005578 Bacteria 3987
223 Ga0068854_100075177 3300005578 Bacteria 2480
224 Ga0068854_100173356 3300005578 Unclassified 1680
225 Ga0068854_100220678 3300005578 Bacteria 1500
226 Ga0068854_100310618 3300005578 Bacteria 1278
227 Ga0068856_100000601 3300005614 Bacteria 39402
228 Ga0068856_100001518 3300005614 Bacteria 24335
229 Ga0068856_100230290 3300005614 Bacteria 1868
230 Ga0070702_100107149 3300005615 Bacteria 1725
231 Ga0068852_100001015 3300005616 Bacteria 18527
232 Ga0068852_100001638 3300005616 Bacteria 15290
233 Ga0068852_100001646 3300005616 Bacteria 15247
234 Ga0068852_100012767 3300005616 Bacteria 6397
235 Ga0068852_100016058 3300005616 Bacteria 5830
236 Ga0068852_100039171 3300005616 Bacteria 3989
237 Ga0068852_100579662 3300005616 Bacteria 1124
238 Ga0068859_100001231 3300005617 Bacteria 26157
239 Ga0068859_100011216 3300005617 Bacteria 9013
240 Ga0068859_100019995 3300005617 Bacteria 6723
241 Ga0068859_100067314 3300005617 Bacteria 3616
242 Ga0068859_100084896 3300005617 Bacteria 3211
243 Ga0068859_100188938 3300005617 Bacteria 2144
244 Ga0068864_100000003 3300005618 Bacteria 568775
245 Ga0068864_100000082 3300005618 Bacteria 101182
246 Ga0068864_100000106 3300005618 Bacteria 81202
247 Ga0068864_100000953 3300005618 Bacteria 24235
248 Ga0068864_100001870 3300005618 Bacteria 17284
249 Ga0068864_100017157 3300005618 Bacteria 6038
250 Ga0068866_10004891 3300005718 Bacteria 5504
251 Ga0068861_100007289 3300005719 Bacteria 7580
252 Ga0068861_100275365 3300005719 Bacteria 1447
253 Ga0068851_10001580 3300005834 Bacteria 9997
254 Ga0068851_10031422 3300005834 Bacteria 2637
255 Ga0068870_10099198 3300005840 Bacteria 1643
256 Ga0068863_100000079 3300005841 Bacteria 107383
257 Ga0068863_100000560 3300005841 Bacteria 37696
258 Ga0068863_100001401 3300005841 Bacteria 23908
259 Ga0068863_100003508 3300005841 Bacteria 15478
260 Ga0068863_100020113 3300005841 Bacteria 6386
261 Ga0068863_100059457 3300005841 Bacteria 3615
262 Ga0068863_100335835 3300005841 Bacteria 1469
263 Ga0068863_100440106 3300005841 Bacteria 1278
264 Ga0068858_100000006 3300005842 Bacteria 256011
265 Ga0068858_100000561 3300005842 Bacteria 38777
266 Ga0068858_100001052 3300005842 Bacteria 28522
267 Ga0068858_100031660 3300005842 Bacteria 4914
268 Ga0068858_100039178 3300005842 Bacteria 4395
269 Ga0068858_100060498 3300005842 Bacteria 3501
270 Ga0068858_100164293 3300005842 Bacteria 2091
271 Ga0068858_100797493 3300005842 Bacteria 921
272 Ga0068860_100000077 3300005843 Bacteria 171297
273 Ga0068860_100005038 3300005843 Bacteria 13446
274 Ga0068860_100005142 3300005843 Bacteria 13302
275 Ga0068860_100005872 3300005843 Bacteria 12356
276 Ga0068860_100017042 3300005843 Bacteria 7081
277 Ga0068860_100020438 3300005843 Bacteria 6412
278 Ga0068860_100099784 3300005843 Bacteria 2769
279 Ga0068860_100212890 3300005843 Bacteria 1875
280 Ga0068860_100321734 3300005843 Bacteria 1518
281 Ga0068860_100474456 3300005843 Bacteria 1246
282 Ga0068862_100000183 3300005844 Bacteria 68758
283 Ga0068862_100006226 3300005844 Bacteria 9935
284 Ga0068862_100022521 3300005844 Bacteria 5271
285 Ga0068862_100023271 3300005844 Bacteria 5189
286 Ga0068862_100024894 3300005844 Bacteria 5023
287 Ga0068862_100026253 3300005844 Bacteria 4895
288 Ga0068862_100026865 3300005844 Bacteria 4842
289 Ga0068862_100038768 3300005844 Bacteria 4043
290 Ga0068862_100135164 3300005844 Bacteria 2185
291 Ga0068862_100203078 3300005844 Bacteria 1788
292 Ga0081455_10001053 3300005937 Bacteria 34716
293 Ga0081455_10001354 3300005937 Bacteria 30285
294 Ga0081455_10010329 3300005937 Bacteria 9490
295 Ga0081455_10034420 3300005937 Bacteria 4538
296 Ga0081455_10034469 3300005937 Bacteria 4534
297 Ga0081455_10042902 3300005937 Bacteria 3963
298 Ga0081539_10003150 3300005985 Bacteria 20941
299 Ga0081539_10010563 3300005985 Bacteria 7470
300 Ga0081539_10013963 3300005985 Bacteria 5990
301 Ga0070717_10099484 3300006028 Bacteria 2467
302 Ga0075368_10045377 3300006042 Bacteria 1736
303 Ga0075364_10000055 3300006051 Bacteria 41950
304 Ga0075364_10001168 3300006051 Bacteria 14075
305 Ga0075364_10072535 3300006051 Bacteria 2269
306 Ga0075364_10084753 3300006051 Bacteria 2098
307 Ga0070712_100000023 3300006175 Bacteria 80972
308 Ga0070712_100000803 3300006175 Bacteria 18648
309 Ga0070712_100077902 3300006175 Bacteria 2391
310 Ga0070712_100139503 3300006175 Bacteria 1848
311 Ga0070712_100331173 3300006175 Bacteria 1240
312 Ga0075362_10015707 3300006177 Bacteria 3085
313 Ga0075362_10052451 3300006177 Bacteria 1828
314 Ga0075367_10051789 3300006178 Bacteria 2428
315 Ga0075369_10074557 3300006186 Bacteria 1497
316 Ga0097621_100002067 3300006237 Bacteria 13732
317 Ga0097621_100366229 3300006237 Bacteria 1285
318 Ga0075370_10257587 3300006353 Bacteria 1034
319 Ga0068871_100001398 3300006358 Bacteria 16156
320 Ga0068871_100164782 3300006358 Bacteria 1897
321 Ga0075428_100022864 3300006844 Bacteria 6918
322 Ga0075428_100235699 3300006844 Bacteria 1975
323 Ga0075428_100308611 3300006844 Bacteria 1701
324 Ga0075428_100421428 3300006844 Bacteria 1430
325 Ga0075430_100072924 3300006846 Bacteria 2879
326 Ga0075430_100180190 3300006846 Bacteria 1757
327 Ga0075431_100018811 3300006847 Bacteria 7038
328 Ga0075431_100151857 3300006847 Bacteria 2384
329 Ga0075431_100232121 3300006847 Bacteria 1879
330 Ga0075431_100410176 3300006847 Bacteria 1355
331 Ga0075431_100658457 3300006847 Bacteria 1027
332 Ga0075433_10007758 3300006852 Bacteria 8526
333 Ga0075433_10055028 3300006852 Bacteria 3472
334 Ga0075434_100027557 3300006871 Bacteria 5580
335 Ga0075434_100090753 3300006871 Bacteria 3056
336 Ga0075429_100059475 3300006880 Bacteria 3329
337 Ga0068865_100000263 3300006881 Bacteria 28940
338 Ga0068865_100116088 3300006881 Bacteria 1982
339 Ga0075436_100000211 3300006914 Bacteria 36106
340 Ga0075436_100000463 3300006914 Bacteria 26307
341 Ga0075436_100032050 3300006914 Bacteria 3622
342 Ga0075436_100035888 3300006914 Bacteria 3420
343 Ga0097620_100001231 3300006931 Bacteria 26157
344 Ga0097620_100011216 3300006931 Bacteria 9013
345 Ga0097620_100019995 3300006931 Bacteria 6723
346 Ga0097620_100067314 3300006931 Bacteria 3616
347 Ga0097620_100084894 3300006931 Bacteria 3211
348 Ga0097620_100188918 3300006931 Bacteria 2144
349 Ga0079104_1000310 3300006946 Bacteria 61815
350 Ga0075435_100002305 3300007076 Bacteria 12619
351 Ga0075435_100077595 3300007076 Bacteria 2723
352 Ga0075435_100160203 3300007076 Unclassified 1895
353 Ga0099794_10080232 3300007265 Bacteria 1609
354 Ga0105251_10019337 3300009011 Bacteria 3601
355 Ga0105244_10026182 3300009036 Bacteria 3159
356 Ga0105250_10030095 3300009092 Bacteria 2183
357 Ga0105240_10000088 3300009093 Bacteria 186026
358 Ga0105240_10000969 3300009093 Bacteria 51126
359 Ga0105240_10001838 3300009093 Bacteria 35562
360 Ga0105240_10002383 3300009093 Bacteria 30304
361 Ga0105240_10003992 3300009093 Bacteria 22736
362 Ga0105240_10007477 3300009093 Bacteria 15852
363 Ga0105240_10027485 3300009093 Bacteria 7446
364 Ga0105240_10066052 3300009093 Bacteria 4490
365 Ga0105240_10135616 3300009093 Bacteria 2948
366 Ga0111539_10119671 3300009094 Bacteria 3086
367 Ga0105245_10000170 3300009098 Bacteria 61721
368 Ga0105245_10277584 3300009098 Bacteria 1637
369 Ga0105247_10000847 3300009101 Bacteria 23191
370 Ga0105247_10031507 3300009101 Bacteria 3218
371 Ga0105247_10216949 3300009101 Bacteria 1293
372 Ga0114129_10000062 3300009147 Bacteria 96507
373 Ga0114129_10055454 3300009147 Bacteria 5554
374 Ga0114129_10143619 3300009147 Bacteria 3270
375 Ga0114129_10222886 3300009147 Bacteria 2543
376 Ga0105243_10000005 3300009148 Bacteria 576265
377 Ga0105243_10011445 3300009148 Bacteria 6712
378 Ga0105241_10390882 3300009174 Bacteria 1218
379 Ga0105241_10540250 3300009174 Bacteria 1045
380 Ga0105242_10002451 3300009176 Bacteria 14549
381 Ga0105242_10327317 3300009176 Bacteria 1408
382 Ga0105248_10000184 3300009177 Bacteria 72728
383 Ga0105248_10000789 3300009177 Bacteria 35531
384 Ga0105248_10002857 3300009177 Bacteria 19171
385 Ga0105248_10005596 3300009177 Bacteria 13805
386 Ga0105248_10011687 3300009177 Bacteria 9676
387 Ga0105248_10013013 3300009177 Bacteria 9170
388 Ga0105248_10014093 3300009177 Bacteria 8796
389 Ga0105237_10054385 3300009545 Bacteria 4011
390 Ga0105237_10061634 3300009545 Bacteria 3750
391 Ga0105237_10185971 3300009545 Bacteria 2077
392 Ga0105238_10001476 3300009551 Bacteria 23610
393 Ga0105238_10002367 3300009551 Bacteria 18947
394 Ga0105238_10232108 3300009551 Bacteria 1822
395 Ga0105238_10283784 3300009551 Bacteria 1637
396 Ga0105238_10402207 3300009551 Bacteria 1363
397 Ga0105249_10000838 3300009553 Bacteria 27558
398 Ga0105249_10014274 3300009553 Bacteria 7023
399 Ga0105249_10015705 3300009553 Bacteria 6705
400 Ga0105249_10042496 3300009553 Bacteria 4134
401 Ga0105249_10100564 3300009553 Bacteria 2719
402 Ga0105249_10170029 3300009553 Bacteria 2113
403 Ga0105249_10408541 3300009553 Bacteria 1389
404 Ga0105249_10598055 3300009553 Bacteria 1157
405 Ga0105239_10001780 3300010375 Bacteria 28338
406 Ga0105239_10014084 3300010375 Bacteria 8878
407 Ga0105239_10039656 3300010375 Bacteria 5159
408 Ga0105239_10056934 3300010375 Bacteria 4288
409 Ga0105239_10080575 3300010375 Bacteria 3582
410 Ga0105246_10007418 3300011119 Bacteria 6723
411 Ga0105246_10037172 3300011119 Bacteria 3266
412 Ga0157373_10001642 3300013100 Bacteria 17076
413 Ga0157373_10097566 3300013100 Bacteria 2069
414 Ga0157373_10123709 3300013100 Bacteria 1819
415 Ga0157371_10002370 3300013102 Bacteria 18036
416 Ga0157371_10002538 3300013102 Bacteria 17347
417 Ga0157371_10100944 3300013102 Bacteria 2047
418 Ga0157371_10106097 3300013102 Bacteria 1994
419 Ga0157371_10167244 3300013102 Bacteria 1571
420 Ga0157371_10365363 3300013102 Bacteria 1052
421 Ga0157370_10005233 3300013104 Bacteria 14593
422 Ga0157370_10013571 3300013104 Bacteria 8385
423 Ga0157370_10029212 3300013104 Bacteria 5415
424 Ga0157370_10093429 3300013104 Bacteria 2823
425 Ga0157369_10016738 3300013105 Bacteria 8242
426 Ga0157369_10053092 3300013105 Bacteria 4381
427 Ga0157369_10087264 3300013105 Bacteria 3332
428 Ga0157369_10180386 3300013105 Bacteria 2222
429 Ga0157369_10752978 3300013105 Bacteria 1002
430 Ga0157374_10000837 3300013296 Bacteria 26885
431 Ga0157374_10031464 3300013296 Bacteria 4823
432 Ga0157374_10082522 3300013296 Bacteria 3052
433 Ga0157374_10475657 3300013296 Unclassified 1252
434 Ga0157378_10000540 3300013297 Bacteria 35981
435 Ga0157378_10001948 3300013297 Bacteria 18521
436 Ga0157378_10010920 3300013297 Bacteria 7943
437 Ga0157378_10294750 3300013297 Bacteria 1568
438 Ga0157378_10424770 3300013297 Bacteria 1314
439 Ga0157378_10465757 3300013297 Bacteria 1257
440 Ga0163162_10006665 3300013306 Bacteria 11200
441 Ga0163162_10027266 3300013306 Bacteria 5648
442 Ga0163162_10032994 3300013306 Bacteria 5142
443 Ga0163162_10049394 3300013306 Bacteria 4216
444 Ga0163162_10238791 3300013306 Bacteria 1948
445 Ga0163162_10244031 3300013306 Bacteria 1928
446 Ga0163162_10253603 3300013306 Bacteria 1891
447 Ga0163162_10412281 3300013306 Bacteria 1483
448 Ga0163162_10618093 3300013306 Bacteria 1209
449 Ga0157372_10033499 3300013307 Bacteria 5643
450 Ga0157372_10065373 3300013307 Bacteria 4083
451 Ga0157372_10071189 3300013307 Bacteria 3915
452 Ga0157372_10148586 3300013307 Bacteria 2703
453 Ga0157372_10222403 3300013307 Bacteria 2188
454 Ga0157375_10000144 3300013308 Bacteria 70151
455 Ga0157375_10002627 3300013308 Bacteria 15569
456 Ga0157375_10266450 3300013308 Bacteria 1875
457 Ga0163163_10000131 3300014325 Bacteria 76809
458 Ga0163163_10000145 3300014325 Bacteria 74233
459 Ga0163163_10008166 3300014325 Bacteria 9283
460 Ga0163163_10017716 3300014325 Bacteria 6649
461 Ga0163163_10194372 3300014325 Bacteria 2077
462 Ga0163163_10656768 3300014325 Bacteria 1112
463 Ga0163163_10725940 3300014325 Bacteria 1057
464 Ga0157380_10072743 3300014326 Bacteria 2785
465 Ga0157380_10110040 3300014326 Bacteria 2313
466 Ga0157380_10134417 3300014326 Bacteria 2115
467 Ga0182008_10000913 3300014497 Bacteria 20555
468 Ga0182008_10006499 3300014497 Bacteria 6527
469 Ga0182008_10049221 3300014497 Bacteria 2092
470 Ga0157379_10002201 3300014968 Bacteria 16220
471 Ga0157379_10004164 3300014968 Bacteria 12347
472 Ga0157379_10004862 3300014968 Bacteria 11538
473 Ga0157379_10007585 3300014968 Bacteria 9395
474 Ga0157379_10018883 3300014968 Bacteria 6083
475 Ga0157379_10066868 3300014968 Bacteria 3213
476 Ga0157379_10083161 3300014968 Bacteria 2869
477 Ga0157379_10123021 3300014968 Bacteria 2335
478 Ga0157379_10162845 3300014968 Bacteria 2013
479 Ga0157376_10004137 3300014969 Bacteria 10053
480 Ga0157376_10130631 3300014969 Bacteria 2241
481 Ga0157376_10543791 3300014969 Bacteria 1148
482 Ga0182006_1050911 3300015261 Bacteria 1595
483 Ga0182006_1052715 3300015261 Bacteria 1562
484 Ga0182007_10000019 3300015262 Bacteria 194770
485 Ga0182005_1000088 3300015265 Bacteria 69427
486 Ga0163161_10001958 3300017792 Bacteria 14979
487 Ga0163161_10020114 3300017792 Bacteria 4681
488 Ga0213872_10001776 3300021361 Bacteria 13470
489 Ga0213872_10072378 3300021361 Bacteria 1553
490 Ga0213874_10004179 3300021377 Bacteria 3267
491 Ga0213874_10043283 3300021377 Bacteria 1356
492 Ga0213876_10008313 3300021384 Bacteria 5616
493 Ga0213876_10065834 3300021384 Bacteria 1912
494 Ga0213875_10003041 3300021388 Bacteria 9713
495 Ga0213875_10073128 3300021388 Bacteria 1600
496 Ga0207425_1000005 3300025245 Bacteria 900502
497 Ga0209129_1000701 3300025258 Bacteria 21860
498 Ga0209565_1000113 3300025263 Bacteria 116343
499 Ga0209565_1000272 3300025263 Bacteria 52468
500 Ga0209673_1000369 3300025273 Bacteria 81061
501 Ga0209673_1013882 3300025273 Bacteria 3153
502 Ga0209673_1019973 3300025273 Bacteria 2389
503 Ga0209673_1028160 3300025273 Bacteria 1814
504 Ga0209130_1005244 3300025284 Bacteria 4566
505 Ga0209130_1017793 3300025284 Bacteria 1684
506 Ga0209675_1000007 3300025291 Bacteria 683430
507 Ga0209675_1000515 3300025291 Bacteria 28533
508 Ga0209675_1005027 3300025291 Bacteria 5666
509 Ga0209676_1000018 3300025292 Bacteria 631385
510 Ga0209676_1000063 3300025292 Bacteria 322025
511 Ga0209676_1000143 3300025292 Bacteria 175267
512 Ga0209676_1001361 3300025292 Bacteria 24039
513 Ga0209676_1001572 3300025292 Bacteria 20396
514 Ga0209676_1001849 3300025292 Bacteria 17458
515 Ga0209676_1005025 3300025292 Bacteria 7081
516 Ga0209025_1000042 3300025294 Bacteria 370577
517 Ga0209025_1000357 3300025294 Bacteria 98040
518 Ga0209025_1001007 3300025294 Bacteria 41722
519 Ga0209025_1001794 3300025294 Bacteria 25490
520 Ga0209025_1004726 3300025294 Bacteria 11609
521 Ga0209564_1000333 3300025295 Bacteria 91663
522 Ga0209564_1001051 3300025295 Bacteria 33695
523 Ga0209564_1026008 3300025295 Bacteria 1948
524 Ga0209758_1000002 3300025297 Bacteria 1400310
525 Ga0209050_1000001 3300025298 Bacteria 3563507
526 Ga0209050_1000396 3300025298 Bacteria 81559
527 Ga0209050_1001391 3300025298 Bacteria 26316
528 Ga0209050_1001430 3300025298 Bacteria 25721
529 Ga0209050_1021655 3300025298 Bacteria 2335
530 Ga0209256_1000876 3300025299 Bacteria 37189
531 Ga0209256_1002151 3300025299 Bacteria 17009
532 Ga0209256_1005969 3300025299 Bacteria 6695
533 Ga0209256_1008759 3300025299 Bacteria 4607
534 Ga0207426_1012332 3300025302 Bacteria 3214
535 Ga0209051_1000449 3300025303 Bacteria 54625
536 Ga0209051_1000472 3300025303 Bacteria 52350
537 Ga0209257_1000035 3300025304 Bacteria 631463
538 Ga0209257_1000861 3300025304 Bacteria 43224
539 Ga0209257_1001769 3300025304 Bacteria 23916
540 Ga0209257_1002921 3300025304 Bacteria 15747
541 Ga0209257_1003045 3300025304 Bacteria 15123
542 Ga0209257_1003113 3300025304 Bacteria 14856
543 Ga0209257_1004367 3300025304 Bacteria 11008
544 Ga0209257_1006408 3300025304 Bacteria 7597
545 Ga0209257_1008020 3300025304 Bacteria 6160
546 Ga0209257_1018637 3300025304 Bacteria 2656
547 Ga0209257_1049314 3300025304 Bacteria 1199
548 Ga0207697_10000072 3300025315 Bacteria 43473
549 Ga0207656_10002678 3300025321 Bacteria 6037
550 Ga0207656_10007484 3300025321 Bacteria 3979
551 Ga0207656_10062919 3300025321 Bacteria 1632
552 Ga0207656_10186665 3300025321 Bacteria 997
553 Ga0207696_1001081 3300025711 Bacteria 16071
554 Ga0207713_1001002 3300025735 Bacteria 24653
555 Ga0207713_1029091 3300025735 Bacteria 2481
556 Ga0207653_10026429 3300025885 Bacteria 1861
557 Ga0207710_10000172 3300025900 Bacteria 66486
558 Ga0207710_10035391 3300025900 Bacteria 2197
559 Ga0207688_10000289 3300025901 Bacteria 22999
560 Ga0207688_10010619 3300025901 Bacteria 5008
561 Ga0207688_10103231 3300025901 Bacteria 1649
562 Ga0207680_10002281 3300025903 Bacteria 8944
563 Ga0207680_10005098 3300025903 Bacteria 6260
564 Ga0207680_10012307 3300025903 Bacteria 4353
565 Ga0207680_10030887 3300025903 Bacteria 3028
566 Ga0207647_10000629 3300025904 Bacteria 27446
567 Ga0207647_10001021 3300025904 Bacteria 21752
568 Ga0207699_10000280 3300025906 Bacteria 27852
569 Ga0207699_10015404 3300025906 Bacteria 3970
570 Ga0207645_10014382 3300025907 Bacteria 5296
571 Ga0207645_10046819 3300025907 Bacteria 2762
572 Ga0207645_10049484 3300025907 Bacteria 2683
573 Ga0207643_10105795 3300025908 Bacteria 1654
574 Ga0207705_10000105 3300025909 Bacteria 95742
575 Ga0207705_10107496 3300025909 Bacteria 2058
576 Ga0207705_10157555 3300025909 Bacteria 1704
577 Ga0207705_10160957 3300025909 Bacteria 1686
578 Ga0207705_10505294 3300025909 Bacteria 939
579 Ga0207654_10333593 3300025911 Bacteria 1040
580 Ga0207707_10000002 3300025912 Bacteria 1142054
581 Ga0207707_10032738 3300025912 Bacteria 4550
582 Ga0207707_10108321 3300025912 Bacteria 2429
583 Ga0207695_10000755 3300025913 Bacteria 62189
584 Ga0207695_10000932 3300025913 Bacteria 52193
585 Ga0207695_10002096 3300025913 Bacteria 30294
586 Ga0207695_10017819 3300025913 Bacteria 8239
587 Ga0207695_10038185 3300025913 Bacteria 5173
588 Ga0207695_10127172 3300025913 Bacteria 2509
589 Ga0207695_10197157 3300025913 Bacteria 1929
590 Ga0207695_10256604 3300025913 Bacteria 1647
591 Ga0207671_10040777 3300025914 Bacteria 3436
592 Ga0207693_10000018 3300025915 Bacteria 138365
593 Ga0207693_10000534 3300025915 Bacteria 34415
594 Ga0207693_10274008 3300025915 Bacteria 1322
595 Ga0207663_10000014 3300025916 Bacteria 164118
596 Ga0207663_10025004 3300025916 Bacteria 3445
597 Ga0207663_10075315 3300025916 Bacteria 2190
598 Ga0207663_10107229 3300025916 Bacteria 1889
599 Ga0207663_10140540 3300025916 Bacteria 1681
600 Ga0207660_10004700 3300025917 Bacteria 8889
601 Ga0207660_10031267 3300025917 Bacteria 3664
602 Ga0207660_10045661 3300025917 Bacteria 3087
603 Ga0207657_10001006 3300025919 Bacteria 29987
604 Ga0207657_10009745 3300025919 Bacteria 9631
605 Ga0207657_10038796 3300025919 Bacteria 4236
606 Ga0207657_10041770 3300025919 Bacteria 4052
607 Ga0207657_10045255 3300025919 Bacteria 3864
608 Ga0207657_10059690 3300025919 Bacteria 3275
609 Ga0207649_10044337 3300025920 Bacteria 2722
610 Ga0207649_10056805 3300025920 Bacteria 2445
611 Ga0207649_10060123 3300025920 Bacteria 2387
612 Ga0207649_10122105 3300025920 Bacteria 1757
613 Ga0207649_10240271 3300025920 Bacteria 1300
614 Ga0207652_10000052 3300025921 Bacteria 119002
615 Ga0207652_10002051 3300025921 Bacteria 17342
616 Ga0207652_10005171 3300025921 Bacteria 10591
617 Ga0207652_10098147 3300025921 Bacteria 2583
618 Ga0207652_10427298 3300025921 Bacteria 1195
619 Ga0207646_10029093 3300025922 Bacteria 5023
620 Ga0207681_10006421 3300025923 Bacteria 7218
621 Ga0207681_10083733 3300025923 Bacteria 2258
622 Ga0207681_10093509 3300025923 Bacteria 2152
623 Ga0207681_10109026 3300025923 Bacteria 2011
624 Ga0207681_10132563 3300025923 Bacteria 1844
