F494586

General Info

Members Datasets Scaffolds Average Seq Length
1529 984 893 251

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10001262|Ga0055531_100012628
Length 287
Sequence MVTDTQHQLGERVLSKGIELFDLSGKRALITGSSQGIGLSLAKGLAAAGAEIVLNGRDRGRATVRTLLFDATDVRAVRAAIDGFEQSTGPIDILVNNAGMQHRAPLEEFDPDMFELLMRTNVSSAFNVGQAVARHMIARGRGKIINIASIQTALARPGIAPYTASKGALGNLTKGMATDWARHGLAVNAIAPGYFDTPLNAALVADAEFSRWIERRTPAGRWGRLEELTGACIFLASDASSYVNGHILYVDGGMSACLXXPSDTGFAAFCAPPRIRVPXGLRPPPAH

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
54 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
55 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
56 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
57 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
58 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
59 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
60 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
61 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
62 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
63 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
64 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
65 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
66 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
67 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
68 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
69 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
70 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
71 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
72 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
73 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
74 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
75 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
76 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
77 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
78 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
79 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
80 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
81 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
82 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
83 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
84 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
85 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
86 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
87 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
88 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
89 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
90 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
91 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
92 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
93 2643221558 Rhizobium sp. Root149 Isolate Unclassified
94 2643221582 Rhizobium sp. Root651 Isolate Unclassified
95 2643221591 Devosia sp. Root685 Isolate Unclassified
96 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
97 2643221599 Rhizobium sp. Root708 Isolate Unclassified
98 2643221607 Rhizobium sp. Root73 Isolate Unclassified
99 2643221618 Ensifer sp. Root231 Isolate Unclassified
100 2643221626 Ensifer sp. Root31 Isolate Unclassified
101 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
102 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
103 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
104 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
105 2643221655 Ensifer sp. Root1252 Isolate Unclassified
106 2643221659 Ensifer sp. Root127 Isolate Unclassified
107 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
108 2643221688 Rhizobium sp. Root482 Isolate Unclassified
109 2643221693 Rhizobium sp. Root491 Isolate Unclassified
110 2643221698 Ensifer sp. Root142 Isolate Unclassified
111 2643221712 Ensifer sp. Root258 Isolate Unclassified
112 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
113 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
114 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
115 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
116 2718217882 Rhizobium sp. N741 Isolate Nodule
117 2718217927 Rhizobium sp. N324 Isolate Nodule
118 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
119 2718218009 Rhizobium sp. N561 Isolate Nodule
120 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
121 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
122 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
123 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
124 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
125 2718218363 Rhizobium sp. N113 Isolate Nodule
126 2718218365 Rhizobium sp. N731 Isolate Nodule
127 2718218366 Rhizobium sp. N621 Isolate Nodule
128 2718218423 Rhizobium sp. N941 Isolate Nodule
129 2721755514 Rhizobium sp. N6212 Isolate Nodule
130 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
131 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
132 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
133 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
134 2721755809 Rhizobium sp. N541 Isolate Nodule
135 2721755810 Rhizobium sp. N871 Isolate Nodule
136 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
137 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
138 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
139 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
140 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
141 2728369365 Rhizobium sp. N1341 Isolate Nodule
142 2728369397 Rhizobium sp. N1314 Isolate Nodule
143 2738541293 Rhizobium sp. GV031 Isolate Unclassified
144 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
145 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
146 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
147 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
148 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
149 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
150 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
151 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
152 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
153 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
154 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
155 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
156 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
157 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
158 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
159 2791355199
160 2791355256 Rhizobium sp. M10 Isolate Nodule
161 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
162 2791355260 Rhizobium sp. L9 Isolate Nodule
163 2791355261 Rhizobium sp. J15 Isolate Nodule
164 2791355262 Rhizobium sp. M1 Isolate Nodule
165 2791355263 Rhizobium chutanense C5 Isolate Nodule
166 2791355264 Rhizobium sp. S9 Isolate Nodule
167 2791355265 Rhizobium sp. H4 Isolate Nodule
168 2791355267 Rhizobium sp. L18 Isolate Nodule
169 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
170 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
171 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
172 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
173 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
174 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
175 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
176 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
177 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
178 2802429633 Rhizobium anhuiense J3 Isolate Nodule
179 2802429634 Rhizobium anhuiense S10 Isolate Nodule
180 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
181 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
182 2802429637 Rhizobium anhuiense C15 Isolate Nodule
183 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
184 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
185 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
186 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
187 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
188 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
189 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
190 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
191 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
192 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
193 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
194 2838061910 Rhizobium phaseoli L15 Isolate Nodule
195 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
196 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
197 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
198 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
199 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
200 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
201 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
202 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
203 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
204 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
205 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
206 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
207 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
208 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
209 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
210 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
211 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
212 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
213 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
214 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
215 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
216 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
217 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
218 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
219 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
220 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
221 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
222 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
223 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
224 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
225 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
226 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
227 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
228 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
229 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
230 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
231 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
232 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
233 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
234 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
235 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
236 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
237 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
238 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
239 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
240 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
241 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
242 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
243 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
244 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
245 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
246 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
247 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
248 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
249 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
250 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
251 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
252 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
253 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
254 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
255 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
256 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
257 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
258 2844163670 Ensifer sp. 1H6 Isolate Unclassified
259 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
260 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
261 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
262 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
263 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
264 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
265 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
266 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
267 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
268 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
269 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
270 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
271 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
272 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
273 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
274 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
275 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
276 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
277 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
278 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
279 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
280 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
281 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
282 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
283 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
284 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
285 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
286 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
287 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
288 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
289 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
290 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
291 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
292 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
293 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
294 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
295 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
296 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
297 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
298 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
299 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
300 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
301 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
302 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
303 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
304 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
305 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
306 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
307 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
308 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
309 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
310 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
311 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
312 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
313 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
314 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
315 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
316 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
317 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
318 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
319 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
320 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
321 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
322 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
323 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
324 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
325 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
326 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
327 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
328 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
329 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
330 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
331 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
332 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
333 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
334 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
335 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
336 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
337 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
338 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
339 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
340 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
341 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
342 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
343 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
344 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
345 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
346 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
347 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
348 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
349 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
350 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
351 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
352 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
353 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
354 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
355 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
356 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
357 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
358 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
359 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
360 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
361 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
362 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
363 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
364 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
365 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
366 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
367 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
368 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
369 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
370 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
371 2936381700 Rhizobium chutanense C16 Isolate Unclassified
372 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
373 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
374 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
375 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
376 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
377 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
378 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
379 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
380 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
381 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
382 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
383 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
384 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
385 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
386 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
387 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
388 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
389 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
390 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
391 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
392 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
393 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
394 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
395 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
396 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
397 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
398 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
399 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
400 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
401 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
402 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
403 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
404 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
405 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
406 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
407 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
408 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
409 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
410 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
411 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
412 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
413 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
414 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
415 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
416 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
417 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
418 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
419 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
420 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
421 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
422 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
423 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
424 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
425 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
426 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
427 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
428 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
429 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
430 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
431 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
432 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
433 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
434 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
435 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
436 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
437 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
438 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
439 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
440 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
441 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
442 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
443 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
444 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
445 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
446 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
447 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
448 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
449 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
450 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
451 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
452 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
453 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
454 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
455 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
456 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
457 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
458 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
459 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
460 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
461 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
462 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
463 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
464 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
465 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
466 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
467 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
468 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
469 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
470 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
471 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
472 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
473 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
474 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
475 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
476 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
477 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
478 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
479 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
480 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
481 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
482 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
483 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
484 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
485 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
486 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
487 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
488 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
489 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
490 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
491 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
492 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
493 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
494 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
495 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
496 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
497 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
498 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
499 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
500 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
501 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
502 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
503 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
504 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
505 2996887358 Rhizobium sp. R711 Isolate Nodule
506 2996893221 Rhizobium sp. R635 Isolate Nodule
507 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
508 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
509 3004167301 Mesorhizobium loti 582 Isolate Unclassified
510 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
511 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
512 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
513 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
514 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
515 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
516 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
517 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
518 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
519 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
520 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
521 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
522 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
523 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
524 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
525 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
526 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
527 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
528 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
529 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
530 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
531 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
532 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
533 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
534 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
535 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
536 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
537 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
538 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
539 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
540 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
541 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
542 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
543 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
544 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
545 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
546 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
547 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
548 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
549 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
550 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
551 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
552 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
553 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
554 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
555 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
556 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
557 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
558 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
559 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
560 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
561 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
562 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
563 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
564 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
565 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
566 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
567 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
568 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
569 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
570 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
571 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
572 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
573 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
574 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
575 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
576 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
577 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
578 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
579 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
580 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
581 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
582 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
583 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
584 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
585 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
586 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
587 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
588 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
589 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
590 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
591 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
592 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
593 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
594 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
595 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
596 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
597 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
598 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
599 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
600 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
601 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
602 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
603 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