625 Ga0207681_10188914 3300025923 Bacteria 1574
626 Ga0207681_10193313 3300025923 Bacteria 1558
627 Ga0207681_10291811 3300025923 Bacteria 1287
628 Ga0207681_10318909 3300025923 Bacteria 1235
629 Ga0207681_10412645 3300025923 Bacteria 1093
630 Ga0207694_10000488 3300025924 Bacteria 35943
631 Ga0207694_10294957 3300025924 Bacteria 1334
632 Ga0207650_10000003 3300025925 Bacteria 1123235
633 Ga0207650_10000033 3300025925 Bacteria 226809
634 Ga0207650_10001730 3300025925 Bacteria 15525
635 Ga0207650_10015567 3300025925 Bacteria 5298
636 Ga0207650_10058555 3300025925 Bacteria 2869
637 Ga0207659_10001138 3300025926 Bacteria 15793
638 Ga0207659_10004404 3300025926 Bacteria 8511
639 Ga0207687_10001079 3300025927 Bacteria 18514
640 Ga0207700_10000026 3300025928 Bacteria 139690
641 Ga0207700_10017868 3300025928 Bacteria 4748
642 Ga0207700_10028927 3300025928 Bacteria 3905
643 Ga0207700_10061566 3300025928 Bacteria 2847
644 Ga0207664_10006047 3300025929 Bacteria 8288
645 Ga0207664_10011167 3300025929 Bacteria 6367
646 Ga0207664_10014026 3300025929 Bacteria 5777
647 Ga0207664_10030239 3300025929 Bacteria 4135
648 Ga0207664_10089324 3300025929 Bacteria 2523
649 Ga0207664_10161751 3300025929 Bacteria 1910
650 Ga0207664_10203081 3300025929 Bacteria 1712
651 Ga0207644_10000013 3300025931 Bacteria 185370
652 Ga0207644_10001066 3300025931 Bacteria 17529
653 Ga0207644_10010080 3300025931 Bacteria 6223
654 Ga0207644_10024915 3300025931 Bacteria 4110
655 Ga0207644_10083939 3300025931 Bacteria 2360
656 Ga0207690_10003153 3300025932 Bacteria 9902
657 Ga0207690_10022231 3300025932 Bacteria 3943
658 Ga0207690_10030107 3300025932 Bacteria 3458
659 Ga0207690_10073937 3300025932 Bacteria 2359
660 Ga0207690_10086876 3300025932 Bacteria 2199
661 Ga0207690_10286878 3300025932 Bacteria 1284
662 Ga0207706_10000816 3300025933 Bacteria 32338
663 Ga0207706_10016163 3300025933 Bacteria 6742
664 Ga0207706_10017330 3300025933 Bacteria 6488
665 Ga0207706_10022391 3300025933 Bacteria 5672
666 Ga0207706_10139716 3300025933 Bacteria 2131
667 Ga0207706_10200573 3300025933 Bacteria 1750
668 Ga0207686_10057887 3300025934 Bacteria 2441
669 Ga0207686_10074493 3300025934 Bacteria 2194
670 Ga0207709_10000001 3300025935 Bacteria 2228154
671 Ga0207709_10000972 3300025935 Bacteria 21403
672 Ga0207709_10022388 3300025935 Bacteria 3584
673 Ga0207709_10127458 3300025935 Bacteria 1729
674 Ga0207669_10182008 3300025937 Bacteria 1508
675 Ga0207669_10230213 3300025937 Bacteria 1367
676 Ga0207704_10000514 3300025938 Bacteria 17233
677 Ga0207704_10013711 3300025938 Bacteria 4067
678 Ga0207704_10264517 3300025938 Bacteria 1298
679 Ga0207665_10066869 3300025939 Bacteria 2447
680 Ga0207691_10000381 3300025940 Bacteria 44523
681 Ga0207691_10001562 3300025940 Bacteria 22738
682 Ga0207691_10015863 3300025940 Bacteria 7160
683 Ga0207691_10049985 3300025940 Bacteria 3829
684 Ga0207691_10062102 3300025940 Bacteria 3392
685 Ga0207711_10000105 3300025941 Bacteria 90036
686 Ga0207711_10000290 3300025941 Bacteria 53653
687 Ga0207711_10000950 3300025941 Bacteria 27744
688 Ga0207711_10002153 3300025941 Bacteria 17733
689 Ga0207711_10003216 3300025941 Bacteria 14231
690 Ga0207711_10003286 3300025941 Bacteria 14054
691 Ga0207711_10004051 3300025941 Bacteria 12576
692 Ga0207711_10007529 3300025941 Bacteria 9107
693 Ga0207711_10035362 3300025941 Bacteria 4234
694 Ga0207689_10000051 3300025942 Bacteria 88480
695 Ga0207689_10005022 3300025942 Bacteria 11921
696 Ga0207689_10016638 3300025942 Bacteria 6224
697 Ga0207689_10215197 3300025942 Bacteria 1588
698 Ga0207661_10114027 3300025944 Bacteria 2291
699 Ga0207661_10322974 3300025944 Bacteria 1388
700 Ga0207679_10003402 3300025945 Bacteria 9809
701 Ga0207679_10007340 3300025945 Bacteria 6987
702 Ga0207679_10010949 3300025945 Bacteria 5852
703 Ga0207679_10171660 3300025945 Bacteria 1786
704 Ga0207679_10318859 3300025945 Bacteria 1345
705 Ga0207679_10363124 3300025945 Bacteria 1265
706 Ga0207667_10009379 3300025949 Bacteria 11532
707 Ga0207667_10013680 3300025949 Bacteria 9274
708 Ga0207667_10024411 3300025949 Bacteria 6638
709 Ga0207667_10120848 3300025949 Bacteria 2699
710 Ga0207667_10193438 3300025949 Bacteria 2087
711 Ga0207667_10464388 3300025949 Bacteria 1285
712 Ga0207651_10001268 3300025960 Bacteria 11366
713 Ga0207651_10038903 3300025960 Bacteria 3130
714 Ga0207712_10000651 3300025961 Bacteria 27001
715 Ga0207712_10000783 3300025961 Bacteria 23699
716 Ga0207712_10009828 3300025961 Bacteria 6063
717 Ga0207712_10321370 3300025961 Bacteria 1277
718 Ga0207668_10000004 3300025972 Bacteria 201204
719 Ga0207668_10000426 3300025972 Bacteria 26589
720 Ga0207668_10001556 3300025972 Bacteria 13422
721 Ga0207668_10016309 3300025972 Bacteria 4634
722 Ga0207668_10034894 3300025972 Bacteria 3345
723 Ga0207668_10072528 3300025972 Bacteria 2464
724 Ga0207668_10141526 3300025972 Bacteria 1851
725 Ga0207668_10194991 3300025972 Bacteria 1608
726 Ga0207640_10003018 3300025981 Bacteria 9054
727 Ga0207640_10103427 3300025981 Bacteria 2002
728 Ga0207640_10269579 3300025981 Bacteria 1331
729 Ga0207640_10298510 3300025981 Bacteria 1273
730 Ga0207640_10482811 3300025981 Bacteria 1028
731 Ga0207658_10000004 3300025986 Bacteria 569357
732 Ga0207658_10000229 3300025986 Bacteria 58984
733 Ga0207658_10001832 3300025986 Bacteria 15917
734 Ga0207658_10004192 3300025986 Bacteria 10047
735 Ga0207658_10016455 3300025986 Bacteria 5086
736 Ga0207658_10031300 3300025986 Bacteria 3776
737 Ga0207658_10039423 3300025986 Bacteria 3408
738 Ga0207677_10001566 3300026023 Bacteria 12087
739 Ga0207677_10005957 3300026023 Bacteria 6638
740 Ga0207677_10017151 3300026023 Bacteria 4310
741 Ga0207677_10228931 3300026023 Bacteria 1496
742 Ga0207703_10000027 3300026035 Bacteria 209608
743 Ga0207703_10002918 3300026035 Bacteria 14553
744 Ga0207703_10006321 3300026035 Bacteria 9470
745 Ga0207703_10010670 3300026035 Bacteria 7175
746 Ga0207703_10016915 3300026035 Bacteria 5689
747 Ga0207703_10027749 3300026035 Bacteria 4458
748 Ga0207703_10041892 3300026035 Bacteria 3671
749 Ga0207703_10070497 3300026035 Bacteria 2885
750 Ga0207639_10002396 3300026041 Bacteria 12576
751 Ga0207639_10004318 3300026041 Bacteria 9580
752 Ga0207639_10009068 3300026041 Bacteria 6855
753 Ga0207639_10010625 3300026041 Bacteria 6375
754 Ga0207639_10027199 3300026041 Bacteria 4164
755 Ga0207678_10000321 3300026067 Bacteria 43233
756 Ga0207678_10021259 3300026067 Bacteria 5689
757 Ga0207678_10026877 3300026067 Bacteria 5020
758 Ga0207678_10036063 3300026067 Bacteria 4304
759 Ga0207678_10052534 3300026067 Bacteria 3516
760 Ga0207678_10085250 3300026067 Bacteria 2701
761 Ga0207678_10110638 3300026067 Bacteria 2344
762 Ga0207678_10193012 3300026067 Bacteria 1741
763 Ga0207708_10165025 3300026075 Bacteria 1751
764 Ga0207708_10208253 3300026075 Bacteria 1562
765 Ga0207708_10258755 3300026075 Bacteria 1404
766 Ga0207708_10376863 3300026075 Bacteria 1169
767 Ga0207702_10000021 3300026078 Bacteria 196115
768 Ga0207702_10001285 3300026078 Bacteria 25172
769 Ga0207702_10001739 3300026078 Bacteria 21434
770 Ga0207702_10157399 3300026078 Bacteria 2072
771 Ga0207702_10224280 3300026078 Bacteria 1753
772 Ga0207702_10297191 3300026078 Bacteria 1531
773 Ga0207641_10000003 3300026088 Bacteria 496984
774 Ga0207641_10000205 3300026088 Bacteria 78692
775 Ga0207641_10001887 3300026088 Bacteria 20119
776 Ga0207641_10002378 3300026088 Bacteria 17352
777 Ga0207641_10016815 3300026088 Bacteria 5989
778 Ga0207641_10057442 3300026088 Bacteria 3309
779 Ga0207641_10073424 3300026088 Bacteria 2948
780 Ga0207648_10000221 3300026089 Bacteria 61280
781 Ga0207648_10029134 3300026089 Bacteria 4896
782 Ga0207648_10096960 3300026089 Bacteria 2581
783 Ga0207648_10131563 3300026089 Bacteria 2203
784 Ga0207676_10000003 3300026095 Bacteria 1123235
785 Ga0207676_10000068 3300026095 Bacteria 104705
786 Ga0207676_10000898 3300026095 Bacteria 23098
787 Ga0207676_10007358 3300026095 Bacteria 7809
788 Ga0207676_10130939 3300026095 Bacteria 2132
789 Ga0207676_10143733 3300026095 Bacteria 2046
790 Ga0207676_10192798 3300026095 Bacteria 1794
791 Ga0207676_10241236 3300026095 Bacteria 1621
792 Ga0207674_10000014 3300026116 Bacteria 183605
793 Ga0207674_10000134 3300026116 Bacteria 86377
794 Ga0207674_10001223 3300026116 Bacteria 33472
795 Ga0207674_10021077 3300026116 Bacteria 7029
796 Ga0207674_10113418 3300026116 Bacteria 2684
797 Ga0207674_10157030 3300026116 Bacteria 2230
798 Ga0207674_10185182 3300026116 Bacteria 2033
799 Ga0207675_100009359 3300026118 Bacteria 9182
800 Ga0207675_100063616 3300026118 Bacteria 3447
801 Ga0207675_100337628 3300026118 Bacteria 1474
802 Ga0207683_10001475 3300026121 Bacteria 21194
803 Ga0207683_10074023 3300026121 Bacteria 3013
804 Ga0207698_10001465 3300026142 Bacteria 13726
805 Ga0207698_10014565 3300026142 Bacteria 5234
806 Ga0207698_10018365 3300026142 Bacteria 4763
807 Ga0207698_10038303 3300026142 Bacteria 3541
808 Ga0207698_10307262 3300026142 Bacteria 1479
809 Ga0209281_1000028 3300027111 Bacteria 440027
810 Ga0209371_1000006 3300027312 Bacteria 1055642
811 Ga0209371_1000018 3300027312 Bacteria 614700
812 Ga0209999_1001015 3300027543 Bacteria 4763
813 Ga0209970_1004231 3300027614 Bacteria 2389
814 Ga0209983_1000709 3300027665 Bacteria 7199
815 Ga0209971_1001818 3300027682 Bacteria 5224
816 Ga0209974_10005007 3300027876 Bacteria 4685
817 Ga0207428_10269336 3300027907 Unclassified 1267
818 Ga0265357_1000174 3300028023 Bacteria 2936
819 Ga0268266_10000200 3300028379 Bacteria 104456
820 Ga0268266_10001373 3300028379 Bacteria 29333
821 Ga0268266_10004139 3300028379 Bacteria 14009
822 Ga0268266_10047634 3300028379 Bacteria 3673
823 Ga0268266_10058419 3300028379 Bacteria 3321
824 Ga0268266_10119760 3300028379 Bacteria 2341
825 Ga0268265_10001499 3300028380 Bacteria 19542
826 Ga0268265_10002659 3300028380 Bacteria 13260
827 Ga0268265_10004547 3300028380 Bacteria 9593
828 Ga0268265_10007828 3300028380 Bacteria 7211
829 Ga0268265_10013087 3300028380 Bacteria 5634
830 Ga0268265_10031822 3300028380 Bacteria 3813
831 Ga0268265_10108840 3300028380 Bacteria 2257
832 Ga0268265_10123688 3300028380 Bacteria 2136
833 Ga0268265_10216316 3300028380 Bacteria 1673
834 Ga0268265_10226160 3300028380 Bacteria 1641
835 Ga0268264_10000009 3300028381 Bacteria 724972
836 Ga0268264_10000032 3300028381 Bacteria 408337
837 Ga0268264_10001019 3300028381 Bacteria 28201
838 Ga0268264_10005356 3300028381 Bacteria 10876
839 Ga0268264_10006551 3300028381 Bacteria 9802
840 Ga0268264_10040000 3300028381 Bacteria 3874
841 Ga0268264_10065732 3300028381 Bacteria 3057
842 Ga0268264_10131845 3300028381 Bacteria 2217
843 Ga0265334_10000330 3300028573 Bacteria 25447
844 Ga0265334_10011266 3300028573 Bacteria 3767
845 Ga0265334_10043808 3300028573 Bacteria 1740
846 Ga0265338_10018343 3300028800 Bacteria 7496
847 Ga0265338_10023035 3300028800 Bacteria 6418
848 Ga0265338_10158623 3300028800 Bacteria 1750
849 Ga0268256_1000007 3300030500 Bacteria 1055326
850 Ga0268256_1000016 3300030500 Bacteria 614700
851 Ga0316177_1170645 3300030731 Bacteria 1302
852 Ga0316176_1026458 3300030732 Bacteria 4459
853 Ga0314311_1183412 3300030733 Bacteria 3758
854 Ga0316183_1047328 3300030742 Bacteria 4007
855 Ga0316182_1155287 3300030745 Bacteria 4437
856 Ga0265330_10084826 3300031235 Bacteria 1363
857 Ga0265328_10000023 3300031239 Bacteria 123873
858 Ga0265328_10000417 3300031239 Bacteria 19913
859 Ga0265328_10002712 3300031239 Bacteria 7920
860 Ga0265328_10062827 3300031239 Bacteria 1363
861 Ga0265320_10000034 3300031240 Bacteria 141117
862 Ga0265320_10004662 3300031240 Bacteria 8952
863 Ga0265325_10015985 3300031241 Bacteria 4203
864 Ga0265325_10041712 3300031241 Bacteria 2404
865 Ga0265325_10042196 3300031241 Bacteria 2386
866 Ga0265340_10014685 3300031247 Bacteria 4084
867 Ga0265339_10000068 3300031249 Bacteria 91555
868 Ga0265339_10011306 3300031249 Bacteria 5504
869 Ga0265339_10018281 3300031249 Bacteria 4135
870 Ga0265339_10027678 3300031249 Bacteria 3230
871 Ga0265331_10000058 3300031250 Bacteria 175410
872 Ga0265331_10001205 3300031250 Bacteria 19491
873 Ga0265331_10001452 3300031250 Bacteria 17418
874 Ga0265331_10015615 3300031250 Bacteria 4005
875 Ga0265327_10010799 3300031251 Bacteria 6369
876 Ga0265327_10027713 3300031251 Bacteria 3255
877 Ga0265327_10131454 3300031251 Bacteria 1177
878 Ga0265316_10000880 3300031344 Bacteria 32907
879 Ga0307408_100189984 3300031548 Bacteria 1654
880 Ga0307408_100284968 3300031548 Bacteria 1377
881 Ga0265313_10000351 3300031595 Bacteria 50142
882 Ga0265313_10004290 3300031595 Bacteria 11038
883 Ga0265313_10006241 3300031595 Bacteria 8507
884 Ga0307508_10063127 3300031616 Bacteria 3269
885 Ga0316579_10001465 3300031691 Bacteria 8583
886 Ga0316579_10082979 3300031691 Bacteria 1527
887 Ga0265314_10008099 3300031711 Bacteria 9045
888 Ga0265314_10012421 3300031711 Bacteria 6948
889 Ga0265314_10031762 3300031711 Bacteria 3893
890 Ga0265314_10032914 3300031711 Bacteria 3808
891 Ga0265342_10198541 3300031712 Bacteria 1091
892 Ga0307516_10065290 3300031730 Bacteria 3515
893 Ga0307405_10065809 3300031731 Bacteria 2309
894 Ga0307405_10070715 3300031731 Bacteria 2242
895 Ga0316577_10072358 3300031733 Bacteria 1924
896 Ga0307413_10036922 3300031824 Bacteria 2818
897 Ga0307410_10178177 3300031852 Bacteria 1607
898 Ga0307410_10262030 3300031852 Bacteria 1348
899 Ga0307410_10374852 3300031852 Bacteria 1143
900 Ga0307406_10042324 3300031901 Bacteria 2843
901 Ga0307406_10056561 3300031901 Bacteria 2513
902 Ga0307406_10184897 3300031901 Bacteria 1520
903 Ga0307406_10248352 3300031901 Bacteria 1339
904 Ga0307407_10104652 3300031903 Bacteria 1764
905 Ga0307407_10121446 3300031903 Bacteria 1657
906 Ga0307407_10299767 3300031903 Bacteria 1120
907 Ga0307412_10050872 3300031911 Bacteria 2736
908 Ga0307412_10168359 3300031911 Bacteria 1636
909 Ga0307412_10285416 3300031911 Bacteria 1298
910 Ga0307412_10416596 3300031911 Bacteria 1098
911 Ga0307409_100047886 3300031995 Unclassified 3249
912 Ga0307414_10000567 3300032004 Bacteria 19287
913 Ga0307414_10012890 3300032004 Bacteria 4961
914 Ga0307414_10044355 3300032004 Bacteria 3036
915 Ga0307414_10077134 3300032004 Bacteria 2424
916 Ga0307414_10091042 3300032004 Bacteria 2265
917 Ga0307414_10131878 3300032004 Bacteria 1941
918 Ga0307414_10167325 3300032004 Bacteria 1753
919 Ga0307414_10333679 3300032004 Bacteria 1295
920 Ga0307411_10036861 3300032005 Bacteria 3069
921 Ga0307411_10154099 3300032005 Bacteria 1712
922 Ga0307411_10434930 3300032005 Bacteria 1093
923 Ga0307415_100011926 3300032126 Bacteria 5002
924 Ga0316583_10035116 3300032133 Bacteria 1779
925 Ga0316585_10079882 3300032137 Bacteria 1065
926 Ga0316593_10000644 3300032168 Bacteria 6684
927 Ga0316593_10000719 3300032168 Bacteria 6494
928 Ga0316593_10033869 3300032168 Bacteria 1674
929 Ga0307510_10039096 3300033180 Bacteria 5234
930 Ga0307510_10230928 3300033180 Bacteria 1353
931 Ga0373928_0019327 3300035084 Bacteria 1420
932 Ga0373940_0011289 3300035088 Bacteria 2119
933 Ga0373923_0030373 3300035111 Bacteria 2173
934 Ga0373923_0067422 3300035111 Bacteria 1531
935 Ga0373923_0162889 3300035111 Bacteria 1018
936 Ga0373936_0010479 3300035113 Bacteria 3497
937 Ga0373945_0038698 3300035116 Bacteria 1716
938 Ga0373953_0003803 3300035117 Bacteria 4750
939 Ga0373953_0016807 3300035117 Bacteria 2678
940 Ga0373954_0012077 3300035118 Bacteria 3837
941 Ga0373956_0023567 3300035119 Bacteria 2643
942 Ga0373957_0241285 3300035120 Bacteria 759
943 Ga0373943_0000193 3300035170 Bacteria 24677
944 Ga0373943_0253135 3300035170 Bacteria 990
945 Ga0373946_0003060 3300035171 Bacteria 5920
946 Ga0373955_0014392 3300035172 Bacteria 3847
947 Ga0373955_0014552 3300035172 Bacteria 3830
948 Ga0373955_0160721 3300035172 Bacteria 1326
949 Ga0316574_0118771 3300035398 Bacteria 1697
950 Ga0373924_0001157 3300035410 Bacteria 8463
951 Ga0373931_0107602 3300035691 Bacteria 1577
952 Ga0373935_0011008 3300035692 Bacteria 5434
953 Ga0373935_0016783 3300035692 Bacteria 4432
954 Ga0373935_0101921 3300035692 Bacteria 1894
955 Ga0373927_0000001 3300035695 Bacteria 1082160
956 Ga0373927_0003709 3300035695 Bacteria 10858
957 Ga0373927_0061084 3300035695 Bacteria 2438
958 Ga0373927_0064367 3300035695 Bacteria 2372
959 Ga0373933_0000565 3300035724 Bacteria 23136
960 Ga0373933_0050041 3300035724 Bacteria 2493
961 Ga0373933_0114563 3300035724 Bacteria 1684
962 Ga0373947_0000076 3300035725 Bacteria 49938
963 Ga0373947_0018642 3300035725 Bacteria 3996
964 Ga0373947_0099948 3300035725 Bacteria 1822
965 Ga0373947_0202870 3300035725 Bacteria 1298
966 Ga0373947_0267870 3300035725 Bacteria 1133
967 Ga0373937_0001232 3300036401 Bacteria 21520
968 Ga0373937_0006584 3300036401 Bacteria 10030
969 Ga0373937_0010393 3300036401 Bacteria 8128
970 Ga0373937_0159581 3300036401 Bacteria 2114
971 Ga0373937_0239939 3300036401 Bacteria 1708
972 Ga0316582_0025101 3300036647 Bacteria 3574
973 Ga0316582_0030009 3300036647 Bacteria 3308
974 Ga0316582_0212929 3300036647 Bacteria 1320
975 Ga0316582_0387086 3300036647 Bacteria 963
976 Ga0316584_0012487 3300036712 Bacteria 5990
977 Ga0316584_0042160 3300036712 Bacteria 3403
978 Ga0316584_0064388 3300036712 Bacteria 2745
979 Ga0316584_0173226 3300036712 Bacteria 1599
980 Ga0373925_0005607 3300037068 Bacteria 9345
981 Ga0373925_0017823 3300037068 Bacteria 5153
982 Ga0373925_0021045 3300037068 Bacteria 4753
983 Ga0373925_0155169 3300037068 Bacteria 1800
984 Ga0395899_0159725 3300037312 Bacteria 1593
985 Ga0395899_0188808 3300037312 Bacteria 1443
986 Ga0395900_0001243 3300037418 Bacteria 31304
987 Ga0395900_0042203 3300037418 Bacteria 4699
988 Ga0395900_0277031 3300037418 Bacteria 1671
989 Ga0395898_0081810 3300037466 Bacteria 3113
990 Ga0395898_0454764 3300037466 Bacteria 1219
991 Ga0395905_0042939 3300037471 Bacteria 4242
992 Ga0395905_0109855 3300037471 Bacteria 2589
993 Ga0395905_0199967 3300037471 Bacteria 1874
994 Ga0316581_0034830 3300037588 Bacteria 1524
995 Ga0436364_0697377 3300037853 Bacteria 6625
996 Ga0436364_0958902 3300037853 Bacteria 1745
997 Ga0436364_0964747 3300037853 Bacteria 1281
998 Ga0436364_1554086 3300037853 Bacteria 6462
999 Ga0395901_0030728 3300038443 Bacteria 5534
1000 Ga0395901_0118952 3300038443 Bacteria 2776
1001 Ga0395901_0464238 3300038443 Bacteria 1293
1002 Ga0400490_33215 3300038726 Bacteria 2971
1003 Ga0400488_63061 3300038741 Bacteria 2010
1004 Ga0400486_00542 3300038742 Bacteria 1919
1005 Ga0400486_10450 3300038742 Bacteria 2193
1006 Ga0242420_018134 3300038996 Bacteria 1237
1007 Ga0400483_015557 3300039062 Bacteria 3618
1008 Ga0400483_133234 3300039062 Bacteria 6082
1009 Ga0400483_135634 3300039062 Bacteria 1285
1010 Ga0400483_227477 3300039062 Bacteria 1094
1011 Ga0400483_244091 3300039062 Bacteria 5162
1012 Ga0400483_252524 3300039062 Bacteria 5370
1013 Ga0400489_67955 3300039093 Bacteria 1877
1014 Ga0400489_73156 3300039093 Bacteria 1804
1015 Ga0436365_0138950 3300039437 Bacteria 10189
1016 Ga0436365_0733541 3300039437 Bacteria 1181
1017 Ga0436365_0942406 3300039437 Bacteria 3117
1018 Ga0436365_0961511 3300039437 Bacteria 5073
1019 Ga0436365_1501840 3300039437 Unclassified 2773
1020 Ga0436365_1906591 3300039437 Bacteria 89846
1021 Ga0436360_0438284 3300039438 Bacteria 2643
1022 Ga0436360_0831553 3300039438 Bacteria 5639
1023 Ga0436360_0955023 3300039438 Bacteria 1069
1024 Ga0436361_0095589 3300039447 Bacteria 1584
1025 Ga0436361_0103120 3300039447 Bacteria 123137
1026 Ga0436361_0416901 3300039447 Bacteria 8194
1027 Ga0436361_0534303 3300039447 Bacteria 1591
1028 Ga0436361_0602414 3300039447 Bacteria 1718
1029 Ga0436361_0810226 3300039447 Bacteria 2010
1030 Ga0436363_0214837 3300039450 Unclassified 1309
1031 Ga0436363_0485340 3300039450 Bacteria 6324
1032 Ga0436363_0715275 3300039450 Bacteria 14881
1033 Ga0436363_1032809 3300039450 Bacteria 11767
1034 Ga0436363_1408746 3300039450 Bacteria 1661
1035 Ga0436363_1461336 3300039450 Bacteria 1670
1036 Ga0436362_0020367 3300039453 Bacteria 10410
1037 Ga0436362_0865405 3300039453 Bacteria 1308
1038 Ga0436362_1301339 3300039453 Bacteria 980
1039 Ga0439436_0001101 3300041404 Bacteria 7628
1040 Ga0439465_0000821 3300041413 Bacteria 9761
1041 Ga0439465_0033501 3300041413 Bacteria 1643
1042 Ga0451789_0915396 3300041443 Bacteria 1588
1043 Ga0451802_1915534 3300041460 Bacteria 1717
1044 Ga0451837_0019715 3300041494 Bacteria 1576
1045 Ga0451837_1224968 3300041494 Bacteria 4091
1046 Ga0451843_0505550 3300041509 Bacteria 2252
1047 Ga0451843_0997273 3300041509 Bacteria 1732
1048 Ga0439432_008299 3300042006 Bacteria 3650
1049 Ga0439449_0000005 3300042007 Bacteria 81904
1050 Ga0451577_0013406 3300042876 Bacteria 7672
1051 Ga0466972_0153146 3300044658 Bacteria 1084
1052 Ga0453683_0003598 3300044673 Bacteria 11378
1053 Ga0466965_0038749 3300044683 Bacteria 2342
1054 Ga0466965_0225824 3300044683 Bacteria 999
1055 Ga0466961_0190624 3300044693 Bacteria 1271
1056 Ga0466963_0024247 3300044694 Bacteria 3861
1057 Ga0453684_0004122 3300044712 Bacteria 31493
1058 Ga0453684_0141280 3300044712 Bacteria 2875
1059 Ga0453684_0265723 3300044712 Bacteria 1963
1060 Ga0466957_0058893 3300044842 Bacteria 2353
1061 Ga0466960_0050556 3300044901 Bacteria 2005
1062 Ga0466959_0106995 3300045049 Bacteria 1999
1063 Ga0451576_0000153 3300045051 Bacteria 175596
1064 Ga0451576_0000479 3300045051 Bacteria 89703
1065 Ga0451576_0067762 3300045051 Bacteria 3715
1066 Ga0466967_0018227 3300045976 Bacteria 5602
1067 Ga0466967_0240015 3300045976 Bacteria 1728
1068 Ga0495592_0025358 3300046454 Bacteria 4501
1069 Ga0495592_0064784 3300046454 Bacteria 2677
1070 Ga0495592_0102487 3300046454 Bacteria 2038
1071 Ga0495592_0313330 3300046454 Bacteria 1016
1072 Ga0495603_0108960 3300046455 Bacteria 1616
1073 Ga0495629_0001993 3300046459 Bacteria 15861
1074 Ga0495629_0129774 3300046459 Bacteria 1756
1075 Ga0495638_0023663 3300046460 Bacteria 4014
1076 Ga0495638_0066815 3300046460 Bacteria 2209
1077 Ga0495651_0000136 3300046462 Bacteria 54665
1078 Ga0495653_0001743 3300046463 Bacteria 17165
1079 Ga0495582_0058999 3300046473 Bacteria 2117
1080 Ga0495582_0139231 3300046473 Bacteria 1375
1081 Ga0495662_0020350 3300046476 Bacteria 3209
1082 Ga0495662_0128760 3300046476 Bacteria 1244
1083 Ga0495664_0008491 3300046477 Bacteria 5730
1084 Ga0495594_0033264 3300046499 Bacteria 2802
1085 Ga0495594_0168784 3300046499 Bacteria 1245
1086 Ga0495596_0074009 3300046500 Bacteria 1323
1087 Ga0495607_0042991 3300046501 Bacteria 2675
1088 Ga0495608_0000282 3300046511 Bacteria 35820
1089 Ga0495610_0013350 3300046512 Bacteria 4886
1090 Ga0495610_0105931 3300046512 Bacteria 1252
1091 Ga0495618_0007700 3300046514 Bacteria 6513
1092 Ga0495628_0000643 3300046516 Bacteria 31928
1093 Ga0495628_0008875 3300046516 Bacteria 8601
1094 Ga0495630_0008243 3300046517 Bacteria 7485
1095 Ga0495630_0019912 3300046517 Bacteria 4939
1096 Ga0495630_0089419 3300046517 Bacteria 2326
1097 Ga0495630_0284291 3300046517 Bacteria 1264
1098 Ga0495643_0001375 3300046522 Bacteria 22762
1099 Ga0495643_0170031 3300046522 Bacteria 1066
1100 Ga0495663_0022197 3300046525 Bacteria 1832
1101 Ga0495663_0024795 3300046525 Bacteria 1745
1102 Ga0495666_0008457 3300046526 Bacteria 5162
1103 Ga0495666_0051634 3300046526 Bacteria 1975
1104 Ga0495652_0005586 3300046529 Bacteria 11817
1105 Ga0495652_0039570 3300046529 Bacteria 4077
1106 Ga0495654_0000143 3300046530 Bacteria 74495
1107 Ga0495654_0105984 3300046530 Bacteria 1288
1108 Ga0495640_0001369 3300046533 Bacteria 19192
1109 Ga0495640_0006577 3300046533 Bacteria 9182
1110 Ga0495640_0090849 3300046533 Bacteria 2015
1111 Ga0495640_0090966 3300046533 Bacteria 2013
1112 Ga0495640_0136858 3300046533 Bacteria 1581
1113 Ga0495587_0001140 3300046536 Bacteria 17405
1114 Ga0495621_0069355 3300046539 Bacteria 1295
1115 Ga0495645_0020607 3300046543 Bacteria 4761
1116 Ga0495645_0117245 3300046543 Bacteria 1878
1117 Ga0495645_0308464 3300046543 Bacteria 1031
1118 Ga0495622_0006793 3300046557 Bacteria 5309
1119 Ga0495622_0049152 3300046557 Bacteria 1958
1120 Ga0495633_0057288 3300046558 Bacteria 1830
1121 Ga0495633_0068945 3300046558 Bacteria 1651
1122 Ga0495667_0000392 3300046559 Bacteria 27924
1123 Ga0495656_0006815 3300046615 Bacteria 4016
1124 Ga0495668_0009231 3300046616 Bacteria 6069
1125 Ga0495668_0012789 3300046616 Bacteria 4969
1126 Ga0495668_0028753 3300046616 Bacteria 3143
1127 Ga0495634_0005388 3300046642 Bacteria 9857
1128 Ga0495634_0012404 3300046642 Bacteria 6169
1129 Ga0495625_0008016 3300046660 Bacteria 9067
1130 Ga0495625_0083478 3300046660 Bacteria 2221
1131 Ga0495625_0166393 3300046660 Bacteria 1474
1132 Ga0495635_0001645 3300046663 Bacteria 15067
1133 Ga0495657_0002613 3300046675 Bacteria 15065
1134 Ga0495623_0001489 3300046679 Bacteria 15874
1135 Ga0495646_0008281 3300046680 Bacteria 6610
1136 Ga0495647_0027602 3300046681 Bacteria 2087
1137 Ga0495658_0095703 3300046683 Bacteria 1765
1138 Ga0495613_0046126 3300046689 Bacteria 3223
1139 Ga0495613_0242997 3300046689 Bacteria 1258
1140 Ga0495624_0026171 3300046690 Bacteria 3823
1141 Ga0495624_0225483 3300046690 Bacteria 1136
1142 Ga0495671_0007336 3300046692 Bacteria 6295
1143 Ga0495600_0034397 3300046809 Bacteria 3289
1144 Ga0495600_0037198 3300046809 Bacteria 3164
1145 Ga0495581_0022861 3300047315 Bacteria 3622
1146 Ga0495581_0029748 3300047315 Bacteria 3165
1147 Ga0495604_0000168 3300047317 Bacteria 57429
1148 Ga0495674_0000573 3300047319 Bacteria 34362
1149 Ga0495674_0065302 3300047319 Bacteria 3161
1150 Ga0495674_0283028 3300047319 Bacteria 1358
1151 Ga0495672_0001550 3300047320 Bacteria 22485
1152 Ga0495680_0000285 3300047322 Bacteria 56843
1153 Ga0495675_0008016 3300047444 Bacteria 6534
1154 Ga0495684_0043330 3300047471 Bacteria 3446
1155 Ga0495686_0006050 3300047472 Bacteria 9385
1156 Ga0495686_0011750 3300047472 Bacteria 6164
1157 Ga0495593_0069627 3300047673 Bacteria 1829
1158 Ga0495602_0002627 3300048088 Bacteria 18358
1159 Ga0495626_0073853 3300048091 Bacteria 1527
1160 Ga0496100_0056476 3300048903 Bacteria 2568
1161 Ga0496101_0003911 3300048904 Bacteria 9310
1162 Ga0496101_0025843 3300048904 Bacteria 4077
1163 Ga0496102_0007555 3300048905 Bacteria 9292
1164 Ga0496102_0081113 3300048905 Bacteria 2990
1165 Ga0496102_0132876 3300048905 Bacteria 2331
1166 Ga0496104_0000005 3300048907 Bacteria 620360
1167 Ga0496104_0000118 3300048907 Bacteria 74158
1168 Ga0496104_0006870 3300048907 Bacteria 10032
1169 Ga0496104_0048705 3300048907 Bacteria 3995
1170 Ga0496104_0108307 3300048907 Bacteria 2663
1171 Ga0496105_0000018 3300048908 Bacteria 197208
1172 Ga0496105_0000056 3300048908 Bacteria 88217
1173 Ga0496105_0100718 3300048908 Bacteria 2385
1174 Ga0496106_0004357 3300048909 Bacteria 10513
1175 Ga0496106_0199361 3300048909 Bacteria 1593
1176 Ga0496107_0355488 3300048910 Bacteria 1090
1177 Ga0496108_0002873 3300048911 Bacteria 13816
1178 Ga0496108_0004829 3300048911 Bacteria 10877
1179 Ga0496108_0008681 3300048911 Bacteria 8239
1180 Ga0496108_0181635 3300048911 Bacteria 1822
1181 Ga0496108_0300871 3300048911 Bacteria 1397
1182 Ga0496109_0000015 3300048912 Bacteria 214913
1183 Ga0496109_0003174 3300048912 Bacteria 13700
1184 Ga0496109_0034975 3300048912 Bacteria 4529
1185 Ga0496109_0043607 3300048912 Bacteria 4066
1186 Ga0496110_0000751 3300048913 Bacteria 22417
1187 Ga0496110_0002553 3300048913 Bacteria 13681
1188 Ga0496110_0100090 3300048913 Bacteria 2598
1189 Ga0496110_0186041 3300048913 Bacteria 1886
1190 Ga0496110_0211139 3300048913 Bacteria 1765
1191 Ga0496110_0307893 3300048913 Bacteria 1443
1192 Ga0496111_0004928 3300048914 Bacteria 8477
1193 Ga0496111_0022272 3300048914 Bacteria 4433
1194 Ga0496111_0094540 3300048914 Bacteria 2192
1195 Ga0496111_0155426 3300048914 Bacteria 1697
1196 Ga0496112_0008091 3300048915 Bacteria 9389
1197 Ga0496112_0018667 3300048915 Bacteria 6536
1198 Ga0496112_0032012 3300048915 Bacteria 5105
1199 Ga0496113_0054754 3300048916 Bacteria 2987
1200 Ga0496114_0022877 3300048917 Bacteria 5094
1201 Ga0496114_0110570 3300048917 Bacteria 2354
1202 Ga0496114_0129275 3300048917 Bacteria 2179
1203 Ga0496114_0315008 3300048917 Bacteria 1382
1204 Ga0496115_0000002 3300048918 Bacteria 365286
1205 Ga0496115_0001166 3300048918 Bacteria 18830
1206 Ga0496115_0085271 3300048918 Bacteria 2576
1207 Ga0496116_0110403 3300048919 Bacteria 1618
1208 Ga0496117_0002847 3300048920 Bacteria 21034
1209 Ga0496117_0003923 3300048920 Bacteria 16846
1210 Ga0496117_0008418 3300048920 Bacteria 9802
1211 Ga0496117_0043010 3300048920 Bacteria 3290
1212 Ga0496117_0059598 3300048920 Bacteria 2635
1213 Ga0496118_0003155 3300048921 Bacteria 21078
1214 Ga0496118_0004179 3300048921 Bacteria 17387
1215 Ga0496118_0070407 3300048921 Bacteria 2525
1216 Ga0496118_0095014 3300048921 Bacteria 2036
1217 Ga0496119_0000206 3300048922 Bacteria 83950
1218 Ga0496119_0000787 3300048922 Bacteria 42365
1219 Ga0496119_0116713 3300048922 Bacteria 1473
1220 Ga0496120_0000776 3300048923 Bacteria 46146
1221 Ga0496120_0057469 3300048923 Bacteria 2189
1222 Ga0496120_0070467 3300048923 Bacteria 1923
1223 Ga0496121_0000042 3300048924 Bacteria 342304
1224 Ga0496121_0000888 3300048924 Bacteria 53958
1225 Ga0496121_0009225 3300048924 Bacteria 11395
1226 Ga0496121_0017687 3300048924 Bacteria 7256
1227 Ga0496121_0266545 3300048924 Bacteria 1179
1228 Ga0496122_0000308 3300048925 Bacteria 107960
1229 Ga0496122_0000355 3300048925 Bacteria 98786
1230 Ga0496122_0054111 3300048925 Bacteria 3017
1231 Ga0496123_0000066 3300048926 Bacteria 210327
1232 Ga0496123_0001332 3300048926 Bacteria 34880
1233 Ga0496123_0016366 3300048926 Bacteria 6028
1234 Ga0496123_0137232 3300048926 Bacteria 1344
1235 Ga0496123_0243229 3300048926 Bacteria 892
1236 Ga0496124_0000001 3300048927 Bacteria 1747840
1237 Ga0496124_0001215 3300048927 Bacteria 39879
1238 Ga0496124_0003077 3300048927 Bacteria 20780
1239 Ga0496124_0031164 3300048927 Bacteria 4723
1240 Ga0496124_0035735 3300048927 Bacteria 4344
1241 Ga0496124_0164115 3300048927 Bacteria 1728
1242 Ga0496124_0164347 3300048927 Bacteria 1726
1243 Ga0496124_0229599 3300048927 Bacteria 1389
1244 Ga0496125_0000288 3300048928 Bacteria 99681
1245 Ga0496125_0000486 3300048928 Bacteria 69727
1246 Ga0496125_0013801 3300048928 Bacteria 7914
1247 Ga0496125_0030723 3300048928 Bacteria 4799
1248 Ga0496125_0057135 3300048928 Bacteria 3163
1249 Ga0496125_0064968 3300048928 Bacteria 2895
1250 Ga0496125_0068259 3300048928 Bacteria 2798
1251 Ga0496126_0000052 3300048929 Bacteria 312383
1252 Ga0496126_0000258 3300048929 Bacteria 113843
1253 Ga0496126_0000463 3300048929 Bacteria 80860
1254 Ga0496126_0002494 3300048929 Bacteria 24732
1255 Ga0496126_0054046 3300048929 Bacteria 3640
1256 Ga0501031_0229664 3300049568 Bacteria 1208
1257 Ga0501032_0038915 3300049569 Bacteria 3237
1258 Ga0501032_0076687 3300049569 Bacteria 2226
1259 Ga0501033_0000847 3300049570 Bacteria 27913
1260 Ga0501033_0035656 3300049570 Bacteria 3729
1261 Ga0501034_0000127 3300049571 Bacteria 142181
1262 Ga0501034_0020559 3300049571 Bacteria 6742
1263 Ga0501034_0139427 3300049571 Bacteria 2405
1264 Ga0501036_0020667 3300049572 Bacteria 5530
1265 Ga0501036_0081034 3300049572 Bacteria 2743
1266 Ga0501037_0040316 3300049573 Bacteria 3437
1267 Ga0501037_0060985 3300049573 Bacteria 2751
1268 Ga0501037_0192011 3300049573 Bacteria 1446
1269 Ga0501038_0048130 3300049574 Bacteria 3691
1270 Ga0501039_0045660 3300049575 Bacteria 3385
1271 Ga0501039_0082758 3300049575 Bacteria 2499
1272 Ga0501039_0095165 3300049575 Bacteria 2322
1273 Ga0501039_0255762 3300049575 Bacteria 1377
1274 Ga0501041_0103385 3300049577 Bacteria 1764
1275 Ga0501043_0002614 3300049579 Bacteria 15190
1276 Ga0501043_0092471 3300049579 Bacteria 2378
1277 Ga0501046_0023123 3300049580 Bacteria 5118
1278 Ga0501046_0147781 3300049580 Bacteria 1774
1279 Ga0501047_0001549 3300049581 Bacteria 22497
1280 Ga0501047_0031025 3300049581 Bacteria 5153
1281 Ga0501047_0088599 3300049581 Bacteria 2972
1282 Ga0501047_0095958 3300049581 Bacteria 2844
1283 Ga0501047_0191635 3300049581 Bacteria 1907
1284 Ga0501047_0229776 3300049581 Bacteria 1709
1285 Ga0501048_0058628 3300049582 Bacteria 2729
1286 Ga0501048_0212185 3300049582 Bacteria 1373
1287 Ga0501067_0006256 3300049583 Bacteria 6604
1288 Ga0501067_0039185 3300049583 Bacteria 2631
1289 Ga0501067_0087584 3300049583 Bacteria 1728
1290 Ga0501067_0175796 3300049583 Bacteria 1192
1291 Ga0501069_0005097 3300049585 Bacteria 6818
1292 Ga0501069_0054289 3300049585 Bacteria 2232
1293 Ga0501069_0091881 3300049585 Bacteria 1717
1294 Ga0501070_0000014 3300049586 Bacteria 180454
1295 Ga0501070_0004919 3300049586 Bacteria 11407
1296 Ga0501070_0017142 3300049586 Bacteria 6079
1297 Ga0501071_0147329 3300049587 Bacteria 1755
1298 Ga0501072_0007477 3300049588 Bacteria 8290
1299 Ga0501072_0353350 3300049588 Bacteria 1167
1300 Ga0501073_0012747 3300049589 Bacteria 6132
1301 Ga0501073_0078675 3300049589 Bacteria 2295
1302 Ga0501073_0084159 3300049589 Bacteria 2213
1303 Ga0501075_0016391 3300049591 Bacteria 5338
1304 Ga0501075_0205994 3300049591 Bacteria 1500
1305 Ga0501075_0242130 3300049591 Bacteria 1375
1306 Ga0501076_0102896 3300049592 Bacteria 2303
1307 Ga0501076_0104362 3300049592 Bacteria 2287
1308 Ga0501076_0167532 3300049592 Bacteria 1791
1309 Ga0501077_0018120 3300049593 Bacteria 4452
1310 Ga0501077_0024462 3300049593 Bacteria 3836
1311 Ga0501225_0003136 3300049705 Bacteria 5052
1312 Ga0501079_0016314 3300049741 Bacteria 5676
1313 Ga0501079_0022269 3300049741 Bacteria 4858
1314 Ga0501079_0091010 3300049741 Bacteria 2364
1315 Ga0501079_0115133 3300049741 Bacteria 2090
1316 Ga0501079_0203617 3300049741 Bacteria 1546
1317 Ga0501079_0443806 3300049741 Bacteria 1019
1318 Ga0501080_0001520 3300049742 Bacteria 19580
1319 Ga0501080_0002117 3300049742 Bacteria 17234
1320 Ga0501080_0058128 3300049742 Bacteria 3600
1321 Ga0501080_0164166 3300049742 Bacteria 2050
1322 Ga0501080_0266857 3300049742 Bacteria 1558
1323 Ga0501081_0069884 3300049743 Bacteria 2447
1324 Ga0501081_0270494 3300049743 Bacteria 1243
1325 Ga0501083_0013821 3300049744 Bacteria 5644
1326 Ga0501083_0119473 3300049744 Bacteria 1729
1327 Ga0501275_000135 3300049772 Bacteria 8249
1328 Ga0501280_004984 3300049776 Bacteria 1918
1329 Ga0501035_0002615 3300049822 Bacteria 17557
1330 Ga0501035_0035293 3300049822 Bacteria 4538
1331 Ga0501035_0131333 3300049822 Bacteria 2183
1332 Ga0501044_0002945 3300049823 Bacteria 19364
1333 Ga0501044_0003065 3300049823 Bacteria 18912
1334 Ga0501044_0013291 3300049823 Bacteria 8912
1335 Ga0501044_0054322 3300049823 Bacteria 4118
1336 Ga0501044_0080832 3300049823 Bacteria 3291
1337 Ga0501044_0184563 3300049823 Bacteria 2051
1338 Ga0501044_0218052 3300049823 Bacteria 1859
1339 Ga0501044_0262528 3300049823 Bacteria 1665
1340 Ga0501044_0410061 3300049823 Bacteria 1266
1341 nmdc:mga03683_120193_c1 3300050489 Bacteria 1168
1342 nmdc:mga00v17_16575_c1 3300050491 Bacteria 4154
1343 nmdc:mga00v17_200_c1 3300050491 Bacteria 36047
1344 nmdc:mga00v17_431_c1 3300050491 Bacteria 23635
1345 nmdc:mga00v17_69366_c1 3300050491 Bacteria 2182
1346 nmdc:mga07m45_143022_c1 3300050496 Bacteria 1386
1347 nmdc:mga05p37_26796_c1 3300050507 Bacteria 7010
1348 nmdc:mga09592_141809_c1 3300050508 Bacteria 2071
1349 nmdc:mga0qj67_58745_c1 3300050509 Bacteria 3049
1350 nmdc:mga06r32_113267_c1 3300050510 Unclassified 2670
1351 nmdc:mga06r32_228695_c1 3300050510 Bacteria 1848
1352 nmdc:mga06r32_35890_c1 3300050510 Bacteria 4679
1353 nmdc:mga06r32_37824_c1 3300050510 Bacteria 4566
1354 nmdc:mga06r32_639927_c1 3300050510 Bacteria 1032
1355 nmdc:mga08y16_6650_c1 3300050511 Bacteria 12128
1356 nmdc:mga08y16_91877_c1 3300050511 Bacteria 3163
1357 nmdc:mga0n895_146730_c1 3300050512 Bacteria 2389
1358 nmdc:mga0n895_228599_c1 3300050512 Bacteria 1888
1359 nmdc:mga0n895_49045_c1 3300050512 Bacteria 4135
1360 nmdc:mga0rr50_141603_c1 3300050513 Unclassified 1935
1361 nmdc:mga0rr50_78248_c1 3300050513 Bacteria 2544
1362 nmdc:mga0rr50_87687_c1 3300050513 Bacteria 2416
1363 nmdc:mga08x19_19_c1 3300050514 Bacteria 315774
1364 nmdc:mga08x19_54_c1 3300050514 Bacteria 121662
1365 nmdc:mga08x19_58705_c1 3300050514 Plasmid 2490
1366 nmdc:mga08x19_89320_c1 3300050514 Bacteria 2032
1367 nmdc:mga0a205_20211_c1 3300050515 Bacteria 6281
1368 nmdc:mga0a205_4289_c1 3300050515 Bacteria 12798
1369 Ga0495601_0007011 3300053077 Bacteria 6603
1370 Ga0495601_0021116 3300053077 Bacteria 3984
1371 Ga0495601_0143245 3300053077 Bacteria 1559
1372 Ga0495612_0017182 3300053078 Bacteria 2898
1373 Ga0500635_0000051 3300053080 Bacteria 76510
1374 Ga0495595_0000996 3300053084 Bacteria 10935
1375 Ga0495619_0000309 3300053085 Bacteria 34322
1376 Ga0500643_000336 3300053087 Bacteria 37374
1377 Ga0500643_004409 3300053087 Bacteria 6379
1378 Ga0500644_0028801 3300053088 Bacteria 1740
1379 Ga0500646_0006695 3300053090 Bacteria 2931
1380 Ga0500646_0016547 3300053090 Bacteria 1926
1381 Ga0500647_0048848 3300053091 Bacteria 2034
1382 Ga0500651_0007702 3300053093 Bacteria 6298
1383 Ga0500650_0000116 3300053098 Bacteria 21863
1384 Ga0500555_002713 3300053103 Bacteria 5089
1385 Ga0500555_005686 3300053103 Bacteria 3536
1386 Ga0500555_031233 3300053103 Bacteria 1509
1387 Ga0500556_0000092 3300053104 Bacteria 83297
1388 Ga0500556_0000217 3300053104 Bacteria 46762
1389 Ga0500556_0009403 3300053104 Bacteria 2840
1390 Ga0500556_0017250 3300053104 Bacteria 2260
1391 Ga0500556_0025337 3300053104 Bacteria 1959
1392 Ga0500562_043309 3300053108 Bacteria 1198
1393 Ga0500594_0000636 3300053118 Bacteria 7492
1394 Ga0500595_004828 3300053119 Bacteria 5964
1395 Ga0500608_070504 3300053122 Bacteria 1661
1396 Ga0500618_001619 3300053125 Bacteria 9745
1397 Ga0500621_056389 3300053126 Bacteria 1589
1398 Ga0500642_0000001 3300053130 Bacteria 1468402
1399 Ga0500652_000234 3300053131 Bacteria 21234
1400 Ga0500658_0000032 3300053134 Bacteria 90863
1401 Ga0500568_0005603 3300053139 Bacteria 6464
1402 Ga0500568_0044678 3300053139 Bacteria 1766
1403 Ga0500588_0004975 3300053146 Bacteria 2919
1404 Ga0500588_0122988 3300053146 Bacteria 917
1405 Ga0500603_028516 3300053150 Bacteria 1425
1406 Ga0500616_0063108 3300053153 Bacteria 1911
1407 Ga0500620_001156 3300053155 Bacteria 4692
1408 Ga0500622_0000441 3300053156 Bacteria 39445
1409 Ga0500622_0165105 3300053156 Bacteria 1035
1410 Ga0500624_000003 3300053157 Bacteria 253364
1411 Ga0500624_002262 3300053157 Bacteria 2645
1412 Ga0500627_0002598 3300053158 Bacteria 5399
1413 Ga0500638_014263 3300053162 Bacteria 3622
1414 Ga0500636_0070510 3300053177 Bacteria 2027
1415 Ga0500637_0000073 3300053178 Bacteria 35884
1416 Ga0500637_0001628 3300053178 Bacteria 9633
1417 Ga0500637_0006080 3300053178 Bacteria 5907
1418 Ga0500657_082053 3300053728 Bacteria 1382
1419 Ga0500645_000148 3300053730 Bacteria 54683
1420 Ga0500645_000539 3300053730 Bacteria 25211
1421 Ga0500645_004116 3300053730 Bacteria 5682
1422 Ga0501084_0011075 3300054114 Bacteria 7468
1423 Ga0501084_0046313 3300054114 Bacteria 3643
1424 Ga0501084_0076623 3300054114 Bacteria 2803
1425 Ga0501084_0266968 3300054114 Bacteria 1445
1426 Ga0501084_0314573 3300054114 Bacteria 1322
1427 Ga0501084_0393253 3300054114 Bacteria 1171
1428 Ga0501082_0001851 3300060353 Bacteria 18631
1429 Ga0501082_0075828 3300060353 Bacteria 2897
1430 Ga0501082_0240774 3300060353 Bacteria 1574
1431 Ga0530510_0101822 3300061734 Bacteria 2100
1432 Ga0530510_0112660 3300061734 Bacteria 1993
1433 Ga0530510_0172039 3300061734 Bacteria 1604