604 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
605 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
606 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
607 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
608 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
609 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
610 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
611 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
612 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
613 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
614 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
615 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
616 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
617 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
618 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
619 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
620 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
621 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
622 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
623 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
624 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
625 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
626 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
627 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
628 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
629 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
630 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
631 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
632 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
633 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
634 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
635 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
636 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
637 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
638 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
639 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
640 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
641 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
642 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
643 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
644 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
645 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
646 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
647 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
648 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
649 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
650 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
651 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
652 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
653 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
654 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
655 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
656 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
657 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
658 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
659 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
660 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
661 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
662 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
663 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
664 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
665 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
666 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
667 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
668 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
669 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
670 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
671 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
672 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
673 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
674 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
675 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
676 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
677 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
678 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
680 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
681 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
682 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
683 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
684 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
695 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
696 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
697 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
698 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
700 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
701 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
702 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
703 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
704 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
705 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
706 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
707 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
708 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
709 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
710 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
711 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
712 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
713 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
714 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
715 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
716 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
717 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
718 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
719 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
720 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
721 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
722 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
723 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
724 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
725 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
726 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
727 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
728 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
729 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
730 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
731 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
732 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
733 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
734 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
735 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
736 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
737 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
738 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
739 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
740 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
741 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
742 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
743 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
744 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
745 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
746 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
747 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
748 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
749 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
750 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
751 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
752 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
753 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
754 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
755 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
756 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
757 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
758 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
759 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
760 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
761 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
762 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
763 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
764 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
765 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
766 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
767 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
768 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
769 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
770 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
771 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
772 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
773 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
774 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
775 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
776 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
777 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
778 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
779 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
780 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
781 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
782 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
783 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
784 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
785 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
786 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
787 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
788 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
789 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
790 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
791 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
792 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
793 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
794 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
795 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
796 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
797 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
798 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
799 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
800 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
801 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
802 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
803 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
804 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
805 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
806 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
807 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
808 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
809 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
810 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
811 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
812 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
813 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
814 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
815 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
816 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
817 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
818 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
819 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
820 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
821 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
822 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
823 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
824 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
825 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
826 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
827 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
828 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
829 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
830 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
831 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
832 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
833 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
834 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
835 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
836 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
837 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
838 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
839 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
840 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
841 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
842 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
843 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
844 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
845 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
846 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
847 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
848 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
849 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
850 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
851 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
852 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
853 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
854 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
855 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
856 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
857 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
858 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
859 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
860 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
861 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
862 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
863 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
864 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
865 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
866 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
867 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
868 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
869 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
870 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
871 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
872 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
873 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
874 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
875 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
876 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
877 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
878 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
879 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
880 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
881 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
882 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
883 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
884 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
885 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
886 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
887 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
888 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
889 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
890 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
891 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
892 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
893 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
894 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
895 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
896 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
897 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
898 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
899 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
900 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
901 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
902 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
903 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
904 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
905 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
906 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
907 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
908 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
909 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
910 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
911 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
912 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
913 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
914 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
915 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
916 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
917 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
918 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
919 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
920 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
921 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
922 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
923 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
924 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
925 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
926 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
927 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
928 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
929 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
930 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
931 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
932 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
933 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
934 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
935 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
936 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
937 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
938 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
939 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
940 8005258706 Rhizobium sp. R693 Isolate Nodule
941 8005275841 Rhizobium sp. N4311 Isolate Nodule
942 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
943 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
944 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
945 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
946 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
947 8005321885 Rhizobium sp. R72 Isolate Nodule
948 8005382845 Rhizobium sp. R634 Isolate Nodule
949 8005395548 Rhizobium sp. R339 Isolate Nodule
950 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
951 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
952 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
953 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
954 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
955 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
956 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
957 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
958 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
959 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
960 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
961 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
962 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
963 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
964 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
965 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
966 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
967 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
968 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
969 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
970 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
971 8018176218 Rhizobium sp. N122 Isolate Nodule
972 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
973 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
974 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
975 8024501048 Rhizobium sp. H4 Isolate Nodule
976 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
977 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
978 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
979 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
980 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
981 8056382006 Rhizobium croatiense 13T Isolate Nodule
982 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
983 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
984 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.57
Metatranscriptomes 0
Isolates 41.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 14.19
Nodule 32.5
Rhizoplane 2.75
Rhizosphere 35.06
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000407 3300002067 Bacteria 15061
2 JGI25155J39150_1000047 3300002704 Bacteria 80068
3 JGI25156J39149_1000069 3300002705 Bacteria 81255
4 JGI25156J39149_1000078 3300002705 Bacteria 74254
5 JGI25162J39368_1000184 3300002737 Bacteria 67069
6 JGI25162J39368_1001511 3300002737 Bacteria 12072
7 JGI25154J39366_1000091 3300002738 Bacteria 80948
8 JGI25154J39366_1000105 3300002738 Bacteria 74254
9 JGI25157J39369_1000085 3300002741 Bacteria 81255
10 JGI25157J39369_1000098 3300002741 Bacteria 74254
11 JGI25152J39213_1000318 3300002773 Bacteria 31015
12 JGI25152J39213_1020291 3300002773 Bacteria 1189
13 JGI25150J39212_1000103 3300002774 Bacteria 49029
14 JGI25150J39212_1000223 3300002774 Bacteria 31015
15 JGI25151J46595_10000085 3300003187 Bacteria 127212
16 JGI25151J46595_10000337 3300003187 Bacteria 50281
17 JGI25151J46595_10000442 3300003187 Bacteria 40576
18 JGI25151J46595_10000481 3300003187 Bacteria 37750
19 JGI25406J46586_10046501 3300003203 Bacteria 1486
20 JGI25406J46586_10067921 3300003203 Bacteria 1127
21 JGI25165J46597_1000163 3300003214 Bacteria 104693
22 JGI25165J46597_1000505 3300003214 Bacteria 37462
23 JGI25165J46597_1004580 3300003214 Bacteria 2917
24 JGI25153J46596_10001557 3300003215 Bacteria 13610
25 JGI25153J46596_10001705 3300003215 Bacteria 13039
26 JGI25153J46596_10002607 3300003215 Bacteria 10314
27 JGI25153J46596_10007007 3300003215 Bacteria 5612
28 JGI25153J46596_10016829 3300003215 Bacteria 2910
29 JGI25153J46596_10047318 3300003215 Bacteria 1266
30 rootL2_10000436 3300003322 Bacteria 30353
31 rootL2_10229133 3300003322 Bacteria 2342
32 rootH1_10013159 3300003323 Bacteria 10352
33 rootH1_10020411 3300003323 Bacteria 3603
34 rootH1_10130821 3300003323 Bacteria 2490
35 rootH1_10233468 3300003323 Bacteria 1282
36 JGI25160J50197_1000040 3300003354 Bacteria 154507
37 JGI25160J50197_1000042 3300003354 Bacteria 149808
38 JGI25160J50197_1002870 3300003354 Bacteria 7886
39 JGI25160J50197_1027272 3300003354 Bacteria 1558
40 JGI25161J50226_1000023 3300003374 Bacteria 154507
41 JGI25161J50226_1002292 3300003374 Bacteria 4998
42 Ga0055526_1001366 3300003771 Bacteria 17474
43 Ga0055526_1002425 3300003771 Bacteria 12630
44 Ga0055526_1005586 3300003771 Bacteria 7168
45 Ga0055526_1054777 3300003771 Bacteria 884
46 Ga0055524_1001200 3300003775 Bacteria 15379
47 Ga0055524_1002365 3300003775 Bacteria 9812
48 Ga0055524_1006515 3300003775 Bacteria 5055
49 Ga0055524_1018578 3300003775 Bacteria 2409
50 Ga0055524_1033400 3300003775 Bacteria 1441
51 Ga0055528_1000684 3300003790 Bacteria 24218
52 Ga0055528_1001834 3300003790 Bacteria 12128
53 Ga0055528_1001856 3300003790 Bacteria 12030
54 Ga0055528_1032308 3300003790 Bacteria 1339
55 Ga0055528_1040001 3300003790 Bacteria 1063
56 Ga0055540_1000066 3300003792 Bacteria 122947
57 Ga0055540_1003244 3300003792 Bacteria 7973
58 Ga0055540_1004899 3300003792 Bacteria 5846
59 Ga0055540_1008406 3300003792 Bacteria 3723
60 Ga0055540_1013560 3300003792 Bacteria 2483
61 Ga0055531_10001262 3300003794 Bacteria 19144
62 Ga0058692_1001181 3300003856 Bacteria 10020
63 Ga0058692_1001802 3300003856 Bacteria 7558
64 Ga0055543_1000123 3300004625 Bacteria 64977
65 Ga0055543_1001035 3300004625 Bacteria 12362
66 Ga0055543_1001548 3300004625 Bacteria 8926
67 Ga0055543_1001620 3300004625 Bacteria 8595
68 Ga0065165_1000484 3300005262 Bacteria 61542
69 Ga0065165_1010245 3300005262 Bacteria 4082
70 Ga0070658_10177806 3300005327 Bacteria 1790
71 Ga0070676_10279281 3300005328 Bacteria 1125
72 Ga0070683_100134214 3300005329 Bacteria 2343
73 Ga0070670_100023690 3300005331 Bacteria 5284
74 Ga0070670_100218563 3300005331 Bacteria 1658
75 Ga0070677_10013535 3300005333 Bacteria 2855
76 Ga0070666_10133810 3300005335 Bacteria 1724
77 Ga0068868_100016759 3300005338 Bacteria 5448
78 Ga0070689_100064391 3300005340 Bacteria 2853
79 Ga0070675_100052192 3300005354 Bacteria 3361
80 Ga0070675_100053659 3300005354 Bacteria 3316
81 Ga0070671_100043262 3300005355 Bacteria 3743
82 Ga0070671_100161529 3300005355 Bacteria 1894
83 Ga0070674_100002557 3300005356 Bacteria 10071
84 Ga0070674_100083437 3300005356 Bacteria 2289
85 Ga0070674_100266129 3300005356 Bacteria 1353
86 Ga0070673_100133648 3300005364 Bacteria 2085
87 Ga0070673_100166883 3300005364 Bacteria 1876
88 Ga0070688_100171018 3300005365 Bacteria 1500
89 Ga0070688_100269308 3300005365 Bacteria 1220
90 Ga0070659_100611932 3300005366 Bacteria 937
91 Ga0070709_10222278 3300005434 Bacteria 1347
92 Ga0070713_100395117 3300005436 Bacteria 1290
93 Ga0070711_100097584 3300005439 Bacteria 2131
94 Ga0070705_100466455 3300005440 Bacteria 951
95 Ga0070663_100058323 3300005455 Bacteria 2772
96 Ga0070663_100112169 3300005455 Bacteria 2050
97 Ga0070678_100012048 3300005456 Bacteria 5359
98 Ga0070678_100052246 3300005456 Bacteria 2966
99 Ga0070662_100029491 3300005457 Bacteria 3829
100 Ga0068867_100160797 3300005459 Bacteria 1771
101 Ga0070684_100068103 3300005535 Bacteria 3128
102 Ga0070684_100246082 3300005535 Bacteria 1634
103 Ga0068853_100157987 3300005539 Bacteria 2044
104 Ga0068853_100572991 3300005539 Bacteria 1071
105 Ga0070672_100051962 3300005543 Bacteria 3198
106 Ga0070686_100089375 3300005544 Bacteria 2058
107 Ga0070693_100129750 3300005547 Bacteria 1574
108 Ga0070665_100060258 3300005548 Bacteria 3804
109 Ga0070665_100088407 3300005548 Bacteria 3104
110 Ga0070665_100106701 3300005548 Bacteria 2803
111 Ga0070665_100114284 3300005548 Bacteria 2702
112 Ga0070665_100118935 3300005548 Bacteria 2644
113 Ga0070665_100149826 3300005548 Bacteria 2336
114 Ga0070665_100490496 3300005548 Bacteria 1239
115 Ga0070665_100557771 3300005548 Bacteria 1158
116 Ga0068855_100068261 3300005563 Bacteria 4139
117 Ga0068855_100535566 3300005563 Bacteria 1269
118 Ga0070664_100092885 3300005564 Bacteria 2614
119 Ga0068857_100167948 3300005577 Bacteria 1993
120 Ga0068854_100232482 3300005578 Bacteria 1464
121 Ga0068854_100357008 3300005578 Bacteria 1198
122 Ga0068854_100479637 3300005578 Bacteria 1044
123 Ga0068856_100034675 3300005614 Bacteria 4943
124 Ga0068856_100290762 3300005614 Bacteria 1651
125 Ga0068852_100018103 3300005616 Bacteria 5543
126 Ga0068852_100096814 3300005616 Bacteria 2653
127 Ga0068852_100216615 3300005616 Bacteria 1819
128 Ga0068859_100026378 3300005617 Bacteria 5826
129 Ga0068859_100113037 3300005617 Bacteria 2779
130 Ga0068864_100013581 3300005618 Bacteria 6750
131 Ga0068864_100102635 3300005618 Bacteria 2538
132 Ga0068866_10031507 3300005718 Bacteria 2555
133 Ga0068861_100008832 3300005719 Bacteria 6943
134 Ga0068861_100264312 3300005719 Bacteria 1474
135 Ga0068863_100218476 3300005841 Bacteria 1836
136 Ga0068858_100734354 3300005842 Bacteria 961
137 Ga0068860_100094627 3300005843 Bacteria 2847
138 Ga0068860_100575769 3300005843 Bacteria 1130
139 Ga0068862_100082809 3300005844 Bacteria 2785
140 Ga0081455_10161595 3300005937 Bacteria 1716
141 Ga0081455_10413796 3300005937 Bacteria 932
142 Ga0081540_1003572 3300005983 Bacteria 12223
143 Ga0081540_1043689 3300005983 Bacteria 2295
144 Ga0081539_10002462 3300005985 Bacteria 26092
145 Ga0081539_10003922 3300005985 Bacteria 17277
146 Ga0070717_10075006 3300006028 Bacteria 2828
147 Ga0075365_10001142 3300006038 Bacteria 11631
148 Ga0075365_10045745 3300006038 Bacteria 2872
149 Ga0075365_10132740 3300006038 Bacteria 1724
150 Ga0075365_10170912 3300006038 Bacteria 1517
151 Ga0075368_10005890 3300006042 Bacteria 4244
152 Ga0075363_100025077 3300006048 Bacteria 3037
153 Ga0075363_100067595 3300006048 Bacteria 1937
154 Ga0075363_100075634 3300006048 Bacteria 1835
155 Ga0075363_100205310 3300006048 Bacteria 1127
156 Ga0075363_100356798 3300006048 Bacteria 854
157 Ga0075364_10000163 3300006051 Bacteria 29585
158 Ga0075364_10003707 3300006051 Bacteria 8720
159 Ga0075364_10157254 3300006051 Bacteria 1533
160 Ga0075364_10205924 3300006051 Bacteria 1334
161 Ga0075364_10358721 3300006051 Bacteria 994
162 Ga0070712_100019610 3300006175 Bacteria 4414
163 Ga0075367_10009766 3300006178 Bacteria 5026
164 Ga0075367_10022280 3300006178 Bacteria 3551
165 Ga0075367_10026904 3300006178 Bacteria 3267
166 Ga0075367_10114506 3300006178 Bacteria 1658
167 Ga0075369_10002248 3300006186 Bacteria 6849
168 Ga0075369_10009890 3300006186 Bacteria 3719
169 Ga0075369_10018083 3300006186 Bacteria 2867
170 Ga0075369_10095470 3300006186 Bacteria 1330
171 Ga0075369_10111914 3300006186 Bacteria 1231
172 Ga0075366_10000625 3300006195 Bacteria 16631
173 Ga0075366_10034805 3300006195 Bacteria 2968
174 Ga0075366_10125527 3300006195 Bacteria 1548
175 Ga0075366_10236868 3300006195 Bacteria 1112
176 Ga0097621_100008954 3300006237 Bacteria 7240
177 Ga0097621_100235015 3300006237 Bacteria 1601
178 Ga0075370_10008891 3300006353 Bacteria 5188
179 Ga0075370_10018822 3300006353 Bacteria 3750
180 Ga0075370_10075573 3300006353 Bacteria 1931
181 Ga0068871_100383618 3300006358 Bacteria 1249
182 Ga0075428_100131340 3300006844 Bacteria 2724
183 Ga0075431_100028716 3300006847 Bacteria 5719
184 Ga0075429_100119094 3300006880 Bacteria 2307
185 Ga0097620_100026378 3300006931 Bacteria 5826
186 Ga0097620_100113037 3300006931 Bacteria 2779
187 Ga0079104_1000086 3300006946 Bacteria 136260
188 Ga0079104_1018423 3300006946 Bacteria 1977
189 Ga0099826_10003912 3300006948 Bacteria 10289
190 Ga0099826_10005440 3300006948 Bacteria 9133
191 Ga0099826_10164118 3300006948 Bacteria 1255
192 Ga0105251_10001562 3300009011 Bacteria 19609
193 Ga0105240_10000214 3300009093 Bacteria 117038
194 Ga0105240_10000805 3300009093 Bacteria 56899
195 Ga0105240_10006510 3300009093 Bacteria 17157
196 Ga0105240_10550112 3300009093 Bacteria 1277
197 Ga0105240_11115568 3300009093 Bacteria 839
198 Ga0111539_10089994 3300009094 Bacteria 3607
199 Ga0105245_10011711 3300009098 Bacteria 7633
200 Ga0105245_10129365 3300009098 Bacteria 2367
201 Ga0105245_10213355 3300009098 Bacteria 1859
202 Ga0105247_10136853 3300009101 Bacteria 1601
203 Ga0105243_10024296 3300009148 Bacteria 4622
204 Ga0105243_10173480 3300009148 Bacteria 1870
205 Ga0105241_10008631 3300009174 Bacteria 7489
206 Ga0105248_10005586 3300009177 Bacteria 13824
207 Ga0105248_10342177 3300009177 Bacteria 1684
208 Ga0105237_10001263 3300009545 Bacteria 33774
209 Ga0105237_10002236 3300009545 Bacteria 24170
210 Ga0105237_10034873 3300009545 Bacteria 5092
211 Ga0105237_10113948 3300009545 Bacteria 2696
212 Ga0105237_10290018 3300009545 Bacteria 1639
213 Ga0105237_10420753 3300009545 Bacteria 1341
214 Ga0105238_10006455 3300009551 Bacteria 11662
215 Ga0105238_10036176 3300009551 Bacteria 5018
216 Ga0105238_10263197 3300009551 Bacteria 1704
217 Ga0123341_1000005 3300009765 Bacteria 150422
218 Ga0105239_10000952 3300010375 Bacteria 40803
219 Ga0105239_10025522 3300010375 Bacteria 6505
220 Ga0105239_10042797 3300010375 Bacteria 4962
221 Ga0105239_11120350 3300010375 Bacteria 906
222 Ga0105246_10003827 3300011119 Bacteria 9123
223 Ga0105246_10432763 3300011119 Bacteria 1101
224 Ga0157322_1002570 3300012490 Bacteria 1036
225 Ga0157371_10000219 3300013102 Bacteria 83847
226 Ga0157370_10002266 3300013104 Bacteria 23363
227 Ga0157370_10060520 3300013104 Bacteria 3595
228 Ga0157369_10048441 3300013105 Bacteria 4612
229 Ga0157374_10159332 3300013296 Bacteria 2198
230 Ga0157378_10047353 3300013297 Bacteria 3823
231 Ga0163162_10024359 3300013306 Bacteria 5971
232 Ga0157375_10357964 3300013308 Bacteria 1625
233 Ga0157375_10649497 3300013308 Bacteria 1211
234 Ga0163163_10373201 3300014325 Bacteria 1484
235 Ga0157377_10344917 3300014745 Bacteria 997
236 Ga0157376_10063103 3300014969 Bacteria 3120
237 Ga0182007_10002152 3300015262 Bacteria 10020
238 Ga0182005_1022000 3300015265 Bacteria 1747
239 Ga0163161_10089613 3300017792 Bacteria 2275
240 Ga0214544_1000018 3300021320 Bacteria 187095
241 Ga0214542_1000081 3300021321 Bacteria 121242
242 Ga0214542_1003702 3300021321 Bacteria 30842
243 Ga0214542_1019910 3300021321 Bacteria 5110
244 Ga0214543_1000005 3300021327 Bacteria 454523
245 Ga0214543_1000042 3300021327 Bacteria 164433
246 Ga0214543_1003409 3300021327 Bacteria 30837
247 Ga0213876_10017486 3300021384 Bacteria 3786
248 Ga0228711_1030140 3300022739 Bacteria 2864
249 Ga0228710_1017381 3300022740 Bacteria 7177
250 Ga0228710_1021493 3300022740 Bacteria 5197
251 Ga0228710_1022699 3300022740 Bacteria 4759
252 Ga0209435_100010 3300025206 Bacteria 475373
253 Ga0209435_100058 3300025206 Bacteria 81307
254 Ga0209436_100949 3300025208 Bacteria 11425
255 Ga0209437_100095 3300025233 Bacteria 236997
256 Ga0209437_100239 3300025233 Bacteria 89942
257 Ga0207425_1000065 3300025245 Bacteria 127264
258 Ga0207425_1000263 3300025245 Bacteria 38917
259 Ga0207425_1003396 3300025245 Bacteria 5111
260 Ga0207425_1003978 3300025245 Bacteria 4547
261 Ga0209646_1000001 3300025246 Bacteria 3092932
262 Ga0209646_1000178 3300025246 Bacteria 81307
263 Ga0209646_1005995 3300025246 Bacteria 2071
264 Ga0209026_1000001 3300025250 Bacteria 1228671
265 Ga0209026_1000208 3300025250 Bacteria 81307
266 Ga0209677_100248 3300025253 Bacteria 36912
267 Ga0209148_1000302 3300025254 Bacteria 70861
268 Ga0209759_1000001 3300025256 Bacteria 2799452
269 Ga0209759_1000242 3300025256 Bacteria 81307
270 Ga0209129_1000132 3300025258 Bacteria 127262
271 Ga0209129_1000305 3300025258 Bacteria 44613
272 Ga0209129_1000350 3300025258 Bacteria 38917
273 Ga0209129_1000852 3300025258 Bacteria 19125
274 Ga0209233_1000117 3300025261 Bacteria 236984
275 Ga0209233_1000245 3300025261 Bacteria 89961
276 Ga0209233_1000340 3300025261 Bacteria 45824
277 Ga0209455_1000986 3300025272 Bacteria 14388
278 Ga0209673_1000020 3300025273 Bacteria 430653
279 Ga0209673_1000433 3300025273 Bacteria 72554
280 Ga0209673_1001173 3300025273 Bacteria 28378
281 Ga0209673_1002509 3300025273 Bacteria 12617
282 Ga0209673_1007944 3300025273 Bacteria 4791
283 Ga0209673_1010504 3300025273 Bacteria 3898
284 Ga0209673_1021485 3300025273 Bacteria 2255
285 Ga0209130_1000075 3300025284 Bacteria 171698
286 Ga0209130_1000142 3300025284 Bacteria 114724
287 Ga0209130_1016079 3300025284 Bacteria 1822
288 Ga0209675_1022469 3300025291 Bacteria 1656
289 Ga0209676_1065061 3300025292 Bacteria 889
290 Ga0209025_1000081 3300025294 Bacteria 265899
291 Ga0209025_1000247 3300025294 Bacteria 127264
292 Ga0209025_1000603 3300025294 Bacteria 64824
293 Ga0209025_1000996 3300025294 Bacteria 41994
294 Ga0209025_1047278 3300025294 Bacteria 1759
295 Ga0209564_1000114 3300025295 Bacteria 209934
296 Ga0209564_1000722 3300025295 Bacteria 47441
297 Ga0209564_1001882 3300025295 Bacteria 18900
298 Ga0209564_1010318 3300025295 Bacteria 4322
299 Ga0209564_1013756 3300025295 Bacteria 3411
300 Ga0209758_1000076 3300025297 Bacteria 270615
301 Ga0209758_1000130 3300025297 Bacteria 184456
302 Ga0209758_1000212 3300025297 Bacteria 127597
303 Ga0209758_1001278 3300025297 Bacteria 31046
304 Ga0209758_1004022 3300025297 Bacteria 12682
305 Ga0209758_1005376 3300025297 Bacteria 9915
306 Ga0209758_1008129 3300025297 Bacteria 6897
307 Ga0209758_1013138 3300025297 Bacteria 4549
308 Ga0209758_1013694 3300025297 Bacteria 4394
309 Ga0209256_1000123 3300025299 Bacteria 165547
310 Ga0209256_1000175 3300025299 Bacteria 127671
311 Ga0209256_1001407 3300025299 Bacteria 25000
312 Ga0209256_1007753 3300025299 Bacteria 5194
313 Ga0209256_1009511 3300025299 Bacteria 4249
314 Ga0209256_1016219 3300025299 Bacteria 2554
315 Ga0207426_1000076 3300025302 Bacteria 320851
316 Ga0207426_1000163 3300025302 Bacteria 171698
317 Ga0207426_1000169 3300025302 Bacteria 164859
318 Ga0207426_1000285 3300025302 Bacteria 102879
319 Ga0207426_1003057 3300025302 Bacteria 9636
320 Ga0207426_1007406 3300025302 Bacteria 4602
321 Ga0209051_1000038 3300025303 Bacteria 320926
322 Ga0209051_1001529 3300025303 Bacteria 19259
323 Ga0209051_1004437 3300025303 Bacteria 8646
324 Ga0209051_1018859 3300025303 Bacteria 3036
325 Ga0209051_1028520 3300025303 Bacteria 2203
326 Ga0209257_1008419 3300025304 Bacteria 5871
327 Ga0209257_1023815 3300025304 Bacteria 2138
328 Ga0207713_1008595 3300025735 Bacteria 5854
329 Ga0207682_10002344 3300025893 Bacteria 8541
330 Ga0207688_10358253 3300025901 Bacteria 900
331 Ga0207680_10111345 3300025903 Bacteria 1776
332 Ga0207680_10168458 3300025903 Bacteria 1474
333 Ga0207647_10010687 3300025904 Bacteria 6469
334 Ga0207699_10036981 3300025906 Bacteria 2786
335 Ga0207699_10052109 3300025906 Bacteria 2421
336 Ga0207645_10159361 3300025907 Bacteria 1476
337 Ga0207643_10138773 3300025908 Bacteria 1451
338 Ga0207705_10164807 3300025909 Bacteria 1666
339 Ga0207654_10008524 3300025911 Bacteria 5189
340 Ga0207654_10038596 3300025911 Bacteria 2681
341 Ga0207707_10126352 3300025912 Bacteria 2236
342 Ga0207695_10000008 3300025913 Bacteria 1058268
343 Ga0207695_10000373 3300025913 Bacteria 101687
344 Ga0207695_10010120 3300025913 Bacteria 11574
345 Ga0207695_10596650 3300025913 Bacteria 985
346 Ga0207671_10000536 3300025914 Bacteria 51271
347 Ga0207671_10002957 3300025914 Bacteria 17487
348 Ga0207671_10024472 3300025914 Bacteria 4540
349 Ga0207671_10313655 3300025914 Bacteria 1240
350 Ga0207693_10030293 3300025915 Bacteria 4273
351 Ga0207662_10061301 3300025918 Bacteria 2258
352 Ga0207652_10245167 3300025921 Bacteria 1615
353 Ga0207694_10280625 3300025924 Bacteria 1368
354 Ga0207650_10015477 3300025925 Bacteria 5313
355 Ga0207650_10252327 3300025925 Bacteria 1428
356 Ga0207659_10381238 3300025926 Bacteria 1176
357 Ga0207687_10005665 3300025927 Bacteria 8253
358 Ga0207687_10251689 3300025927 Bacteria 1405
359 Ga0207700_10205169 3300025928 Bacteria 1663
360 Ga0207644_10210718 3300025931 Bacteria 1536
361 Ga0207644_10236585 3300025931 Bacteria 1453
362 Ga0207706_10048925 3300025933 Bacteria 3738
363 Ga0207709_10016371 3300025935 Bacteria 4121
364 Ga0207709_10155966 3300025935 Bacteria 1587
365 Ga0207670_10165741 3300025936 Bacteria 1653
366 Ga0207669_10007097 3300025937 Bacteria 5157
367 Ga0207669_10024754 3300025937 Bacteria 3232
368 Ga0207669_10128743 3300025937 Bacteria 1735
369 Ga0207691_10032439 3300025940 Bacteria 4868
370 Ga0207689_10237554 3300025942 Bacteria 1506
371 Ga0207661_10616618 3300025944 Bacteria 996
372 Ga0207679_10254620 3300025945 Bacteria 1494
373 Ga0207667_10689577 3300025949 Bacteria 1024
374 Ga0207640_10428823 3300025981 Bacteria 1084
375 Ga0207640_10830322 3300025981 Bacteria 803
376 Ga0207677_10011073 3300026023 Bacteria 5126
377 Ga0207677_10752342 3300026023 Bacteria 869
378 Ga0207639_10088753 3300026041 Bacteria 2468
379 Ga0207639_10540986 3300026041 Bacteria 1068
380 Ga0207678_10005398 3300026067 Bacteria 11452
381 Ga0207678_10083708 3300026067 Bacteria 2729
382 Ga0207678_10269217 3300026067 Bacteria 1461
383 Ga0207708_10615201 3300026075 Bacteria 921
384 Ga0207702_10824140 3300026078 Bacteria 918
385 Ga0207648_10003173 3300026089 Bacteria 17320
386 Ga0207676_10010301 3300026095 Bacteria 6655
387 Ga0207674_10101536 3300026116 Bacteria 2857
388 Ga0207675_100039144 3300026118 Bacteria 4425
389 Ga0207683_10008735 3300026121 Bacteria 8650
390 Ga0207683_10094456 3300026121 Bacteria 2665
391 Ga0207683_10102807 3300026121 Bacteria 2552
392 Ga0207683_10599713 3300026121 Bacteria 1019
393 Ga0207698_10094138 3300026142 Bacteria 2462
394 Ga0207698_10098968 3300026142 Bacteria 2411
395 Ga0209281_1000920 3300027111 Bacteria 24429
396 Ga0209281_1005534 3300027111 Bacteria 3490
397 Ga0209371_1000035 3300027312 Bacteria 368979
398 Ga0209371_1001218 3300027312 Bacteria 18553
399 Ga0209371_1006004 3300027312 Bacteria 4640
400 Ga0209282_1000230 3300027666 Bacteria 28914
401 Ga0209282_1056745 3300027666 Bacteria 2207
402 Ga0209282_1061294 3300027666 Bacteria 2095
403 Ga0209813_10015067 3300027866 Bacteria 2089
404 Ga0207428_10112287 3300027907 Bacteria 2096
405 Ga0268266_10004161 3300028379 Bacteria 13950
406 Ga0268266_10025419 3300028379 Bacteria 5038
407 Ga0268266_10061548 3300028379 Bacteria 3237
408 Ga0268266_10087731 3300028379 Bacteria 2722
409 Ga0268266_10147600 3300028379 Bacteria 2116
410 Ga0268265_10497480 3300028380 Bacteria 1148
411 Ga0268264_10918964 3300028381 Bacteria 879
412 Ga0265319_1003086 3300028563 Bacteria 8810
413 Ga0265334_10007422 3300028573 Bacteria 4702
414 Ga0265318_10007706 3300028577 Bacteria 4846
415 Ga0265318_10042860 3300028577 Bacteria 1716
416 Ga0265323_10002112 3300028653 Bacteria 9280
417 Ga0265336_10000380 3300028666 Bacteria 28330
418 Ga0307517_10136150 3300028786 Bacteria 1746
419 Ga0307515_10000136 3300028794 Bacteria 174265
420 Ga0307515_10040124 3300028794 Bacteria 7413
421 Ga0307515_10137421 3300028794 Bacteria 2646
422 Ga0265338_10000024 3300028800 Bacteria 297778
423 Ga0265324_10001715 3300029957 Bacteria 12057
424 Ga0268256_1000037 3300030500 Bacteria 367024
425 Ga0268256_1003362 3300030500 Bacteria 7263
426 Ga0268256_1006002 3300030500 Bacteria 4631
427 Ga0316181_1155915 3300030744 Bacteria 2193
428 Ga0265330_10080351 3300031235 Bacteria 1405
429 Ga0265320_10069558 3300031240 Bacteria 1661
430 Ga0265329_10040216 3300031242 Bacteria 1500
431 Ga0265340_10146663 3300031247 Bacteria 1077
432 Ga0265316_10162139 3300031344 Bacteria 1671
433 Ga0307513_10005749 3300031456 Bacteria 16317
434 Ga0307513_10185244 3300031456 Bacteria 1940
435 Ga0307513_10216888 3300031456 Bacteria 1739
436 Ga0307513_10278847 3300031456 Bacteria 1450
437 Ga0307513_10422899 3300031456 Bacteria 1062
438 Ga0307509_10065476 3300031507 Bacteria 3815
439 Ga0307408_100185781 3300031548 Bacteria 1671
440 Ga0265313_10005060 3300031595 Bacteria 9824
441 Ga0307508_10126581 3300031616 Bacteria 2157
442 Ga0307508_10285224 3300031616 Bacteria 1245
443 Ga0265314_10022794 3300031711 Bacteria 4792
444 Ga0265342_10013991 3300031712 Bacteria 5345
445 Ga0265342_10040204 3300031712 Bacteria 2837
446 Ga0316576_10061783 3300031727 Bacteria 2746
447 Ga0307516_10002345 3300031730 Bacteria 25420
448 Ga0307516_10052706 3300031730 Bacteria 3981
449 Ga0307405_10045830 3300031731 Bacteria 2682
450 Ga0307405_10055308 3300031731 Bacteria 2483
451 Ga0307405_10125562 3300031731 Bacteria 1764
452 Ga0315914_1016454 3300031967 Bacteria 7240
453 Ga0315914_1036005 3300031967 Bacteria 1995
454 Ga0307409_100963183 3300031995 Bacteria 870
455 Ga0307414_10309009 3300032004 Bacteria 1341
456 Ga0307510_10003141 3300033180 Bacteria 19142
457 Ga0315913_1013022 3300033430 Bacteria 9141
458 Ga0315913_1029943 3300033430 Bacteria 3930
459 Ga0315915_1000368 3300033464 Bacteria 44095
460 Ga0315915_1021320 3300033464 Bacteria 5269
461 Ga0373958_0015886 3300034819 Bacteria 1336
462 Ga0373939_0045701 3300035114 Bacteria 1338
463 Ga0373953_0195012 3300035117 Bacteria 875
464 Ga0373931_0258265 3300035691 Bacteria 1062
465 Ga0373927_0000586 3300035695 Bacteria 27726
466 Ga0373927_0000835 3300035695 Bacteria 23617
467 Ga0373927_0148667 3300035695 Bacteria 1534
468 Ga0373947_0028775 3300035725 Bacteria 3259
469 Ga0373925_0002089 3300037068 Bacteria 16413
470 Ga0373925_0260398 3300037068 Bacteria 1393
471 Ga0373925_0628844 3300037068 Bacteria 884
472 Ga0436364_0053771 3300037853 Bacteria 1104
473 Ga0436364_0166030 3300037853 Bacteria 1168
474 Ga0436364_0569494 3300037853 Bacteria 1170
475 Ga0400483_277886 3300039062 Bacteria 8296
476 Ga0400483_284574 3300039062 Bacteria 1773
477 Ga0436365_0110753 3300039437 Bacteria 4434
478 Ga0436365_0173076 3300039437 Bacteria 9946
479 Ga0436365_1627531 3300039437 Bacteria 1361
480 Ga0436363_1341968 3300039450 Bacteria 801
481 Ga0439436_0022618 3300041404 Bacteria 1862
482 Ga0439466_0082958 3300041411 Bacteria 1010
483 Ga0439465_0014474 3300041413 Bacteria 2458
484 Ga0439465_0102753 3300041413 Bacteria 988
485 Ga0451793_1613516 3300041452 Bacteria 1042
486 Ga0451807_1532728 3300041486 Bacteria 1083
487 Ga0451833_0571278 3300041491 Bacteria 1254
488 Ga0451835_0341194 3300041492 Bacteria 3083
489 Ga0451839_0553209 3300041496 Bacteria 1535
490 Ga0451847_0247730 3300041503 Bacteria 2122
491 Ga0451849_0247574 3300041505 Bacteria 1131
492 Ga0451851_1205047 3300041507 Bacteria 3460
493 Ga0451855_1407221 3300041511 Bacteria 1068
494 Ga0451855_1443745 3300041511 Bacteria 2364
495 Ga0439449_0055506 3300042007 Bacteria 1463
496 Ga0466963_0005475 3300044694 Bacteria 7434
497 Ga0466963_0063382 3300044694 Bacteria 2474
498 Ga0466963_0250738 3300044694 Bacteria 1242
499 Ga0466970_0000198 3300044765 Bacteria 29185
500 Ga0466957_0065990 3300044842 Bacteria 2230
501 Ga0466957_0125938 3300044842 Bacteria 1637
502 Ga0466959_0060121 3300045049 Bacteria 2765
503 Ga0451576_0215639 3300045051 Bacteria 2004
504 Ga0466958_0073454 3300045836 Bacteria 2095
505 Ga0466958_0155327 3300045836 Bacteria 1444
506 Ga0466967_0082659 3300045976 Bacteria 2903
507 Ga0466967_0082967 3300045976 Bacteria 2898
508 Ga0466967_0762071 3300045976 Bacteria 960
509 Ga0495617_010437 3300046452 Bacteria 3182
510 Ga0495617_040889 3300046452 Bacteria 1550
511 Ga0495603_0007832 3300046455 Bacteria 6441
512 Ga0495603_0022026 3300046455 Bacteria 3859
513 Ga0495590_0003083 3300046457 Bacteria 6820
514 Ga0495590_0071797 3300046457 Bacteria 1215
515 Ga0495638_0000163 3300046460 Bacteria 103363
516 Ga0495638_0004790 3300046460 Bacteria 10202
517 Ga0495638_0013376 3300046460 Bacteria 5588
518 Ga0495638_0016087 3300046460 Bacteria 5013
519 Ga0495638_0019892 3300046460 Bacteria 4439
520 Ga0495638_0067375 3300046460 Bacteria 2198
521 Ga0495605_0037800 3300046474 Bacteria 2425
522 Ga0495662_0001363 3300046476 Bacteria 12078
523 Ga0495664_0010526 3300046477 Bacteria 5192
524 Ga0495664_0112455 3300046477 Bacteria 1644
525 Ga0495584_0005808 3300046491 Bacteria 6505
526 Ga0495585_0025689 3300046492 Bacteria 3370
527 Ga0495585_0036386 3300046492 Bacteria 2777
528 Ga0495585_0165717 3300046492 Bacteria 1144
529 Ga0495607_0003436 3300046501 Bacteria 12123
530 Ga0495607_0025977 3300046501 Bacteria 3637
531 Ga0495583_0001051 3300046506 Bacteria 31052
532 Ga0495583_0004011 3300046506 Bacteria 10852
533 Ga0495583_0032865 3300046506 Bacteria 2501
534 Ga0495606_0000587 3300046507 Bacteria 57743
535 Ga0495606_0002496 3300046507 Bacteria 21251
536 Ga0495606_0008984 3300046507 Bacteria 8549
537 Ga0495606_0060068 3300046507 Bacteria 2436
538 Ga0495606_0232012 3300046507 Bacteria 1034
539 Ga0495610_0001529 3300046512 Bacteria 20383
540 Ga0495610_0052509 3300046512 Bacteria 1978
541 Ga0495610_0085183 3300046512 Bacteria 1443
542 Ga0495616_0016322 3300046513 Bacteria 4114
543 Ga0495616_0023527 3300046513 Bacteria 3313
544 Ga0495616_0071258 3300046513 Bacteria 1681
545 Ga0495616_0132125 3300046513 Bacteria 1143
546 Ga0495620_0005142 3300046515 Bacteria 7321
547 Ga0495620_0010070 3300046515 Bacteria 4998
548 Ga0495620_0015518 3300046515 Bacteria 3843
549 Ga0495628_0301490 3300046516 Bacteria 1186
550 Ga0495631_0004695 3300046518 Bacteria 7223
551 Ga0495631_0030541 3300046518 Bacteria 2444
552 Ga0495631_0106583 3300046518 Bacteria 1205
553 Ga0495632_0005967 3300046519 Bacteria 7934
554 Ga0495632_0047523 3300046519 Bacteria 2128
555 Ga0495632_0053803 3300046519 Bacteria 1975
556 Ga0495632_0071159 3300046519 Bacteria 1671
557 Ga0495632_0205384 3300046519 Bacteria 895
558 Ga0495637_0005721 3300046520 Bacteria 6301
559 Ga0495637_0018620 3300046520 Bacteria 3219
560 Ga0495643_0006217 3300046522 Bacteria 7921
561 Ga0495643_0007516 3300046522 Bacteria 7010
562 Ga0495643_0127844 3300046522 Bacteria 1278
563 Ga0495648_0023237 3300046524 Bacteria 4251
564 Ga0495648_0033138 3300046524 Bacteria 3379
565 Ga0495648_0068506 3300046524 Bacteria 2070
566 Ga0495654_0113790 3300046530 Bacteria 1232
567 Ga0495609_0086015 3300046538 Bacteria 1371
568 Ga0495621_0002234 3300046539 Bacteria 5178
569 Ga0495597_0011209 3300046542 Bacteria 4349
570 Ga0495597_0023590 3300046542 Bacteria 2845
571 Ga0495622_0014155 3300046557 Bacteria 3703
572 Ga0495633_0028246 3300046558 Bacteria 2736
573 Ga0495633_0042165 3300046558 Bacteria 2169
574 Ga0495633_0065690 3300046558 Bacteria 1695
575 Ga0495633_0206685 3300046558 Bacteria 900
576 Ga0495667_0145153 3300046559 Bacteria 1529
577 Ga0495668_0010371 3300046616 Bacteria 5639
578 Ga0495668_0039097 3300046616 Bacteria 2649
579 Ga0495668_0094347 3300046616 Bacteria 1638
580 Ga0495668_0127022 3300046616 Bacteria 1396
581 Ga0495634_0060986 3300046642 Bacteria 2509
582 Ga0495611_0025199 3300046648 Bacteria 2591
583 Ga0495611_0042804 3300046648 Bacteria 2023
584 Ga0495611_0085902 3300046648 Bacteria 1451
585 Ga0495611_0155919 3300046648 Bacteria 1066
586 Ga0495625_0003905 3300046660 Bacteria 14369
587 Ga0495625_0016210 3300046660 Bacteria 5871
588 Ga0495625_0027749 3300046660 Bacteria 4255
589 Ga0495625_0031718 3300046660 Bacteria 3928
590 Ga0495625_0115398 3300046660 Bacteria 1832
591 Ga0495625_0126032 3300046660 Bacteria 1738
592 Ga0495625_0283942 3300046660 Bacteria 1064
593 Ga0495635_0432912 3300046663 Bacteria 871
594 Ga0495661_0038796 3300046665 Bacteria 2964
595 Ga0495661_0060919 3300046665 Bacteria 2241
596 Ga0495661_0172149 3300046665 Bacteria 1154
597 Ga0495588_0001445 3300046674 Bacteria 10174
598 Ga0495588_0194200 3300046674 Bacteria 1072
599 Ga0495588_0201788 3300046674 Bacteria 1050
600 Ga0495657_0036996 3300046675 Bacteria 3368
601 Ga0495646_0224196 3300046680 Bacteria 1015
602 Ga0495624_0120943 3300046690 Bacteria 1608
603 Ga0495624_0261952 3300046690 Bacteria 1045
604 Ga0495670_0216136 3300046691 Bacteria 1018
605 Ga0495671_0090095 3300046692 Bacteria 1501
606 Ga0495649_0001088 3300046694 Bacteria 21190
607 Ga0495649_0006784 3300046694 Bacteria 7091
608 Ga0495589_0139562 3300046794 Bacteria 1161
609 Ga0495589_0147371 3300046794 Bacteria 1125
610 Ga0495600_0025386 3300046809 Bacteria 3819
611 Ga0495660_0019134 3300046810 Bacteria 3931
612 Ga0495660_0124616 3300046810 Bacteria 1299
613 Ga0495660_0143079 3300046810 Bacteria 1188
614 Ga0495660_0150619 3300046810 Bacteria 1149
615 Ga0495604_0014117 3300047317 Bacteria 6369
616 Ga0495604_0065353 3300047317 Bacteria 2769
617 Ga0495604_0232088 3300047317 Bacteria 1265
618 Ga0495636_0139330 3300047318 Bacteria 1082
619 Ga0495674_0021339 3300047319 Bacteria 5991
620 Ga0495672_0013154 3300047320 Bacteria 5723
621 Ga0495676_0064476 3300047321 Bacteria 2848
622 Ga0495683_0000019 3300047323 Bacteria 183206
623 Ga0495683_0001428 3300047323 Bacteria 15720
624 Ga0495683_0089086 3300047323 Bacteria 1497
625 Ga0495687_005208 3300047443 Bacteria 8390
626 Ga0495687_007825 3300047443 Bacteria 6222
627 Ga0495687_034450 3300047443 Bacteria 2288
628 Ga0495687_044962 3300047443 Bacteria 1915
629 Ga0495675_0255054 3300047444 Bacteria 1052
630 Ga0495677_0077817 3300047445 Bacteria 1241
631 Ga0495685_069886 3300047447 Bacteria 1177
632 Ga0495673_0020859 3300047469 Bacteria 3252
633 Ga0495681_0001049 3300047470 Bacteria 21067
634 Ga0495681_0012798 3300047470 Bacteria 4908
635 Ga0495681_0037532 3300047470 Bacteria 2385
636 Ga0495684_0233194 3300047471 Bacteria 1345
637 Ga0495686_0016723 3300047472 Bacteria 4965
638 Ga0495686_0084786 3300047472 Bacteria 1930
639 Ga0495602_0077089 3300048088 Bacteria 2822
640 Ga0495615_0095846 3300048090 Bacteria 832
641 Ga0496100_0010828 3300048903 Bacteria 5174
642 Ga0496100_0212612 3300048903 Bacteria 1415
643 Ga0496100_0246288 3300048903 Bacteria 1321
644 Ga0496101_0001581 3300048904 Bacteria 13660
645 Ga0496101_0334881 3300048904 Bacteria 1188
646 Ga0496101_0419381 3300048904 Bacteria 1055
647 Ga0496102_0000981 3300048905 Bacteria 26837
648 Ga0496102_0028748 3300048905 Bacteria 4969
649 Ga0496102_0128750 3300048905 Bacteria 2368
650 Ga0496102_0566923 3300048905 Bacteria 1058
651 Ga0496103_0000660 3300048906 Bacteria 26094
652 Ga0496103_0007016 3300048906 Bacteria 6724
653 Ga0496104_0009153 3300048907 Bacteria 8806
654 Ga0496104_0090320 3300048907 Bacteria 2927
655 Ga0496104_0337955 3300048907 Bacteria 1419
656 Ga0496105_0043416 3300048908 Bacteria 3708
657 Ga0496106_0003138 3300048909 Bacteria 12329
658 Ga0496107_0005547 3300048910 Bacteria 8640
659 Ga0496107_0008447 3300048910 Bacteria 7128
660 Ga0496107_0056883 3300048910 Bacteria 2827
661 Ga0496107_0088138 3300048910 Bacteria 2266
662 Ga0496109_0414861 3300048912 Bacteria 1272
663 Ga0496109_0505124 3300048912 Bacteria 1141
664 Ga0496110_0001494 3300048913 Bacteria 16951
665 Ga0496110_0166024 3300048913 Bacteria 2002
666 Ga0496110_0388877 3300048913 Bacteria 1271
667 Ga0496110_0603936 3300048913 Bacteria 995
668 Ga0496111_0015312 3300048914 Bacteria 5262
669 Ga0496111_0179915 3300048914 Bacteria 1572
670 Ga0496112_0000725 3300048915 Bacteria 22888
671 Ga0496112_0063607 3300048915 Bacteria 3640
672 Ga0496113_0005964 3300048916 Bacteria 7664
673 Ga0496113_0215652 3300048916 Bacteria 1529
674 Ga0496113_0599322 3300048916 Bacteria 882
675 Ga0496116_0001582 3300048919 Bacteria 25058
676 Ga0496116_0009211 3300048919 Bacteria 8451
677 Ga0496116_0013691 3300048919 Bacteria 6522
678 Ga0496116_0048276 3300048919 Bacteria 2858
679 Ga0496116_0160273 3300048919 Bacteria 1235
680 Ga0496116_0162245 3300048919 Bacteria 1224
681 Ga0496117_0000066 3300048920 Bacteria 253534
682 Ga0496117_0017198 3300048920 Bacteria 6051
683 Ga0496117_0030766 3300048920 Bacteria 4111
684 Ga0496117_0069530 3300048920 Bacteria 2370
685 Ga0496118_0004078 3300048921 Bacteria 17718
686 Ga0496118_0008608 3300048921 Bacteria 10502
687 Ga0496118_0016332 3300048921 Bacteria 6814
688 Ga0496118_0026933 3300048921 Bacteria 4880
689 Ga0496118_0033704 3300048921 Bacteria 4195
690 Ga0496118_0072878 3300048921 Bacteria 2464
691 Ga0496118_0119959 3300048921 Bacteria 1718
692 Ga0496119_0009811 3300048922 Bacteria 8144
693 Ga0496119_0032320 3300048922 Bacteria 3489
694 Ga0496119_0037363 3300048922 Bacteria 3155
695 Ga0496119_0039298 3300048922 Bacteria 3042
696 Ga0496119_0062063 3300048922 Bacteria 2228
697 Ga0496119_0114470 3300048922 Bacteria 1492
698 Ga0496120_0001197 3300048923 Bacteria 32900
699 Ga0496120_0019205 3300048923 Bacteria 4379
700 Ga0496120_0070270 3300048923 Bacteria 1926
701 Ga0496120_0180914 3300048923 Bacteria 1035
702 Ga0496120_0238017 3300048923 Bacteria 861
703 Ga0496121_0000615 3300048924 Bacteria 66351
704 Ga0496121_0003840 3300048924 Bacteria 20896
705 Ga0496121_0015935 3300048924 Bacteria 7806
706 Ga0496121_0018594 3300048924 Bacteria 6997
707 Ga0496121_0038400 3300048924 Bacteria 4242
708 Ga0496121_0121865 3300048924 Bacteria 1968
709 Ga0496121_0132257 3300048924 Bacteria 1865
710 Ga0496121_0157257 3300048924 Bacteria 1666
711 Ga0496121_0157259 3300048924 Bacteria 1666
712 Ga0496121_0248924 3300048924 Bacteria 1234
713 Ga0496122_0000057 3300048925 Bacteria 253452
714 Ga0496122_0002747 3300048925 Bacteria 24310
715 Ga0496122_0003713 3300048925 Bacteria 19738
716 Ga0496122_0009846 3300048925 Bacteria 9971
717 Ga0496122_0026519 3300048925 Bacteria 4992
718 Ga0496122_0028627 3300048925 Bacteria 4720
719 Ga0496122_0052995 3300048925 Bacteria 3062
720 Ga0496122_0063578 3300048925 Bacteria 2691
721 Ga0496123_0000096 3300048926 Bacteria 173914
722 Ga0496123_0005115 3300048926 Bacteria 13384
723 Ga0496123_0010599 3300048926 Bacteria 8114
724 Ga0496123_0015702 3300048926 Bacteria 6195
725 Ga0496123_0078056 3300048926 Bacteria 2030
726 Ga0496123_0100979 3300048926 Bacteria 1678
727 Ga0496124_0000254 3300048927 Bacteria 103551
728 Ga0496124_0004690 3300048927 Bacteria 15797
729 Ga0496124_0006914 3300048927 Bacteria 12193
730 Ga0496124_0019276 3300048927 Bacteria 6357
731 Ga0496124_0026204 3300048927 Bacteria 5262
732 Ga0496124_0043889 3300048927 Bacteria 3840
733 Ga0496124_0206261 3300048927 Bacteria 1490
734 Ga0496124_0233676 3300048927 Bacteria 1372
735 Ga0496124_0297912 3300048927 Bacteria 1166
736 Ga0496125_0000101 3300048928 Bacteria 202248
737 Ga0496125_0000692 3300048928 Bacteria 55634
738 Ga0496125_0005881 3300048928 Bacteria 13458
739 Ga0496125_0008410 3300048928 Bacteria 10808
740 Ga0496125_0011332 3300048928 Bacteria 8929
741 Ga0496125_0012374 3300048928 Bacteria 8475
742 Ga0496125_0015257 3300048928 Bacteria 7435
743 Ga0496125_0020272 3300048928 Bacteria 6243
744 Ga0496125_0069639 3300048928 Bacteria 2759
745 Ga0496125_0090250 3300048928 Bacteria 2301
746 Ga0496125_0169730 3300048928 Bacteria 1468
747 Ga0496125_0216956 3300048928 Bacteria 1236
748 Ga0496126_0000430 3300048929 Bacteria 84663
749 Ga0496126_0010075 3300048929 Bacteria 9969
750 Ga0496126_0011352 3300048929 Bacteria 9235
751 Ga0496126_0016806 3300048929 Bacteria 7304
752 Ga0496126_0058498 3300048929 Bacteria 3474
753 Ga0496126_0121496 3300048929 Bacteria 2264
754 Ga0496126_0155255 3300048929 Bacteria 1959
755 Ga0496126_0189864 3300048929 Bacteria 1741
756 Ga0495678_066936 3300049459 Bacteria 1328
757 Ga0501031_0000010 3300049568 Bacteria 146435
758 Ga0501031_0046808 3300049568 Bacteria 2820
759 Ga0501031_0330206 3300049568 Bacteria 987
760 Ga0501032_0000023 3300049569 Bacteria 146435
761 Ga0501032_0050973 3300049569 Bacteria 2791
762 Ga0501032_0091610 3300049569 Bacteria 2016
763 Ga0501032_0162988 3300049569 Bacteria 1464
764 Ga0501033_0000104 3300049570 Bacteria 81029
765 Ga0501033_0032233 3300049570 Bacteria 3935
766 Ga0501033_0060283 3300049570 Bacteria 2800
767 Ga0501033_0173527 3300049570 Bacteria 1548
768 Ga0501033_0195001 3300049570 Bacteria 1448
769 Ga0501034_0000116 3300049571 Bacteria 146442
770 Ga0501034_0201244 3300049571 Bacteria 1949
771 Ga0501034_0391046 3300049571 Bacteria 1314
772 Ga0501034_0512905 3300049571 Bacteria 1111
773 Ga0501036_0000015 3300049572 Bacteria 146442
774 Ga0501036_0043555 3300049572 Bacteria 3801
775 Ga0501036_0170914 3300049572 Bacteria 1831
776 Ga0501037_0000023 3300049573 Bacteria 146542
777 Ga0501038_0000025 3300049574 Bacteria 146542
778 Ga0501038_0135794 3300049574 Bacteria 2015
779 Ga0501038_0535945 3300049574 Bacteria 892
780 Ga0501039_0000037 3300049575 Bacteria 122286
781 Ga0501039_0455757 3300049575 Bacteria 1004
782 Ga0501040_0005598 3300049576 Bacteria 8116
783 Ga0501043_0000070 3300049579 Bacteria 89839
784 Ga0501043_0016194 3300049579 Bacteria 5848
785 Ga0501043_0242350 3300049579 Bacteria 1390
786 Ga0501043_0352806 3300049579 Bacteria 1117
787 Ga0501046_0013466 3300049580 Bacteria 6924
788 Ga0501046_0219006 3300049580 Bacteria 1410
789 Ga0501047_0001244 3300049581 Bacteria 25242
790 Ga0501047_0115506 3300049581 Bacteria 2566
791 Ga0501047_0382359 3300049581 Bacteria 1242
792 Ga0501047_0413634 3300049581 Bacteria 1180
793 Ga0501070_0017965 3300049586 Bacteria 5936
794 Ga0501070_0054954 3300049586 Bacteria 3301
795 Ga0501070_0140247 3300049586 Bacteria 1996
796 Ga0501070_0190247 3300049586 Bacteria 1687
797 Ga0501072_0004650 3300049588 Bacteria 10450
798 Ga0501073_0057589 3300049589 Bacteria 2717
799 Ga0501074_0046189 3300049590 Bacteria 3149
800 Ga0501238_016681 3300049671 Bacteria 1019
801 Ga0501080_0113468 3300049742 Bacteria 2512
802 Ga0501083_0111763 3300049744 Bacteria 1796
803 Ga0501083_0177523 3300049744 Bacteria 1391
804 Ga0501280_001581 3300049776 Bacteria 4093
805 Ga0501035_0000074 3300049822 Bacteria 122269
806 Ga0501035_0005429 3300049822 Bacteria 12055
807 Ga0501035_0009467 3300049822 Bacteria 9057
808 Ga0501035_0030307 3300049822 Bacteria 4932
809 Ga0501035_0161435 3300049822 Bacteria 1939
810 Ga0501035_0161442 3300049822 Bacteria 1939
811 Ga0501035_0532923 3300049822 Bacteria 963
812 Ga0501044_0000069 3300049823 Bacteria 125974
813 Ga0501044_0030918 3300049823 Bacteria 5639
814 Ga0501044_0079267 3300049823 Bacteria 3328
815 Ga0501044_0231637 3300049823 Bacteria 1794
816 Ga0501044_0286245 3300049823 Bacteria 1580
817 Ga0501045_0128427 3300049824 Bacteria 1884
818 nmdc:mga03683_16660_c2 3300050489 Bacteria 2389
819 nmdc:mga03683_179392_c1 3300050489 Bacteria 966
820 nmdc:mga03683_91543_c1 3300050489 Bacteria 1326
821 nmdc:mga00v17_14_c1 3300050491 Bacteria 126589
822 nmdc:mga00v17_59_c2 3300050491 Bacteria 33192
823 nmdc:mga00v17_9569_c1 3300050491 Bacteria 5251
824 nmdc:mga0yw44_135029_c1 3300050492 Bacteria 1600
825 nmdc:mga0yw44_14452_c1 3300050492 Bacteria 4193
826 nmdc:mga0yw44_155595_c1 3300050492 Bacteria 1494
827 nmdc:mga0yw44_163822_c1 3300050492 Bacteria 1457
828 nmdc:mga0yw44_23882_c1 3300050492 Bacteria 3451
829 nmdc:mga0yw44_68031_c1 3300050492 Bacteria 2202
830 nmdc:mga0yw44_7224_c1 3300050492 Bacteria 5444
831 nmdc:mga0k408_12529_c1 3300050493 Bacteria 4637
832 nmdc:mga0k408_14833_c1 3300050493 Bacteria 4301
833 nmdc:mga06z11_134020_c1 3300050494 Bacteria 1394
834 nmdc:mga06z11_136330_c1 3300050494 Bacteria 1383
835 nmdc:mga06z11_15017_c1 3300050494 Bacteria 3447
836 nmdc:mga06z11_97845_c1 3300050494 Bacteria 1605
837 nmdc:mga04h51_31977_c1 3300050495 Bacteria 1666
838 nmdc:mga04h51_32080_c1 3300050495 Bacteria 1664
839 nmdc:mga07m45_68339_c1 3300050496 Bacteria 2020
840 nmdc:mga09592_112096_c1 3300050508 Bacteria 2340
841 nmdc:mga0sz30_100424_c1 3300050516 Bacteria 1264
842 nmdc:mga0sz30_14265_c1 3300050516 Bacteria 3125
843 nmdc:mga0sz30_145567_c1 3300050516 Bacteria 1047
844 nmdc:mga0sz30_578_c1 3300050516 Bacteria 13792
845 nmdc:mga0sz30_9773_c1 3300050516 Bacteria 3657
846 Ga0495601_0136999 3300053077 Bacteria 1596
847 Ga0495601_0165302 3300053077 Bacteria 1446
848 Ga0495612_0165626 3300053078 Bacteria 966
849 Ga0500610_0035282 3300053079 Bacteria 2564
850 Ga0500610_0053619 3300053079 Bacteria 2102
851 Ga0495595_0119664 3300053084 Bacteria 1282
852 Ga0495619_0043876 3300053085 Bacteria 2933
853 Ga0495619_0066957 3300053085 Bacteria 2397
854 Ga0500578_0053825 3300053086 Bacteria 2576
855 Ga0500643_011296 3300053087 Bacteria 3265
856 Ga0500641_0009976 3300053096 Bacteria 3424
857 Ga0500560_000150 3300053107 Bacteria 7775
858 Ga0500594_0006924 3300053118 Bacteria 2556
859 Ga0500595_009740 3300053119 Bacteria 3862
860 Ga0500595_044034 3300053119 Bacteria 1417
861 Ga0500608_115540 3300053122 Bacteria 1225
862 Ga0500618_001078 3300053125 Bacteria 13432
863 Ga0500618_001226 3300053125 Bacteria 12014
864 Ga0500658_0000486 3300053134 Bacteria 16965
865 Ga0500658_0069685 3300053134 Bacteria 1481
866 Ga0500659_0073849 3300053135 Bacteria 1802
867 Ga0500561_0000021 3300053137 Bacteria 39116
868 Ga0500568_0000587 3300053139 Bacteria 26463
869 Ga0500573_0003975 3300053140 Bacteria 7720
870 Ga0500577_0042717 3300053142 Bacteria 1662
871 Ga0500590_000124 3300053148 Bacteria 21215
872 Ga0500604_0002852 3300053151 Bacteria 4691
873 Ga0500604_0066999 3300053151 Bacteria 1138
874 Ga0500616_0000094 3300053153 Bacteria 181038
875 Ga0500616_0001233 3300053153 Bacteria 25673
876 Ga0500616_0003199 3300053153 Bacteria 12737
877 Ga0500624_000889 3300053157 Bacteria 6433
878 Ga0500627_0002037 3300053158 Bacteria 5842
879 Ga0500627_0034904 3300053158 Bacteria 2135
880 Ga0500634_0000008 3300053161 Bacteria 152203
881 Ga0500634_0007871 3300053161 Bacteria 5292
882 Ga0500636_0000027 3300053177 Bacteria 83029
883 Ga0500636_0000679 3300053177 Bacteria 18258
884 Ga0500636_0093545 3300053177 Bacteria 1719
885 Ga0500611_001114 3300053727 Bacteria 2858
886 Ga0500611_010675 3300053727 Bacteria 1496
887 Ga0500611_017532 3300053727 Bacteria 1306
888 Ga0500645_028297 3300053730 Bacteria 1697
889 Ga0500596_002261 3300053735 Bacteria 3815
890 Ga0501084_0057528 3300054114 Bacteria 3253
891 Ga0501082_0000007 3300060353 Bacteria 126506
892 Ga0501082_0362003 3300060353 Bacteria 1265
893 Ga0501082_0582473 3300060353 Bacteria 979