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100035888 Ga0075436_1000358882 221
2 3300026075 Ga0207708_10376863 Ga0207708_103768631 222
3 3300009174 Ga0105241_10540250 Ga0105241_105402501 226
4 3300013306 Ga0163162_10412281 Ga0163162_104122813 227
5 3300045976 Ga0466967_0018227 Ga0466967_0018227_2818_3750 227
6 3300035120 Ga0373957_0241285 Ga0373957_0241285_11_736 232
7 3300038726 Ga0400490_33215 Ga0400490_33215_1214_2098 232
8 3300039062 Ga0400483_252524 Ga0400483_252524_4018_4902 232
9 3300013307 Ga0157372_10065373 Ga0157372_100653733 233
10 3300032004 Ga0307414_10077134 Ga0307414_100771341 234
11 3300046558 Ga0495633_0057288 Ga0495633_0057288_671_1594 234
12 3300030745 Ga0316182_1155287 Ga0316182_11552873 235
13 3300009148 Ga0105243_10011445 Ga0105243_100114455 238
14 3300005563 Ga0068855_100191262 Ga0068855_1001912622 239
15 3300009093 Ga0105240_10066052 Ga0105240_100660524 239
16 3300025913 Ga0207695_10256604 Ga0207695_102566042 239
17 3300025949 Ga0207667_10120848 Ga0207667_101208482 239
18 3300049573 Ga0501037_0192011 Ga0501037_0192011_411_1286 240
19 3300049575 Ga0501039_0095165 Ga0501039_0095165_14_889 240
20 3300049577 Ga0501041_0103385 Ga0501041_0103385_359_1234 240
21 3300049582 Ga0501048_0212185 Ga0501048_0212185_149_1024 240
22 3300049591 Ga0501075_0242130 Ga0501075_0242130_348_1223 240
23 3300049592 Ga0501076_0167532 Ga0501076_0167532_769_1644 240
24 3300049741 Ga0501079_0091010 Ga0501079_0091010_1349_2224 240
25 3300049743 Ga0501081_0069884 Ga0501081_0069884_50_925 240
26 3300013306 Ga0163162_10618093 Ga0163162_106180932 242
27 3300025933 Ga0207706_10139716 Ga0207706_101397163 242
28 3300026067 Ga0207678_10193012 Ga0207678_101930121 245
29 3300035725 Ga0373947_0202870 Ga0373947_0202870_194_1114 245
30 3300037312 Ga0395899_0188808 Ga0395899_0188808_30_842 245
31 3300049582 Ga0501048_0058628 Ga0501048_0058628_11_775 245
32 3300049741 Ga0501079_0443806 Ga0501079_0443806_15_779 245
33 3300005327 Ga0070658_10020917 Ga0070658_100209175 246
34 3300009551 Ga0105238_10283784 Ga0105238_102837842 246
35 3300025909 Ga0207705_10107496 Ga0207705_101074963 246
36 3300013104 Ga0157370_10093429 Ga0157370_100934292 248
37 3300046522 Ga0495643_0170031 Ga0495643_0170031_35_802 248
38 3300009147 Ga0114129_10222886 Ga0114129_102228861 249
39 3300031911 Ga0307412_10285416 Ga0307412_102854162 249
40 3300039437 Ga0436365_1501840 Ga0436365_1501840_480_1298 249
41 3300048926 Ga0496123_0243229 Ga0496123_0243229_11_772 249
42 3300005438 Ga0070701_10003150 Ga0070701_100031507 250
43 3300005440 Ga0070705_100010706 Ga0070705_1000107064 250
44 3300005842 Ga0068858_100039178 Ga0068858_1000391784 250
45 3300009101 Ga0105247_10216949 Ga0105247_102169492 250
46 3300014968 Ga0157379_10002201 Ga0157379_100022018 250
47 3300026035 Ga0207703_10027749 Ga0207703_100277494 250
48 3300039450 Ga0436363_0214837 Ga0436363_0214837_27_815 250
49 3300041443 Ga0451789_0915396 Ga0451789_0915396_769_1578 250
50 3300053077 Ga0495601_0143245 Ga0495601_0143245_762_1538 250
51 3300053131 Ga0500652_000234 Ga0500652_000234_10164_11093 250
52 3300028380 Ga0268265_10226160 Ga0268265_102261602 251
53 3300048903 Ga0496100_0056476 Ga0496100_0056476_1602_2417 251
54 3300048904 Ga0496101_0003911 Ga0496101_0003911_6789_7604 251
55 3300048905 Ga0496102_0007555 Ga0496102_0007555_1557_2372 251
56 3300048907 Ga0496104_0006870 Ga0496104_0006870_1043_1858 251
57 3300048907 Ga0496104_0048705 Ga0496104_0048705_3120_3935 251
58 3300048909 Ga0496106_0004357 Ga0496106_0004357_8954_9769 251
59 3300048911 Ga0496108_0002873 Ga0496108_0002873_6845_7660 251
60 3300048911 Ga0496108_0300871 Ga0496108_0300871_256_1071 251
61 3300048912 Ga0496109_0003174 Ga0496109_0003174_3025_3840 251
62 3300048912 Ga0496109_0043607 Ga0496109_0043607_1873_2688 251
63 3300048913 Ga0496110_0002553 Ga0496110_0002553_11719_12534 251
64 3300048914 Ga0496111_0004928 Ga0496111_0004928_6158_6973 251
65 3300048914 Ga0496111_0022272 Ga0496111_0022272_1864_2679 251
66 3300048915 Ga0496112_0032012 Ga0496112_0032012_3204_4019 251
67 3300048918 Ga0496115_0085271 Ga0496115_0085271_1347_2162 251
68 3300049583 Ga0501067_0087584 Ga0501067_0087584_148_963 251
69 3300053146 Ga0500588_0122988 Ga0500588_0122988_13_825 251
70 3300005347 Ga0070668_100550602 Ga0070668_1005506021 252
71 3300031911 Ga0307412_10416596 Ga0307412_104165962 252
72 3300039437 Ga0436365_0138950 Ga0436365_0138950_6966_7784 252
73 3300048927 Ga0496124_0000001 Ga0496124_0000001_904536_905567 252
74 3300049776 Ga0501280_004984 Ga0501280_004984_32_817 252
75 3300014325 Ga0163163_10017716 Ga0163163_100177165 253
76 3300037466 Ga0395898_0454764 Ga0395898_0454764_175_999 253
77 3300048923 Ga0496120_0057469 Ga0496120_0057469_1345_2175 253
78 3300025292 Ga0209676_1000063 Ga0209676_100006382 254
79 3300025916 Ga0207663_10140540 Ga0207663_101405402 254
80 3300039447 Ga0436361_0534303 Ga0436361_0534303_305_1243 254
81 3300041494 Ga0451837_0019715 Ga0451837_0019715_54_980 254
82 3300048928 Ga0496125_0068259 Ga0496125_0068259_1408_2334 254
83 3300021377 Ga0213874_10004179 Ga0213874_100041793 255
84 3300035117 Ga0373953_0016807 Ga0373953_0016807_729_1556 255
85 3300035172 Ga0373955_0014552 Ga0373955_0014552_1842_2669 255
86 3300036401 Ga0373937_0001232 Ga0373937_0001232_7432_8259 255
87 3300039450 Ga0436363_0485340 Ga0436363_0485340_3420_4304 255
88 3300046533 Ga0495640_0136858 Ga0495640_0136858_642_1469 255
89 3300046689 Ga0495613_0242997 Ga0495613_0242997_101_928 255
90 3300039447 Ga0436361_0416901 Ga0436361_0416901_1358_2188 256
91 3300003775 Ga0055524_1032968 Ga0055524_10329682 257
92 3300003781 Ga0055536_1015229 Ga0055536_10152292 257
93 3300003791 Ga0055530_10000735 Ga0055530_1000073523 257
94 3300003794 Ga0055531_10016237 Ga0055531_100162374 257
95 3300003794 Ga0055531_10043335 Ga0055531_100433352 257
96 3300005455 Ga0070663_100012890 Ga0070663_1000128905 257
97 3300005539 Ga0068853_100262942 Ga0068853_1002629422 257
98 3300005563 Ga0068855_100005557 Ga0068855_1000055575 257
99 3300005615 Ga0070702_100107149 Ga0070702_1001071492 257
100 3300006844 Ga0075428_100235699 Ga0075428_1002356992 257
101 3300009093 Ga0105240_10027485 Ga0105240_100274852 257
102 3300009147 Ga0114129_10055454 Ga0114129_100554545 257
103 3300025273 Ga0209673_1019973 Ga0209673_10199733 257
104 3300025284 Ga0209130_1005244 Ga0209130_10052444 257
105 3300025291 Ga0209675_1005027 Ga0209675_10050273 257
106 3300025294 Ga0209025_1001794 Ga0209025_10017949 257
107 3300025298 Ga0209050_1001391 Ga0209050_10013916 257
108 3300025299 Ga0209256_1002151 Ga0209256_10021515 257
109 3300025304 Ga0209257_1000861 Ga0209257_100086111 257
110 3300025304 Ga0209257_1002921 Ga0209257_100292115 257
111 3300025304 Ga0209257_1004367 Ga0209257_10043676 257
112 3300025304 Ga0209257_1008020 Ga0209257_10080202 257
113 3300025913 Ga0207695_10017819 Ga0207695_100178192 257
114 3300025932 Ga0207690_10286878 Ga0207690_102868781 257
115 3300025949 Ga0207667_10009379 Ga0207667_100093798 257
116 3300026067 Ga0207678_10026877 Ga0207678_100268775 257
117 3300026075 Ga0207708_10165025 Ga0207708_101650253 257
118 3300044842 Ga0466957_0058893 Ga0466957_0058893_641_1525 257
119 3300045049 Ga0466959_0106995 Ga0466959_0106995_997_1881 257
120 3300046517 Ga0495630_0008243 Ga0495630_0008243_952_1824 257
121 3300048912 Ga0496109_0000015 Ga0496109_0000015_16781_17617 257
122 3300049579 Ga0501043_0002614 Ga0501043_0002614_3142_4050 257
123 3300050507 nmdc:mga05p37_26796_c1 nmdc:mga05p37_26796_c1_5308_6147 257
124 3300050510 nmdc:mga06r32_113267_c1 nmdc:mga06r32_113267_c1_27_866 257
125 3300050510 nmdc:mga06r32_35890_c1 nmdc:mga06r32_35890_c1_2287_3126 257
126 3300050511 nmdc:mga08y16_6650_c1 nmdc:mga08y16_6650_c1_1951_2790 257
127 3300050512 nmdc:mga0n895_49045_c1 nmdc:mga0n895_49045_c1_1349_2188 257
128 3300050515 nmdc:mga0a205_20211_c1 nmdc:mga0a205_20211_c1_5111_5950 257
129 3300053080 Ga0500635_0000051 Ga0500635_0000051_48337_49212 257
130 3300053091 Ga0500647_0048848 Ga0500647_0048848_678_1553 257
131 3300053146 Ga0500588_0004975 Ga0500588_0004975_1781_2707 257
132 3300053150 Ga0500603_028516 Ga0500603_028516_309_1184 257
133 3300053157 Ga0500624_002262 Ga0500624_002262_1594_2469 257
134 3300053162 Ga0500638_014263 Ga0500638_014263_817_1692 257
135 3300053177 Ga0500636_0070510 Ga0500636_0070510_691_1566 257
136 3300053178 Ga0500637_0001628 Ga0500637_0001628_7919_8794 257
137 3300054114 Ga0501084_0314573 Ga0501084_0314573_361_1200 257
138 3300041509 Ga0451843_0997273 Ga0451843_0997273_805_1704 258
139 3300005347 Ga0070668_100059844 Ga0070668_1000598443 259
140 3300005353 Ga0070669_100344635 Ga0070669_1003446351 259
141 3300005459 Ga0068867_100196206 Ga0068867_1001962062 259
142 3300005543 Ga0070672_100050260 Ga0070672_1000502604 259
143 3300005577 Ga0068857_100011431 Ga0068857_1000114313 259
144 3300009545 Ga0105237_10185971 Ga0105237_101859712 259
145 3300013102 Ga0157371_10106097 Ga0157371_101060972 259
146 3300021377 Ga0213874_10043283 Ga0213874_100432832 259
147 3300025907 Ga0207645_10049484 Ga0207645_100494842 259
148 3300025940 Ga0207691_10049985 Ga0207691_100499854 259
149 3300025942 Ga0207689_10215197 Ga0207689_102151972 259
150 3300026116 Ga0207674_10157030 Ga0207674_101570302 259
151 3300039062 Ga0400483_133234 Ga0400483_133234_1759_2658 259
152 3300039450 Ga0436363_1408746 Ga0436363_1408746_221_1105 259
153 3300049580 Ga0501046_0023123 Ga0501046_0023123_864_1763 259
154 3300049588 Ga0501072_0353350 Ga0501072_0353350_211_1122 259
155 3300050491 nmdc:mga00v17_16575_c1 nmdc:mga00v17_16575_c1_99_1031 259
156 3300050491 nmdc:mga00v17_69366_c1 nmdc:mga00v17_69366_c1_1152_2084 259
157 3300005334 Ga0068869_100016059 Ga0068869_1000160595 260
158 3300005435 Ga0070714_100315143 Ga0070714_1003151431 260
159 3300005539 Ga0068853_100001563 Ga0068853_1000015636 260
160 3300005617 Ga0068859_100188938 Ga0068859_1001889383 260
161 3300005841 Ga0068863_100003508 Ga0068863_10000350811 260
162 3300005843 Ga0068860_100017042 Ga0068860_1000170426 260
163 3300006881 Ga0068865_100116088 Ga0068865_1001160882 260
164 3300006931 Ga0097620_100188918 Ga0097620_1001889183 260
165 3300009176 Ga0105242_10002451 Ga0105242_1000245110 260
166 3300010375 Ga0105239_10001780 Ga0105239_1000178013 260
167 3300013102 Ga0157371_10167244 Ga0157371_101672442 260
168 3300013306 Ga0163162_10027266 Ga0163162_100272667 260
169 3300013306 Ga0163162_10253603 Ga0163162_102536032 260
170 3300013308 Ga0157375_10000144 Ga0157375_1000014431 260
171 3300014325 Ga0163163_10008166 Ga0163163_1000816610 260
172 3300014968 Ga0157379_10004862 Ga0157379_100048628 260
173 3300014969 Ga0157376_10004137 Ga0157376_1000413711 260
174 3300025916 Ga0207663_10107229 Ga0207663_101072292 260
175 3300025929 Ga0207664_10203081 Ga0207664_102030812 260
176 3300025934 Ga0207686_10057887 Ga0207686_100578873 260
177 3300025938 Ga0207704_10013711 Ga0207704_100137113 260
178 3300025938 Ga0207704_10264517 Ga0207704_102645172 260
179 3300026041 Ga0207639_10009068 Ga0207639_100090684 260
180 3300026088 Ga0207641_10016815 Ga0207641_100168153 260
181 3300026121 Ga0207683_10074023 Ga0207683_100740233 260
182 3300028379 Ga0268266_10119760 Ga0268266_101197602 260
183 3300028381 Ga0268264_10040000 Ga0268264_100400001 260
184 3300031730 Ga0307516_10065290 Ga0307516_100652903 260
185 3300041460 Ga0451802_1915534 Ga0451802_1915534_214_1113 260
186 3300041494 Ga0451837_1224968 Ga0451837_1224968_3087_3986 260
187 3300048907 Ga0496104_0000005 Ga0496104_0000005_524987_525853 260
188 3300048908 Ga0496105_0000018 Ga0496105_0000018_90572_91438 260
189 3300049571 Ga0501034_0000127 Ga0501034_0000127_128781_129689 260
190 3300049742 Ga0501080_0001520 Ga0501080_0001520_1803_2654 260
191 3300005618 Ga0068864_100000106 Ga0068864_10000010649 261
192 3300005841 Ga0068863_100000079 Ga0068863_100000079104 261
193 3300005842 Ga0068858_100000006 Ga0068858_100000006103 261
194 3300009092 Ga0105250_10030095 Ga0105250_100300951 261
195 3300009177 Ga0105248_10000789 Ga0105248_100007898 261
196 3300009177 Ga0105248_10011687 Ga0105248_100116879 261
197 3300010375 Ga0105239_10080575 Ga0105239_100805752 261
198 3300021384 Ga0213876_10008313 Ga0213876_100083135 261
199 3300025941 Ga0207711_10003286 Ga0207711_1000328611 261
200 3300025941 Ga0207711_10004051 Ga0207711_100040514 261
201 3300026035 Ga0207703_10000027 Ga0207703_1000002730 261
202 3300026088 Ga0207641_10000003 Ga0207641_10000003344 261
203 3300026095 Ga0207676_10007358 Ga0207676_100073584 261
204 3300028573 Ga0265334_10043808 Ga0265334_100438082 261
205 3300031240 Ga0265320_10004662 Ga0265320_100046626 261
206 3300031712 Ga0265342_10198541 Ga0265342_101985411 261
207 3300037471 Ga0395905_0042939 Ga0395905_0042939_1455_2336 261
208 3300038741 Ga0400488_63061 Ga0400488_63061_618_1523 261
209 3300039062 Ga0400483_135634 Ga0400483_135634_368_1273 261
210 3300039062 Ga0400483_227477 Ga0400483_227477_142_1047 261
211 3300039437 Ga0436365_0961511 Ga0436365_0961511_570_1475 261
212 3300039447 Ga0436361_0095589 Ga0436361_0095589_115_999 261
213 3300044693 Ga0466961_0190624 Ga0466961_0190624_326_1201 261
214 3300046516 Ga0495628_0008875 Ga0495628_0008875_6794_7678 261
215 3300046517 Ga0495630_0019912 Ga0495630_0019912_1183_2067 261
216 3300048917 Ga0496114_0110570 Ga0496114_0110570_975_1847 261
217 3300048918 Ga0496115_0000002 Ga0496115_0000002_289250_290122 261
218 3300048920 Ga0496117_0059598 Ga0496117_0059598_1667_2575 261
219 3300048921 Ga0496118_0095014 Ga0496118_0095014_719_1627 261
220 3300048924 Ga0496121_0000042 Ga0496121_0000042_158889_159797 261
221 3300048929 Ga0496126_0000052 Ga0496126_0000052_236421_237293 261
222 3300049570 Ga0501033_0035656 Ga0501033_0035656_1475_2371 261
223 3300049575 Ga0501039_0255762 Ga0501039_0255762_287_1183 261
224 3300049823 Ga0501044_0054322 Ga0501044_0054322_766_1662 261
225 3300005578 Ga0068854_100220678 Ga0068854_1002206781 262
226 3300005843 Ga0068860_100321734 Ga0068860_1003217342 262
227 3300005937 Ga0081455_10034420 Ga0081455_100344203 262
228 3300013105 Ga0157369_10087264 Ga0157369_100872644 262
229 3300031995 Ga0307409_100047886 Ga0307409_1000478863 262
230 3300035692 Ga0373935_0101921 Ga0373935_0101921_517_1395 262
231 3300037312 Ga0395899_0159725 Ga0395899_0159725_497_1444 262
232 3300037466 Ga0395898_0081810 Ga0395898_0081810_1052_1999 262
233 3300038443 Ga0395901_0030728 Ga0395901_0030728_837_1784 262
234 3300038742 Ga0400486_10450 Ga0400486_10450_412_1368 262
235 3300046455 Ga0495603_0108960 Ga0495603_0108960_41_934 262
236 3300046499 Ga0495594_0033264 Ga0495594_0033264_342_1235 262
237 3300046516 Ga0495628_0000643 Ga0495628_0000643_1558_2424 262
238 3300046530 Ga0495654_0105984 Ga0495654_0105984_109_1020 262
239 3300046557 Ga0495622_0006793 Ga0495622_0006793_3754_4647 262
240 3300048091 Ga0495626_0073853 Ga0495626_0073853_450_1343 262
241 3300053090 Ga0500646_0016547 Ga0500646_0016547_570_1463 262
242 3300053103 Ga0500555_002713 Ga0500555_002713_3553_4455 262
243 3300053178 Ga0500637_0006080 Ga0500637_0006080_4577_5470 262
244 iso_pu_bacteria 2551306352 2552749139 262
245 iso_pu_bacteria 2639762793 2640734086 262
246 iso_pu_bacteria 2675903507 2678231061 262
247 iso_pu_bacteria 2744054655 2745160185 262
248 iso_pu_bacteria 2773857761 2774388390 262
249 iso_pu_bacteria 2773857770 2774437592 262
250 iso_pu_bacteria 2883354860 2883359923 262
251 iso_pu_bacteria 2916699645 2916702072 262
252 iso_pu_bacteria 2919182534 2919183973 262
253 iso_pu_bacteria 2919506607 2919507821 262
254 iso_pu_bacteria 8015556637 8015559062 262
255 iso_pu_bacteria 8033232454 8033232747 262
256 3300005331 Ga0070670_100000002 Ga0070670_10000000285 263
257 3300005331 Ga0070670_100000004 Ga0070670_100000004125 263
258 3300005335 Ga0070666_10022684 Ga0070666_100226844 263
259 3300005335 Ga0070666_10153050 Ga0070666_101530501 263
260 3300005347 Ga0070668_100001643 Ga0070668_1000016439 263
261 3300005353 Ga0070669_100096073 Ga0070669_1000960732 263
262 3300005355 Ga0070671_100000094 Ga0070671_10000009447 263
263 3300005367 Ga0070667_100000018 Ga0070667_10000001884 263
264 3300005367 Ga0070667_100000105 Ga0070667_10000010512 263
265 3300005466 Ga0070685_10000001 Ga0070685_10000001299 263
266 3300005548 Ga0070665_100001194 Ga0070665_10000119425 263
267 3300005563 Ga0068855_100776242 Ga0068855_1007762421 263
268 3300005577 Ga0068857_100094324 Ga0068857_1000943242 263
269 3300005617 Ga0068859_100019995 Ga0068859_1000199953 263
270 3300005617 Ga0068859_100067314 Ga0068859_1000673144 263
271 3300005618 Ga0068864_100000003 Ga0068864_10000000386 263
272 3300005618 Ga0068864_100000082 Ga0068864_100000082106 263
273 3300005841 Ga0068863_100000560 Ga0068863_10000056029 263
274 3300005842 Ga0068858_100031660 Ga0068858_1000316607 263
275 3300005842 Ga0068858_100060498 Ga0068858_1000604984 263
276 3300005843 Ga0068860_100000077 Ga0068860_100000077125 263
277 3300005843 Ga0068860_100005872 Ga0068860_10000587211 263
278 3300005843 Ga0068860_100474456 Ga0068860_1004744562 263
279 3300005844 Ga0068862_100000183 Ga0068862_1000001834 263
280 3300005844 Ga0068862_100006226 Ga0068862_1000062263 263
281 3300005844 Ga0068862_100022521 Ga0068862_1000225213 263
282 3300006175 Ga0070712_100139503 Ga0070712_1001395031 263
283 3300006931 Ga0097620_100019995 Ga0097620_1000199953 263
284 3300006931 Ga0097620_100067314 Ga0097620_1000673142 263
285 3300009094 Ga0111539_10119671 Ga0111539_101196714 263
286 3300009101 Ga0105247_10031507 Ga0105247_100315074 263
287 3300009147 Ga0114129_10143619 Ga0114129_101436192 263
288 3300009177 Ga0105248_10014093 Ga0105248_100140931 263
289 3300009553 Ga0105249_10000838 Ga0105249_100008382 263
290 3300009553 Ga0105249_10015705 Ga0105249_100157054 263
291 3300009553 Ga0105249_10100564 Ga0105249_101005643 263
292 3300013306 Ga0163162_10238791 Ga0163162_102387912 263
293 3300014325 Ga0163163_10000145 Ga0163163_1000014520 263
294 3300014325 Ga0163163_10656768 Ga0163163_106567681 263
295 3300014968 Ga0157379_10018883 Ga0157379_100188835 263
296 3300014968 Ga0157379_10123021 Ga0157379_101230212 263
297 3300025900 Ga0207710_10035391 Ga0207710_100353914 263
298 3300025903 Ga0207680_10005098 Ga0207680_100050984 263
299 3300025903 Ga0207680_10012307 Ga0207680_100123075 263
300 3300025912 Ga0207707_10032738 Ga0207707_100327382 263
301 3300025913 Ga0207695_10197157 Ga0207695_101971572 263
302 3300025923 Ga0207681_10083733 Ga0207681_100837332 263
303 3300025923 Ga0207681_10132563 Ga0207681_101325633 263
304 3300025925 Ga0207650_10000003 Ga0207650_10000003640 263
305 3300025925 Ga0207650_10000033 Ga0207650_10000033219 263
306 3300025931 Ga0207644_10000013 Ga0207644_100000133 263
307 3300025941 Ga0207711_10000290 Ga0207711_1000029020 263
308 3300025941 Ga0207711_10000950 Ga0207711_1000095013 263
309 3300025941 Ga0207711_10035362 Ga0207711_100353624 263
310 3300025949 Ga0207667_10464388 Ga0207667_104643881 263
311 3300025961 Ga0207712_10000651 Ga0207712_100006512 263
312 3300025961 Ga0207712_10009828 Ga0207712_100098284 263
313 3300025972 Ga0207668_10000426 Ga0207668_100004268 263
314 3300025986 Ga0207658_10000004 Ga0207658_1000000487 263
315 3300025986 Ga0207658_10000229 Ga0207658_1000022962 263
316 3300026035 Ga0207703_10041892 Ga0207703_100418924 263
317 3300026035 Ga0207703_10070497 Ga0207703_100704973 263
318 3300026088 Ga0207641_10001887 Ga0207641_100018878 263
319 3300026095 Ga0207676_10000003 Ga0207676_10000003455 263
320 3300026095 Ga0207676_10000068 Ga0207676_1000006889 263
321 3300028379 Ga0268266_10004139 Ga0268266_100041398 263
322 3300028379 Ga0268266_10047634 Ga0268266_100476342 263
323 3300028380 Ga0268265_10001499 Ga0268265_100014996 263
324 3300028380 Ga0268265_10004547 Ga0268265_100045475 263
325 3300028380 Ga0268265_10013087 Ga0268265_100130877 263
326 3300028381 Ga0268264_10000009 Ga0268264_1000000931 263
327 3300028381 Ga0268264_10000032 Ga0268264_10000032290 263
328 3300031251 Ga0265327_10010799 Ga0265327_100107997 263
329 3300031903 Ga0307407_10299767 Ga0307407_102997672 263
330 3300035695 Ga0373927_0000001 Ga0373927_0000001_8944_9816 263
331 3300046530 Ga0495654_0000143 Ga0495654_0000143_48912_49790 263
332 3300046539 Ga0495621_0069355 Ga0495621_0069355_415_1278 263
333 3300047315 Ga0495581_0022861 Ga0495581_0022861_2635_3537 263
334 3300048905 Ga0496102_0081113 Ga0496102_0081113_1317_2222 263
335 3300048927 Ga0496124_0164347 Ga0496124_0164347_806_1693 263
336 3300049772 Ga0501275_000135 Ga0501275_000135_5152_6063 263
337 3300050508 nmdc:mga09592_141809_c1 nmdc:mga09592_141809_c1_1068_1937 263
338 3300050511 nmdc:mga08y16_91877_c1 nmdc:mga08y16_91877_c1_168_1052 263
339 iso_pu_bacteria 2643221581 2643914476 263
340 iso_pu_bacteria 2671180139 2671693604 263
341 iso_pu_bacteria 2883291878 2883297141 263
342 iso_pu_bacteria 2984568884 2984570164 263
343 3300005347 Ga0070668_100002624 Ga0070668_1000026247 264
344 3300005435 Ga0070714_100029776 Ga0070714_1000297763 264
345 3300005439 Ga0070711_100000012 Ga0070711_100000012113 264
346 3300005439 Ga0070711_100040037 Ga0070711_1000400373 264
347 3300005458 Ga0070681_10050441 Ga0070681_100504413 264
348 3300005530 Ga0070679_100131470 Ga0070679_1001314702 264
349 3300005548 Ga0070665_100000198 Ga0070665_10000019831 264
350 3300005578 Ga0068854_100173356 Ga0068854_1001733562 264
351 3300005842 Ga0068858_100797493 Ga0068858_1007974931 264
352 3300006914 Ga0075436_100000463 Ga0075436_10000046313 264
353 3300007076 Ga0075435_100160203 Ga0075435_1001602032 264
354 3300014969 Ga0157376_10543791 Ga0157376_105437912 264
355 3300025909 Ga0207705_10505294 Ga0207705_105052941 264
356 3300025912 Ga0207707_10108321 Ga0207707_101083211 264
357 3300025916 Ga0207663_10000014 Ga0207663_10000014111 264
358 3300025928 Ga0207700_10061566 Ga0207700_100615663 264
359 3300025929 Ga0207664_10006047 Ga0207664_100060473 264
360 3300025929 Ga0207664_10014026 Ga0207664_100140266 264
361 3300025972 Ga0207668_10000004 Ga0207668_1000000492 264
362 3300025986 Ga0207658_10039423 Ga0207658_100394234 264
363 3300028379 Ga0268266_10001373 Ga0268266_100013737 264
364 3300028380 Ga0268265_10108840 Ga0268265_101088402 264
365 3300028573 Ga0265334_10011266 Ga0265334_100112663 264
366 3300028800 Ga0265338_10023035 Ga0265338_100230357 264
367 3300030731 Ga0316177_1170645 Ga0316177_11706452 264
368 3300030733 Ga0314311_1183412 Ga0314311_11834124 264
369 3300031595 Ga0265313_10004290 Ga0265313_100042905 264
370 3300031691 Ga0316579_10082979 Ga0316579_100829791 264
371 3300031733 Ga0316577_10072358 Ga0316577_100723582 264
372 3300031901 Ga0307406_10184897 Ga0307406_101848972 264
373 3300032137 Ga0316585_10079882 Ga0316585_100798822 264
374 3300032168 Ga0316593_10000719 Ga0316593_100007195 264
375 3300035725 Ga0373947_0267870 Ga0373947_0267870_245_1099 264
376 3300036647 Ga0316582_0025101 Ga0316582_0025101_286_1164 264
377 3300036712 Ga0316584_0173226 Ga0316584_0173226_499_1377 264
378 3300037418 Ga0395900_0001243 Ga0395900_0001243_27233_28105 264
379 3300039438 Ga0436360_0438284 Ga0436360_0438284_1726_2610 264
380 3300041413 Ga0439465_0000821 Ga0439465_0000821_8605_9519 264
381 3300041509 Ga0451843_0505550 Ga0451843_0505550_784_1701 264
382 3300042007 Ga0439449_0000005 Ga0439449_0000005_6507_7406 264
383 3300042876 Ga0451577_0013406 Ga0451577_0013406_5265_6179 264