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100064391 Ga0070689_1000643913 191
2 3300005365 Ga0070688_100269308 Ga0070688_1002693082 191
3 3300014745 Ga0157377_10344917 Ga0157377_103449172 191
4 3300025918 Ga0207662_10061301 Ga0207662_100613013 191
5 3300025936 Ga0207670_10165741 Ga0207670_101657412 191
6 3300026075 Ga0207708_10615201 Ga0207708_106152011 191
7 3300005366 Ga0070659_100611932 Ga0070659_1006119321 192
8 3300021384 Ga0213876_10017486 Ga0213876_100174862 197
9 3300025927 Ga0207687_10251689 Ga0207687_102516892 199
10 3300039437 Ga0436365_0110753 Ga0436365_0110753_1992_2765 199
11 3300005548 Ga0070665_100557771 Ga0070665_1005577713 200
12 3300005578 Ga0068854_100232482 Ga0068854_1002324822 200
13 3300048904 Ga0496101_0334881 Ga0496101_0334881_228_995 200
14 3300048919 Ga0496116_0048276 Ga0496116_0048276_557_1324 200
15 3300048921 Ga0496118_0016332 Ga0496118_0016332_3821_4588 200
16 3300048925 Ga0496122_0003713 Ga0496122_0003713_3332_4099 200
17 3300048926 Ga0496123_0015702 Ga0496123_0015702_532_1299 200
18 3300005436 Ga0070713_100395117 Ga0070713_1003951172 201
19 3300005439 Ga0070711_100097584 Ga0070711_1000975842 201
20 3300006175 Ga0070712_100019610 Ga0070712_1000196103 201
21 3300025906 Ga0207699_10036981 Ga0207699_100369812 201
22 3300025915 Ga0207693_10030293 Ga0207693_100302933 201
23 3300025928 Ga0207700_10205169 Ga0207700_102051692 201
24 3300005356 Ga0070674_100266129 Ga0070674_1002661292 203
25 3300017792 Ga0163161_10089613 Ga0163161_100896133 203
26 3300025937 Ga0207669_10128743 Ga0207669_101287432 203
27 3300025914 Ga0207671_10313655 Ga0207671_103136552 205
28 3300045051 Ga0451576_0215639 Ga0451576_0215639_112_873 205
29 3300025981 Ga0207640_10830322 Ga0207640_108303221 206
30 3300035117 Ga0373953_0195012 Ga0373953_0195012_52_819 208
31 3300035695 Ga0373927_0000586 Ga0373927_0000586_4221_4988 208
32 3300035725 Ga0373947_0028775 Ga0373947_0028775_260_1027 208
33 3300037068 Ga0373925_0260398 Ga0373925_0260398_610_1377 208
34 3300046477 Ga0495664_0010526 Ga0495664_0010526_3605_4372 208
35 3300047319 Ga0495674_0021339 Ga0495674_0021339_518_1285 208
36 3300047471 Ga0495684_0233194 Ga0495684_0233194_208_975 208
37 3300013308 Ga0157375_10649497 Ga0157375_106494972 209
38 3300028380 Ga0268265_10497480 Ga0268265_104974802 209
39 3300028381 Ga0268264_10918964 Ga0268264_109189641 209
40 3300011119 Ga0105246_10432763 Ga0105246_104327631 212
41 3300013297 Ga0157378_10047353 Ga0157378_100473533 214
42 3300037853 Ga0436364_0053771 Ga0436364_0053771_23_667 214
43 3300025908 Ga0207643_10138773 Ga0207643_101387732 215
44 3300031616 Ga0307508_10285224 Ga0307508_102852242 215
45 3300046452 Ga0495617_040889 Ga0495617_040889_265_1032 215
46 3300046492 Ga0495585_0036386 Ga0495585_0036386_1023_1790 215
47 3300047445 Ga0495677_0077817 Ga0495677_0077817_172_939 215
48 3300048929 Ga0496126_0189864 Ga0496126_0189864_557_1324 215
49 3300005355 Ga0070671_100043262 Ga0070671_1000432622 216
50 3300005614 Ga0068856_100290762 Ga0068856_1002907621 216
51 3300005616 Ga0068852_100018103 Ga0068852_1000181034 216
52 3300005718 Ga0068866_10031507 Ga0068866_100315072 216
53 3300005843 Ga0068860_100575769 Ga0068860_1005757692 216
54 3300010375 Ga0105239_10025522 Ga0105239_100255227 216
55 3300031507 Ga0307509_10065476 Ga0307509_100654763 216
56 3300031730 Ga0307516_10052706 Ga0307516_100527062 216
57 3300031731 Ga0307405_10125562 Ga0307405_101255622 216
58 3300034819 Ga0373958_0015886 Ga0373958_0015886_393_1160 216
59 3300035114 Ga0373939_0045701 Ga0373939_0045701_404_1171 216
60 3300048910 Ga0496107_0008447 Ga0496107_0008447_3535_4302 216
61 3300053078 Ga0495612_0165626 Ga0495612_0165626_49_816 216
62 3300031456 Ga0307513_10185244 Ga0307513_101852442 219
63 3300046518 Ga0495631_0030541 Ga0495631_0030541_23_703 219
64 3300013296 Ga0157374_10159332 Ga0157374_101593321 220
65 3300031730 Ga0307516_10002345 Ga0307516_1000234510 220
66 3300048921 Ga0496118_0119959 Ga0496118_0119959_981_1697 220
67 3300049570 Ga0501033_0173527 Ga0501033_0173527_518_1267 220
68 3300049581 Ga0501047_0382359 Ga0501047_0382359_427_1176 220
69 3300049822 Ga0501035_0030307 Ga0501035_0030307_2080_2829 220
70 3300049823 Ga0501044_0079267 Ga0501044_0079267_518_1267 220
71 3300002737 JGI25162J39368_1000184 JGI25162J39368_100018448 222
72 3300003214 JGI25165J46597_1000163 JGI25165J46597_10001633 222
73 3300005614 Ga0068856_100034675 Ga0068856_1000346755 222
74 3300025233 Ga0209437_100095 Ga0209437_100095205 222
75 3300025246 Ga0209646_1005995 Ga0209646_10059952 222
76 3300025261 Ga0209233_1000117 Ga0209233_1000117205 222
77 3300025901 Ga0207688_10358253 Ga0207688_103582531 222
78 3300048922 Ga0496119_0039298 Ga0496119_0039298_1416_2174 222
79 3300048923 Ga0496120_0070270 Ga0496120_0070270_306_1064 222
80 3300048925 Ga0496122_0026519 Ga0496122_0026519_886_1644 222
81 3300048927 Ga0496124_0206261 Ga0496124_0206261_440_1198 222
82 3300005328 Ga0070676_10279281 Ga0070676_102792812 223
83 3300045976 Ga0466967_0082659 Ga0466967_0082659_1460_2230 223
84 3300053122 Ga0500608_115540 Ga0500608_115540_383_1138 223
85 3300005365 Ga0070688_100171018 Ga0070688_1001710181 224
86 3300003215 JGI25153J46596_10016829 JGI25153J46596_100168292 226
87 3300003792 Ga0055540_1003244 Ga0055540_10032442 226
88 3300003794 Ga0055531_10001262 Ga0055531_100012628 226
89 3300005331 Ga0070670_100218563 Ga0070670_1002185631 226
90 3300005333 Ga0070677_10013535 Ga0070677_100135354 226
91 3300005335 Ga0070666_10133810 Ga0070666_101338102 226
92 3300005356 Ga0070674_100002557 Ga0070674_1000025572 226
93 3300005364 Ga0070673_100133648 Ga0070673_1001336482 226
94 3300005456 Ga0070678_100012048 Ga0070678_1000120482 226
95 3300005459 Ga0068867_100160797 Ga0068867_1001607972 226
96 3300005543 Ga0070672_100051962 Ga0070672_1000519625 226
97 3300005544 Ga0070686_100089375 Ga0070686_1000893752 226
98 3300009098 Ga0105245_10213355 Ga0105245_102133553 226
99 3300013308 Ga0157375_10357964 Ga0157375_103579642 226
100 3300025292 Ga0209676_1065061 Ga0209676_10650611 226
101 3300025297 Ga0209758_1000130 Ga0209758_1000130120 226
102 3300025303 Ga0209051_1018859 Ga0209051_10188593 226
103 3300025893 Ga0207682_10002344 Ga0207682_100023445 226
104 3300025903 Ga0207680_10168458 Ga0207680_101684582 226
105 3300025931 Ga0207644_10236585 Ga0207644_102365852 226
106 3300025937 Ga0207669_10007097 Ga0207669_100070974 226
107 3300025940 Ga0207691_10032439 Ga0207691_100324394 226
108 3300026089 Ga0207648_10003173 Ga0207648_100031738 226
109 3300026121 Ga0207683_10094456 Ga0207683_100944562 226
110 3300046539 Ga0495621_0002234 Ga0495621_0002234_3066_3821 226
111 3300046460 Ga0495638_0067375 Ga0495638_0067375_48_803 227
112 3300046518 Ga0495631_0106583 Ga0495631_0106583_431_1168 227
113 3300046660 Ga0495625_0115398 Ga0495625_0115398_280_1017 227
114 3300046810 Ga0495660_0150619 Ga0495660_0150619_184_921 227
115 3300053151 Ga0500604_0002852 Ga0500604_0002852_344_1081 227
116 3300053158 Ga0500627_0002037 Ga0500627_0002037_1512_2249 227
117 3300053727 Ga0500611_010675 Ga0500611_010675_410_1147 227
118 iso_pu_bacteria 2551306091 2551729657 227
119 iso_pu_bacteria 2643221591 2643964904 227
120 3300053079 Ga0500610_0035282 Ga0500610_0035282_1738_2493 228
121 iso_pu_bacteria 3004334049 3004336426 228
122 iso_pu_bacteria 2509276019 2509377288 229
123 iso_pu_bacteria 2510917028 2511184240 229
124 iso_pu_bacteria 2511231052 2511499348 229
125 iso_pu_bacteria 2512875026 2512975419 229
126 iso_pu_bacteria 2513237086 2513585471 229
127 iso_pu_bacteria 2513237089 2513606643 229
128 iso_pu_bacteria 2513237104 2513721638 229
129 iso_pu_bacteria 2513237156 2513988833 229
130 iso_pu_bacteria 2513237160 2514008671 229
131 iso_pu_bacteria 2516143018 2516208041 229
132 iso_pu_bacteria 2516653046 2516898308 229
133 iso_pu_bacteria 2517487022 2517567011 229
134 iso_pu_bacteria 2534681796 2535514390 229
135 iso_pu_bacteria 2537561587 2537875401 229
136 iso_pu_bacteria 2551306084 2551676934 229
137 iso_pu_bacteria 2551306085 2551686815 229
138 iso_pu_bacteria 2551306090 2551720857 229
139 iso_pu_bacteria 2554235003 2554244877 229
140 iso_pu_bacteria 2558860100 2558862187 229
141 iso_pu_bacteria 2558860242 2559297289 229
142 iso_pu_bacteria 2600255279 2601611608 229
143 iso_pu_bacteria 2600255308 2601748840 229
144 iso_pu_bacteria 2643221582 2643921830 229
145 iso_pu_bacteria 2643221599 2644003592 229
146 iso_pu_bacteria 2643221618 2644109738 229
147 iso_pu_bacteria 2643221626 2644149056 229
148 iso_pu_bacteria 2643221655 2644312616 229
149 iso_pu_bacteria 2643221659 2644336833 229
150 iso_pu_bacteria 2643221693 2644519798 229
151 iso_pu_bacteria 2643221698 2644540932 229
152 iso_pu_bacteria 2643221712 2644618347 229
153 iso_pu_bacteria 2657244999 2657686219 229
154 iso_pu_bacteria 2690316117 2692319485 229
155 iso_pu_bacteria 2751185821 2753461933 229
156 iso_pu_bacteria 2775507049 2776915070 229
157 iso_pu_bacteria 2791355082 2792583746 229
158 iso_pu_bacteria 2791355091 2792623280 229
159 iso_pu_bacteria 2791355092 2792629406 229
160 iso_pu_bacteria 2791355094 2792642095 229
161 iso_pu_bacteria 2802428858 2802721129 229
162 iso_pu_bacteria 2802428859 2802728375 229
163 iso_pu_bacteria 2802428860 2802734083 229
164 iso_pu_bacteria 2802428861 2802740467 229
165 iso_pu_bacteria 2802428862 2802746749 229
166 iso_pu_bacteria 2802428863 2802753604 229
167 iso_pu_bacteria 2802429268 2804755084 229
168 iso_pu_bacteria 2808606387 2808988753 229
169 iso_pu_bacteria 2818991439 2819561383 229
170 iso_pu_bacteria 2838675328 2838679465 229
171 iso_pu_bacteria 2838714209 2838718822 229
172 iso_pu_bacteria 2838719591 2838723820 229
173 iso_pu_bacteria 2838724970 2838729143 229
174 iso_pu_bacteria 2841846520 2841851089 229
175 iso_pu_bacteria 2841859092 2841863894 229
176 iso_pu_bacteria 2842124991 2842129840 229
177 iso_pu_bacteria 2842130223 2842134416 229
178 iso_pu_bacteria 2842152218 2842156412 229
179 iso_pu_bacteria 2842170452 2842175067 229
180 iso_pu_bacteria 2842175837 2842179984 229
181 iso_pu_bacteria 2842187318 2842191598 229
182 iso_pu_bacteria 2842211629 2842215915 229
183 iso_pu_bacteria 2842224351 2842228585 229
184 iso_pu_bacteria 2842515876 2842520676 229
185 iso_pu_bacteria 2844163670 2844164395 229
186 iso_pu_bacteria 2847417321 2847422013 229
187 iso_pu_bacteria 2848992105 2848996988 229
188 iso_pu_bacteria 2850079185 2850085426 229
189 iso_pu_bacteria 2854916844 2854922032 229
190 iso_pu_bacteria 2855825444 2855830147 229
191 iso_pu_bacteria 2855839649 2855845037 229
192 iso_pu_bacteria 2855872281 2855874983 229
193 iso_pu_bacteria 2858800743 2858804290 229
194 iso_pu_bacteria 2896384573 2896390478 229
195 iso_pu_bacteria 2899275550 2899275631 229
196 iso_pu_bacteria 2899792073 2899794940 229
197 iso_pu_bacteria 2899845264 2899850432 229
198 iso_pu_bacteria 2913295892 2913297030 229
199 iso_pu_bacteria 2915980308 2915983377 229
200 iso_pu_bacteria 2915993759 2915995998 229
201 iso_pu_bacteria 2916007675 2916008073 229
202 iso_pu_bacteria 2916014648 2916017235 229
203 iso_pu_bacteria 2916035215 2916040970 229
204 iso_pu_bacteria 2916061851 2916065529 229
205 iso_pu_bacteria 2916068649 2916071195 229
206 iso_pu_bacteria 2919114240 2919118804 229
207 iso_pu_bacteria 2921201388 2921207868 229
208 iso_pu_bacteria 2921237296 2921238081 229
209 iso_pu_bacteria 2921244191 2921246534 229
210 iso_pu_bacteria 2921250672 2921255213 229
211 iso_pu_bacteria 2921282425 2921284089 229
212 iso_pu_bacteria 2921289301 2921292938 229
213 iso_pu_bacteria 2921296804 2921297395 229
214 iso_pu_bacteria 2924144063 2924146805 229
215 iso_pu_bacteria 2924150972 2924153037 229
216 iso_pu_bacteria 2924158325 2924161442 229
217 iso_pu_bacteria 2924165586 2924169334 229
218 iso_pu_bacteria 2924186466 2924190453 229
219 iso_pu_bacteria 2924193448 2924199213 229
220 iso_pu_bacteria 2924200457 2924203196 229
221 iso_pu_bacteria 2924207177 2924213416 229
222 iso_pu_bacteria 2924214083 2924219647 229
223 iso_pu_bacteria 2924228884 2924232636 229
224 iso_pu_bacteria 2926754445 2926758175 229
225 iso_pu_bacteria 2926760298 2926764258 229
226 iso_pu_bacteria 2933006813 2933011186 229
227 iso_pu_bacteria 2933594066 2933598987 229
228 iso_pu_bacteria 2937002841 2937006256 229
229 iso_pu_bacteria 2937016420 2937019861 229
230 iso_pu_bacteria 2937029754 2937032140 229
231 iso_pu_bacteria 2937036028 2937042320 229
232 iso_pu_bacteria 2937049772 2937056567 229
233 iso_pu_bacteria 2937056579 2937058819 229
234 iso_pu_bacteria 2937078374 2937081918 229
235 iso_pu_bacteria 2937084907 2937089628 229
236 iso_pu_bacteria 2937091812 2937092646 229
237 iso_pu_bacteria 2937098957 2937100227 229
238 iso_pu_bacteria 2937106411 2937112334 229
239 iso_pu_bacteria 2957375807 2957380224 229
240 iso_pu_bacteria 2957388812 2957391205 229
241 iso_pu_bacteria 2957422303 2957427884 229
242 iso_pu_bacteria 2957430029 2957433681 229
243 iso_pu_bacteria 2957437181 2957437989 229
244 iso_pu_bacteria 2957457609 2957464613 229
245 iso_pu_bacteria 2957464669 2957467156 229
246 iso_pu_bacteria 2957471148 2957473777 229
247 iso_pu_bacteria 2957498199 2957505016 229
248 iso_pu_bacteria 2957505466 2957510732 229
249 iso_pu_bacteria 2960584000 2960589746 229
250 iso_pu_bacteria 2960591022 2960592944 229
251 iso_pu_bacteria 2960603979 2960606722 229
252 iso_pu_bacteria 2960624210 2960627802 229
253 iso_pu_bacteria 2960631154 2960633611 229
254 iso_pu_bacteria 2960637947 2960641315 229
255 iso_pu_bacteria 2960645483 2960649461 229
256 iso_pu_bacteria 2960652885 2960653339 229
257 iso_pu_bacteria 2960680706 2960683958 229
258 iso_pu_bacteria 2960687367 2960689837 229
259 iso_pu_bacteria 2960693952 2960699093 229
260 iso_pu_bacteria 2964607997 2964612723 229
261 iso_pu_bacteria 2964621998 2964623859 229
262 iso_pu_bacteria 2964643177 2964649192 229
263 iso_pu_bacteria 2964649959 2964653306 229
264 iso_pu_bacteria 2964656573 2964659816 229
265 iso_pu_bacteria 2964663802 2964667781 229
266 iso_pu_bacteria 2964678106 2964680252 229
267 iso_pu_bacteria 2964685014 2964686636 229
268 iso_pu_bacteria 2964691889 2964698636 229
269 iso_pu_bacteria 2964705432 2964708276 229
270 iso_pu_bacteria 2964705432 2964708327 229
271 iso_pu_bacteria 2964719344 2964725224 229
272 iso_pu_bacteria 2967664464 2967668774 229
273 iso_pu_bacteria 2967671571 2967678269 229
274 iso_pu_bacteria 2967678726 2967685701 229
275 iso_pu_bacteria 2967686174 2967690765 229
276 iso_pu_bacteria 2967693043 2967699123 229
277 iso_pu_bacteria 2967699805 2967706256 229
278 iso_pu_bacteria 2967714385 2967718061 229
279 iso_pu_bacteria 2967721400 2967724484 229
280 iso_pu_bacteria 2967728569 2967733731 229
281 iso_pu_bacteria 2967735183 2967738122 229
282 iso_pu_bacteria 2967742019 2967747538 229
283 iso_pu_bacteria 2967748971 2967754335 229
284 iso_pu_bacteria 2967762386 2967766698 229
285 iso_pu_bacteria 2967769361 2967773642 229
286 iso_pu_bacteria 2970019648 2970020436 229
287 iso_pu_bacteria 2970026789 2970030273 229
288 iso_pu_bacteria 2970040964 2970047235 229
289 iso_pu_bacteria 2970047711 2970051372 229
290 iso_pu_bacteria 2970054988 2970060829 229
291 iso_pu_bacteria 2970061556 2970063613 229
292 iso_pu_bacteria 2970088815 2970091475 229
293 iso_pu_bacteria 2970109326 2970112503 229
294 iso_pu_bacteria 2970116247 2970121795 229
295 iso_pu_bacteria 2970122695 2970128010 229
296 iso_pu_bacteria 2970129317 2970135088 229
297 iso_pu_bacteria 2970143518 2970148386 229
298 iso_pu_bacteria 2970149975 2970154655 229
299 iso_pu_bacteria 2970156795 2970161849 229
300 iso_pu_bacteria 2970164137 2970169863 229
301 iso_pu_bacteria 2970170962 2970174895 229
302 iso_pu_bacteria 2970184632 2970188626 229
303 iso_pu_bacteria 2970191845 2970195704 229
304 iso_pu_bacteria 2977530762 2977536504 229
305 iso_pu_bacteria 2977537788 2977541219 229
306 iso_pu_bacteria 2977544691 2977549901 229
307 iso_pu_bacteria 2977551784 2977558084 229
308 iso_pu_bacteria 2977558990 2977560789 229
309 iso_pu_bacteria 2977572785 2977578847 229
310 iso_pu_bacteria 2977579622 2977585304 229
311 iso_pu_bacteria 2977858184 2977859516 229
312 iso_pu_bacteria 2979089926 2979090641 229
313 iso_pu_bacteria 2979095461 2979096165 229
314 iso_pu_bacteria 2979100975 2979101692 229
315 iso_pu_bacteria 2984509177 2984510355 229
316 iso_pu_bacteria 2984518228 2984518940 229
317 iso_pu_bacteria 2984537506 2984538703 229
318 iso_pu_bacteria 2984601300 2984605411 229
319 iso_pu_bacteria 2996887358 2996891452 229
320 iso_pu_bacteria 3005452660 3005458390 229
321 iso_pu_bacteria 3005718088 3005718497 229
322 iso_pu_bacteria 648276728 648741035 229
323 iso_pu_bacteria 8003999396 8004005601 229
324 iso_pu_bacteria 8004445564 8004449259 229
325 iso_pu_bacteria 8005258706 8005264003 229
326 iso_pu_bacteria 8005321885 8005325979 229
327 iso_pu_bacteria 8005542996 8005543023 229
328 iso_pu_bacteria 8018150411 8018150865 229
329 iso_pu_bacteria 8049293176 8049298120 229
330 iso_pu_bacteria 8054558443 8054562357 229
331 3300005329 Ga0070683_100134214 Ga0070683_1001342142 230
332 3300005547 Ga0070693_100129750 Ga0070693_1001297502 230
333 3300025944 Ga0207661_10616618 Ga0207661_106166182 230
334 3300048914 Ga0496111_0179915 Ga0496111_0179915_660_1406 230
335 3300048915 Ga0496112_0063607 Ga0496112_0063607_1625_2371 230
336 3300048916 Ga0496113_0599322 Ga0496113_0599322_70_816 230
337 iso_pu_bacteria 2510461069 2510842991 230
338 iso_pu_bacteria 2510917022 2511136989 230
339 iso_pu_bacteria 2513237144 2513913912 230
340 iso_pu_bacteria 2513237146 2513927849 230
341 iso_pu_bacteria 2524023209 2524461537 230
342 iso_pu_bacteria 2582581299 2585232153 230
343 iso_pu_bacteria 2582581307 2585272261 230
344 iso_pu_bacteria 2582581308 2585282650 230
345 iso_pu_bacteria 2582581316 2585335718 230
346 iso_pu_bacteria 2582581866 2585395778 230
347 iso_pu_bacteria 2585427527 2585536853 230
348 iso_pu_bacteria 2585427530 2585555568 230
349 iso_pu_bacteria 2585427531 2585561675 230
350 iso_pu_bacteria 2585427590 2585825059 230
351 iso_pu_bacteria 2585427608 2585899523 230
352 iso_pu_bacteria 2585427609 2585906903 230
353 iso_pu_bacteria 2585428125 2587982324 230
354 iso_pu_bacteria 2599185170 2599416720 230
355 iso_pu_bacteria 2615840626 2616310189 230
356 iso_pu_bacteria 2615840698 2616551350 230
357 iso_pu_bacteria 2617270742 2617380900 230
358 iso_pu_bacteria 2643221558 2643814585 230
359 iso_pu_bacteria 2643221634 2644196204 230
360 iso_pu_bacteria 2667528174 2671114972 230
361 iso_pu_bacteria 2767802442 2770199367 230
362 iso_pu_bacteria 2775506902 2776268390 230
363 iso_pu_bacteria 2775506904 2776283217 230
364 iso_pu_bacteria 2775507266 2778176907 230
365 iso_pu_bacteria 2818991272 2819244842 230
366 iso_pu_bacteria 2818991448 2819607467 230
367 iso_pu_bacteria 2818991453 2819643897 230
368 iso_pu_bacteria 2838029111 2838031957 230
369 iso_pu_bacteria 2838661181 2838662136 230
370 iso_pu_bacteria 2842298080 2842303117 230
371 iso_pu_bacteria 2842357229 2842361407 230
372 iso_pu_bacteria 2842475841 2842478689 230
373 iso_pu_bacteria 2842482326 2842486403 230
374 iso_pu_bacteria 2842502639 2842505992 230
375 iso_pu_bacteria 2842509118 2842513577 230
376 iso_pu_bacteria 2852387548 2852393407 230
377 iso_pu_bacteria 2919408235 2919411882 230
378 iso_pu_bacteria 2923556063 2923559055 230
379 iso_pu_bacteria 2933016740 2933021161 230
380 iso_pu_bacteria 2989776772 2989780884 230
381 iso_pu_bacteria 3005416602 3005418102 230
382 iso_pu_bacteria 8005246636 8005250567 230
383 iso_pu_bacteria 8005314921 8005317947 230
384 iso_pu_bacteria 8005484373 8005486135 230
385 iso_pu_bacteria 8005645114 8005650968 230
386 iso_pu_bacteria 8005682033 8005688250 230
387 iso_pu_bacteria 8055431914 8055434836 230
388 iso_pu_bacteria 8057575449 8057579342 230
389 3300003323 rootH1_10233468 rootH1_102334682 231
390 3300005327 Ga0070658_10177806 Ga0070658_101778062 231
391 3300025909 Ga0207705_10164807 Ga0207705_101648072 231
392 3300031731 Ga0307405_10045830 Ga0307405_100458301 231
393 3300049569 Ga0501032_0050973 Ga0501032_0050973_1714_2463 231
394 3300049569 Ga0501032_0162988 Ga0501032_0162988_399_1148 231
395 3300049574 Ga0501038_0535945 Ga0501038_0535945_92_841 231
396 3300049580 Ga0501046_0013466 Ga0501046_0013466_4959_5708 231
397 3300049586 Ga0501070_0190247 Ga0501070_0190247_216_965 231
398 3300003203 JGI25406J46586_10067921 JGI25406J46586_100679211 232
399 3300005539 Ga0068853_100572991 Ga0068853_1005729911 232
400 3300005985 Ga0081539_10003922 Ga0081539_100039226 232
401 3300009093 Ga0105240_11115568 Ga0105240_111155681 232
402 3300009545 Ga0105237_10113948 Ga0105237_101139483 232
403 3300009551 Ga0105238_10036176 Ga0105238_100361762 232
404 3300010375 Ga0105239_11120350 Ga0105239_111203501 232
405 3300025913 Ga0207695_10596650 Ga0207695_105966501 232
406 3300026041 Ga0207639_10540986 Ga0207639_105409861 232
407 3300026078 Ga0207702_10824140 Ga0207702_108241401 232
408 3300039437 Ga0436365_0173076 Ga0436365_0173076_560_1312 232
409 3300039450 Ga0436363_1341968 Ga0436363_1341968_32_784 232
410 3300044694 Ga0466963_0250738 Ga0466963_0250738_373_1125 232
411 3300044842 Ga0466957_0125938 Ga0466957_0125938_349_1101 232
412 3300045836 Ga0466958_0155327 Ga0466958_0155327_402_1154 232
413 3300045976 Ga0466967_0762071 Ga0466967_0762071_156_908 232
414 iso_pu_bacteria 2509276033 2509441889 232
415 iso_pu_bacteria 2510065019 2510137486 232
416 iso_pu_bacteria 2510461076 2510893384 232
417 iso_pu_bacteria 2513237084 2513572134 232
418 iso_pu_bacteria 2513237085 2513575956 232
419 iso_pu_bacteria 2513237093 2513633610 232
420 iso_pu_bacteria 2513237103 2513712200 232
421 iso_pu_bacteria 2513237162 2514019165 232
422 iso_pu_bacteria 2515075009 2515109557 232
423 iso_pu_bacteria 2515154113 2515634324 232
424 iso_pu_bacteria 2515154114 2515641797 232
425 iso_pu_bacteria 2515154116 2515658935 232
426 iso_pu_bacteria 2515154134 2515742632 232
427 iso_pu_bacteria 2516653077 2517042624 232
428 iso_pu_bacteria 2516653085 2517081413 232
429 iso_pu_bacteria 2517093000 2517100204 232
430 iso_pu_bacteria 2517287029 2517411185 232
431 iso_pu_bacteria 2519899620 2520380173 232
432 iso_pu_bacteria 2529292951 2530648626 232
433 iso_pu_bacteria 2585427526 2585526500 232
434 iso_pu_bacteria 2585427528 2585538794 232
435 iso_pu_bacteria 2585427593 2585836745 232
436 iso_pu_bacteria 2615840624 2616294336 232
437 iso_pu_bacteria 2643221643 2644241894 232
438 iso_pu_bacteria 2718217882 2719184174 232
439 iso_pu_bacteria 2718217927 2719389917 232
440 iso_pu_bacteria 2718217997 2719669517 232
441 iso_pu_bacteria 2718218009 2719729747 232
442 iso_pu_bacteria 2718218199 2720494533 232
443 iso_pu_bacteria 2718218232 2720610869 232
444 iso_pu_bacteria 2718218233 2720616747 232
445 iso_pu_bacteria 2718218235 2720628104 232
446 iso_pu_bacteria 2718218269 2720771684 232
447 iso_pu_bacteria 2718218363 2721143997 232
448 iso_pu_bacteria 2718218365 2721156685 232
449 iso_pu_bacteria 2718218366 2721161372 232
450 iso_pu_bacteria 2718218423 2721403556 232
451 iso_pu_bacteria 2721755514 2722837325 232
452 iso_pu_bacteria 2721755556 2723030947 232
453 iso_pu_bacteria 2721755684 2723563447 232
454 iso_pu_bacteria 2721755685 2723571438 232
455 iso_pu_bacteria 2721755809 2724035132 232
456 iso_pu_bacteria 2721755810 2724040901 232
457 iso_pu_bacteria 2721755819 2724087233 232
458 iso_pu_bacteria 2721755822 2724100944 232
459 iso_pu_bacteria 2721755823 2724108187 232
460 iso_pu_bacteria 2724679232 2725946351 232
461 iso_pu_bacteria 2728369352 2730105413 232
462 iso_pu_bacteria 2728369365 2730162314 232
463 iso_pu_bacteria 2728369397 2730295446 232
464 iso_pu_bacteria 2738541333 2739034216 232
465 iso_pu_bacteria 2765235942 2766068250 232
466 iso_pu_bacteria 2775506901 2776266411 232
467 iso_pu_bacteria 2791355256 2793295830 232
468 iso_pu_bacteria 2791355259 2793312772 232
469 iso_pu_bacteria 2791355260 2793321912 232
470 iso_pu_bacteria 2791355261 2793326842 232
471 iso_pu_bacteria 2791355262 2793334675 232
472 iso_pu_bacteria 2791355263 2793340710 232
473 iso_pu_bacteria 2791355264 2793348633 232
474 iso_pu_bacteria 2791355265 2793354258 232
475 iso_pu_bacteria 2791355267 2793367321 232
476 iso_pu_bacteria 2802429605 2805929737 232
477 iso_pu_bacteria 2802429606 2805933085 232
478 iso_pu_bacteria 2802429633 2806043016 232
479 iso_pu_bacteria 2802429634 2806050969 232
480 iso_pu_bacteria 2802429635 2806057863 232
481 iso_pu_bacteria 2802429636 2806065421 232
482 iso_pu_bacteria 2802429637 2806075338 232
483 iso_pu_bacteria 2838016132 2838019582 232
484 iso_pu_bacteria 2838022645 2838028462 232
485 iso_pu_bacteria 2838061910 2838066369 232
486 iso_pu_bacteria 2838068647 2838072451 232
487 iso_pu_bacteria 2838668709 2838669026 232
488 iso_pu_bacteria 2838686498 2838688431 232
489 iso_pu_bacteria 2838701080 2838701314 232
490 iso_pu_bacteria 2838729681 2838734434 232
491 iso_pu_bacteria 2838742623 2838746893 232
492 iso_pu_bacteria 2841851746 2841852172 232
493 iso_pu_bacteria 2842110456 2842111643 232
494 iso_pu_bacteria 2842146304 2842146621 232
495 iso_pu_bacteria 2842156927 2842158753 232
496 iso_pu_bacteria 2842163707 2842166182 232
497 iso_pu_bacteria 2842180545 2842182367 232
498 iso_pu_bacteria 2842192696 2842193985 232
499 iso_pu_bacteria 2842198810 2842204434 232
500 iso_pu_bacteria 2842205361 2842208570 232
501 iso_pu_bacteria 2842229732 2842234620 232
502 iso_pu_bacteria 2842243621 2842248353 232
503 iso_pu_bacteria 2842250916 2842251149 232
504 iso_pu_bacteria 2842257432 2842262474 232
505 iso_pu_bacteria 2842271015 2842272619 232
506 iso_pu_bacteria 2842278818 2842282084 232
507 iso_pu_bacteria 2842285085 2842289129 232
508 iso_pu_bacteria 2842304105 2842307940 232
509 iso_pu_bacteria 2842311132 2842313175 232
510 iso_pu_bacteria 2842317721 2842319398 232
511 iso_pu_bacteria 2842402390 2842407335 232
512 iso_pu_bacteria 2842409023 2842413416 232
513 iso_pu_bacteria 2842415677 2842420059 232
514 iso_pu_bacteria 2842422224 2842426101 232
515 iso_pu_bacteria 2842428310 2842430245 232
516 iso_pu_bacteria 2842441272 2842442803 232
517 iso_pu_bacteria 2842447887 2842452520 232
518 iso_pu_bacteria 2842462802 2842464679 232
519 iso_pu_bacteria 2842469257 2842470953 232
520 iso_pu_bacteria 2842489311 2842490747 232
521 iso_pu_bacteria 2842495871 2842498840 232
522 iso_pu_bacteria 2844454524 2844461517 232
523 iso_pu_bacteria 2857516855 2857520661 232
524 iso_pu_bacteria 2933570622 2933574390 232
525 iso_pu_bacteria 2933586486 2933590849 232
526 iso_pu_bacteria 2935901341 2935907668 232
527 iso_pu_bacteria 2936367885 2936370801 232
528 iso_pu_bacteria 2936381700 2936382497 232
529 iso_pu_bacteria 2996336353 2996338482 232
530 iso_pu_bacteria 2996893221 2996894866 232
531 iso_pu_bacteria 639633055 639650982 232
532 iso_pu_bacteria 8005275841 8005276040 232
533 iso_pu_bacteria 8005282627 8005287277 232
534 iso_pu_bacteria 8005289223 8005289980 232
535 iso_pu_bacteria 8005301065 8005307358 232
536 iso_pu_bacteria 8005307578 8005312014 232
537 iso_pu_bacteria 8005382845 8005389334 232
538 iso_pu_bacteria 8005395548 8005396803 232
539 iso_pu_bacteria 8005430974 8005435673 232
540 iso_pu_bacteria 8005460587 8005466178 232
541 iso_pu_bacteria 8005497431 8005503416 232
542 iso_pu_bacteria 8005556819 8005563316 232
543 iso_pu_bacteria 8005563573 8005564878 232
544 iso_pu_bacteria 8005570704 8005575867 232
545 iso_pu_bacteria 8005619151 8005625719 232
546 iso_pu_bacteria 8005626139 8005631976 232
547 iso_pu_bacteria 8005668836 8005675294 232
548 iso_pu_bacteria 8005688590 8005688647 232
549 iso_pu_bacteria 8005695170 8005695376 232
550 iso_pu_bacteria 8018127388 8018134651 232
551 iso_pu_bacteria 8018163183 8018169730 232
552 iso_pu_bacteria 8018176218 8018180624 232
553 iso_pu_bacteria 8023680758 8023686004 232
554 iso_pu_bacteria 8024479707 8024485399 232
555 iso_pu_bacteria 8024486573 8024488881 232
556 iso_pu_bacteria 8024501048 8024507049 232
557 iso_pu_bacteria 8056375014 8056381870 232
558 iso_pu_bacteria 8056382006 8056385387 232
559 iso_pu_bacteria 8057874678 8057876275 232
560 3300002773 JGI25152J39213_1020291 JGI25152J39213_10202912 233
561 3300003187 JGI25151J46595_10000442 JGI25151J46595_100004424 233
562 3300003215 JGI25153J46596_10001705 JGI25153J46596_100017059 233
563 3300003323 rootH1_10020411 rootH1_100204112 233
564 3300003771 Ga0055526_1002425 Ga0055526_10024252 233
565 3300003775 Ga0055524_1006515 Ga0055524_10065154 233
566 3300003790 Ga0055528_1001856 Ga0055528_10018569 233
567 3300003792 Ga0055540_1004899 Ga0055540_10048992 233
568 3300003792 Ga0055540_1013560 Ga0055540_10135602 233
569 3300003856 Ga0058692_1001181 Ga0058692_10011813 233
570 3300003856 Ga0058692_1001802 Ga0058692_10018022 233
571 3300005354 Ga0070675_100052192 Ga0070675_1000521922 233
572 3300005548 Ga0070665_100114284 Ga0070665_1001142843 233
573 3300005577 Ga0068857_100167948 Ga0068857_1001679482 233
574 3300005616 Ga0068852_100096814 Ga0068852_1000968143 233
575 3300005617 Ga0068859_100113037 Ga0068859_1001130372 233
576 3300005618 Ga0068864_100102635 Ga0068864_1001026352 233
577 3300006048 Ga0075363_100025077 Ga0075363_1000250772 233
578 3300006048 Ga0075363_100075634 Ga0075363_1000756342 233
579 3300006048 Ga0075363_100356798 Ga0075363_1003567981 233
580 3300006051 Ga0075364_10003707 Ga0075364_100037072 233
581 3300006051 Ga0075364_10157254 Ga0075364_101572541 233
582 3300006178 Ga0075367_10022280 Ga0075367_100222803 233
583 3300006178 Ga0075367_10114506 Ga0075367_101145062 233
584 3300006186 Ga0075369_10009890 Ga0075369_100098902 233
585 3300006186 Ga0075369_10018083 Ga0075369_100180834 233
586 3300006195 Ga0075366_10000625 Ga0075366_100006257 233
587 3300006195 Ga0075366_10034805 Ga0075366_100348052 233
588 3300006195 Ga0075366_10236868 Ga0075366_102368681 233
589 3300006353 Ga0075370_10075573 Ga0075370_100755732 233
590 3300006358 Ga0068871_100383618 Ga0068871_1003836182 233
591 3300006844 Ga0075428_100131340 Ga0075428_1001313403 233
592 3300006931 Ga0097620_100113037 Ga0097620_1001130372 233
593 3300006946 Ga0079104_1018423 Ga0079104_10184232 233
594 3300006948 Ga0099826_10003912 Ga0099826_100039127 233
595 3300006948 Ga0099826_10005440 Ga0099826_100054406 233
596 3300006948 Ga0099826_10164118 Ga0099826_101641182 233
597 3300009093 Ga0105240_10006510 Ga0105240_100065102 233
598 3300009094 Ga0111539_10089994 Ga0111539_100899942 233
599 3300009098 Ga0105245_10011711 Ga0105245_100117116 233
600 3300009148 Ga0105243_10024296 Ga0105243_100242962 233
601 3300009148 Ga0105243_10173480 Ga0105243_101734802 233
602 3300009545 Ga0105237_10001263 Ga0105237_100012632 233
603 3300009551 Ga0105238_10263197 Ga0105238_102631972 233
604 3300010375 Ga0105239_10042797 Ga0105239_100427974 233
605 3300013102 Ga0157371_10000219 Ga0157371_1000021921 233
606 3300013104 Ga0157370_10002266 Ga0157370_100022668 233
607 3300014325 Ga0163163_10373201 Ga0163163_103732012 233
608 3300021320 Ga0214544_1000018 Ga0214544_1000018149 233
609 3300021321 Ga0214542_1000081 Ga0214542_1000081118 233
610 3300021321 Ga0214542_1019910 Ga0214542_10199104 233
611 3300021327 Ga0214543_1000005 Ga0214543_1000005193 233
612 3300021327 Ga0214543_1000042 Ga0214543_1000042161 233
613 3300022739 Ga0228711_1030140 Ga0228711_10301405 233
614 3300022740 Ga0228710_1017381 Ga0228710_10173817 233
615 3300022740 Ga0228710_1021493 Ga0228710_10214935 233
616 3300022740 Ga0228710_1022699 Ga0228710_10226994 233
617 3300025245 Ga0207425_1003396 Ga0207425_10033965 233
618 3300025258 Ga0209129_1000305 Ga0209129_100030522 233
619 3300025273 Ga0209673_1002509 Ga0209673_10025092 233
620 3300025291 Ga0209675_1022469 Ga0209675_10224692 233
621 3300025294 Ga0209025_1000081 Ga0209025_1000081192 233
622 3300025295 Ga0209564_1001882 Ga0209564_100188213 233
623 3300025297 Ga0209758_1000076 Ga0209758_1000076174 233
624 3300025297 Ga0209758_1008129 Ga0209758_10081294 233
625 3300025299 Ga0209256_1007753 Ga0209256_10077532 233
626 3300025303 Ga0209051_1004437 Ga0209051_10044376 233
627 3300025903 Ga0207680_10111345 Ga0207680_101113452 233
628 3300025911 Ga0207654_10038596 Ga0207654_100385961 233
629 3300025913 Ga0207695_10000008 Ga0207695_10000008391 233
630 3300025924 Ga0207694_10280625 Ga0207694_102806252 233
631 3300025925 Ga0207650_10252327 Ga0207650_102523272 233
632 3300025935 Ga0207709_10016371 Ga0207709_100163712 233
633 3300025935 Ga0207709_10155966 Ga0207709_101559662 233
634 3300025942 Ga0207689_10237554 Ga0207689_102375542 233
635 3300026023 Ga0207677_10752342 Ga0207677_107523421 233
636 3300026095 Ga0207676_10010301 Ga0207676_100103014 233
637 3300026116 Ga0207674_10101536 Ga0207674_101015362 233
638 3300026142 Ga0207698_10094138 Ga0207698_100941382 233
639 3300027111 Ga0209281_1000920 Ga0209281_100092019 233
640 3300027111 Ga0209281_1005534 Ga0209281_10055343 233
641 3300027312 Ga0209371_1000035 Ga0209371_100003591 233
642 3300027312 Ga0209371_1001218 Ga0209371_100121814 233
643 3300027666 Ga0209282_1000230 Ga0209282_100023022 233
644 3300027666 Ga0209282_1056745 Ga0209282_10567452 233
645 3300027666 Ga0209282_1061294 Ga0209282_10612944 233
646 3300027866 Ga0209813_10015067 Ga0209813_100150672 233
647 3300027907 Ga0207428_10112287 Ga0207428_101122872 233
648 3300028379 Ga0268266_10087731 Ga0268266_100877313 233
649 3300028563 Ga0265319_1003086 Ga0265319_10030862 233
650 3300028573 Ga0265334_10007422 Ga0265334_100074228 233
651 3300028577 Ga0265318_10007706 Ga0265318_100077063 233
652 3300028577 Ga0265318_10042860 Ga0265318_100428602 233
653 3300028653 Ga0265323_10002112 Ga0265323_100021123 233
654 3300028666 Ga0265336_10000380 Ga0265336_100003809 233
655 3300028800 Ga0265338_10000024 Ga0265338_10000024177 233
656 3300029957 Ga0265324_10001715 Ga0265324_100017159 233
657 3300030500 Ga0268256_1000037 Ga0268256_100003790 233
658 3300030500 Ga0268256_1003362 Ga0268256_10033627 233
659 3300030744 Ga0316181_1155915 Ga0316181_11559151 233
660 3300031235 Ga0265330_10080351 Ga0265330_100803512 233
661 3300031240 Ga0265320_10069558 Ga0265320_100695582 233
662 3300031242 Ga0265329_10040216 Ga0265329_100402161 233
663 3300031247 Ga0265340_10146663 Ga0265340_101466632 233
664 3300031344 Ga0265316_10162139 Ga0265316_101621392 233
665 3300031456 Ga0307513_10216888 Ga0307513_102168882 233
666 3300031595 Ga0265313_10005060 Ga0265313_100050608 233
667 3300031711 Ga0265314_10022794 Ga0265314_100227943 233
668 3300031712 Ga0265342_10013991 Ga0265342_100139912 233
669 3300031712 Ga0265342_10040204 Ga0265342_100402041 233
670 3300031967 Ga0315914_1016454 Ga0315914_10164543 233
671 3300031967 Ga0315914_1036005 Ga0315914_10360051 233
672 3300033430 Ga0315913_1013022 Ga0315913_10130227 233
673 3300033430 Ga0315913_1029943 Ga0315913_10299434 233
674 3300033464 Ga0315915_1000368 Ga0315915_10003687 233
675 3300033464 Ga0315915_1021320 Ga0315915_10213207 233
676 3300039437 Ga0436365_1627531 Ga0436365_1627531_593_1348 233
677 3300041411 Ga0439466_0082958 Ga0439466_0082958_100_855 233
678 3300044694 Ga0466963_0063382 Ga0466963_0063382_320_1075 233
679 3300046516 Ga0495628_0301490 Ga0495628_0301490_229_984 233
680 3300046522 Ga0495643_0127844 Ga0495643_0127844_342_1157 233
681 3300046524 Ga0495648_0023237 Ga0495648_0023237_2177_2932 233
682 3300046558 Ga0495633_0028246 Ga0495633_0028246_10_825 233
683 3300046663 Ga0495635_0432912 Ga0495635_0432912_35_790 233
684 3300046674 Ga0495588_0001445 Ga0495588_0001445_3199_4014 233
685 3300046680 Ga0495646_0224196 Ga0495646_0224196_156_911 233
686 3300046690 Ga0495624_0261952 Ga0495624_0261952_243_998 233
687 3300046692 Ga0495671_0090095 Ga0495671_0090095_293_1108 233
688 3300047317 Ga0495604_0232088 Ga0495604_0232088_77_832 233
689 3300047470 Ga0495681_0001049 Ga0495681_0001049_14843_15658 233
690 3300047472 Ga0495686_0016723 Ga0495686_0016723_2944_3699 233
691 3300048090 Ga0495615_0095846 Ga0495615_0095846_66_821 233
692 3300048903 Ga0496100_0212612 Ga0496100_0212612_522_1277 233
693 3300048903 Ga0496100_0246288 Ga0496100_0246288_434_1189 233
694 3300048905 Ga0496102_0566923 Ga0496102_0566923_180_935 233
695 3300048907 Ga0496104_0090320 Ga0496104_0090320_1988_2803 233
696 3300048919 Ga0496116_0013691 Ga0496116_0013691_3326_4141 233
697 3300048920 Ga0496117_0000066 Ga0496117_0000066_97110_97925 233
698 3300048922 Ga0496119_0009811 Ga0496119_0009811_7257_8072 233
699 3300048922 Ga0496119_0062063 Ga0496119_0062063_387_1202 233
700 3300048923 Ga0496120_0001197 Ga0496120_0001197_19478_20293 233
701 3300048925 Ga0496122_0000057 Ga0496122_0000057_155525_156340 233
702 3300048926 Ga0496123_0000096 Ga0496123_0000096_17575_18390 233
703 3300048927 Ga0496124_0019276 Ga0496124_0019276_81_896 233
704 3300048927 Ga0496124_0043889 Ga0496124_0043889_440_1195 233
705 3300048928 Ga0496125_0008410 Ga0496125_0008410_2198_3013 233
706 3300048928 Ga0496125_0169730 Ga0496125_0169730_54_869 233
707 3300048929 Ga0496126_0000430 Ga0496126_0000430_14801_15556 233
708 3300049568 Ga0501031_0000010 Ga0501031_0000010_89207_89962 233
709 3300049568 Ga0501031_0046808 Ga0501031_0046808_1242_1997 233
710 3300049569 Ga0501032_0000023 Ga0501032_0000023_56474_57229 233
711 3300049569 Ga0501032_0091610 Ga0501032_0091610_802_1557 233
712 3300049570 Ga0501033_0000104 Ga0501033_0000104_44277_45032 233
713 3300049570 Ga0501033_0032233 Ga0501033_0032233_994_1749 233
714 3300049571 Ga0501034_0000116 Ga0501034_0000116_89214_89969 233
715 3300049571 Ga0501034_0201244 Ga0501034_0201244_17_772 233
716 3300049571 Ga0501034_0391046 Ga0501034_0391046_499_1254 233
717 3300049572 Ga0501036_0000015 Ga0501036_0000015_89214_89969 233
718 3300049572 Ga0501036_0170914 Ga0501036_0170914_149_904 233
719 3300049573 Ga0501037_0000023 Ga0501037_0000023_89314_90069 233
720 3300049574 Ga0501038_0000025 Ga0501038_0000025_89314_90069 233
721 3300049575 Ga0501039_0000037 Ga0501039_0000037_89214_89969 233
722 3300049576 Ga0501040_0005598 Ga0501040_0005598_5159_5914 233
723 3300049579 Ga0501043_0000070 Ga0501043_0000070_32650_33405 233
724 3300049579 Ga0501043_0016194 Ga0501043_0016194_1844_2599 233
725 3300049580 Ga0501046_0219006 Ga0501046_0219006_528_1283 233
726 3300049581 Ga0501047_0001244 Ga0501047_0001244_14957_15712 233
727 3300049588 Ga0501072_0004650 Ga0501072_0004650_1490_2245 233
728 3300049744 Ga0501083_0177523 Ga0501083_0177523_565_1320 233
729 3300049776 Ga0501280_001581 Ga0501280_001581_218_973 233
730 3300049822 Ga0501035_0000074 Ga0501035_0000074_89195_89950 233
731 3300049822 Ga0501035_0161435 Ga0501035_0161435_819_1574 233
732 3300049823 Ga0501044_0000069 Ga0501044_0000069_36006_36761 233
733 3300049824 Ga0501045_0128427 Ga0501045_0128427_447_1202 233
734 3300050489 nmdc:mga03683_16660_c2 nmdc:mga03683_16660_c2_336_1091 233
735 3300050489 nmdc:mga03683_179392_c1 nmdc:mga03683_179392_c1_81_896 233
736 3300050491 nmdc:mga00v17_59_c2 nmdc:mga00v17_59_c2_81_896 233
737 3300050492 nmdc:mga0yw44_23882_c1 nmdc:mga0yw44_23882_c1_2126_2881 233
738 3300050492 nmdc:mga0yw44_68031_c1 nmdc:mga0yw44_68031_c1_1292_2080 233
739 3300050492 nmdc:mga0yw44_7224_c1 nmdc:mga0yw44_7224_c1_2494_3309 233
740 3300050493 nmdc:mga0k408_12529_c1 nmdc:mga0k408_12529_c1_1085_1840 233
741 3300050494 nmdc:mga06z11_134020_c1 nmdc:mga06z11_134020_c1_472_1227 233
742 3300050494 nmdc:mga06z11_136330_c1 nmdc:mga06z11_136330_c1_604_1359 233
743 3300050494 nmdc:mga06z11_15017_c1 nmdc:mga06z11_15017_c1_1540_2355 233
744 3300050495 nmdc:mga04h51_32080_c1 nmdc:mga04h51_32080_c1_807_1622 233
745 3300050496 nmdc:mga07m45_68339_c1 nmdc:mga07m45_68339_c1_144_932 233
746 3300050516 nmdc:mga0sz30_100424_c1 nmdc:mga0sz30_100424_c1_143_931 233
747 3300050516 nmdc:mga0sz30_14265_c1 nmdc:mga0sz30_14265_c1_1817_2572 233
748 3300050516 nmdc:mga0sz30_145567_c1 nmdc:mga0sz30_145567_c1_236_991 233
749 3300050516 nmdc:mga0sz30_578_c1 nmdc:mga0sz30_578_c1_4509_5324 233
750 3300053107 Ga0500560_000150 Ga0500560_000150_2358_3173 233
751 3300053119 Ga0500595_044034 Ga0500595_044034_399_1154 233
752 3300053137 Ga0500561_0000021 Ga0500561_0000021_16582_17397 233
753 3300053157 Ga0500624_000889 Ga0500624_000889_4739_5554 233
754 3300053161 Ga0500634_0000008 Ga0500634_0000008_56039_56794 233
755 3300053161 Ga0500634_0007871 Ga0500634_0007871_3864_4619 233
756 3300053177 Ga0500636_0000027 Ga0500636_0000027_67426_68181 233
757 3300053177 Ga0500636_0000679 Ga0500636_0000679_259_1014 233
758 3300054114 Ga0501084_0057528 Ga0501084_0057528_1139_1894 233
759 3300060353 Ga0501082_0000007 Ga0501082_0000007_5115_5870 233
760 3300060353 Ga0501082_0362003 Ga0501082_0362003_489_1244 233
761 iso_pu_bacteria 2508501050 2508730178 233
762 iso_pu_bacteria 2509276018 2509367898 233
763 iso_pu_bacteria 2510065059 2510315580 233
764 iso_pu_bacteria 2510461069 2510842124 233
765 iso_pu_bacteria 2510917026 2511169060 233
766 iso_pu_bacteria 2510917030 2511193654 233
767 iso_pu_bacteria 2512047086 2512531381 233
768 iso_pu_bacteria 2513237088 2513595508 233
769 iso_pu_bacteria 2513237101 2513693476 233
770 iso_pu_bacteria 2513237138 2513871194 233
771 iso_pu_bacteria 2513237159 2513999069 233
772 iso_pu_bacteria 2558860983 2561468753 233
773 iso_pu_bacteria 2582581283 2585166619 233
774 iso_pu_bacteria 2582581294 2585204660 233
775 iso_pu_bacteria 2582581294 2585205387 233
776 iso_pu_bacteria 2582581298 2585221985 233
777 iso_pu_bacteria 2582581304 2585255439 233
778 iso_pu_bacteria 2582581306 2585269245 233
779 iso_pu_bacteria 2582581865 2585390759 233
780 iso_pu_bacteria 2582581867 2585403010 233
781 iso_pu_bacteria 2585427529 2585545062 233
782 iso_pu_bacteria 2585427590 2585820014 233
783 iso_pu_bacteria 2585427594 2585842451 233
784 iso_pu_bacteria 2585427633 2585992750 233
785 iso_pu_bacteria 2585427634 2586003412 233
786 iso_pu_bacteria 2599185210 2599605093 233
787 iso_pu_bacteria 2643221595 2643986868 233
788 iso_pu_bacteria 2643221607 2644052325 233
789 iso_pu_bacteria 2643221627 2644156289 233
790 iso_pu_bacteria 2643221636 2644201292 233
791 iso_pu_bacteria 2643221686 2644484603 233
792 iso_pu_bacteria 2643221688 2644494989 233
793 iso_pu_bacteria 2687453392 2688598373 233
794 iso_pu_bacteria 2721755755 2723848370 233
795 iso_pu_bacteria 2738541293 2738802563 233
796 iso_pu_bacteria 2756170246 2756672534 233
797 iso_pu_bacteria 2775506901 2776265153 233
798 iso_pu_bacteria 2791355123 2792752721 233
799 iso_pu_bacteria 2791355199 2793082820 233
800 iso_pu_bacteria 2821123053 2821126912 233
801 iso_pu_bacteria 2821123053 2821128914 233
802 iso_pu_bacteria 2824679649 2824682712 233
803 iso_pu_bacteria 2838074704 2838080054 233
804 iso_pu_bacteria 2841734538 2841739124 233
805 iso_pu_bacteria 2842521101 2842524813 233
806 iso_pu_bacteria 2844002411 2844007505 233
807 iso_pu_bacteria 2844009547 2844013626 233
808 iso_pu_bacteria 2856328259 2856334491 233