384 3300044712 Ga0453684_0265723 Ga0453684_0265723_231_1145 264
385 3300046533 Ga0495640_0090849 Ga0495640_0090849_1000_1851 264
386 3300049705 Ga0501225_0003136 Ga0501225_0003136_3561_4460 264
387 3300050513 nmdc:mga0rr50_141603_c1 nmdc:mga0rr50_141603_c1_174_1040 264
388 3300050514 nmdc:mga08x19_19_c1 nmdc:mga08x19_19_c1_229363_230223 264
389 3300050514 nmdc:mga08x19_58705_c1 nmdc:mga08x19_58705_c1_277_1143 264
390 3300053104 Ga0500556_0017250 Ga0500556_0017250_263_1162 264
391 iso_pu_bacteria 8002869464 8002870509 264
392 iso_pu_bacteria 8054563764 8054566031 264
393 3300003794 Ga0055531_10012552 Ga0055531_100125524 265
394 3300005327 Ga0070658_10044630 Ga0070658_100446304 265
395 3300005328 Ga0070676_10041747 Ga0070676_100417473 265
396 3300005329 Ga0070683_100000479 Ga0070683_10000047912 265
397 3300005331 Ga0070670_100000594 Ga0070670_10000059414 265
398 3300005334 Ga0068869_100130623 Ga0068869_1001306232 265
399 3300005336 Ga0070680_100059100 Ga0070680_1000591003 265
400 3300005344 Ga0070661_100000367 Ga0070661_1000003672 265
401 3300005347 Ga0070668_100037808 Ga0070668_1000378082 265
402 3300005354 Ga0070675_100000494 Ga0070675_10000049411 265
403 3300005355 Ga0070671_100001151 Ga0070671_1000011514 265
404 3300005355 Ga0070671_100037740 Ga0070671_1000377404 265
405 3300005364 Ga0070673_100001037 Ga0070673_1000010379 265
406 3300005366 Ga0070659_100008001 Ga0070659_1000080014 265
407 3300005435 Ga0070714_100001453 Ga0070714_1000014535 265
408 3300005439 Ga0070711_100020963 Ga0070711_1000209633 265
409 3300005445 Ga0070708_100038486 Ga0070708_1000384864 265
410 3300005456 Ga0070678_100001072 Ga0070678_1000010723 265
411 3300005458 Ga0070681_10081458 Ga0070681_100814583 265
412 3300005459 Ga0068867_100013925 Ga0068867_1000139257 265
413 3300005459 Ga0068867_100018820 Ga0068867_1000188202 265
414 3300005468 Ga0070707_100132587 Ga0070707_1001325872 265
415 3300005530 Ga0070679_100497223 Ga0070679_1004972231 265
416 3300005535 Ga0070684_100005553 Ga0070684_10000555311 265
417 3300005535 Ga0070684_100037546 Ga0070684_1000375461 265
418 3300005539 Ga0068853_100151898 Ga0068853_1001518982 265
419 3300005543 Ga0070672_100000296 Ga0070672_10000029615 265
420 3300005564 Ga0070664_100000600 Ga0070664_10000060011 265
421 3300005564 Ga0070664_100001724 Ga0070664_10000172410 265
422 3300005577 Ga0068857_100002588 Ga0068857_10000258818 265
423 3300005578 Ga0068854_100007111 Ga0068854_1000071112 265
424 3300005578 Ga0068854_100026474 Ga0068854_1000264745 265
425 3300005614 Ga0068856_100230290 Ga0068856_1002302901 265
426 3300005616 Ga0068852_100001015 Ga0068852_10000101515 265
427 3300005616 Ga0068852_100001646 Ga0068852_10000164616 265
428 3300005618 Ga0068864_100017157 Ga0068864_1000171572 265
429 3300005719 Ga0068861_100007289 Ga0068861_1000072892 265
430 3300005834 Ga0068851_10031422 Ga0068851_100314222 265
431 3300005840 Ga0068870_10099198 Ga0068870_100991982 265
432 3300005841 Ga0068863_100020113 Ga0068863_1000201131 265
433 3300005844 Ga0068862_100026865 Ga0068862_1000268651 265
434 3300005844 Ga0068862_100135164 Ga0068862_1001351642 265
435 3300005844 Ga0068862_100203078 Ga0068862_1002030782 265
436 3300005937 Ga0081455_10001053 Ga0081455_100010537 265
437 3300005937 Ga0081455_10034469 Ga0081455_100344694 265
438 3300005985 Ga0081539_10003150 Ga0081539_1000315020 265
439 3300006051 Ga0075364_10001168 Ga0075364_100011685 265
440 3300006237 Ga0097621_100002067 Ga0097621_10000206714 265
441 3300006358 Ga0068871_100001398 Ga0068871_10000139813 265
442 3300006844 Ga0075428_100022864 Ga0075428_1000228647 265
443 3300006844 Ga0075428_100308611 Ga0075428_1003086112 265
444 3300006846 Ga0075430_100072924 Ga0075430_1000729243 265
445 3300006847 Ga0075431_100018811 Ga0075431_1000188114 265
446 3300006847 Ga0075431_100151857 Ga0075431_1001518572 265
447 3300006847 Ga0075431_100658457 Ga0075431_1006584571 265
448 3300006852 Ga0075433_10055028 Ga0075433_100550282 265
449 3300006880 Ga0075429_100059475 Ga0075429_1000594752 265
450 3300009093 Ga0105240_10007477 Ga0105240_1000747718 265
451 3300009545 Ga0105237_10054385 Ga0105237_100543853 265
452 3300009551 Ga0105238_10002367 Ga0105238_100023672 265
453 3300013104 Ga0157370_10013571 Ga0157370_1001357110 265
454 3300013105 Ga0157369_10016738 Ga0157369_1001673810 265
455 3300013296 Ga0157374_10475657 Ga0157374_104756571 265
456 3300013297 Ga0157378_10010920 Ga0157378_100109203 265
457 3300013297 Ga0157378_10465757 Ga0157378_104657572 265
458 3300014326 Ga0157380_10072743 Ga0157380_100727433 265
459 3300014968 Ga0157379_10066868 Ga0157379_100668683 265
460 3300025292 Ga0209676_1001849 Ga0209676_100184917 265
461 3300025294 Ga0209025_1004726 Ga0209025_100472611 265
462 3300025295 Ga0209564_1026008 Ga0209564_10260082 265
463 3300025304 Ga0209257_1001769 Ga0209257_100176918 265
464 3300025321 Ga0207656_10007484 Ga0207656_100074845 265
465 3300025321 Ga0207656_10186665 Ga0207656_101866651 265
466 3300025901 Ga0207688_10010619 Ga0207688_100106194 265
467 3300025909 Ga0207705_10160957 Ga0207705_101609572 265
468 3300025916 Ga0207663_10025004 Ga0207663_100250042 265
469 3300025917 Ga0207660_10045661 Ga0207660_100456612 265
470 3300025920 Ga0207649_10044337 Ga0207649_100443372 265
471 3300025921 Ga0207652_10005171 Ga0207652_1000517112 265
472 3300025922 Ga0207646_10029093 Ga0207646_100290936 265
473 3300025924 Ga0207694_10000488 Ga0207694_100004884 265
474 3300025925 Ga0207650_10001730 Ga0207650_100017309 265
475 3300025926 Ga0207659_10001138 Ga0207659_100011384 265
476 3300025929 Ga0207664_10011167 Ga0207664_100111679 265
477 3300025931 Ga0207644_10001066 Ga0207644_1000106615 265
478 3300025931 Ga0207644_10010080 Ga0207644_100100803 265
479 3300025932 Ga0207690_10030107 Ga0207690_100301073 265
480 3300025933 Ga0207706_10017330 Ga0207706_100173307 265
481 3300025940 Ga0207691_10000381 Ga0207691_1000038124 265
482 3300025944 Ga0207661_10114027 Ga0207661_101140272 265
483 3300025945 Ga0207679_10003402 Ga0207679_1000340211 265
484 3300025945 Ga0207679_10010949 Ga0207679_100109494 265
485 3300025972 Ga0207668_10016309 Ga0207668_100163093 265
486 3300026023 Ga0207677_10001566 Ga0207677_1000156611 265
487 3300026078 Ga0207702_10001739 Ga0207702_1000173923 265
488 3300026089 Ga0207648_10029134 Ga0207648_100291342 265
489 3300026089 Ga0207648_10096960 Ga0207648_100969603 265
490 3300026095 Ga0207676_10192798 Ga0207676_101927983 265
491 3300026116 Ga0207674_10000014 Ga0207674_10000014130 265
492 3300026118 Ga0207675_100009359 Ga0207675_1000093592 265
493 3300026121 Ga0207683_10001475 Ga0207683_1000147514 265
494 3300026142 Ga0207698_10001465 Ga0207698_100014655 265
495 3300027907 Ga0207428_10269336 Ga0207428_102693362 265
496 3300028380 Ga0268265_10216316 Ga0268265_102163162 265
497 3300028573 Ga0265334_10000330 Ga0265334_1000033012 265
498 3300028800 Ga0265338_10158623 Ga0265338_101586232 265
499 3300031241 Ga0265325_10015985 Ga0265325_100159853 265
500 3300031595 Ga0265313_10000351 Ga0265313_1000035131 265
501 3300031691 Ga0316579_10001465 Ga0316579_100014656 265
502 3300032133 Ga0316583_10035116 Ga0316583_100351162 265
503 3300032168 Ga0316593_10000644 Ga0316593_100006443 265
504 3300035691 Ga0373931_0107602 Ga0373931_0107602_277_1140 265
505 3300035695 Ga0373927_0064367 Ga0373927_0064367_579_1442 265
506 3300035724 Ga0373933_0050041 Ga0373933_0050041_323_1198 265
507 3300035724 Ga0373933_0114563 Ga0373933_0114563_376_1239 265
508 3300035725 Ga0373947_0099948 Ga0373947_0099948_122_1000 265
509 3300036401 Ga0373937_0010393 Ga0373937_0010393_7178_8041 265
510 3300036401 Ga0373937_0159581 Ga0373937_0159581_144_1019 265
511 3300036647 Ga0316582_0030009 Ga0316582_0030009_63_947 265
512 3300036647 Ga0316582_0387086 Ga0316582_0387086_19_924 265
513 3300036712 Ga0316584_0012487 Ga0316584_0012487_1108_2013 265
514 3300036712 Ga0316584_0064388 Ga0316584_0064388_443_1381 265
515 3300037068 Ga0373925_0017823 Ga0373925_0017823_2754_3617 265
516 3300037418 Ga0395900_0277031 Ga0395900_0277031_67_1071 265
517 3300037588 Ga0316581_0034830 Ga0316581_0034830_355_1239 265
518 3300038742 Ga0400486_00542 Ga0400486_00542_293_1180 265
519 3300039093 Ga0400489_67955 Ga0400489_67955_85_969 265
520 3300039093 Ga0400489_73156 Ga0400489_73156_224_1108 265
521 3300039450 Ga0436363_1461336 Ga0436363_1461336_589_1461 265
522 3300041404 Ga0439436_0001101 Ga0439436_0001101_284_1186 265
523 3300044673 Ga0453683_0003598 Ga0453683_0003598_800_1741 265
524 3300044712 Ga0453684_0141280 Ga0453684_0141280_788_1729 265
525 3300045051 Ga0451576_0000479 Ga0451576_0000479_3775_4716 265
526 3300046454 Ga0495592_0064784 Ga0495592_0064784_959_1837 265
527 3300046543 Ga0495645_0308464 Ga0495645_0308464_155_1018 265
528 3300046615 Ga0495656_0006815 Ga0495656_0006815_1757_2665 265
529 3300047319 Ga0495674_0283028 Ga0495674_0283028_457_1329 265
530 3300048907 Ga0496104_0000118 Ga0496104_0000118_8980_9846 265
531 3300048908 Ga0496105_0000056 Ga0496105_0000056_8980_9846 265
532 3300048908 Ga0496105_0100718 Ga0496105_0100718_506_1369 265
533 3300048915 Ga0496112_0018667 Ga0496112_0018667_2698_3561 265
534 3300048916 Ga0496113_0054754 Ga0496113_0054754_1970_2833 265
535 3300048917 Ga0496114_0022877 Ga0496114_0022877_491_1357 265
536 3300048922 Ga0496119_0000206 Ga0496119_0000206_55653_56519 265
537 3300048922 Ga0496119_0116713 Ga0496119_0116713_38_901 265
538 3300050491 nmdc:mga00v17_200_c1 nmdc:mga00v17_200_c1_8721_9647 265
539 3300050509 nmdc:mga0qj67_58745_c1 nmdc:mga0qj67_58745_c1_1780_2661 265
540 3300050510 nmdc:mga06r32_37824_c1 nmdc:mga06r32_37824_c1_1719_2600 265
541 3300053103 Ga0500555_031233 Ga0500555_031233_84_956 265
542 iso_pu_bacteria 2643221559 2643817966 265
543 iso_pu_bacteria 2643221586 2643937624 265
544 iso_pu_bacteria 2643221612 2644078538 265
545 iso_pu_bacteria 2643221727 2644693315 265
546 iso_pu_bacteria 2987605356 2987606915 265
547 iso_pu_bacteria 8003014200 8003017885 265
548 3300003856 Ga0058692_1000003 Ga0058692_1000003105 266
549 3300005272 Ga0065703_1000145 Ga0065703_100014568 266
550 3300005335 Ga0070666_10000196 Ga0070666_100001966 266
551 3300005336 Ga0070680_100001064 Ga0070680_10000106420 266
552 3300005338 Ga0068868_100655641 Ga0068868_1006556411 266
553 3300005341 Ga0070691_10000339 Ga0070691_1000033911 266
554 3300005347 Ga0070668_100045394 Ga0070668_1000453941 266
555 3300005353 Ga0070669_100012016 Ga0070669_1000120164 266
556 3300005434 Ga0070709_10000408 Ga0070709_100004084 266
557 3300005434 Ga0070709_10076039 Ga0070709_100760392 266
558 3300005436 Ga0070713_100000333 Ga0070713_1000003339 266
559 3300005437 Ga0070710_10056604 Ga0070710_100566043 266
560 3300005444 Ga0070694_100073799 Ga0070694_1000737992 266
561 3300005458 Ga0070681_10000002 Ga0070681_10000002760 266
562 3300005530 Ga0070679_100000393 Ga0070679_1000003939 266
563 3300005539 Ga0068853_100022918 Ga0068853_1000229184 266
564 3300005547 Ga0070693_100012809 Ga0070693_1000128094 266
565 3300005563 Ga0068855_100038242 Ga0068855_1000382424 266
566 3300005563 Ga0068855_100166484 Ga0068855_1001664842 266
567 3300005564 Ga0070664_100202865 Ga0070664_1002028652 266
568 3300005577 Ga0068857_100005605 Ga0068857_1000056054 266
569 3300005614 Ga0068856_100000601 Ga0068856_10000060130 266
570 3300005614 Ga0068856_100001518 Ga0068856_1000015184 266
571 3300005616 Ga0068852_100039171 Ga0068852_1000391714 266
572 3300005937 Ga0081455_10010329 Ga0081455_100103296 266
573 3300005937 Ga0081455_10042902 Ga0081455_100429022 266
574 3300006051 Ga0075364_10072535 Ga0075364_100725352 266
575 3300006051 Ga0075364_10084753 Ga0075364_100847532 266
576 3300006175 Ga0070712_100000023 Ga0070712_10000002373 266
577 3300006175 Ga0070712_100000803 Ga0070712_1000008033 266
578 3300006175 Ga0070712_100331173 Ga0070712_1003311732 266
579 3300006177 Ga0075362_10015707 Ga0075362_100157074 266
580 3300006237 Ga0097621_100366229 Ga0097621_1003662292 266
581 3300006871 Ga0075434_100027557 Ga0075434_1000275575 266
582 3300006914 Ga0075436_100000211 Ga0075436_10000021122 266
583 3300006914 Ga0075436_100032050 Ga0075436_1000320502 266
584 3300007076 Ga0075435_100002305 Ga0075435_10000230511 266
585 3300009093 Ga0105240_10001838 Ga0105240_1000183835 266
586 3300009093 Ga0105240_10003992 Ga0105240_100039924 266
587 3300009101 Ga0105247_10000847 Ga0105247_1000084717 266
588 3300009148 Ga0105243_10000005 Ga0105243_10000005180 266
589 3300009177 Ga0105248_10013013 Ga0105248_100130138 266
590 3300009545 Ga0105237_10061634 Ga0105237_100616342 266
591 3300009551 Ga0105238_10001476 Ga0105238_100014767 266
592 3300010375 Ga0105239_10014084 Ga0105239_100140845 266
593 3300010375 Ga0105239_10039656 Ga0105239_100396564 266
594 3300013100 Ga0157373_10001642 Ga0157373_1000164217 266
595 3300013104 Ga0157370_10029212 Ga0157370_100292124 266
596 3300013105 Ga0157369_10053092 Ga0157369_100530924 266
597 3300013296 Ga0157374_10031464 Ga0157374_100314643 266
598 3300013297 Ga0157378_10294750 Ga0157378_102947502 266
599 3300013307 Ga0157372_10148586 Ga0157372_101485863 266
600 3300014325 Ga0163163_10194372 Ga0163163_101943722 266
601 3300014326 Ga0157380_10110040 Ga0157380_101100402 266
602 3300014968 Ga0157379_10007585 Ga0157379_100075855 266
603 3300014968 Ga0157379_10083161 Ga0157379_100831613 266
604 3300021361 Ga0213872_10001776 Ga0213872_100017761 266
605 3300025711 Ga0207696_1001081 Ga0207696_100108113 266
606 3300025735 Ga0207713_1001002 Ga0207713_10010025 266
607 3300025900 Ga0207710_10000172 Ga0207710_1000017229 266
608 3300025903 Ga0207680_10002281 Ga0207680_100022817 266
609 3300025906 Ga0207699_10000280 Ga0207699_1000028027 266
610 3300025906 Ga0207699_10015404 Ga0207699_100154044 266
611 3300025912 Ga0207707_10000002 Ga0207707_10000002198 266
612 3300025913 Ga0207695_10038185 Ga0207695_100381854 266
613 3300025914 Ga0207671_10040777 Ga0207671_100407773 266
614 3300025915 Ga0207693_10000018 Ga0207693_10000018136 266
615 3300025915 Ga0207693_10000534 Ga0207693_100005343 266
616 3300025916 Ga0207663_10075315 Ga0207663_100753153 266
617 3300025917 Ga0207660_10031267 Ga0207660_100312672 266
618 3300025921 Ga0207652_10000052 Ga0207652_1000005247 266
619 3300025923 Ga0207681_10188914 Ga0207681_101889142 266
620 3300025928 Ga0207700_10000026 Ga0207700_1000002657 266
621 3300025928 Ga0207700_10017868 Ga0207700_100178685 266
622 3300025929 Ga0207664_10161751 Ga0207664_101617512 266
623 3300025935 Ga0207709_10000001 Ga0207709_100000011247 266
624 3300025941 Ga0207711_10007529 Ga0207711_100075298 266
625 3300025944 Ga0207661_10322974 Ga0207661_103229742 266
626 3300025945 Ga0207679_10171660 Ga0207679_101716601 266
627 3300025960 Ga0207651_10001268 Ga0207651_100012689 266
628 3300026041 Ga0207639_10004318 Ga0207639_100043188 266
629 3300026078 Ga0207702_10000021 Ga0207702_10000021190 266
630 3300026078 Ga0207702_10001285 Ga0207702_1000128517 266
631 3300026116 Ga0207674_10000134 Ga0207674_1000013428 266
632 3300026142 Ga0207698_10307262 Ga0207698_103072622 266
633 3300027312 Ga0209371_1000006 Ga0209371_1000006399 266
634 3300030500 Ga0268256_1000007 Ga0268256_1000007399 266
635 3300031247 Ga0265340_10014685 Ga0265340_100146852 266
636 3300031731 Ga0307405_10065809 Ga0307405_100658093 266
637 3300032005 Ga0307411_10154099 Ga0307411_101540992 266
638 3300035084 Ga0373928_0019327 Ga0373928_0019327_150_1064 266
639 3300035111 Ga0373923_0162889 Ga0373923_0162889_29_895 266
640 3300035172 Ga0373955_0160721 Ga0373955_0160721_155_1021 266
641 3300035398 Ga0316574_0118771 Ga0316574_0118771_334_1248 266
642 3300036401 Ga0373937_0239939 Ga0373937_0239939_225_1082 266
643 3300037471 Ga0395905_0199967 Ga0395905_0199967_566_1471 266
644 3300039437 Ga0436365_1906591 Ga0436365_1906591_44491_45369 266
645 3300039447 Ga0436361_0103120 Ga0436361_0103120_104282_105193 266
646 3300039450 Ga0436363_1032809 Ga0436363_1032809_10603_11481 266
647 3300039453 Ga0436362_0865405 Ga0436362_0865405_264_1142 266
648 3300046454 Ga0495592_0313330 Ga0495592_0313330_90_947 266
649 3300046517 Ga0495630_0284291 Ga0495630_0284291_11_868 266
650 3300046525 Ga0495663_0024795 Ga0495663_0024795_721_1635 266
651 3300046809 Ga0495600_0037198 Ga0495600_0037198_2270_3124 266
652 3300048910 Ga0496107_0355488 Ga0496107_0355488_117_983 266
653 3300048925 Ga0496122_0000355 Ga0496122_0000355_12498_13412 266
654 3300048926 Ga0496123_0001332 Ga0496123_0001332_21473_22387 266
655 3300049569 Ga0501032_0038915 Ga0501032_0038915_1572_2450 266
656 3300049571 Ga0501034_0020559 Ga0501034_0020559_3226_4104 266
657 3300049572 Ga0501036_0020667 Ga0501036_0020667_1735_2613 266
658 3300049581 Ga0501047_0031025 Ga0501047_0031025_3053_3931 266
659 3300049581 Ga0501047_0095958 Ga0501047_0095958_586_1455 266
660 3300049581 Ga0501047_0229776 Ga0501047_0229776_768_1652 266
661 3300049583 Ga0501067_0039185 Ga0501067_0039185_1408_2286 266
662 3300049585 Ga0501069_0005097 Ga0501069_0005097_2142_3020 266
663 3300049586 Ga0501070_0017142 Ga0501070_0017142_4350_5228 266
664 3300049589 Ga0501073_0012747 Ga0501073_0012747_3914_4819 266
665 3300049741 Ga0501079_0022269 Ga0501079_0022269_1464_2342 266
666 3300049742 Ga0501080_0164166 Ga0501080_0164166_1135_2040 266
667 3300049742 Ga0501080_0266857 Ga0501080_0266857_454_1332 266
668 3300049744 Ga0501083_0013821 Ga0501083_0013821_3582_4466 266
669 3300049822 Ga0501035_0035293 Ga0501035_0035293_1557_2435 266
670 3300050512 nmdc:mga0n895_146730_c1 nmdc:mga0n895_146730_c1_734_1600 266
671 3300050513 nmdc:mga0rr50_87687_c1 nmdc:mga0rr50_87687_c1_609_1475 266
672 3300050514 nmdc:mga08x19_54_c1 nmdc:mga08x19_54_c1_68739_69605 266
673 3300050514 nmdc:mga08x19_89320_c1 nmdc:mga08x19_89320_c1_699_1565 266
674 3300054114 Ga0501084_0011075 Ga0501084_0011075_1658_2542 266
675 3300054114 Ga0501084_0393253 Ga0501084_0393253_23_901 266
676 3300060353 Ga0501082_0075828 Ga0501082_0075828_1486_2391 266
677 iso_pu_bacteria 2821123053 2821129208 266
678 iso_pu_bacteria 2838736955 2838742225 266
679 iso_pu_bacteria 2841840854 2841846081 266
680 iso_pu_bacteria 2842140634 2842145785 266
681 iso_pu_bacteria 2857531043 2857536149 266
682 iso_pu_bacteria 2891088606 2891090219 266
683 iso_pu_bacteria 2996336353 2996341623 266
684 3300003320 rootH2_10006857 rootH2_100068574 267
685 3300003320 rootH2_10118832 rootH2_101188322 267
686 3300003856 Ga0058692_1000004 Ga0058692_1000004374 267
687 3300005262 Ga0065165_1021928 Ga0065165_10219281 267
688 3300005336 Ga0070680_100069759 Ga0070680_1000697593 267
689 3300005339 Ga0070660_100002726 Ga0070660_1000027264 267
690 3300005347 Ga0070668_100002646 Ga0070668_1000026467 267
691 3300005435 Ga0070714_100120992 Ga0070714_1001209923 267
692 3300005455 Ga0070663_100033858 Ga0070663_1000338584 267
693 3300005455 Ga0070663_100090888 Ga0070663_1000908882 267
694 3300005548 Ga0070665_100017715 Ga0070665_1000177155 267
695 3300005563 Ga0068855_100184752 Ga0068855_1001847522 267
696 3300005578 Ga0068854_100075177 Ga0068854_1000751773 267
697 3300005985 Ga0081539_10010563 Ga0081539_100105636 267
698 3300009098 Ga0105245_10277584 Ga0105245_102775842 267
699 3300011119 Ga0105246_10037172 Ga0105246_100371725 267
700 3300013102 Ga0157371_10100944 Ga0157371_101009442 267
701 3300013105 Ga0157369_10752978 Ga0157369_107529782 267
702 3300013296 Ga0157374_10000837 Ga0157374_1000083710 267
703 3300013297 Ga0157378_10001948 Ga0157378_100019487 267
704 3300013306 Ga0163162_10006665 Ga0163162_100066657 267
705 3300013307 Ga0157372_10033499 Ga0157372_100334995 267
706 3300013307 Ga0157372_10222403 Ga0157372_102224032 267
707 3300013308 Ga0157375_10002627 Ga0157375_100026274 267
708 3300014326 Ga0157380_10134417 Ga0157380_101344173 267
709 3300014969 Ga0157376_10130631 Ga0157376_101306313 267
710 3300025292 Ga0209676_1000143 Ga0209676_1000143158 267
711 3300025909 Ga0207705_10000105 Ga0207705_1000010542 267
712 3300025917 Ga0207660_10004700 Ga0207660_1000470010 267
713 3300025919 Ga0207657_10001006 Ga0207657_1000100634 267
714 3300025921 Ga0207652_10002051 Ga0207652_100020512 267
715 3300025929 Ga0207664_10089324 Ga0207664_100893243 267
716 3300025935 Ga0207709_10000972 Ga0207709_100009725 267
717 3300025935 Ga0207709_10022388 Ga0207709_100223883 267
718 3300025937 Ga0207669_10230213 Ga0207669_102302132 267
719 3300025949 Ga0207667_10193438 Ga0207667_101934382 267
720 3300025972 Ga0207668_10001556 Ga0207668_100015567 267
721 3300025981 Ga0207640_10103427 Ga0207640_101034271 267
722 3300026067 Ga0207678_10036063 Ga0207678_100360634 267
723 3300026067 Ga0207678_10052534 Ga0207678_100525344 267
724 3300027312 Ga0209371_1000018 Ga0209371_100001829 267
725 3300028379 Ga0268266_10058419 Ga0268266_100584193 267
726 3300028800 Ga0265338_10018343 Ga0265338_100183434 267
727 3300030500 Ga0268256_1000016 Ga0268256_100001629 267
728 3300031240 Ga0265320_10000034 Ga0265320_10000034142 267
729 3300031241 Ga0265325_10041712 Ga0265325_100417123 267
730 3300031249 Ga0265339_10011306 Ga0265339_100113062 267
731 3300031249 Ga0265339_10018281 Ga0265339_100182812 267
732 3300031250 Ga0265331_10015615 Ga0265331_100156154 267
733 3300031711 Ga0265314_10008099 Ga0265314_100080994 267
734 3300031711 Ga0265314_10012421 Ga0265314_100124215 267
735 3300031711 Ga0265314_10031762 Ga0265314_100317622 267
736 3300031824 Ga0307413_10036922 Ga0307413_100369223 267
737 3300032126 Ga0307415_100011926 Ga0307415_1000119264 267
738 3300035113 Ga0373936_0010479 Ga0373936_0010479_1819_2679 267
739 3300035170 Ga0373943_0000193 Ga0373943_0000193_7733_8593 267
740 3300035171 Ga0373946_0003060 Ga0373946_0003060_1843_2703 267
741 3300035692 Ga0373935_0011008 Ga0373935_0011008_687_1547 267
742 3300035695 Ga0373927_0003709 Ga0373927_0003709_1843_2703 267
743 3300035725 Ga0373947_0000076 Ga0373947_0000076_29366_30226 267
744 3300037068 Ga0373925_0005607 Ga0373925_0005607_2233_3093 267
745 3300037418 Ga0395900_0042203 Ga0395900_0042203_3568_4449 267
746 3300037471 Ga0395905_0109855 Ga0395905_0109855_1180_2061 267
747 3300038443 Ga0395901_0464238 Ga0395901_0464238_262_1143 267
748 3300039062 Ga0400483_015557 Ga0400483_015557_382_1293 267
749 3300039062 Ga0400483_244091 Ga0400483_244091_280_1191 267
750 3300044694 Ga0466963_0024247 Ga0466963_0024247_2657_3505 267
751 3300044712 Ga0453684_0004122 Ga0453684_0004122_1308_2279 267
752 3300045051 Ga0451576_0000153 Ga0451576_0000153_102865_103836 267
753 3300045051 Ga0451576_0067762 Ga0451576_0067762_1869_2819 267
754 3300045976 Ga0466967_0240015 Ga0466967_0240015_868_1716 267
755 3300046499 Ga0495594_0168784 Ga0495594_0168784_106_987 267
756 3300046526 Ga0495666_0008457 Ga0495666_0008457_1469_2329 267
757 3300046616 Ga0495668_0009231 Ga0495668_0009231_3151_4017 267
758 3300046660 Ga0495625_0166393 Ga0495625_0166393_28_894 267
759 3300046681 Ga0495647_0027602 Ga0495647_0027602_1105_1965 267
760 3300046690 Ga0495624_0026171 Ga0495624_0026171_2769_3629 267
761 3300047471 Ga0495684_0043330 Ga0495684_0043330_1831_2691 267
762 3300047472 Ga0495686_0011750 Ga0495686_0011750_1287_2153 267
763 3300048904 Ga0496101_0025843 Ga0496101_0025843_2087_2956 267
764 3300048907 Ga0496104_0108307 Ga0496104_0108307_1722_2591 267
765 3300048911 Ga0496108_0008681 Ga0496108_0008681_3618_4487 267
766 3300048912 Ga0496109_0034975 Ga0496109_0034975_1950_2819 267
767 3300048913 Ga0496110_0000751 Ga0496110_0000751_9426_10295 267
768 3300048914 Ga0496111_0094540 Ga0496111_0094540_417_1286 267
769 3300048917 Ga0496114_0129275 Ga0496114_0129275_497_1366 267
770 3300049569 Ga0501032_0076687 Ga0501032_0076687_945_1835 267
771 3300049573 Ga0501037_0040316 Ga0501037_0040316_98_988 267
772 3300049574 Ga0501038_0048130 Ga0501038_0048130_1111_2001 267
773 3300049581 Ga0501047_0088599 Ga0501047_0088599_470_1366 267
774 3300049585 Ga0501069_0091881 Ga0501069_0091881_390_1280 267
775 3300049586 Ga0501070_0000014 Ga0501070_0000014_164722_165612 267
776 3300049591 Ga0501075_0205994 Ga0501075_0205994_116_1027 267
777 3300049592 Ga0501076_0104362 Ga0501076_0104362_1279_2190 267
778 3300049593 Ga0501077_0024462 Ga0501077_0024462_1728_2663 267
779 3300049742 Ga0501080_0002117 Ga0501080_0002117_14495_15385 267
780 3300049822 Ga0501035_0002615 Ga0501035_0002615_6790_7680 267
781 3300049823 Ga0501044_0002945 Ga0501044_0002945_8255_9151 267
782 3300049823 Ga0501044_0003065 Ga0501044_0003065_1972_2862 267
783 3300049823 Ga0501044_0184563 Ga0501044_0184563_1096_1986 267
784 3300049823 Ga0501044_0410061 Ga0501044_0410061_39_935 267
785 3300053093 Ga0500651_0007702 Ga0500651_0007702_454_1320 267
786 3300053098 Ga0500650_0000116 Ga0500650_0000116_14513_15442 267
787 3300053119 Ga0500595_004828 Ga0500595_004828_2295_3176 267
788 3300053730 Ga0500645_000539 Ga0500645_000539_11167_12033 267
789 3300054114 Ga0501084_0266968 Ga0501084_0266968_104_1015 267
790 iso_pu_bacteria 2547132130 2547502644 267
791 iso_pu_bacteria 2643221551 2643777314 267
792 iso_pu_bacteria 2643221555 2643795762 267
793 iso_pu_bacteria 2747842428 2747949812 267
794 iso_pu_bacteria 2765235840 2765581114 267
795 iso_pu_bacteria 2816332141 2816517904 267
796 iso_pu_bacteria 2842391507 2842394134 267
797 iso_pu_bacteria 2874220319 2874223756 267
798 iso_pu_bacteria 2919089067 2919089307 267
799 iso_pu_bacteria 2919134579 2919136453 267
800 iso_pu_bacteria 2919513703 2919516064 267
801 iso_pu_bacteria 2919675420 2919677880 267
802 iso_pu_bacteria 2928496128 2928499312 267
803 iso_pu_bacteria 2931380184 2931382844 267
804 iso_pu_bacteria 2937610967 2937613770 267
805 iso_pu_bacteria 2939626828 2939628482 267
806 iso_pu_bacteria 2961047084 2961050520 267
807 iso_pu_bacteria 2961064222 2961064329 267
808 3300003187 JGI25151J46595_10000088 JGI25151J46595_1000008840 268
809 3300003773 Ga0055537_1000989 Ga0055537_100098910 268
810 3300003775 Ga0055524_1019185 Ga0055524_10191852 268
811 3300003784 Ga0055534_1000307 Ga0055534_100030715 268
812 3300003790 Ga0055528_1000402 Ga0055528_100040216 268
813 3300005331 Ga0070670_100045694 Ga0070670_1000456941 268
814 3300005406 Ga0070703_10023665 Ga0070703_100236652 268
815 3300005435 Ga0070714_100152309 Ga0070714_1001523092 268
816 3300005436 Ga0070713_100065121 Ga0070713_1000651211 268
817 3300005445 Ga0070708_100102582 Ga0070708_1001025822 268
818 3300005445 Ga0070708_100320058 Ga0070708_1003200582 268
819 3300005468 Ga0070707_100162041 Ga0070707_1001620412 268
820 3300005518 Ga0070699_100325758 Ga0070699_1003257581 268
821 3300005530 Ga0070679_100427856 Ga0070679_1004278562 268
822 3300005536 Ga0070697_100453361 Ga0070697_1004533611 268
823 3300005617 Ga0068859_100084896 Ga0068859_1000848963 268
824 3300005937 Ga0081455_10001354 Ga0081455_100013542 268
825 3300006042 Ga0075368_10045377 Ga0075368_100453772 268
826 3300006178 Ga0075367_10051789 Ga0075367_100517893 268
827 3300006871 Ga0075434_100090753 Ga0075434_1000907533 268
828 3300006931 Ga0097620_100084894 Ga0097620_1000848943 268
829 3300007076 Ga0075435_100077595 Ga0075435_1000775953 268
830 3300007265 Ga0099794_10080232 Ga0099794_100802321 268
831 3300009011 Ga0105251_10019337 Ga0105251_100193372 268
832 3300009036 Ga0105244_10026182 Ga0105244_100261822 268
833 3300009093 Ga0105240_10000088 Ga0105240_100000883 268
834 3300013100 Ga0157373_10097566 Ga0157373_100975662 268
835 3300013102 Ga0157371_10002370 Ga0157371_1000237017 268
836 3300013104 Ga0157370_10005233 Ga0157370_1000523310 268
837 3300014497 Ga0182008_10000913 Ga0182008_100009139 268
838 3300014497 Ga0182008_10006499 Ga0182008_100064997 268
839 3300015261 Ga0182006_1050911 Ga0182006_10509112 268
840 3300015261 Ga0182006_1052715 Ga0182006_10527152 268
841 3300015262 Ga0182007_10000019 Ga0182007_100000198 268
842 3300015265 Ga0182005_1000088 Ga0182005_100008863 268
843 3300017792 Ga0163161_10001958 Ga0163161_1000195814 268
844 3300017792 Ga0163161_10020114 Ga0163161_100201144 268
845 3300021361 Ga0213872_10072378 Ga0213872_100723782 268
846 3300025263 Ga0209565_1000113 Ga0209565_100011357 268
847 3300025273 Ga0209673_1000369 Ga0209673_100036931 268
848 3300025284 Ga0209130_1017793 Ga0209130_10177932 268
849 3300025291 Ga0209675_1000007 Ga0209675_100000745 268
850 3300025292 Ga0209676_1000018 Ga0209676_1000018500 268
851 3300025292 Ga0209676_1001361 Ga0209676_10013619 268
852 3300025292 Ga0209676_1001572 Ga0209676_10015728 268
853 3300025295 Ga0209564_1000333 Ga0209564_100033344 268
854 3300025298 Ga0209050_1000396 Ga0209050_100039640 268
855 3300025298 Ga0209050_1001430 Ga0209050_100143011 268
856 3300025299 Ga0209256_1005969 Ga0209256_10059696 268
857 3300025299 Ga0209256_1008759 Ga0209256_10087596 268
858 3300025303 Ga0209051_1000449 Ga0209051_100044916 268
859 3300025304 Ga0209257_1000035 Ga0209257_1000035500 268
860 3300025304 Ga0209257_1006408 Ga0209257_10064081 268
861 3300025735 Ga0207713_1029091 Ga0207713_10290912 268
862 3300025885 Ga0207653_10026429 Ga0207653_100264291 268
863 3300025913 Ga0207695_10000755 Ga0207695_1000075557 268
864 3300025921 Ga0207652_10427298 Ga0207652_104272981 268
865 3300025923 Ga0207681_10109026 Ga0207681_101090262 268
866 3300025925 Ga0207650_10015567 Ga0207650_100155674 268
867 3300025939 Ga0207665_10066869 Ga0207665_100668694 268
868 3300027543 Ga0209999_1001015 Ga0209999_10010152 268
869 3300027614 Ga0209970_1004231 Ga0209970_10042313 268
870 3300027665 Ga0209983_1000709 Ga0209983_10007098 268
871 3300027682 Ga0209971_1001818 Ga0209971_10018183 268
872 3300030732 Ga0316176_1026458 Ga0316176_10264585 268
873 3300030742 Ga0316183_1047328 Ga0316183_10473282 268
874 3300031731 Ga0307405_10070715 Ga0307405_100707152 268
875 3300031903 Ga0307407_10121446 Ga0307407_101214461 268
876 3300031911 Ga0307412_10050872 Ga0307412_100508722 268
877 3300032004 Ga0307414_10131878 Ga0307414_101318782 268
878 3300032004 Ga0307414_10333679 Ga0307414_103336792 268
879 3300032005 Ga0307411_10036861 Ga0307411_100368614 268
880 3300035170 Ga0373943_0253135 Ga0373943_0253135_17_883 268
881 3300038996 Ga0242420_018134 Ga0242420_018134_152_1027 268
882 3300039447 Ga0436361_0810226 Ga0436361_0810226_920_1792 268
883 3300042006 Ga0439432_008299 Ga0439432_008299_2415_3338 268
884 3300046460 Ga0495638_0066815 Ga0495638_0066815_957_1880 268
885 3300046512 Ga0495610_0013350 Ga0495610_0013350_2258_3181 268
886 3300046522 Ga0495643_0001375 Ga0495643_0001375_7857_8780 268
887 3300046525 Ga0495663_0022197 Ga0495663_0022197_588_1511 268
888 3300047320 Ga0495672_0001550 Ga0495672_0001550_13651_14574 268
889 3300047472 Ga0495686_0006050 Ga0495686_0006050_1836_2759 268
890 3300048911 Ga0496108_0181635 Ga0496108_0181635_496_1365 268
891 3300048913 Ga0496110_0100090 Ga0496110_0100090_131_1006 268
892 3300048913 Ga0496110_0186041 Ga0496110_0186041_344_1213 268
893 3300048915 Ga0496112_0008091 Ga0496112_0008091_6518_7387 268
894 3300048920 Ga0496117_0002847 Ga0496117_0002847_13752_14675 268
895 3300048920 Ga0496117_0003923 Ga0496117_0003923_15600_16523 268
896 3300048920 Ga0496117_0043010 Ga0496117_0043010_1965_2888 268
897 3300048921 Ga0496118_0003155 Ga0496118_0003155_6374_7297 268
898 3300048921 Ga0496118_0004179 Ga0496118_0004179_15600_16523 268
899 3300048921 Ga0496118_0070407 Ga0496118_0070407_334_1257 268
900 3300048922 Ga0496119_0000787 Ga0496119_0000787_37991_38914 268
901 3300048923 Ga0496120_0000776 Ga0496120_0000776_7054_7977 268
902 3300048924 Ga0496121_0009225 Ga0496121_0009225_4684_5607 268
903 3300048924 Ga0496121_0266545 Ga0496121_0266545_46_969 268
904 3300048925 Ga0496122_0054111 Ga0496122_0054111_849_1772 268
905 3300048926 Ga0496123_0016366 Ga0496123_0016366_3455_4378 268
906 3300048927 Ga0496124_0003077 Ga0496124_0003077_5951_6874 268
907 3300048927 Ga0496124_0031164 Ga0496124_0031164_3525_4448 268
908 3300048927 Ga0496124_0035735 Ga0496124_0035735_1024_1947 268
909 3300048928 Ga0496125_0000486 Ga0496125_0000486_68384_69307 268
910 3300048928 Ga0496125_0013801 Ga0496125_0013801_1208_2131 268
911 3300048928 Ga0496125_0030723 Ga0496125_0030723_3625_4548 268
912 3300048929 Ga0496126_0000463 Ga0496126_0000463_34484_35356 268
913 3300048929 Ga0496126_0002494 Ga0496126_0002494_16778_17701 268
914 3300049568 Ga0501031_0229664 Ga0501031_0229664_66_989 268
915 3300049570 Ga0501033_0000847 Ga0501033_0000847_7647_8570 268
916 3300049575 Ga0501039_0082758 Ga0501039_0082758_1040_1909 268
917 3300049581 Ga0501047_0001549 Ga0501047_0001549_13555_14442 268
918 3300049583 Ga0501067_0006256 Ga0501067_0006256_548_1435 268
919 3300049587 Ga0501071_0147329 Ga0501071_0147329_20_889 268
920 3300049588 Ga0501072_0007477 Ga0501072_0007477_1875_2762 268
921 3300049589 Ga0501073_0084159 Ga0501073_0084159_1284_2171 268
922 3300049741 Ga0501079_0115133 Ga0501079_0115133_920_1789 268
923 3300049741 Ga0501079_0203617 Ga0501079_0203617_526_1413 268
924 3300049743 Ga0501081_0270494 Ga0501081_0270494_243_1112 268
925 3300050510 nmdc:mga06r32_639927_c1 nmdc:mga06r32_639927_c1_144_1013 268
926 3300050513 nmdc:mga0rr50_78248_c1 nmdc:mga0rr50_78248_c1_294_1166 268
927 3300053104 Ga0500556_0000092 Ga0500556_0000092_1765_2640 268
928 3300054114 Ga0501084_0046313 Ga0501084_0046313_1309_2196 268
929 3300060353 Ga0501082_0240774 Ga0501082_0240774_162_1031 268
930 3300061734 Ga0530510_0101822 Ga0530510_0101822_672_1541 268
931 3300061734 Ga0530510_0112660 Ga0530510_0112660_606_1475 268
932 3300061734 Ga0530510_0172039 Ga0530510_0172039_440_1309 268
933 iso_pu_bacteria 2508501050 2508734607 268
934 iso_pu_bacteria 2576861471 2578456403 268
935 iso_pu_bacteria 2600254933 2600377441 268
936 iso_pu_bacteria 2643221653 2644299689 268
937 iso_pu_bacteria 2643221719 2644657917 268
938 iso_pu_bacteria 2775506901 2776257482 268
939 iso_pu_bacteria 2818991272 2819244465 268
940 iso_pu_bacteria 2818991461 2819688362 268
941 iso_pu_bacteria 2835312727 2835318255 268
942 iso_pu_bacteria 2852649853 2852651652 268
943 iso_pu_bacteria 2857442823 2857444611 268
944 iso_pu_bacteria 2884298095 2884298379 268
945 iso_pu_bacteria 2891373044 2891377792 268
946 iso_pu_bacteria 2894232714 2894235778 268
947 iso_pu_bacteria 2939589442 2939590354 268
948 iso_pu_bacteria 2939622612 2939626559 268
949 iso_pu_bacteria 2941475908 2941479566 268
950 iso_pu_bacteria 2974307012 2974307066 268
951 iso_pu_bacteria 2977247770 2977247810 268
952 iso_pu_bacteria 2989349275 2989355073 268
953 iso_pu_bacteria 2989771324 2989771758 268
954 iso_pu_bacteria 2989776772 2989780250 268
955 iso_pu_bacteria 3003930520 3003931141 268
956 3300005333 Ga0070677_10057510 Ga0070677_100575102 269
957 3300005339 Ga0070660_100173126 Ga0070660_1001731262 269
958 3300005347 Ga0070668_100007344 Ga0070668_1000073448 269
959 3300005355 Ga0070671_100241098 Ga0070671_1002410982 269
960 3300005436 Ga0070713_100439166 Ga0070713_1004391662 269
961 3300005530 Ga0070679_100053554 Ga0070679_1000535543 269
962 3300005841 Ga0068863_100440106 Ga0068863_1004401062 269
963 3300005844 Ga0068862_100024894 Ga0068862_1000248942 269
964 3300006353 Ga0075370_10257587 Ga0075370_102575871 269
965 3300009174 Ga0105241_10390882 Ga0105241_103908822 269
966 3300009176 Ga0105242_10327317 Ga0105242_103273172 269
967 3300014325 Ga0163163_10725940 Ga0163163_107259401 269
968 3300021388 Ga0213875_10073128 Ga0213875_100731282 269
969 3300025915 Ga0207693_10274008 Ga0207693_102740081 269
970 3300025919 Ga0207657_10038796 Ga0207657_100387965 269
971 3300025920 Ga0207649_10240271 Ga0207649_102402711 269
972 3300025921 Ga0207652_10098147 Ga0207652_100981473 269
973 3300025972 Ga0207668_10194991 Ga0207668_101949912 269
974 3300026023 Ga0207677_10017151 Ga0207677_100171512 269
975 3300026078 Ga0207702_10224280 Ga0207702_102242802 269
976 3300031239 Ga0265328_10000417 Ga0265328_100004175 269
977 3300031711 Ga0265314_10032914 Ga0265314_100329144 269
978 3300031901 Ga0307406_10248352 Ga0307406_102483522 269
979 3300035088 Ga0373940_0011289 Ga0373940_0011289_194_1087 269
980 3300044683 Ga0466965_0225824 Ga0466965_0225824_30_896 269
981 3300046473 Ga0495582_0139231 Ga0495582_0139231_356_1216 269
982 3300046690 Ga0495624_0225483 Ga0495624_0225483_215_1075 269
983 3300049580 Ga0501046_0147781 Ga0501046_0147781_308_1204 269
984 3300049581 Ga0501047_0191635 Ga0501047_0191635_570_1466 269
985 3300049586 Ga0501070_0004919 Ga0501070_0004919_4759_5655 269
986 3300049742 Ga0501080_0058128 Ga0501080_0058128_105_1001 269
987 3300049823 Ga0501044_0013291 Ga0501044_0013291_6920_7816 269
988 3300050496 nmdc:mga07m45_143022_c1 nmdc:mga07m45_143022_c1_350_1237 269
989 3300053077 Ga0495601_0021116 Ga0495601_0021116_658_1518 269
990 3300053078 Ga0495612_0017182 Ga0495612_0017182_43_903 269
991 iso_pu_bacteria 2508501114 2509075020 269
992 iso_pu_bacteria 2508501127 2509143088 269
993 iso_pu_bacteria 2597489875 2597810841 269
994 iso_pu_bacteria 2841734538 2841736579 269
995 iso_pu_bacteria 2842757796 2842761236 269
996 iso_pu_bacteria 2856342000 2856348128 269
997 iso_pu_bacteria 2871474448 2871478565 269
998 iso_pu_bacteria 2888343758 2888344553 269
999 iso_pu_bacteria 2924754689 2924762014 269
1000 iso_pu_bacteria 2937836603 2937838838 269
1001 iso_pu_bacteria 2958071322 2958072357 269
1002 iso_pu_bacteria 2970524798 2970526274 269
1003 iso_pu_bacteria 2970540015 2970541098 269
1004 iso_pu_bacteria 8004395343 8004399918 269
1005 iso_pu_bacteria 8004633249 8004639890 269
1006 iso_pu_bacteria 8055617313 8055618131 269
1007 3300005364 Ga0070673_100583722 Ga0070673_1005837222 270
1008 3300005548 Ga0070665_100065392 Ga0070665_1000653924 270
1009 3300006175 Ga0070712_100077902 Ga0070712_1000779022 270
1010 3300006186 Ga0075369_10074557 Ga0075369_100745572 270
1011 3300006847 Ga0075431_100410176 Ga0075431_1004101761 270
1012 3300006946 Ga0079104_1000310 Ga0079104_100031032 270
1013 3300009177 Ga0105248_10000184 Ga0105248_1000018416 270
1014 3300009553 Ga0105249_10042496 Ga0105249_100424962 270
1015 3300013306 Ga0163162_10032994 Ga0163162_100329942 270
1016 3300013306 Ga0163162_10244031 Ga0163162_102440312 270
1017 3300014325 Ga0163163_10000131 Ga0163163_100001318 270
1018 3300014968 Ga0157379_10004164 Ga0157379_100041642 270
1019 3300014968 Ga0157379_10162845 Ga0157379_101628452 270
1020 3300025945 Ga0207679_10318859 Ga0207679_103188591 270
1021 3300026075 Ga0207708_10258755 Ga0207708_102587552 270
1022 3300026095 Ga0207676_10143733 Ga0207676_101437333 270
1023 3300027111 Ga0209281_1000028 Ga0209281_1000028251 270
1024 3300031239 Ga0265328_10000023 Ga0265328_1000002379 270
1025 3300031239 Ga0265328_10002712 Ga0265328_100027123 270
1026 3300031250 Ga0265331_10000058 Ga0265331_1000005855 270
1027 3300031250 Ga0265331_10001452 Ga0265331_1000145210 270
1028 3300031251 Ga0265327_10027713 Ga0265327_100277134 270
1029 3300031251 Ga0265327_10131454 Ga0265327_101314541 270
1030 3300031344 Ga0265316_10000880 Ga0265316_1000088013 270
1031 3300035692 Ga0373935_0016783 Ga0373935_0016783_2721_3593 270
1032 3300037068 Ga0373925_0021045 Ga0373925_0021045_3412_4284 270
1033 3300038443 Ga0395901_0118952 Ga0395901_0118952_490_1335 270
1034 3300044658 Ga0466972_0153146 Ga0466972_0153146_16_897 270
1035 3300046459 Ga0495629_0129774 Ga0495629_0129774_245_1117 270
1036 3300046460 Ga0495638_0023663 Ga0495638_0023663_711_1586 270
1037 3300046476 Ga0495662_0128760 Ga0495662_0128760_93_965 270
1038 3300046512 Ga0495610_0105931 Ga0495610_0105931_166_1044 270
1039 3300046533 Ga0495640_0006577 Ga0495640_0006577_7333_8205 270
1040 3300046660 Ga0495625_0083478 Ga0495625_0083478_26_871 270
1041 3300048917 Ga0496114_0315008 Ga0496114_0315008_178_1050 270
1042 3300048924 Ga0496121_0017687 Ga0496121_0017687_5745_6623 270
1043 3300048926 Ga0496123_0137232 Ga0496123_0137232_41_916 270
1044 3300048927 Ga0496124_0164115 Ga0496124_0164115_168_1046 270
1045 3300049585 Ga0501069_0054289 Ga0501069_0054289_819_1694 270
1046 3300050489 nmdc:mga03683_120193_c1 nmdc:mga03683_120193_c1_236_1117 270
1047 3300053087 Ga0500643_004409 Ga0500643_004409_1149_2024 270
1048 3300053088 Ga0500644_0028801 Ga0500644_0028801_730_1605 270
1049 3300053090 Ga0500646_0006695 Ga0500646_0006695_444_1319 270
1050 3300053103 Ga0500555_005686 Ga0500555_005686_2352_3227 270
1051 3300053122 Ga0500608_070504 Ga0500608_070504_229_1104 270
1052 3300053125 Ga0500618_001619 Ga0500618_001619_3823_4701 270
1053 3300053126 Ga0500621_056389 Ga0500621_056389_50_925 270
1054 3300053153 Ga0500616_0063108 Ga0500616_0063108_580_1470 270
1055 3300053156 Ga0500622_0000441 Ga0500622_0000441_7787_8662 270
1056 3300053158 Ga0500627_0002598 Ga0500627_0002598_2005_2880 270
1057 3300053730 Ga0500645_004116 Ga0500645_004116_462_1337 270
1058 iso_pu_bacteria 2643221595 2643985965 270
1059 iso_pu_bacteria 2844002411 2844003249 270
1060 iso_pu_bacteria 2871466892 2871473497 270
1061 iso_pu_bacteria 2894414249 2894417682 270
1062 iso_pu_bacteria 2906378014 2906379158 270
1063 3300003771 Ga0055526_1001485 Ga0055526_100148514 271
1064 3300003775 Ga0055524_1000399 Ga0055524_100039927 271
1065 3300003784 Ga0055534_1011959 Ga0055534_10119592 271
1066 3300005458 Ga0070681_10095301 Ga0070681_100953011 271
1067 3300006846 Ga0075430_100180190 Ga0075430_1001801903 271
1068 3300009147 Ga0114129_10000062 Ga0114129_1000006214 271
1069 3300021388 Ga0213875_10003041 Ga0213875_100030417 271
1070 3300025273 Ga0209673_1013882 Ga0209673_10138822 271
1071 3300025291 Ga0209675_1000515 Ga0209675_10005154 271
1072 3300025294 Ga0209025_1000357 Ga0209025_100035729 271
1073 3300025295 Ga0209564_1001051 Ga0209564_100105114 271
1074 3300025299 Ga0209256_1000876 Ga0209256_100087628 271
1075 3300025304 Ga0209257_1049314 Ga0209257_10493141 271
1076 3300031239 Ga0265328_10062827 Ga0265328_100628272 271
1077 3300031250 Ga0265331_10001205 Ga0265331_1000120515 271
1078 3300032168 Ga0316593_10033869 Ga0316593_100338692 271
1079 3300036647 Ga0316582_0212929 Ga0316582_0212929_124_1008 271
1080 3300036712 Ga0316584_0042160 Ga0316584_0042160_635_1519 271
1081 3300037853 Ga0436364_0697377 Ga0436364_0697377_4895_5776 271
1082 3300037853 Ga0436364_0964747 Ga0436364_0964747_223_1098 271
1083 3300039437 Ga0436365_0733541 Ga0436365_0733541_33_908 271
1084 3300044683 Ga0466965_0038749 Ga0466965_0038749_297_1178 271
1085 3300048928 Ga0496125_0057135 Ga0496125_0057135_1571_2458 271
1086 3300053104 Ga0500556_0025337 Ga0500556_0025337_684_1637 271
1087 3300053156 Ga0500622_0165105 Ga0500622_0165105_17_895 271
1088 3300005436 Ga0070713_100343897 Ga0070713_1003438971 272
1089 3300006051 Ga0075364_10000055 Ga0075364_100000552 272
1090 3300013100 Ga0157373_10123709 Ga0157373_101237092 272
1091 3300013105 Ga0157369_10180386 Ga0157369_101803862 272
1092 3300021384 Ga0213876_10065834 Ga0213876_100658342 272
1093 3300025294 Ga0209025_1000042 Ga0209025_100004294 272
1094 3300025972 Ga0207668_10034894 Ga0207668_100348944 272
1095 3300031235 Ga0265330_10084826 Ga0265330_100848262 272
1096 3300031249 Ga0265339_10027678 Ga0265339_100276783 272
1097 3300031852 Ga0307410_10178177 Ga0307410_101781772 272
1098 3300031901 Ga0307406_10056561 Ga0307406_100565613 272
1099 3300037853 Ga0436364_1554086 Ga0436364_1554086_709_1593 272
1100 3300039437 Ga0436365_0942406 Ga0436365_0942406_58_966 272
1101 3300039438 Ga0436360_0831553 Ga0436360_0831553_1663_2547 272
1102 3300039438 Ga0436360_0955023 Ga0436360_0955023_72_962 272
1103 3300039447 Ga0436361_0602414 Ga0436361_0602414_740_1630 272
1104 3300039450 Ga0436363_0715275 Ga0436363_0715275_8250_9146 272
1105 3300039453 Ga0436362_0020367 Ga0436362_0020367_3478_4362 272
1106 3300039453 Ga0436362_1301339 Ga0436362_1301339_25_909 272
1107 3300041413 Ga0439465_0033501 Ga0439465_0033501_338_1222 272
1108 3300046500 Ga0495596_0074009 Ga0495596_0074009_408_1286 272
1109 3300046501 Ga0495607_0042991 Ga0495607_0042991_340_1218 272
1110 3300046642 Ga0495634_0012404 Ga0495634_0012404_4175_5074 272
1111 3300047315 Ga0495581_0029748 Ga0495581_0029748_1412_2311 272
1112 3300047673 Ga0495593_0069627 Ga0495593_0069627_548_1447 272
1113 3300048919 Ga0496116_0110403 Ga0496116_0110403_432_1322 272
1114 3300048920 Ga0496117_0008418 Ga0496117_0008418_3375_4265 272
1115 3300048924 Ga0496121_0000888 Ga0496121_0000888_5375_6256 272
1116 3300048925 Ga0496122_0000308 Ga0496122_0000308_75130_76020 272
1117 3300048926 Ga0496123_0000066 Ga0496123_0000066_74897_75787 272
1118 3300048927 Ga0496124_0001215 Ga0496124_0001215_26321_27211 272
1119 3300048927 Ga0496124_0229599 Ga0496124_0229599_466_1347 272
1120 3300048928 Ga0496125_0000288 Ga0496125_0000288_66868_67758 272
1121 3300048928 Ga0496125_0064968 Ga0496125_0064968_1704_2594 272
1122 3300048929 Ga0496126_0000258 Ga0496126_0000258_74127_75017 272
1123 3300048929 Ga0496126_0054046 Ga0496126_0054046_287_1177 272
1124 3300049571 Ga0501034_0139427 Ga0501034_0139427_524_1414 272
1125 3300049572 Ga0501036_0081034 Ga0501036_0081034_1579_2460 272
1126 3300049573 Ga0501037_0060985 Ga0501037_0060985_494_1375 272
1127 3300049575 Ga0501039_0045660 Ga0501039_0045660_1744_2625 272
1128 3300049579 Ga0501043_0092471 Ga0501043_0092471_164_1054 272
1129 3300049589 Ga0501073_0078675 Ga0501073_0078675_1023_1904 272
1130 3300049591 Ga0501075_0016391 Ga0501075_0016391_1401_2282 272
1131 3300049592 Ga0501076_0102896 Ga0501076_0102896_151_1032 272
1132 3300049593 Ga0501077_0018120 Ga0501077_0018120_1334_2215 272
1133 3300049741 Ga0501079_0016314 Ga0501079_0016314_3891_4772 272
1134 3300049744 Ga0501083_0119473 Ga0501083_0119473_227_1108 272
1135 3300049822 Ga0501035_0131333 Ga0501035_0131333_951_1832 272
1136 3300049823 Ga0501044_0080832 Ga0501044_0080832_1091_1972 272
1137 3300049823 Ga0501044_0218052 Ga0501044_0218052_302_1192 272
1138 3300049823 Ga0501044_0262528 Ga0501044_0262528_213_1136 272
1139 3300050491 nmdc:mga00v17_431_c1 nmdc:mga00v17_431_c1_294_1175 272
1140 3300053104 Ga0500556_0009403 Ga0500556_0009403_1110_1988 272
1141 3300053108 Ga0500562_043309 Ga0500562_043309_101_1003 272
1142 3300054114 Ga0501084_0076623 Ga0501084_0076623_1842_2723 272
1143 3300060353 Ga0501082_0001851 Ga0501082_0001851_13736_14617 272
1144 iso_pu_bacteria 2896429255 2896431799 272
1145 3300002774 JGI25150J39212_1000067 JGI25150J39212_10000675 273
1146 3300003187 JGI25151J46595_10023969 JGI25151J46595_100239691 273
1147 3300003215 JGI25153J46596_10000125 JGI25153J46596_1000012580 273
1148 3300003320 rootH2_10196566 rootH2_101965662 273
1149 3300003781 Ga0055536_1026679 Ga0055536_10266792 273
1150 3300003791 Ga0055530_10014468 Ga0055530_100144682 273
1151 3300005262 Ga0065165_1020124 Ga0065165_10201243 273
1152 3300005985 Ga0081539_10013963 Ga0081539_100139634 273
1153 3300025245 Ga0207425_1000005 Ga0207425_1000005833 273