809 iso_pu_bacteria 2856334872 2856340387 233
810 iso_pu_bacteria 2857367948 2857372772 233
811 iso_pu_bacteria 2857531043 2857537795 233
812 iso_pu_bacteria 2869169390 2869171642 233
813 iso_pu_bacteria 2869169390 2869173370 233
814 iso_pu_bacteria 2869234852 2869240008 233
815 iso_pu_bacteria 2869234852 2869240400 233
816 iso_pu_bacteria 2869242130 2869245463 233
817 iso_pu_bacteria 2869242130 2869248822 233
818 iso_pu_bacteria 2869249662 2869253293 233
819 iso_pu_bacteria 2869256925 2869260823 233
820 iso_pu_bacteria 2869264136 2869268056 233
821 iso_pu_bacteria 2869271264 2869276458 233
822 iso_pu_bacteria 2871435913 2871439798 233
823 iso_pu_bacteria 2871451962 2871459504 233
824 iso_pu_bacteria 2871459585 2871466794 233
825 iso_pu_bacteria 2871466892 2871468279 233
826 iso_pu_bacteria 2871474448 2871475478 233
827 iso_pu_bacteria 2871481445 2871482906 233
828 iso_pu_bacteria 2871481445 2871485380 233
829 iso_pu_bacteria 2874109183 2874112557 233
830 iso_pu_bacteria 2874109183 2874116396 233
831 iso_pu_bacteria 2874116593 2874116782 233
832 iso_pu_bacteria 2874116593 2874116906 233
833 iso_pu_bacteria 2874131515 2874134486 233
834 iso_pu_bacteria 2874162495 2874164498 233
835 iso_pu_bacteria 2874168670 2874169141 233
836 iso_pu_bacteria 2874168670 2874169782 233
837 iso_pu_bacteria 2874604998 2874608666 233
838 iso_pu_bacteria 2876386047 2876388016 233
839 iso_pu_bacteria 2876386047 2876390862 233
840 iso_pu_bacteria 2876399893 2876403655 233
841 iso_pu_bacteria 2876420981 2876426911 233
842 iso_pu_bacteria 2876420981 2876427747 233
843 iso_pu_bacteria 2876808645 2876817132 233
844 iso_pu_bacteria 2878730984 2878732783 233
845 iso_pu_bacteria 2878730984 2878735884 233
846 iso_pu_bacteria 2878774303 2878774692 233
847 iso_pu_bacteria 2878781027 2878781635 233
848 iso_pu_bacteria 2878788777 2878795837 233
849 iso_pu_bacteria 2879110137 2879117867 233
850 iso_pu_bacteria 2881665667 2881669988 233
851 iso_pu_bacteria 2882632389 2882640232 233
852 iso_pu_bacteria 2889033259 2889037081 233
853 iso_pu_bacteria 2894652903 2894657491 233
854 iso_pu_bacteria 2896384573 2896389295 233
855 iso_pu_bacteria 2899803654 2899805736 233
856 iso_pu_bacteria 2899803654 2899807083 233
857 iso_pu_bacteria 2903513507 2903517494 233
858 iso_pu_bacteria 2906363423 2906365642 233
859 iso_pu_bacteria 2906370794 2906374191 233
860 iso_pu_bacteria 2906378014 2906382769 233
861 iso_pu_bacteria 2906401398 2906401744 233
862 iso_pu_bacteria 2906401398 2906401987 233
863 iso_pu_bacteria 2906408224 2906408830 233
864 iso_pu_bacteria 2906427513 2906433661 233
865 iso_pu_bacteria 2906427513 2906435464 233
866 iso_pu_bacteria 2913295892 2913298887 233
867 iso_pu_bacteria 2919100787 2919102532 233
868 iso_pu_bacteria 2919171160 2919174443 233
869 iso_pu_bacteria 2919171160 2919177142 233
870 iso_pu_bacteria 2920760137 2920762603 233
871 iso_pu_bacteria 2922151315 2922153400 233
872 iso_pu_bacteria 2922172374 2922175308 233
873 iso_pu_bacteria 2922178524 2922182892 233
874 iso_pu_bacteria 2922361189 2922361200 233
875 iso_pu_bacteria 2922393267 2922394480 233
876 iso_pu_bacteria 2923556063 2923559695 233
877 iso_pu_bacteria 2924710171 2924717599 233
878 iso_pu_bacteria 2924733363 2924735865 233
879 iso_pu_bacteria 2924741084 2924744084 233
880 iso_pu_bacteria 2924741084 2924747365 233
881 iso_pu_bacteria 2924748358 2924749355 233
882 iso_pu_bacteria 2933011516 2933016275 233
883 iso_pu_bacteria 2937836603 2937839312 233
884 iso_pu_bacteria 2937861824 2937862955 233
885 iso_pu_bacteria 2937861824 2937868408 233
886 iso_pu_bacteria 2937868953 2937870263 233
887 iso_pu_bacteria 2937980651 2937986403 233
888 iso_pu_bacteria 2937980651 2937987236 233
889 iso_pu_bacteria 2939669807 2939671917 233
890 iso_pu_bacteria 2958071322 2958072048 233
891 iso_pu_bacteria 2958108152 2958110484 233
892 iso_pu_bacteria 2958108152 2958113267 233
893 iso_pu_bacteria 2958158011 2958161508 233
894 iso_pu_bacteria 2961136820 2961143148 233
895 iso_pu_bacteria 2961183825 2961184347 233
896 iso_pu_bacteria 2961183825 2961186098 233
897 iso_pu_bacteria 2965025482 2965031828 233
898 iso_pu_bacteria 2965032056 2965035160 233
899 iso_pu_bacteria 2965040258 2965045349 233
900 iso_pu_bacteria 2965047637 2965054831 233
901 iso_pu_bacteria 2965089291 2965096007 233
902 iso_pu_bacteria 2965102966 2965107843 233
903 iso_pu_bacteria 2965110997 2965118971 233
904 iso_pu_bacteria 2968138860 2968142182 233
905 iso_pu_bacteria 2970489779 2970492955 233
906 iso_pu_bacteria 2970510686 2970517028 233
907 iso_pu_bacteria 2970510686 2970517397 233
908 iso_pu_bacteria 2970532167 2970534599 233
909 iso_pu_bacteria 2970532167 2970535158 233
910 iso_pu_bacteria 2970547951 2970548932 233
911 iso_pu_bacteria 2970619444 2970623012 233
912 iso_pu_bacteria 2970627176 2970627521 233
913 iso_pu_bacteria 2970627176 2970628771 233
914 iso_pu_bacteria 2977851361 2977855843 233
915 iso_pu_bacteria 2977851361 2977856645 233
916 iso_pu_bacteria 2977864932 2977868549 233
917 iso_pu_bacteria 2977872689 2977873300 233
918 iso_pu_bacteria 2977898635 2977900042 233
919 iso_pu_bacteria 2977907340 2977909233 233
920 iso_pu_bacteria 2977907340 2977909783 233
921 iso_pu_bacteria 2977915119 2977915475 233
922 iso_pu_bacteria 2977935797 2977936089 233
923 iso_pu_bacteria 2977950692 2977954852 233
924 iso_pu_bacteria 2977957713 2977963007 233
925 iso_pu_bacteria 2979764755 2979769424 233
926 iso_pu_bacteria 2979764755 2979770302 233
927 iso_pu_bacteria 2979772303 2979774188 233
928 iso_pu_bacteria 2979772303 2979777985 233
929 iso_pu_bacteria 2979793036 2979794100 233
930 iso_pu_bacteria 2987645492 2987649581 233
931 iso_pu_bacteria 2987673487 2987680839 233
932 iso_pu_bacteria 2996386984 2996392274 233
933 iso_pu_bacteria 3003665799 3003667402 233
934 iso_pu_bacteria 3003930520 3003935026 233
935 iso_pu_bacteria 3004167301 3004168822 233
936 iso_pu_bacteria 3004195979 3004201254 233
937 iso_pu_bacteria 3004232784 3004236089 233
938 iso_pu_bacteria 3004232784 3004237087 233
939 iso_pu_bacteria 3004239961 3004240027 233
940 iso_pu_bacteria 3004248173 3004249091 233
941 iso_pu_bacteria 3004248173 3004253925 233
942 iso_pu_bacteria 3004268573 3004274863 233
943 iso_pu_bacteria 3005594810 3005597920 233
944 iso_pu_bacteria 643692032 643824077 233
945 iso_pu_bacteria 649633066 649872901 233
946 iso_pu_bacteria 650716007 650843720 233
947 iso_pu_bacteria 8003570095 8003574019 233
948 iso_pu_bacteria 8004300914 8004303841 233
949 iso_pu_bacteria 8004312739 8004317421 233
950 iso_pu_bacteria 8004361976 8004362213 233
951 iso_pu_bacteria 8004633249 8004638652 233
952 iso_pu_bacteria 8004695233 8004700865 233
953 iso_pu_bacteria 8004727605 8004728658 233
954 iso_pu_bacteria 8004727605 8004729819 233
955 iso_pu_bacteria 8006964411 8006967944 233
956 iso_pu_bacteria 8006984368 8006984761 233
957 iso_pu_bacteria 8006994254 8006999691 233
958 3300002704 JGI25155J39150_1000047 JGI25155J39150_100004746 234
959 3300002705 JGI25156J39149_1000069 JGI25156J39149_100006948 234
960 3300002737 JGI25162J39368_1001511 JGI25162J39368_10015119 234
961 3300002738 JGI25154J39366_1000091 JGI25154J39366_100009126 234
962 3300002741 JGI25157J39369_1000085 JGI25157J39369_100008548 234
963 3300003214 JGI25165J46597_1000505 JGI25165J46597_100050510 234
964 3300003214 JGI25165J46597_1004580 JGI25165J46597_10045803 234
965 3300003215 JGI25153J46596_10047318 JGI25153J46596_100473182 234
966 3300003322 rootL2_10000436 rootL2_100004368 234
967 3300003322 rootL2_10229133 rootL2_102291333 234
968 3300003323 rootH1_10130821 rootH1_101308213 234
969 3300003354 JGI25160J50197_1000040 JGI25160J50197_1000040143 234
970 3300003374 JGI25161J50226_1000023 JGI25161J50226_1000023143 234
971 3300004625 Ga0055543_1001620 Ga0055543_10016205 234
972 3300005262 Ga0065165_1000484 Ga0065165_100048461 234
973 3300005563 Ga0068855_100535566 Ga0068855_1005355662 234
974 3300006353 Ga0075370_10008891 Ga0075370_100088912 234
975 3300009093 Ga0105240_10000214 Ga0105240_10000214116 234
976 3300009545 Ga0105237_10034873 Ga0105237_100348735 234
977 3300013104 Ga0157370_10060520 Ga0157370_100605203 234
978 3300013105 Ga0157369_10048441 Ga0157369_100484413 234
979 3300015262 Ga0182007_10002152 Ga0182007_100021525 234
980 3300015265 Ga0182005_1022000 Ga0182005_10220002 234
981 3300025206 Ga0209435_100058 Ga0209435_10005827 234
982 3300025233 Ga0209437_100239 Ga0209437_10023955 234
983 3300025246 Ga0209646_1000178 Ga0209646_100017827 234
984 3300025250 Ga0209026_1000208 Ga0209026_100020827 234
985 3300025253 Ga0209677_100248 Ga0209677_10024833 234
986 3300025256 Ga0209759_1000242 Ga0209759_100024227 234
987 3300025261 Ga0209233_1000245 Ga0209233_100024527 234
988 3300025261 Ga0209233_1000340 Ga0209233_100034036 234
989 3300025284 Ga0209130_1000142 Ga0209130_1000142109 234
990 3300025297 Ga0209758_1005376 Ga0209758_10053765 234
991 3300025302 Ga0207426_1000076 Ga0207426_1000076295 234
992 3300025913 Ga0207695_10000373 Ga0207695_1000037399 234
993 3300025914 Ga0207671_10000536 Ga0207671_1000053641 234
994 3300025949 Ga0207667_10689577 Ga0207667_106895772 234
995 3300025981 Ga0207640_10428823 Ga0207640_104288232 234
996 3300027312 Ga0209371_1006004 Ga0209371_10060042 234
997 3300030500 Ga0268256_1006002 Ga0268256_10060022 234
998 3300031727 Ga0316576_10061783 Ga0316576_100617833 234
999 3300042007 Ga0439449_0055506 Ga0439449_0055506_197_955 234
1000 3300044694 Ga0466963_0005475 Ga0466963_0005475_5538_6296 234
1001 3300044765 Ga0466970_0000198 Ga0466970_0000198_22489_23247 234
1002 3300044842 Ga0466957_0065990 Ga0466957_0065990_931_1689 234
1003 3300045836 Ga0466958_0073454 Ga0466958_0073454_1283_2041 234
1004 3300045976 Ga0466967_0082967 Ga0466967_0082967_869_1627 234
1005 3300046506 Ga0495583_0001051 Ga0495583_0001051_24621_25379 234
1006 3300046522 Ga0495643_0007516 Ga0495643_0007516_2360_3118 234
1007 3300046660 Ga0495625_0016210 Ga0495625_0016210_3710_4468 234
1008 3300046665 Ga0495661_0172149 Ga0495661_0172149_293_1054 234
1009 3300047443 Ga0495687_007825 Ga0495687_007825_1663_2421 234
1010 3300047443 Ga0495687_044962 Ga0495687_044962_302_1060 234
1011 3300048905 Ga0496102_0028748 Ga0496102_0028748_104_862 234
1012 3300048906 Ga0496103_0007016 Ga0496103_0007016_2898_3656 234
1013 3300048910 Ga0496107_0088138 Ga0496107_0088138_377_1135 234
1014 3300048920 Ga0496117_0030766 Ga0496117_0030766_2828_3586 234
1015 3300048921 Ga0496118_0026933 Ga0496118_0026933_3597_4355 234
1016 3300048922 Ga0496119_0032320 Ga0496119_0032320_2049_2807 234
1017 3300048922 Ga0496119_0114470 Ga0496119_0114470_497_1267 234
1018 3300048923 Ga0496120_0019205 Ga0496120_0019205_820_1578 234
1019 3300048924 Ga0496121_0121865 Ga0496121_0121865_992_1762 234
1020 3300048924 Ga0496121_0132257 Ga0496121_0132257_249_1019 234
1021 3300048924 Ga0496121_0157257 Ga0496121_0157257_14_772 234
1022 3300048924 Ga0496121_0157259 Ga0496121_0157259_895_1653 234
1023 3300048925 Ga0496122_0028627 Ga0496122_0028627_432_1190 234
1024 3300048926 Ga0496123_0005115 Ga0496123_0005115_445_1203 234
1025 3300048927 Ga0496124_0006914 Ga0496124_0006914_11012_11770 234
1026 3300048927 Ga0496124_0297912 Ga0496124_0297912_110_868 234
1027 3300048928 Ga0496125_0020272 Ga0496125_0020272_2214_2972 234
1028 3300048928 Ga0496125_0069639 Ga0496125_0069639_996_1754 234
1029 3300048928 Ga0496125_0090250 Ga0496125_0090250_328_1098 234
1030 3300048929 Ga0496126_0010075 Ga0496126_0010075_8553_9311 234
1031 3300048929 Ga0496126_0058498 Ga0496126_0058498_46_804 234
1032 iso_pu_bacteria 2582581298 2585226287 234
1033 iso_pu_bacteria 2585427529 2585548793 234
1034 iso_pu_bacteria 2643221591 2643963161 234
1035 iso_pu_bacteria 2838035591 2838036829 234
1036 iso_pu_bacteria 2924762789 2924765042 234
1037 iso_pu_bacteria 2937822353 2937824374 234
1038 iso_pu_bacteria 2987666974 2987667948 234
1039 3300005983 Ga0081540_1003572 Ga0081540_10035726 235
1040 3300031616 Ga0307508_10126581 Ga0307508_101265812 235
1041 3300035691 Ga0373931_0258265 Ga0373931_0258265_30_791 235
1042 3300046515 Ga0495620_0010070 Ga0495620_0010070_2706_3467 235
1043 3300046794 Ga0495589_0147371 Ga0495589_0147371_137_898 235
1044 3300047323 Ga0495683_0001428 Ga0495683_0001428_3933_4694 235
1045 3300047469 Ga0495673_0020859 Ga0495673_0020859_1058_1819 235
1046 3300048903 Ga0496100_0010828 Ga0496100_0010828_1788_2549 235
1047 3300048904 Ga0496101_0001581 Ga0496101_0001581_11877_12638 235
1048 3300048905 Ga0496102_0000981 Ga0496102_0000981_17435_18196 235
1049 3300048906 Ga0496103_0000660 Ga0496103_0000660_15028_15789 235
1050 3300048907 Ga0496104_0009153 Ga0496104_0009153_5476_6237 235
1051 3300048909 Ga0496106_0003138 Ga0496106_0003138_3943_4704 235
1052 3300048910 Ga0496107_0005547 Ga0496107_0005547_1106_1867 235
1053 3300048912 Ga0496109_0414861 Ga0496109_0414861_68_829 235
1054 3300048913 Ga0496110_0001494 Ga0496110_0001494_861_1622 235
1055 3300048914 Ga0496111_0015312 Ga0496111_0015312_1619_2380 235
1056 3300048915 Ga0496112_0000725 Ga0496112_0000725_21233_21994 235
1057 3300048916 Ga0496113_0005964 Ga0496113_0005964_2994_3755 235
1058 3300048919 Ga0496116_0001582 Ga0496116_0001582_7838_8599 235
1059 3300048920 Ga0496117_0069530 Ga0496117_0069530_1465_2226 235
1060 3300048921 Ga0496118_0072878 Ga0496118_0072878_1435_2196 235
1061 3300048924 Ga0496121_0038400 Ga0496121_0038400_2488_3249 235
1062 3300048925 Ga0496122_0002747 Ga0496122_0002747_17653_18414 235
1063 3300048926 Ga0496123_0010599 Ga0496123_0010599_1630_2391 235
1064 3300048927 Ga0496124_0004690 Ga0496124_0004690_5233_5994 235
1065 3300048928 Ga0496125_0011332 Ga0496125_0011332_2519_3280 235
1066 3300053735 Ga0500596_002261 Ga0500596_002261_1014_1805 235
1067 iso_pu_bacteria 2510917030 2511194709 235
1068 iso_pu_bacteria 2585427528 2585538962 235
1069 iso_pu_bacteria 2585427593 2585836912 235
1070 iso_pu_bacteria 2802429633 2806043182 235
1071 iso_pu_bacteria 2802429634 2806051133 235
1072 iso_pu_bacteria 2802429635 2806057695 235
1073 iso_pu_bacteria 2802429636 2806065588 235
1074 iso_pu_bacteria 2802429637 2806075182 235
1075 iso_pu_bacteria 2902682994 2902687785 235
1076 iso_pu_bacteria 8005570704 8005576037 235
1077 iso_pu_bacteria 8054563764 8054565951 235
1078 3300003187 JGI25151J46595_10000337 JGI25151J46595_1000033725 236
1079 3300003203 JGI25406J46586_10046501 JGI25406J46586_100465012 236
1080 3300003215 JGI25153J46596_10002607 JGI25153J46596_100026074 236
1081 3300003354 JGI25160J50197_1002870 JGI25160J50197_10028701 236
1082 3300003374 JGI25161J50226_1002292 JGI25161J50226_10022923 236
1083 3300003771 Ga0055526_1001366 Ga0055526_10013666 236
1084 3300003771 Ga0055526_1005586 Ga0055526_10055866 236
1085 3300003771 Ga0055526_1054777 Ga0055526_10547771 236
1086 3300003775 Ga0055524_1001200 Ga0055524_100120010 236
1087 3300003775 Ga0055524_1018578 Ga0055524_10185782 236
1088 3300003775 Ga0055524_1033400 Ga0055524_10334002 236
1089 3300003790 Ga0055528_1000684 Ga0055528_100068411 236
1090 3300003790 Ga0055528_1001834 Ga0055528_10018346 236
1091 3300003790 Ga0055528_1032308 Ga0055528_10323082 236
1092 3300003790 Ga0055528_1040001 Ga0055528_10400011 236
1093 3300003792 Ga0055540_1000066 Ga0055540_1000066114 236
1094 3300003792 Ga0055540_1008406 Ga0055540_10084062 236
1095 3300004625 Ga0055543_1001035 Ga0055543_10010354 236
1096 3300005262 Ga0065165_1010245 Ga0065165_10102454 236
1097 3300005331 Ga0070670_100023690 Ga0070670_1000236905 236
1098 3300005985 Ga0081539_10002462 Ga0081539_1000246225 236
1099 3300006038 Ga0075365_10001142 Ga0075365_100011426 236
1100 3300006048 Ga0075363_100067595 Ga0075363_1000675951 236
1101 3300006178 Ga0075367_10009766 Ga0075367_100097663 236
1102 3300006186 Ga0075369_10002248 Ga0075369_100022483 236
1103 3300006353 Ga0075370_10018822 Ga0075370_100188224 236
1104 3300009765 Ga0123341_1000005 Ga0123341_100000531 236
1105 3300012490 Ga0157322_1002570 Ga0157322_10025702 236
1106 3300025245 Ga0207425_1003978 Ga0207425_10039784 236
1107 3300025258 Ga0209129_1000852 Ga0209129_100085211 236
1108 3300025273 Ga0209673_1000020 Ga0209673_1000020260 236
1109 3300025273 Ga0209673_1000433 Ga0209673_100043329 236
1110 3300025273 Ga0209673_1001173 Ga0209673_10011732 236
1111 3300025273 Ga0209673_1021485 Ga0209673_10214852 236
1112 3300025284 Ga0209130_1016079 Ga0209130_10160793 236
1113 3300025294 Ga0209025_1000081 Ga0209025_100008134 236
1114 3300025295 Ga0209564_1000114 Ga0209564_100011442 236
1115 3300025295 Ga0209564_1000722 Ga0209564_100072226 236
1116 3300025295 Ga0209564_1013756 Ga0209564_10137564 236
1117 3300025297 Ga0209758_1000076 Ga0209758_100007616 236
1118 3300025297 Ga0209758_1004022 Ga0209758_10040228 236
1119 3300025299 Ga0209256_1000123 Ga0209256_1000123140 236
1120 3300025299 Ga0209256_1001407 Ga0209256_100140716 236
1121 3300025299 Ga0209256_1016219 Ga0209256_10162191 236
1122 3300025302 Ga0207426_1000169 Ga0207426_1000169121 236
1123 3300025303 Ga0209051_1000038 Ga0209051_100003841 236
1124 3300025303 Ga0209051_1001529 Ga0209051_10015294 236
1125 3300025303 Ga0209051_1028520 Ga0209051_10285203 236
1126 3300025304 Ga0209257_1008419 Ga0209257_10084195 236
1127 3300025925 Ga0207650_10015477 Ga0207650_100154772 236
1128 3300035695 Ga0373927_0000835 Ga0373927_0000835_21884_22648 236
1129 3300037068 Ga0373925_0002089 Ga0373925_0002089_4892_5656 236
1130 3300039062 Ga0400483_277886 Ga0400483_277886_7345_8109 236
1131 3300039062 Ga0400483_284574 Ga0400483_284574_549_1313 236
1132 3300041413 Ga0439465_0014474 Ga0439465_0014474_396_1160 236
1133 3300041413 Ga0439465_0102753 Ga0439465_0102753_62_826 236
1134 3300041452 Ga0451793_1613516 Ga0451793_1613516_190_954 236
1135 3300041491 Ga0451833_0571278 Ga0451833_0571278_318_1082 236
1136 3300041492 Ga0451835_0341194 Ga0451835_0341194_2147_2911 236
1137 3300041496 Ga0451839_0553209 Ga0451839_0553209_18_782 236
1138 3300041503 Ga0451847_0247730 Ga0451847_0247730_1265_2029 236
1139 3300041505 Ga0451849_0247574 Ga0451849_0247574_142_906 236
1140 3300041507 Ga0451851_1205047 Ga0451851_1205047_2029_2793 236
1141 3300041511 Ga0451855_1407221 Ga0451855_1407221_161_925 236
1142 3300041511 Ga0451855_1443745 Ga0451855_1443745_212_976 236
1143 3300046476 Ga0495662_0001363 Ga0495662_0001363_9573_10337 236
1144 3300046477 Ga0495664_0112455 Ga0495664_0112455_731_1495 236
1145 3300046492 Ga0495585_0025689 Ga0495585_0025689_1255_2019 236
1146 3300046492 Ga0495585_0165717 Ga0495585_0165717_322_1086 236
1147 3300046507 Ga0495606_0008984 Ga0495606_0008984_4069_4833 236
1148 3300046507 Ga0495606_0060068 Ga0495606_0060068_842_1606 236
1149 3300046512 Ga0495610_0052509 Ga0495610_0052509_732_1496 236
1150 3300046513 Ga0495616_0132125 Ga0495616_0132125_126_890 236
1151 3300046515 Ga0495620_0005142 Ga0495620_0005142_4317_5081 236
1152 3300046519 Ga0495632_0053803 Ga0495632_0053803_733_1497 236
1153 3300046522 Ga0495643_0006217 Ga0495643_0006217_618_1382 236
1154 3300046524 Ga0495648_0033138 Ga0495648_0033138_2582_3346 236
1155 3300046538 Ga0495609_0086015 Ga0495609_0086015_259_1023 236
1156 3300046542 Ga0495597_0023590 Ga0495597_0023590_1539_2303 236
1157 3300046557 Ga0495622_0014155 Ga0495622_0014155_1746_2510 236
1158 3300046558 Ga0495633_0065690 Ga0495633_0065690_92_856 236
1159 3300046558 Ga0495633_0206685 Ga0495633_0206685_88_852 236
1160 3300046616 Ga0495668_0127022 Ga0495668_0127022_163_927 236
1161 3300046642 Ga0495634_0060986 Ga0495634_0060986_163_927 236
1162 3300046648 Ga0495611_0025199 Ga0495611_0025199_66_830 236
1163 3300046665 Ga0495661_0038796 Ga0495661_0038796_2006_2770 236
1164 3300046674 Ga0495588_0194200 Ga0495588_0194200_128_892 236
1165 3300046674 Ga0495588_0201788 Ga0495588_0201788_240_1004 236
1166 3300046690 Ga0495624_0120943 Ga0495624_0120943_362_1126 236
1167 3300046694 Ga0495649_0006784 Ga0495649_0006784_1402_2166 236
1168 3300046810 Ga0495660_0019134 Ga0495660_0019134_1960_2724 236
1169 3300047317 Ga0495604_0065353 Ga0495604_0065353_1402_2166 236
1170 3300047318 Ga0495636_0139330 Ga0495636_0139330_56_820 236
1171 3300047443 Ga0495687_034450 Ga0495687_034450_1295_2059 236
1172 3300047447 Ga0495685_069886 Ga0495685_069886_171_935 236
1173 3300047470 Ga0495681_0037532 Ga0495681_0037532_106_870 236
1174 3300047472 Ga0495686_0084786 Ga0495686_0084786_1031_1795 236
1175 3300048088 Ga0495602_0077089 Ga0495602_0077089_2016_2780 236
1176 3300048913 Ga0496110_0166024 Ga0496110_0166024_848_1612 236
1177 3300048921 Ga0496118_0004078 Ga0496118_0004078_5003_5767 236
1178 3300050492 nmdc:mga0yw44_14452_c1 nmdc:mga0yw44_14452_c1_2012_2776 236
1179 3300050494 nmdc:mga06z11_97845_c1 nmdc:mga06z11_97845_c1_521_1285 236
1180 3300050516 nmdc:mga0sz30_9773_c1 nmdc:mga0sz30_9773_c1_2261_3025 236
1181 3300053077 Ga0495601_0165302 Ga0495601_0165302_629_1393 236
1182 3300053086 Ga0500578_0053825 Ga0500578_0053825_1080_1844 236
1183 3300053087 Ga0500643_011296 Ga0500643_011296_1331_2095 236
1184 3300053134 Ga0500658_0000486 Ga0500658_0000486_15545_16309 236
1185 3300053135 Ga0500659_0073849 Ga0500659_0073849_928_1692 236
1186 3300053148 Ga0500590_000124 Ga0500590_000124_11330_12094 236
1187 3300053153 Ga0500616_0003199 Ga0500616_0003199_7266_8030 236
1188 3300002705 JGI25156J39149_1000078 JGI25156J39149_100007870 237
1189 3300002738 JGI25154J39366_1000105 JGI25154J39366_100010511 237
1190 3300002741 JGI25157J39369_1000098 JGI25157J39369_100009811 237