1154 3300025258 Ga0209129_1000701 Ga0209129_100070123 273
1155 3300025263 Ga0209565_1000272 Ga0209565_100027258 273
1156 3300025273 Ga0209673_1028160 Ga0209673_10281602 273
1157 3300025292 Ga0209676_1005025 Ga0209676_10050253 273
1158 3300025294 Ga0209025_1001007 Ga0209025_100100736 273
1159 3300025297 Ga0209758_1000002 Ga0209758_1000002512 273
1160 3300025298 Ga0209050_1000001 Ga0209050_1000001462 273
1161 3300025298 Ga0209050_1021655 Ga0209050_10216553 273
1162 3300025302 Ga0207426_1012332 Ga0207426_10123324 273
1163 3300025303 Ga0209051_1000472 Ga0209051_100047242 273
1164 3300025304 Ga0209257_1003045 Ga0209257_10030454 273
1165 3300025304 Ga0209257_1003113 Ga0209257_10031134 273
1166 3300025937 Ga0207669_10182008 Ga0207669_101820082 273
1167 3300026075 Ga0207708_10208253 Ga0207708_102082532 273
1168 3300028023 Ga0265357_1000174 Ga0265357_10001743 273
1169 3300031616 Ga0307508_10063127 Ga0307508_100631273 273
1170 3300032004 Ga0307414_10000567 Ga0307414_1000056722 273
1171 3300033180 Ga0307510_10039096 Ga0307510_100390963 273
1172 3300033180 Ga0307510_10230928 Ga0307510_102309282 273
1173 3300037853 Ga0436364_0958902 Ga0436364_0958902_374_1255 273
1174 3300046557 Ga0495622_0049152 Ga0495622_0049152_791_1729 273
1175 3300046558 Ga0495633_0068945 Ga0495633_0068945_664_1602 273
1176 3300046692 Ga0495671_0007336 Ga0495671_0007336_2212_3150 273
1177 3300048905 Ga0496102_0132876 Ga0496102_0132876_1182_2069 273
1178 3300048913 Ga0496110_0211139 Ga0496110_0211139_394_1278 273
1179 3300048918 Ga0496115_0001166 Ga0496115_0001166_896_1777 273
1180 3300053087 Ga0500643_000336 Ga0500643_000336_21353_22273 273
1181 3300053118 Ga0500594_0000636 Ga0500594_0000636_201_1139 273
1182 3300005435 Ga0070714_100093073 Ga0070714_1000930733 274
1183 3300005455 Ga0070663_100533523 Ga0070663_1005335231 274
1184 3300006177 Ga0075362_10052451 Ga0075362_100524511 274
1185 3300013297 Ga0157378_10424770 Ga0157378_104247701 274
1186 3300014497 Ga0182008_10049221 Ga0182008_100492212 274
1187 3300025928 Ga0207700_10028927 Ga0207700_100289273 274
1188 3300025929 Ga0207664_10030239 Ga0207664_100302394 274
1189 3300027876 Ga0209974_10005007 Ga0209974_100050072 274
1190 3300035111 Ga0373923_0067422 Ga0373923_0067422_350_1252 274
1191 3300035725 Ga0373947_0018642 Ga0373947_0018642_2308_3210 274
1192 3300046454 Ga0495592_0102487 Ga0495592_0102487_375_1277 274
1193 3300046476 Ga0495662_0020350 Ga0495662_0020350_807_1709 274
1194 3300046477 Ga0495664_0008491 Ga0495664_0008491_4096_4998 274
1195 3300046517 Ga0495630_0089419 Ga0495630_0089419_567_1469 274
1196 3300046529 Ga0495652_0039570 Ga0495652_0039570_1464_2366 274
1197 3300046533 Ga0495640_0090966 Ga0495640_0090966_517_1419 274
1198 3300046543 Ga0495645_0117245 Ga0495645_0117245_199_1101 274
1199 3300046616 Ga0495668_0028753 Ga0495668_0028753_1254_2144 274
1200 3300046642 Ga0495634_0005388 Ga0495634_0005388_961_1863 274
1201 3300047319 Ga0495674_0065302 Ga0495674_0065302_677_1579 274
1202 3300048923 Ga0496120_0070467 Ga0496120_0070467_382_1269 274
1203 3300053155 Ga0500620_001156 Ga0500620_001156_352_1239 274
1204 3300053728 Ga0500657_082053 Ga0500657_082053_87_989 274
1205 3300005435 Ga0070714_100140544 Ga0070714_1001405442 275
1206 3300006028 Ga0070717_10099484 Ga0070717_100994843 275
1207 3300031911 Ga0307412_10168359 Ga0307412_101683592 275
1208 3300035116 Ga0373945_0038698 Ga0373945_0038698_279_1187 275
1209 3300053139 Ga0500568_0005603 Ga0500568_0005603_4578_5507 275
1210 3300009553 Ga0105249_10598055 Ga0105249_105980551 276
1211 3300025304 Ga0209257_1018637 Ga0209257_10186372 276
1212 3300031241 Ga0265325_10042196 Ga0265325_100421963 276
1213 3300031249 Ga0265339_10000068 Ga0265339_1000006865 276
1214 3300031595 Ga0265313_10006241 Ga0265313_100062418 276
1215 3300031852 Ga0307410_10262030 Ga0307410_102620302 276
1216 3300031852 Ga0307410_10374852 Ga0307410_103748522 276
1217 3300031903 Ga0307407_10104652 Ga0307407_101046522 276
1218 3300032004 Ga0307414_10012890 Ga0307414_100128904 276
1219 3300032004 Ga0307414_10044355 Ga0307414_100443552 276
1220 3300032004 Ga0307414_10091042 Ga0307414_100910422 276
1221 3300032004 Ga0307414_10167325 Ga0307414_101673252 276
1222 3300032005 Ga0307411_10434930 Ga0307411_104349301 276
1223 3300035111 Ga0373923_0030373 Ga0373923_0030373_1164_2084 276
1224 3300035117 Ga0373953_0003803 Ga0373953_0003803_1660_2580 276
1225 3300035118 Ga0373954_0012077 Ga0373954_0012077_1387_2307 276
1226 3300035119 Ga0373956_0023567 Ga0373956_0023567_1057_1977 276
1227 3300035172 Ga0373955_0014392 Ga0373955_0014392_1060_1980 276
1228 3300035410 Ga0373924_0001157 Ga0373924_0001157_7452_8372 276
1229 3300035695 Ga0373927_0061084 Ga0373927_0061084_339_1259 276
1230 3300035724 Ga0373933_0000565 Ga0373933_0000565_20170_21090 276
1231 3300036401 Ga0373937_0006584 Ga0373937_0006584_3470_4390 276
1232 3300037068 Ga0373925_0155169 Ga0373925_0155169_191_1111 276
1233 3300046454 Ga0495592_0025358 Ga0495592_0025358_1709_2629 276
1234 3300046459 Ga0495629_0001993 Ga0495629_0001993_10934_11854 276
1235 3300046462 Ga0495651_0000136 Ga0495651_0000136_15370_16290 276
1236 3300046463 Ga0495653_0001743 Ga0495653_0001743_7698_8618 276
1237 3300046473 Ga0495582_0058999 Ga0495582_0058999_969_1889 276
1238 3300046511 Ga0495608_0000282 Ga0495608_0000282_33315_34235 276
1239 3300046514 Ga0495618_0007700 Ga0495618_0007700_1586_2506 276
1240 3300046526 Ga0495666_0051634 Ga0495666_0051634_912_1832 276
1241 3300046529 Ga0495652_0005586 Ga0495652_0005586_6270_7190 276
1242 3300046533 Ga0495640_0001369 Ga0495640_0001369_10610_11530 276
1243 3300046536 Ga0495587_0001140 Ga0495587_0001140_5830_6750 276
1244 3300046543 Ga0495645_0020607 Ga0495645_0020607_1042_1962 276
1245 3300046559 Ga0495667_0000392 Ga0495667_0000392_20379_21299 276
1246 3300046660 Ga0495625_0008016 Ga0495625_0008016_1623_2564 276
1247 3300046663 Ga0495635_0001645 Ga0495635_0001645_7720_8640 276
1248 3300046675 Ga0495657_0002613 Ga0495657_0002613_8026_8946 276
1249 3300046679 Ga0495623_0001489 Ga0495623_0001489_7372_8292 276
1250 3300046680 Ga0495646_0008281 Ga0495646_0008281_3560_4480 276
1251 3300046683 Ga0495658_0095703 Ga0495658_0095703_158_1078 276
1252 3300046689 Ga0495613_0046126 Ga0495613_0046126_1115_2035 276
1253 3300046809 Ga0495600_0034397 Ga0495600_0034397_115_1035 276
1254 3300047317 Ga0495604_0000168 Ga0495604_0000168_1030_1950 276
1255 3300047319 Ga0495674_0000573 Ga0495674_0000573_9712_10632 276
1256 3300047322 Ga0495680_0000285 Ga0495680_0000285_20298_21218 276
1257 3300047444 Ga0495675_0008016 Ga0495675_0008016_3560_4480 276
1258 3300048088 Ga0495602_0002627 Ga0495602_0002627_8637_9557 276
1259 3300053077 Ga0495601_0007011 Ga0495601_0007011_4443_5363 276
1260 3300053084 Ga0495595_0000996 Ga0495595_0000996_8703_9623 276
1261 3300053085 Ga0495619_0000309 Ga0495619_0000309_15897_16817 276
1262 3300053104 Ga0500556_0000217 Ga0500556_0000217_7155_8096 276
1263 3300053130 Ga0500642_0000001 Ga0500642_0000001_442652_443593 276
1264 3300053139 Ga0500568_0044678 Ga0500568_0044678_382_1317 276
1265 3300053730 Ga0500645_000148 Ga0500645_000148_4549_5484 276
1266 iso_pu_bacteria 8057101203 8057105391 276
1267 3300005344 Ga0070661_100004478 Ga0070661_1000044784 277
1268 3300005345 Ga0070692_10010249 Ga0070692_100102494 277
1269 3300005366 Ga0070659_100101906 Ga0070659_1001019063 277
1270 3300005367 Ga0070667_100371318 Ga0070667_1003713182 277
1271 3300005455 Ga0070663_100016335 Ga0070663_1000163352 277
1272 3300005539 Ga0068853_100174136 Ga0068853_1001741362 277
1273 3300005564 Ga0070664_100350159 Ga0070664_1003501592 277
1274 3300005616 Ga0068852_100016058 Ga0068852_1000160585 277
1275 3300009093 Ga0105240_10000969 Ga0105240_1000096947 277
1276 3300009093 Ga0105240_10002383 Ga0105240_1000238315 277
1277 3300013296 Ga0157374_10082522 Ga0157374_100825223 277
1278 3300025913 Ga0207695_10000932 Ga0207695_100009325 277
1279 3300025913 Ga0207695_10002096 Ga0207695_1000209615 277
1280 3300025919 Ga0207657_10059690 Ga0207657_100596904 277
1281 3300025920 Ga0207649_10122105 Ga0207649_101221052 277
1282 3300025932 Ga0207690_10073937 Ga0207690_100739373 277
1283 3300025945 Ga0207679_10363124 Ga0207679_103631241 277
1284 3300025981 Ga0207640_10482811 Ga0207640_104828111 277
1285 3300026067 Ga0207678_10000321 Ga0207678_1000032134 277
1286 3300026142 Ga0207698_10038303 Ga0207698_100383032 277
1287 3300053157 Ga0500624_000003 Ga0500624_000003_79916_80800 277
1288 3300053178 Ga0500637_0000073 Ga0500637_0000073_11108_11992 277
1289 3300005367 Ga0070667_100077172 Ga0070667_1000771723 278
1290 3300005458 Ga0070681_10331300 Ga0070681_103313001 278
1291 3300005843 Ga0068860_100212890 Ga0068860_1002128902 278
1292 3300009177 Ga0105248_10005596 Ga0105248_1000559611 278
1293 3300025941 Ga0207711_10003216 Ga0207711_100032165 278
1294 3300025986 Ga0207658_10016455 Ga0207658_100164555 278
1295 3300026035 Ga0207703_10016915 Ga0207703_100169153 278
1296 3300028381 Ga0268264_10065732 Ga0268264_100657323 278
1297 3300031548 Ga0307408_100284968 Ga0307408_1002849682 278
1298 3300031901 Ga0307406_10042324 Ga0307406_100423244 278
1299 3300048909 Ga0496106_0199361 Ga0496106_0199361_394_1272 278
1300 3300048913 Ga0496110_0307893 Ga0496110_0307893_478_1356 278
1301 3300048914 Ga0496111_0155426 Ga0496111_0155426_22_900 278
1302 3300049583 Ga0501067_0175796 Ga0501067_0175796_214_1086 278
1303 3300001979 JGI24740J21852_10035217 JGI24740J21852_100352172 279
1304 3300002067 JGI24735J21928_10011843 JGI24735J21928_100118433 279
1305 3300005327 Ga0070658_10024326 Ga0070658_100243262 279
1306 3300005327 Ga0070658_10101204 Ga0070658_101012042 279
1307 3300005335 Ga0070666_10086933 Ga0070666_100869331 279
1308 3300005339 Ga0070660_100036408 Ga0070660_1000364082 279
1309 3300005345 Ga0070692_10019127 Ga0070692_100191272 279
1310 3300005347 Ga0070668_100029834 Ga0070668_1000298344 279
1311 3300005353 Ga0070669_100128352 Ga0070669_1001283522 279
1312 3300005364 Ga0070673_100415190 Ga0070673_1004151902 279
1313 3300005366 Ga0070659_100005172 Ga0070659_1000051728 279
1314 3300005366 Ga0070659_100179570 Ga0070659_1001795702 279
1315 3300005444 Ga0070694_100014006 Ga0070694_1000140062 279
1316 3300005455 Ga0070663_100175187 Ga0070663_1001751872 279
1317 3300005457 Ga0070662_100006493 Ga0070662_1000064934 279
1318 3300005539 Ga0068853_100018318 Ga0068853_1000183184 279
1319 3300005543 Ga0070672_100026242 Ga0070672_1000262422 279
1320 3300005543 Ga0070672_100071046 Ga0070672_1000710462 279
1321 3300005563 Ga0068855_100023996 Ga0068855_1000239964 279
1322 3300005563 Ga0068855_100549981 Ga0068855_1005499812 279
1323 3300005563 Ga0068855_100550001 Ga0068855_1005500012 279
1324 3300005577 Ga0068857_100075772 Ga0068857_1000757724 279
1325 3300005577 Ga0068857_100128607 Ga0068857_1001286073 279
1326 3300005578 Ga0068854_100310618 Ga0068854_1003106182 279
1327 3300005616 Ga0068852_100579662 Ga0068852_1005796621 279
1328 3300005719 Ga0068861_100275365 Ga0068861_1002753651 279
1329 3300005841 Ga0068863_100059457 Ga0068863_1000594572 279
1330 3300005842 Ga0068858_100164293 Ga0068858_1001642932 279
1331 3300005843 Ga0068860_100020438 Ga0068860_1000204385 279
1332 3300005844 Ga0068862_100026253 Ga0068862_1000262532 279
1333 3300006844 Ga0075428_100421428 Ga0075428_1004214282 279
1334 3300006847 Ga0075431_100232121 Ga0075431_1002321212 279
1335 3300006852 Ga0075433_10007758 Ga0075433_100077588 279
1336 3300009093 Ga0105240_10135616 Ga0105240_101356164 279
1337 3300009553 Ga0105249_10014274 Ga0105249_100142744 279
1338 3300009553 Ga0105249_10170029 Ga0105249_101700293 279
1339 3300010375 Ga0105239_10056934 Ga0105239_100569342 279
1340 3300013102 Ga0157371_10365363 Ga0157371_103653632 279
1341 3300013306 Ga0163162_10049394 Ga0163162_100493943 279
1342 3300025321 Ga0207656_10062919 Ga0207656_100629191 279
1343 3300025901 Ga0207688_10103231 Ga0207688_101032312 279
1344 3300025904 Ga0207647_10001021 Ga0207647_1000102119 279
1345 3300025909 Ga0207705_10157555 Ga0207705_101575552 279
1346 3300025911 Ga0207654_10333593 Ga0207654_103335932 279
1347 3300025913 Ga0207695_10127172 Ga0207695_101271723 279
1348 3300025919 Ga0207657_10041770 Ga0207657_100417705 279
1349 3300025919 Ga0207657_10045255 Ga0207657_100452552 279
1350 3300025920 Ga0207649_10056805 Ga0207649_100568053 279
1351 3300025923 Ga0207681_10291811 Ga0207681_102918112 279
1352 3300025923 Ga0207681_10412645 Ga0207681_104126452 279
1353 3300025932 Ga0207690_10022231 Ga0207690_100222314 279
1354 3300025932 Ga0207690_10086876 Ga0207690_100868762 279
1355 3300025933 Ga0207706_10016163 Ga0207706_100161634 279
1356 3300025933 Ga0207706_10022391 Ga0207706_100223912 279
1357 3300025934 Ga0207686_10074493 Ga0207686_100744932 279
1358 3300025935 Ga0207709_10127458 Ga0207709_101274582 279
1359 3300025940 Ga0207691_10015863 Ga0207691_100158637 279
1360 3300025940 Ga0207691_10062102 Ga0207691_100621024 279
1361 3300025942 Ga0207689_10005022 Ga0207689_1000502211 279
1362 3300025949 Ga0207667_10024411 Ga0207667_100244115 279
1363 3300025961 Ga0207712_10000783 Ga0207712_100007839 279
1364 3300025972 Ga0207668_10141526 Ga0207668_101415262 279
1365 3300025981 Ga0207640_10298510 Ga0207640_102985102 279
1366 3300026035 Ga0207703_10010670 Ga0207703_100106706 279
1367 3300026041 Ga0207639_10010625 Ga0207639_100106254 279
1368 3300026067 Ga0207678_10021259 Ga0207678_100212593 279
1369 3300026067 Ga0207678_10085250 Ga0207678_100852504 279
1370 3300026078 Ga0207702_10297191 Ga0207702_102971912 279
1371 3300026088 Ga0207641_10073424 Ga0207641_100734244 279
1372 3300026116 Ga0207674_10113418 Ga0207674_101134182 279
1373 3300026116 Ga0207674_10185182 Ga0207674_101851822 279
1374 3300026118 Ga0207675_100337628 Ga0207675_1003376282 279
1375 3300028380 Ga0268265_10123688 Ga0268265_101236882 279
1376 3300028381 Ga0268264_10005356 Ga0268264_100053564 279
1377 3300031548 Ga0307408_100189984 Ga0307408_1001899842 279
1378 3300044901 Ga0466960_0050556 Ga0466960_0050556_322_1218 279
1379 3300048911 Ga0496108_0004829 Ga0496108_0004829_1292_2173 279
1380 3300050510 nmdc:mga06r32_228695_c1 nmdc:mga06r32_228695_c1_471_1355 279
1381 3300050512 nmdc:mga0n895_228599_c1 nmdc:mga0n895_228599_c1_362_1246 279
1382 3300050515 nmdc:mga0a205_4289_c1 nmdc:mga0a205_4289_c1_989_1873 279
1383 3300001979 JGI24740J21852_10006249 JGI24740J21852_100062495 280
1384 3300001989 JGI24739J22299_10004554 JGI24739J22299_100045545 280
1385 3300001990 JGI24737J22298_10000027 JGI24737J22298_1000002721 280
1386 3300001991 JGI24743J22301_10018467 JGI24743J22301_100184671 280
1387 3300002073 JGI24745J21846_1008512 JGI24745J21846_10085122 280
1388 3300002075 JGI24738J21930_10000290 JGI24738J21930_100002902 280
1389 3300005327 Ga0070658_10308606 Ga0070658_103086062 280
1390 3300005328 Ga0070676_10021382 Ga0070676_100213823 280
1391 3300005330 Ga0070690_100006566 Ga0070690_1000065665 280
1392 3300005331 Ga0070670_100034634 Ga0070670_1000346344 280
1393 3300005331 Ga0070670_100040649 Ga0070670_1000406492 280
1394 3300005333 Ga0070677_10031905 Ga0070677_100319052 280
1395 3300005334 Ga0068869_100000085 Ga0068869_10000008527 280
1396 3300005338 Ga0068868_100020324 Ga0068868_1000203244 280
1397 3300005338 Ga0068868_100245841 Ga0068868_1002458412 280
1398 3300005339 Ga0070660_100000881 Ga0070660_10000088112 280
1399 3300005344 Ga0070661_100087461 Ga0070661_1000874613 280
1400 3300005347 Ga0070668_100089906 Ga0070668_1000899062 280
1401 3300005353 Ga0070669_100000693 Ga0070669_10000069310 280
1402 3300005353 Ga0070669_100085027 Ga0070669_1000850272 280
1403 3300005353 Ga0070669_100382442 Ga0070669_1003824422 280
1404 3300005354 Ga0070675_100007745 Ga0070675_1000077453 280
1405 3300005355 Ga0070671_100018580 Ga0070671_1000185802 280
1406 3300005355 Ga0070671_100036951 Ga0070671_1000369513 280
1407 3300005364 Ga0070673_100000450 Ga0070673_10000045016 280
1408 3300005366 Ga0070659_100000525 Ga0070659_10000052520 280
1409 3300005367 Ga0070667_100017242 Ga0070667_1000172421 280
1410 3300005367 Ga0070667_100042224 Ga0070667_1000422243 280
1411 3300005367 Ga0070667_100070257 Ga0070667_1000702572 280
1412 3300005455 Ga0070663_100098725 Ga0070663_1000987252 280
1413 3300005455 Ga0070663_100205742 Ga0070663_1002057422 280
1414 3300005457 Ga0070662_100000337 Ga0070662_10000033716 280
1415 3300005457 Ga0070662_100173389 Ga0070662_1001733892 280
1416 3300005459 Ga0068867_100000661 Ga0068867_10000066110 280
1417 3300005459 Ga0068867_100097947 Ga0068867_1000979473 280
1418 3300005539 Ga0068853_100009596 Ga0068853_1000095963 280
1419 3300005543 Ga0070672_100000476 Ga0070672_10000047611 280
1420 3300005546 Ga0070696_100006623 Ga0070696_1000066234 280
1421 3300005547 Ga0070693_100132027 Ga0070693_1001320272 280
1422 3300005548 Ga0070665_100001860 Ga0070665_10000186010 280
1423 3300005563 Ga0068855_100001289 Ga0068855_10000128921 280
1424 3300005564 Ga0070664_100010937 Ga0070664_1000109375 280
1425 3300005564 Ga0070664_100012159 Ga0070664_1000121592 280
1426 3300005577 Ga0068857_100001000 Ga0068857_10000100021 280
1427 3300005577 Ga0068857_100076319 Ga0068857_1000763194 280
1428 3300005578 Ga0068854_100000173 Ga0068854_10000017321 280
1429 3300005616 Ga0068852_100001638 Ga0068852_1000016384 280
1430 3300005616 Ga0068852_100012767 Ga0068852_1000127673 280
1431 3300005617 Ga0068859_100001231 Ga0068859_10000123127 280
1432 3300005617 Ga0068859_100011216 Ga0068859_1000112165 280
1433 3300005618 Ga0068864_100000953 Ga0068864_1000009532 280
1434 3300005618 Ga0068864_100001870 Ga0068864_10000187016 280
1435 3300005718 Ga0068866_10004891 Ga0068866_100048912 280
1436 3300005834 Ga0068851_10001580 Ga0068851_100015808 280
1437 3300005841 Ga0068863_100001401 Ga0068863_10000140120 280
1438 3300005841 Ga0068863_100335835 Ga0068863_1003358352 280
1439 3300005842 Ga0068858_100000561 Ga0068858_10000056136 280
1440 3300005842 Ga0068858_100001052 Ga0068858_10000105221 280
1441 3300005843 Ga0068860_100005038 Ga0068860_1000050383 280
1442 3300005843 Ga0068860_100005142 Ga0068860_10000514213 280
1443 3300005843 Ga0068860_100099784 Ga0068860_1000997842 280
1444 3300005844 Ga0068862_100023271 Ga0068862_1000232714 280
1445 3300005844 Ga0068862_100038768 Ga0068862_1000387684 280
1446 3300006358 Ga0068871_100164782 Ga0068871_1001647822 280
1447 3300006881 Ga0068865_100000263 Ga0068865_10000026313 280
1448 3300006931 Ga0097620_100001231 Ga0097620_1000012314 280
1449 3300006931 Ga0097620_100011216 Ga0097620_1000112165 280
1450 3300009098 Ga0105245_10000170 Ga0105245_1000017067 280
1451 3300009177 Ga0105248_10002857 Ga0105248_1000285711 280
1452 3300009551 Ga0105238_10232108 Ga0105238_102321082 280
1453 3300009551 Ga0105238_10402207 Ga0105238_104022072 280
1454 3300009553 Ga0105249_10408541 Ga0105249_104085412 280
1455 3300011119 Ga0105246_10007418 Ga0105246_100074184 280
1456 3300013102 Ga0157371_10002538 Ga0157371_1000253812 280
1457 3300013297 Ga0157378_10000540 Ga0157378_100005404 280
1458 3300013307 Ga0157372_10071189 Ga0157372_100711894 280
1459 3300013308 Ga0157375_10266450 Ga0157375_102664502 280
1460 3300025315 Ga0207697_10000072 Ga0207697_1000007227 280
1461 3300025321 Ga0207656_10002678 Ga0207656_100026784 280
1462 3300025901 Ga0207688_10000289 Ga0207688_1000028919 280
1463 3300025903 Ga0207680_10030887 Ga0207680_100308872 280
1464 3300025904 Ga0207647_10000629 Ga0207647_1000062915 280
1465 3300025907 Ga0207645_10014382 Ga0207645_100143824 280
1466 3300025907 Ga0207645_10046819 Ga0207645_100468194 280
1467 3300025908 Ga0207643_10105795 Ga0207643_101057952 280
1468 3300025919 Ga0207657_10009745 Ga0207657_100097452 280
1469 3300025920 Ga0207649_10060123 Ga0207649_100601233 280
1470 3300025923 Ga0207681_10006421 Ga0207681_100064213 280
1471 3300025923 Ga0207681_10093509 Ga0207681_100935093 280
1472 3300025923 Ga0207681_10193313 Ga0207681_101933132 280
1473 3300025923 Ga0207681_10318909 Ga0207681_103189092 280
1474 3300025924 Ga0207694_10294957 Ga0207694_102949572 280
1475 3300025925 Ga0207650_10058555 Ga0207650_100585554 280
1476 3300025926 Ga0207659_10004404 Ga0207659_100044043 280
1477 3300025927 Ga0207687_10001079 Ga0207687_100010794 280
1478 3300025931 Ga0207644_10024915 Ga0207644_100249153 280
1479 3300025931 Ga0207644_10083939 Ga0207644_100839393 280
1480 3300025932 Ga0207690_10003153 Ga0207690_100031535 280
1481 3300025933 Ga0207706_10000816 Ga0207706_1000081621 280
1482 3300025933 Ga0207706_10200573 Ga0207706_102005732 280
1483 3300025938 Ga0207704_10000514 Ga0207704_1000051413 280
1484 3300025940 Ga0207691_10001562 Ga0207691_1000156211 280
1485 3300025941 Ga0207711_10000105 Ga0207711_1000010597 280
1486 3300025941 Ga0207711_10002153 Ga0207711_100021539 280
1487 3300025942 Ga0207689_10000051 Ga0207689_1000005121 280
1488 3300025942 Ga0207689_10016638 Ga0207689_100166382 280
1489 3300025945 Ga0207679_10007340 Ga0207679_100073404 280
1490 3300025949 Ga0207667_10013680 Ga0207667_100136804 280
1491 3300025960 Ga0207651_10038903 Ga0207651_100389034 280
1492 3300025961 Ga0207712_10321370 Ga0207712_103213702 280
1493 3300025972 Ga0207668_10072528 Ga0207668_100725283 280
1494 3300025981 Ga0207640_10003018 Ga0207640_100030184 280
1495 3300025981 Ga0207640_10269579 Ga0207640_102695792 280
1496 3300025986 Ga0207658_10001832 Ga0207658_1000183213 280
1497 3300025986 Ga0207658_10004192 Ga0207658_100041924 280
1498 3300025986 Ga0207658_10031300 Ga0207658_100313004 280
1499 3300026023 Ga0207677_10005957 Ga0207677_100059575 280
1500 3300026023 Ga0207677_10228931 Ga0207677_102289312 280
1501 3300026035 Ga0207703_10002918 Ga0207703_100029185 280
1502 3300026035 Ga0207703_10006321 Ga0207703_100063212 280
1503 3300026041 Ga0207639_10002396 Ga0207639_1000239611 280
1504 3300026041 Ga0207639_10027199 Ga0207639_100271993 280
1505 3300026067 Ga0207678_10110638 Ga0207678_101106382 280
1506 3300026078 Ga0207702_10157399 Ga0207702_101573992 280
1507 3300026088 Ga0207641_10000205 Ga0207641_1000020580 280
1508 3300026088 Ga0207641_10002378 Ga0207641_1000237813 280
1509 3300026088 Ga0207641_10057442 Ga0207641_100574422 280
1510 3300026089 Ga0207648_10000221 Ga0207648_1000022121 280
1511 3300026089 Ga0207648_10131563 Ga0207648_101315632 280
1512 3300026095 Ga0207676_10000898 Ga0207676_1000089814 280
1513 3300026095 Ga0207676_10130939 Ga0207676_101309392 280
1514 3300026095 Ga0207676_10241236 Ga0207676_102412362 280
1515 3300026116 Ga0207674_10001223 Ga0207674_1000122318 280
1516 3300026116 Ga0207674_10021077 Ga0207674_100210771 280
1517 3300026118 Ga0207675_100063616 Ga0207675_1000636162 280
1518 3300026142 Ga0207698_10014565 Ga0207698_100145654 280
1519 3300026142 Ga0207698_10018365 Ga0207698_100183654 280
1520 3300028379 Ga0268266_10000200 Ga0268266_1000020062 280
1521 3300028380 Ga0268265_10002659 Ga0268265_100026594 280
1522 3300028380 Ga0268265_10007828 Ga0268265_100078289 280
1523 3300028380 Ga0268265_10031822 Ga0268265_100318223 280
1524 3300028381 Ga0268264_10001019 Ga0268264_1000101916 280
1525 3300028381 Ga0268264_10006551 Ga0268264_100065514 280
1526 3300028381 Ga0268264_10131845 Ga0268264_101318452 280
1527 3300046616 Ga0495668_0012789 Ga0495668_0012789_801_1679 280
1528 3300053134 Ga0500658_0000032 Ga0500658_0000032_11090_11968 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02195

ParBc

ParB/Sulfiredoxin domain

76

168

0.98

PF23552

305

354

0.97

PF17762

HTH_ParB

HTH domain found in ParB protein

218

266

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s6h-assembly1.cif.gz_A crystal structure of the dna binding domain of the chromosome-partitioning protein parb complexed to the centromeric pars site 0.9274 107 211
6t1f-assembly2.cif.gz_D crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site 0.911 24 212
6y93-assembly1.cif.gz_A crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.9035 118 218
6t1f-assembly2.cif.gz_D crystal structure of the c-terminally truncated chromosome-partitioning protein parb from caulobacter crescentus complexed to the centromeric pars site 0.8973 24 212
6y93-assembly1.cif.gz_B crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.8969 109 216
ID Description Score Start End Superfamily
1vz0A01 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.987 44 98 3.90.1530.30
af_P9WIJ9_142_255_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9609 109 209 1.10.10.2830
af_Q2FUQ5_107_218_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9576 101 209 1.10.10.2830
1vz0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.936 101 213 1.10.10.2830
af_Q2FUQ5_43_106_3.90.1530.30 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.9345 37 98 3.90.1530.30
ID Description Score Start End GO Terms
AF-A0A2T4RMR3-F1-model_v4 deleted 0.9491 107 215
AF-A0A523DAK4-F1-model_v4 ParB/RepB/Spo0J family partition protein 0.9479 21 212 GO:0003677
GO:0005694
GO:0007059
AF-A0A7C4ZXV3-F1-model_v4 ParB/RepB/Spo0J family partition protein 0.9434 99 222 GO:0003677
GO:0005694
GO:0007059
AF-A0A357Z1L7-F1-model_v4 Nucleoid occlusion protein 0.9416 23 120 GO:0003677
GO:0005694
GO:0007059
AF-A0A375HEQ9-F1-model_v4 Partitioning protein 0.9372 23 209 GO:0005694
GO:0007059
GO:0043565

Feature Viewer

pLDDT pTM Quality
82.92 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map