1191 3300002773 JGI25152J39213_1000318 JGI25152J39213_100031838 237
1192 3300002774 JGI25150J39212_1000103 JGI25150J39212_100010316 237
1193 3300002774 JGI25150J39212_1000223 JGI25150J39212_10002237 237
1194 3300003187 JGI25151J46595_10000085 JGI25151J46595_1000008591 237
1195 3300003187 JGI25151J46595_10000481 JGI25151J46595_1000048152 237
1196 3300003215 JGI25153J46596_10001557 JGI25153J46596_100015575 237
1197 3300003215 JGI25153J46596_10007007 JGI25153J46596_100070074 237
1198 3300003354 JGI25160J50197_1000042 JGI25160J50197_10000424 237
1199 3300003775 Ga0055524_1002365 Ga0055524_10023658 237
1200 3300004625 Ga0055543_1000123 Ga0055543_10001234 237
1201 3300005338 Ga0068868_100016759 Ga0068868_1000167593 237
1202 3300005354 Ga0070675_100053659 Ga0070675_1000536592 237
1203 3300005355 Ga0070671_100161529 Ga0070671_1001615291 237
1204 3300005356 Ga0070674_100083437 Ga0070674_1000834372 237
1205 3300005364 Ga0070673_100166883 Ga0070673_1001668832 237
1206 3300005434 Ga0070709_10222278 Ga0070709_102222782 237
1207 3300005440 Ga0070705_100466455 Ga0070705_1004664551 237
1208 3300005455 Ga0070663_100058323 Ga0070663_1000583232 237
1209 3300005455 Ga0070663_100112169 Ga0070663_1001121692 237
1210 3300005456 Ga0070678_100052246 Ga0070678_1000522462 237
1211 3300005457 Ga0070662_100029491 Ga0070662_1000294913 237
1212 3300005535 Ga0070684_100246082 Ga0070684_1002460821 237
1213 3300005539 Ga0068853_100157987 Ga0068853_1001579872 237
1214 3300005548 Ga0070665_100060258 Ga0070665_1000602583 237
1215 3300005548 Ga0070665_100088407 Ga0070665_1000884073 237
1216 3300005548 Ga0070665_100118935 Ga0070665_1001189355 237
1217 3300005548 Ga0070665_100149826 Ga0070665_1001498262 237
1218 3300005548 Ga0070665_100490496 Ga0070665_1004904962 237
1219 3300005563 Ga0068855_100068261 Ga0068855_1000682612 237
1220 3300005564 Ga0070664_100092885 Ga0070664_1000928852 237
1221 3300005578 Ga0068854_100357008 Ga0068854_1003570081 237
1222 3300005617 Ga0068859_100026378 Ga0068859_1000263782 237
1223 3300005618 Ga0068864_100013581 Ga0068864_1000135814 237
1224 3300005719 Ga0068861_100008832 Ga0068861_1000088325 237
1225 3300005719 Ga0068861_100264312 Ga0068861_1002643122 237
1226 3300005841 Ga0068863_100218476 Ga0068863_1002184762 237
1227 3300005842 Ga0068858_100734354 Ga0068858_1007343541 237
1228 3300005843 Ga0068860_100094627 Ga0068860_1000946272 237
1229 3300006028 Ga0070717_10075006 Ga0070717_100750061 237
1230 3300006038 Ga0075365_10045745 Ga0075365_100457452 237
1231 3300006038 Ga0075365_10132740 Ga0075365_101327403 237
1232 3300006038 Ga0075365_10170912 Ga0075365_101709122 237
1233 3300006042 Ga0075368_10005890 Ga0075368_100058902 237
1234 3300006048 Ga0075363_100205310 Ga0075363_1002053102 237
1235 3300006051 Ga0075364_10000163 Ga0075364_1000016329 237
1236 3300006051 Ga0075364_10205924 Ga0075364_102059242 237
1237 3300006051 Ga0075364_10358721 Ga0075364_103587211 237
1238 3300006186 Ga0075369_10095470 Ga0075369_100954702 237
1239 3300006186 Ga0075369_10111914 Ga0075369_101119142 237
1240 3300006195 Ga0075366_10125527 Ga0075366_101255272 237
1241 3300006237 Ga0097621_100008954 Ga0097621_1000089543 237
1242 3300006847 Ga0075431_100028716 Ga0075431_1000287162 237
1243 3300006880 Ga0075429_100119094 Ga0075429_1001190943 237
1244 3300006931 Ga0097620_100026378 Ga0097620_1000263783 237
1245 3300006946 Ga0079104_1000086 Ga0079104_1000086119 237
1246 3300009098 Ga0105245_10129365 Ga0105245_101293651 237
1247 3300009101 Ga0105247_10136853 Ga0105247_101368532 237
1248 3300009174 Ga0105241_10008631 Ga0105241_100086314 237
1249 3300009177 Ga0105248_10005586 Ga0105248_100055867 237
1250 3300009545 Ga0105237_10290018 Ga0105237_102900182 237
1251 3300009545 Ga0105237_10420753 Ga0105237_104207532 237
1252 3300011119 Ga0105246_10003827 Ga0105246_100038274 237
1253 3300013306 Ga0163162_10024359 Ga0163162_100243593 237
1254 3300014969 Ga0157376_10063103 Ga0157376_100631033 237
1255 3300021321 Ga0214542_1003702 Ga0214542_100370228 237
1256 3300021327 Ga0214543_1003409 Ga0214543_10034099 237
1257 3300025206 Ga0209435_100010 Ga0209435_100010312 237
1258 3300025208 Ga0209436_100949 Ga0209436_1009495 237
1259 3300025245 Ga0207425_1000065 Ga0207425_100006588 237
1260 3300025245 Ga0207425_1000263 Ga0207425_100026351 237
1261 3300025246 Ga0209646_1000001 Ga0209646_10000011830 237
1262 3300025250 Ga0209026_1000001 Ga0209026_1000001484 237
1263 3300025254 Ga0209148_1000302 Ga0209148_10003025 237
1264 3300025256 Ga0209759_1000001 Ga0209759_10000011461 237
1265 3300025258 Ga0209129_1000132 Ga0209129_100013288 237
1266 3300025258 Ga0209129_1000350 Ga0209129_100035051 237
1267 3300025272 Ga0209455_1000986 Ga0209455_10009867 237
1268 3300025273 Ga0209673_1007944 Ga0209673_10079443 237
1269 3300025273 Ga0209673_1010504 Ga0209673_10105042 237
1270 3300025284 Ga0209130_1000075 Ga0209130_10000755 237
1271 3300025294 Ga0209025_1000247 Ga0209025_100024788 237
1272 3300025294 Ga0209025_1000603 Ga0209025_100060381 237
1273 3300025294 Ga0209025_1000996 Ga0209025_100099634 237
1274 3300025295 Ga0209564_1010318 Ga0209564_10103184 237
1275 3300025297 Ga0209758_1000212 Ga0209758_100021289 237
1276 3300025297 Ga0209758_1001278 Ga0209758_10012787 237
1277 3300025297 Ga0209758_1013138 Ga0209758_10131384 237
1278 3300025297 Ga0209758_1013694 Ga0209758_10136943 237
1279 3300025299 Ga0209256_1000175 Ga0209256_100017592 237
1280 3300025299 Ga0209256_1009511 Ga0209256_10095112 237
1281 3300025302 Ga0207426_1000163 Ga0207426_10001635 237
1282 3300025302 Ga0207426_1007406 Ga0207426_10074065 237
1283 3300025304 Ga0209257_1023815 Ga0209257_10238153 237
1284 3300025906 Ga0207699_10052109 Ga0207699_100521093 237
1285 3300025907 Ga0207645_10159361 Ga0207645_101593612 237
1286 3300025911 Ga0207654_10008524 Ga0207654_100085243 237
1287 3300025914 Ga0207671_10024472 Ga0207671_100244722 237
1288 3300025926 Ga0207659_10381238 Ga0207659_103812381 237
1289 3300025927 Ga0207687_10005665 Ga0207687_100056655 237
1290 3300025931 Ga0207644_10210718 Ga0207644_102107181 237
1291 3300025933 Ga0207706_10048925 Ga0207706_100489252 237
1292 3300025937 Ga0207669_10024754 Ga0207669_100247542 237
1293 3300025945 Ga0207679_10254620 Ga0207679_102546202 237
1294 3300026023 Ga0207677_10011073 Ga0207677_100110734 237
1295 3300026041 Ga0207639_10088753 Ga0207639_100887532 237
1296 3300026067 Ga0207678_10005398 Ga0207678_100053985 237
1297 3300026067 Ga0207678_10083708 Ga0207678_100837082 237
1298 3300026118 Ga0207675_100039144 Ga0207675_1000391443 237
1299 3300026121 Ga0207683_10008735 Ga0207683_100087354 237
1300 3300026121 Ga0207683_10102807 Ga0207683_101028073 237
1301 3300028379 Ga0268266_10004161 Ga0268266_100041617 237
1302 3300028379 Ga0268266_10025419 Ga0268266_100254196 237
1303 3300028379 Ga0268266_10061548 Ga0268266_100615482 237
1304 3300028379 Ga0268266_10147600 Ga0268266_101476002 237
1305 3300028786 Ga0307517_10136150 Ga0307517_101361501 237
1306 3300028794 Ga0307515_10000136 Ga0307515_1000013631 237
1307 3300028794 Ga0307515_10040124 Ga0307515_100401247 237
1308 3300028794 Ga0307515_10137421 Ga0307515_101374212 237
1309 3300031456 Ga0307513_10005749 Ga0307513_100057496 237
1310 3300031456 Ga0307513_10278847 Ga0307513_102788472 237
1311 3300031548 Ga0307408_100185781 Ga0307408_1001857812 237
1312 3300031731 Ga0307405_10055308 Ga0307405_100553083 237
1313 3300031995 Ga0307409_100963183 Ga0307409_1009631831 237
1314 3300033180 Ga0307510_10003141 Ga0307510_100031416 237
1315 3300035695 Ga0373927_0148667 Ga0373927_0148667_132_899 237
1316 3300041404 Ga0439436_0022618 Ga0439436_0022618_103_870 237
1317 3300041486 Ga0451807_1532728 Ga0451807_1532728_168_935 237
1318 3300046460 Ga0495638_0004790 Ga0495638_0004790_1091_1858 237
1319 3300046460 Ga0495638_0013376 Ga0495638_0013376_4621_5388 237
1320 3300046460 Ga0495638_0016087 Ga0495638_0016087_1161_1928 237
1321 3300046460 Ga0495638_0019892 Ga0495638_0019892_1925_2692 237
1322 3300046507 Ga0495606_0232012 Ga0495606_0232012_22_789 237
1323 3300046512 Ga0495610_0001529 Ga0495610_0001529_14448_15215 237
1324 3300046519 Ga0495632_0005967 Ga0495632_0005967_6484_7251 237
1325 3300046558 Ga0495633_0042165 Ga0495633_0042165_10_777 237
1326 3300046559 Ga0495667_0145153 Ga0495667_0145153_74_841 237
1327 3300046616 Ga0495668_0094347 Ga0495668_0094347_111_878 237
1328 3300046660 Ga0495625_0027749 Ga0495625_0027749_3423_4190 237
1329 3300046660 Ga0495625_0283942 Ga0495625_0283942_280_1047 237
1330 3300046691 Ga0495670_0216136 Ga0495670_0216136_94_861 237
1331 3300047444 Ga0495675_0255054 Ga0495675_0255054_273_1040 237
1332 3300048904 Ga0496101_0419381 Ga0496101_0419381_92_859 237
1333 3300048905 Ga0496102_0128750 Ga0496102_0128750_1439_2206 237
1334 3300048907 Ga0496104_0337955 Ga0496104_0337955_206_973 237
1335 3300048912 Ga0496109_0505124 Ga0496109_0505124_48_815 237
1336 3300048913 Ga0496110_0603936 Ga0496110_0603936_100_867 237
1337 3300048916 Ga0496113_0215652 Ga0496113_0215652_438_1205 237
1338 3300048919 Ga0496116_0009211 Ga0496116_0009211_3159_3926 237
1339 3300048919 Ga0496116_0160273 Ga0496116_0160273_92_859 237
1340 3300048919 Ga0496116_0162245 Ga0496116_0162245_313_1080 237
1341 3300048920 Ga0496117_0017198 Ga0496117_0017198_5243_6010 237
1342 3300048921 Ga0496118_0008608 Ga0496118_0008608_5260_6027 237
1343 3300048921 Ga0496118_0033704 Ga0496118_0033704_1818_2585 237
1344 3300048922 Ga0496119_0037363 Ga0496119_0037363_696_1463 237
1345 3300048923 Ga0496120_0180914 Ga0496120_0180914_153_920 237
1346 3300048923 Ga0496120_0238017 Ga0496120_0238017_44_811 237
1347 3300048924 Ga0496121_0018594 Ga0496121_0018594_5244_6011 237
1348 3300048924 Ga0496121_0248924 Ga0496121_0248924_103_870 237
1349 3300048925 Ga0496122_0009846 Ga0496122_0009846_7774_8541 237
1350 3300048925 Ga0496122_0052995 Ga0496122_0052995_1300_2067 237
1351 3300048925 Ga0496122_0063578 Ga0496122_0063578_122_889 237
1352 3300048926 Ga0496123_0078056 Ga0496123_0078056_121_888 237
1353 3300048926 Ga0496123_0100979 Ga0496123_0100979_634_1401 237
1354 3300048927 Ga0496124_0000254 Ga0496124_0000254_100109_100876 237
1355 3300048927 Ga0496124_0026204 Ga0496124_0026204_1306_2073 237
1356 3300048928 Ga0496125_0000101 Ga0496125_0000101_32381_33148 237
1357 3300048928 Ga0496125_0015257 Ga0496125_0015257_5369_6136 237
1358 3300048928 Ga0496125_0216956 Ga0496125_0216956_73_840 237
1359 3300048929 Ga0496126_0121496 Ga0496126_0121496_405_1172 237
1360 3300048929 Ga0496126_0155255 Ga0496126_0155255_633_1400 237
1361 3300049570 Ga0501033_0195001 Ga0501033_0195001_157_924 237
1362 3300049579 Ga0501043_0242350 Ga0501043_0242350_387_1154 237
1363 3300049581 Ga0501047_0115506 Ga0501047_0115506_815_1582 237
1364 3300049586 Ga0501070_0017965 Ga0501070_0017965_2150_2917 237
1365 3300049589 Ga0501073_0057589 Ga0501073_0057589_1575_2342 237
1366 3300049590 Ga0501074_0046189 Ga0501074_0046189_899_1666 237
1367 3300049742 Ga0501080_0113468 Ga0501080_0113468_496_1263 237
1368 3300049822 Ga0501035_0005429 Ga0501035_0005429_6778_7545 237
1369 3300049822 Ga0501035_0009467 Ga0501035_0009467_6740_7507 237
1370 3300049823 Ga0501044_0030918 Ga0501044_0030918_3181_3948 237
1371 3300050491 nmdc:mga00v17_9569_c1 nmdc:mga00v17_9569_c1_2802_3569 237
1372 3300050492 nmdc:mga0yw44_135029_c1 nmdc:mga0yw44_135029_c1_57_824 237
1373 3300050492 nmdc:mga0yw44_163822_c1 nmdc:mga0yw44_163822_c1_286_1053 237
1374 3300050495 nmdc:mga04h51_31977_c1 nmdc:mga04h51_31977_c1_190_957 237
1375 3300050508 nmdc:mga09592_112096_c1 nmdc:mga09592_112096_c1_912_1679 237
1376 3300053077 Ga0495601_0136999 Ga0495601_0136999_287_1054 237
1377 3300053084 Ga0495595_0119664 Ga0495595_0119664_158_925 237
1378 3300053085 Ga0495619_0043876 Ga0495619_0043876_546_1313 237
1379 3300053096 Ga0500641_0009976 Ga0500641_0009976_767_1534 237
1380 3300053118 Ga0500594_0006924 Ga0500594_0006924_1718_2485 237
1381 3300053119 Ga0500595_009740 Ga0500595_009740_1876_2643 237
1382 3300053125 Ga0500618_001078 Ga0500618_001078_10170_10937 237
1383 3300053153 Ga0500616_0000094 Ga0500616_0000094_31894_32661 237
1384 3300053727 Ga0500611_017532 Ga0500611_017532_470_1237 237
1385 3300060353 Ga0501082_0582473 Ga0501082_0582473_201_968 237
1386 iso_pu_bacteria 2515154122 2515680483 237
1387 3300003323 rootH1_10013159 rootH1_100131598 238
1388 3300004625 Ga0055543_1001548 Ga0055543_10015486 238
1389 3300005578 Ga0068854_100479637 Ga0068854_1004796371 238
1390 3300005616 Ga0068852_100216615 Ga0068852_1002166152 238
1391 3300005844 Ga0068862_100082809 Ga0068862_1000828094 238
1392 3300005937 Ga0081455_10413796 Ga0081455_104137961 238
1393 3300006237 Ga0097621_100235015 Ga0097621_1002350152 238
1394 3300009093 Ga0105240_10000805 Ga0105240_1000080522 238
1395 3300009545 Ga0105237_10002236 Ga0105237_1000223610 238
1396 3300010375 Ga0105239_10000952 Ga0105239_1000095218 238
1397 3300025294 Ga0209025_1047278 Ga0209025_10472783 238
1398 3300025302 Ga0207426_1000285 Ga0207426_100028547 238
1399 3300025913 Ga0207695_10010120 Ga0207695_100101203 238
1400 3300025914 Ga0207671_10002957 Ga0207671_100029577 238
1401 3300026142 Ga0207698_10098968 Ga0207698_100989682 238
1402 3300031456 Ga0307513_10422899 Ga0307513_104228991 238
1403 3300037068 Ga0373925_0628844 Ga0373925_0628844_35_805 238
1404 3300046452 Ga0495617_010437 Ga0495617_010437_1231_2004 238
1405 3300046460 Ga0495638_0000163 Ga0495638_0000163_96682_97455 238
1406 3300046474 Ga0495605_0037800 Ga0495605_0037800_20_793 238
1407 3300046506 Ga0495583_0004011 Ga0495583_0004011_4163_4936 238
1408 3300046506 Ga0495583_0032865 Ga0495583_0032865_819_1592 238
1409 3300046512 Ga0495610_0085183 Ga0495610_0085183_64_861 238
1410 3300046513 Ga0495616_0016322 Ga0495616_0016322_2897_3670 238
1411 3300046513 Ga0495616_0023527 Ga0495616_0023527_2478_3251 238
1412 3300046515 Ga0495620_0015518 Ga0495620_0015518_2301_3074 238
1413 3300046518 Ga0495631_0004695 Ga0495631_0004695_6322_7095 238
1414 3300046519 Ga0495632_0047523 Ga0495632_0047523_453_1268 238
1415 3300046519 Ga0495632_0205384 Ga0495632_0205384_58_831 238
1416 3300046530 Ga0495654_0113790 Ga0495654_0113790_71_844 238
1417 3300046616 Ga0495668_0010371 Ga0495668_0010371_3325_4140 238
1418 3300046616 Ga0495668_0039097 Ga0495668_0039097_1203_1976 238
1419 3300046648 Ga0495611_0042804 Ga0495611_0042804_118_891 238
1420 3300046648 Ga0495611_0155919 Ga0495611_0155919_24_797 238
1421 3300046660 Ga0495625_0003905 Ga0495625_0003905_11261_12034 238
1422 3300046660 Ga0495625_0031718 Ga0495625_0031718_1653_2426 238
1423 3300046675 Ga0495657_0036996 Ga0495657_0036996_1578_2369 238
1424 3300046809 Ga0495600_0025386 Ga0495600_0025386_1697_2488 238
1425 3300046810 Ga0495660_0124616 Ga0495660_0124616_359_1174 238
1426 3300046810 Ga0495660_0143079 Ga0495660_0143079_92_862 238
1427 3300047317 Ga0495604_0014117 Ga0495604_0014117_715_1485 238
1428 3300047320 Ga0495672_0013154 Ga0495672_0013154_3721_4494 238
1429 3300047323 Ga0495683_0089086 Ga0495683_0089086_394_1167 238
1430 3300047443 Ga0495687_005208 Ga0495687_005208_6571_7344 238
1431 3300048913 Ga0496110_0388877 Ga0496110_0388877_97_867 238
1432 3300048924 Ga0496121_0003840 Ga0496121_0003840_18179_18994 238
1433 3300048928 Ga0496125_0000692 Ga0496125_0000692_5240_6010 238
1434 3300048928 Ga0496125_0005881 Ga0496125_0005881_2671_3441 238
1435 3300048929 Ga0496126_0016806 Ga0496126_0016806_170_940 238
1436 3300049459 Ga0495678_066936 Ga0495678_066936_94_867 238
1437 3300049568 Ga0501031_0330206 Ga0501031_0330206_130_900 238
1438 3300049570 Ga0501033_0060283 Ga0501033_0060283_2006_2776 238
1439 3300049571 Ga0501034_0512905 Ga0501034_0512905_105_875 238
1440 3300049572 Ga0501036_0043555 Ga0501036_0043555_962_1732 238
1441 3300049574 Ga0501038_0135794 Ga0501038_0135794_491_1261 238
1442 3300049575 Ga0501039_0455757 Ga0501039_0455757_151_921 238
1443 3300049586 Ga0501070_0054954 Ga0501070_0054954_675_1445 238
1444 3300049822 Ga0501035_0532923 Ga0501035_0532923_41_811 238
1445 3300049823 Ga0501044_0286245 Ga0501044_0286245_110_880 238
1446 3300053079 Ga0500610_0053619 Ga0500610_0053619_673_1446 238
1447 3300053085 Ga0495619_0066957 Ga0495619_0066957_1365_2156 238
1448 3300053134 Ga0500658_0069685 Ga0500658_0069685_602_1375 238
1449 3300053139 Ga0500568_0000587 Ga0500568_0000587_5896_6669 238
1450 3300053142 Ga0500577_0042717 Ga0500577_0042717_30_803 238
1451 3300053151 Ga0500604_0066999 Ga0500604_0066999_117_887 238
1452 3300053153 Ga0500616_0001233 Ga0500616_0001233_19004_19777 238
1453 3300053158 Ga0500627_0034904 Ga0500627_0034904_1220_2035 238
1454 3300053177 Ga0500636_0093545 Ga0500636_0093545_807_1577 238
1455 3300053727 Ga0500611_001114 Ga0500611_001114_1370_2140 238
1456 iso_pu_bacteria 2582581298 2585222091 238
1457 iso_pu_bacteria 2582581867 2585404165 238
1458 iso_pu_bacteria 2585427529 2585544956 238
1459 iso_pu_bacteria 2585427590 2585820669 238
1460 iso_pu_bacteria 2919171160 2919176573 238
1461 3300002067 JGI24735J21928_10000407 JGI24735J21928_1000040714 239
1462 3300003354 JGI25160J50197_1027272 JGI25160J50197_10272722 239
1463 3300005535 Ga0070684_100068103 Ga0070684_1000681032 239
1464 3300005548 Ga0070665_100106701 Ga0070665_1001067013 239
1465 3300005937 Ga0081455_10161595 Ga0081455_101615952 239
1466 3300005983 Ga0081540_1043689 Ga0081540_10436892 239
1467 3300006178 Ga0075367_10026904 Ga0075367_100269042 239
1468 3300009011 Ga0105251_10001562 Ga0105251_100015623 239
1469 3300009093 Ga0105240_10550112 Ga0105240_105501122 239
1470 3300009177 Ga0105248_10342177 Ga0105248_103421773 239
1471 3300009551 Ga0105238_10006455 Ga0105238_1000645512 239
1472 3300025302 Ga0207426_1003057 Ga0207426_10030576 239
1473 3300025735 Ga0207713_1008595 Ga0207713_10085955 239
1474 3300025904 Ga0207647_10010687 Ga0207647_100106874 239
1475 3300025912 Ga0207707_10126352 Ga0207707_101263523 239
1476 3300025921 Ga0207652_10245167 Ga0207652_102451671 239
1477 3300026067 Ga0207678_10269217 Ga0207678_102692173 239
1478 3300026121 Ga0207683_10599713 Ga0207683_105997131 239
1479 3300032004 Ga0307414_10309009 Ga0307414_103090092 239
1480 3300037853 Ga0436364_0166030 Ga0436364_0166030_36_842 239
1481 3300037853 Ga0436364_0569494 Ga0436364_0569494_299_1075 239
1482 3300045049 Ga0466959_0060121 Ga0466959_0060121_799_1644 239
1483 3300046455 Ga0495603_0007832 Ga0495603_0007832_4267_5046 239
1484 3300046455 Ga0495603_0022026 Ga0495603_0022026_1235_2008 239
1485 3300046457 Ga0495590_0003083 Ga0495590_0003083_1435_2208 239
1486 3300046457 Ga0495590_0071797 Ga0495590_0071797_98_877 239
1487 3300046491 Ga0495584_0005808 Ga0495584_0005808_1355_2128 239
1488 3300046501 Ga0495607_0003436 Ga0495607_0003436_4947_5720 239
1489 3300046501 Ga0495607_0025977 Ga0495607_0025977_140_913 239
1490 3300046507 Ga0495606_0000587 Ga0495606_0000587_41276_42049 239
1491 3300046507 Ga0495606_0002496 Ga0495606_0002496_4953_5729 239
1492 3300046513 Ga0495616_0071258 Ga0495616_0071258_355_1134 239
1493 3300046519 Ga0495632_0071159 Ga0495632_0071159_338_1117 239
1494 3300046520 Ga0495637_0005721 Ga0495637_0005721_1581_2354 239
1495 3300046520 Ga0495637_0018620 Ga0495637_0018620_1623_2396 239
1496 3300046524 Ga0495648_0068506 Ga0495648_0068506_349_1128 239
1497 3300046542 Ga0495597_0011209 Ga0495597_0011209_1093_1866 239
1498 3300046648 Ga0495611_0085902 Ga0495611_0085902_471_1250 239
1499 3300046660 Ga0495625_0126032 Ga0495625_0126032_127_906 239
1500 3300046665 Ga0495661_0060919 Ga0495661_0060919_169_942 239
1501 3300046694 Ga0495649_0001088 Ga0495649_0001088_6493_7266 239
1502 3300046794 Ga0495589_0139562 Ga0495589_0139562_46_825 239
1503 3300047321 Ga0495676_0064476 Ga0495676_0064476_1972_2745 239
1504 3300047323 Ga0495683_0000019 Ga0495683_0000019_47766_48539 239
1505 3300047470 Ga0495681_0012798 Ga0495681_0012798_2273_3046 239
1506 3300048908 Ga0496105_0043416 Ga0496105_0043416_982_1755 239
1507 3300048910 Ga0496107_0056883 Ga0496107_0056883_1267_2043 239
1508 3300048924 Ga0496121_0000615 Ga0496121_0000615_59707_60495 239
1509 3300048924 Ga0496121_0015935 Ga0496121_0015935_1097_1885 239
1510 3300048927 Ga0496124_0233676 Ga0496124_0233676_108_896 239
1511 3300048928 Ga0496125_0012374 Ga0496125_0012374_6416_7189 239
1512 3300048929 Ga0496126_0011352 Ga0496126_0011352_8227_9006 239
1513 3300049579 Ga0501043_0352806 Ga0501043_0352806_214_993 239
1514 3300049581 Ga0501047_0413634 Ga0501047_0413634_247_1026 239
1515 3300049586 Ga0501070_0140247 Ga0501070_0140247_13_792 239
1516 3300049671 Ga0501238_016681 Ga0501238_016681_137_925 239
1517 3300049744 Ga0501083_0111763 Ga0501083_0111763_887_1666 239
1518 3300049822 Ga0501035_0161442 Ga0501035_0161442_116_895 239
1519 3300049823 Ga0501044_0231637 Ga0501044_0231637_865_1644 239
1520 3300050489 nmdc:mga03683_91543_c1 nmdc:mga03683_91543_c1_407_1195 239
1521 3300050491 nmdc:mga00v17_14_c1 nmdc:mga00v17_14_c1_51442_52230 239
1522 3300050492 nmdc:mga0yw44_155595_c1 nmdc:mga0yw44_155595_c1_243_1016 239
1523 3300050493 nmdc:mga0k408_14833_c1 nmdc:mga0k408_14833_c1_339_1112 239
1524 3300053125 Ga0500618_001226 Ga0500618_001226_2887_3660 239
1525 3300053140 Ga0500573_0003975 Ga0500573_0003975_993_1787 239
1526 3300053730 Ga0500645_028297 Ga0500645_028297_329_1108 239
1527 iso_pu_bacteria 2513237351 2514586389 239
1528 iso_pu_bacteria 2885312484 2885318050 239
1529 iso_pu_bacteria 8056673599 8056676791 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

26

208

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

32

255

0.95

PF08659

KR

KR domain

27

197

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yxf-assembly1.cif.gz_B mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis 0.9536 49 235
5u9p-assembly1.cif.gz_C crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate 0.9531 4 239
5gwr-assembly1.cif.gz_D 4-hydroxyisoleucine dehydrogenase complexed with nadh 0.9426 50 237
4ixw-assembly1.cif.gz_B halohydrin dehalogenase (hhec) bound to ethyl (2s)-oxiran-2-ylacetate 0.9407 59 234
1pwz-assembly1.cif.gz_A crystal structure of the haloalcohol dehalogenase hhec complexed with (r)-styrene oxide and chloride 0.9404 59 233
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9649 70 235 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9612 80 179 3.40.50.720
4yxfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9536 49 235 3.40.50.720
5u9pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9529 4 239 3.40.50.720
af_Q21929_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9456 26 236 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4D4L5B6-F1-model_v4 Gluconate 5-dehydrogenase 0.9744 45 239 GO:0016491
AF-A0A847N440-F1-model_v4 SDR family oxidoreductase 0.9734 56 237 GO:0016491
AF-A0A351Z7X1-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9702 51 237 GO:0016616
AF-A0A3D2PK39-F1-model_v4 deleted 0.9702 62 239
AF-X1X1W7-F1-model_v4 deleted 0.9678 35 239

Feature Viewer

pLDDT pTM Quality
93.63 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map