F494586
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1529 | 984 | 893 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300003794|Ga0055531_10001262|Ga0055531_100012628 |
| Length | 287 |
| Sequence | MVTDTQHQLGERVLSKGIELFDLSGKRALITGSSQGIGLSLAKGLAAAGAEIVLNGRDRGRATVRTLLFDATDVRAVRAAIDGFEQSTGPIDILVNNAGMQHRAPLEEFDPDMFELLMRTNVSSAFNVGQAVARHMIARGRGKIINIASIQTALARPGIAPYTASKGALGNLTKGMATDWARHGLAVNAIAPGYFDTPLNAALVADAEFSRWIERRTPAGRWGRLEELTGACIFLASDASSYVNGHILYVDGGMSACLXXPSDTGFAAFCAPPRIRVPXGLRPPPAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 3 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 20 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 21 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 22 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 23 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 24 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 25 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 26 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 27 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 28 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 29 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 30 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 31 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 32 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 33 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 34 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 35 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 36 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 37 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 38 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 39 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 40 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 41 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 42 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 43 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 44 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 45 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 46 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 47 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 48 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 49 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 50 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 51 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 52 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 53 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 54 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 55 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 56 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 57 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 58 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 59 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 60 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 61 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 62 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 63 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 64 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 65 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 66 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 67 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 68 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 69 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 70 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 71 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 72 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 73 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 74 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 75 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 76 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 77 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 78 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 79 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 80 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 81 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 82 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 83 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 84 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 85 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 86 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 87 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 88 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 89 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 90 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 91 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 92 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 93 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 94 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 95 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 96 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 97 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 98 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 99 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 100 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 101 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 102 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 103 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 104 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 105 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 106 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 107 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 108 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 109 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 110 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 111 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 112 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 113 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 114 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 115 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 116 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 117 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 118 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 119 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 120 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 121 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 122 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 123 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 124 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 125 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 126 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 127 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 128 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 129 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 130 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 131 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 132 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 133 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 134 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 135 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 136 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 137 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 138 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 139 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 140 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 141 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 142 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 143 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 144 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 145 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 146 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 147 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 148 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 149 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 150 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 151 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 152 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 153 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 154 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 155 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 156 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 157 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 158 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 159 | 2791355199 | |||
| 160 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 161 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 162 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 163 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 164 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 165 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 166 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 167 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 168 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 169 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 170 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 171 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 172 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 173 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 174 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 175 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 176 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 177 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 178 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 179 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 180 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 181 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 182 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 183 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 184 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 185 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 186 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 187 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 188 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 189 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 190 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 191 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 192 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 193 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 194 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 195 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 196 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 197 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 198 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 199 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 200 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 201 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 202 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 203 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 204 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 205 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 206 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 207 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 208 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 209 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 210 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 211 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 212 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 213 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 214 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 215 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 216 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 217 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 218 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 219 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 220 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 221 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 222 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 223 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 224 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 225 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 226 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 227 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 228 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 229 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 230 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 231 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 232 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 233 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 234 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 235 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 236 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 237 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 238 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 239 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 240 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 241 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 242 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 243 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 244 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 245 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 246 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 247 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 248 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 249 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 250 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 251 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 252 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 253 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 254 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 255 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 256 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 257 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 258 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 259 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 260 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 261 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 262 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 263 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 264 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 265 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 266 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 267 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 268 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 269 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 270 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 271 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 272 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 273 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 274 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 275 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 276 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 277 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 278 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 279 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 280 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 281 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 282 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 283 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 284 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 285 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 286 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 287 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 288 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 289 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 290 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 291 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 292 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 293 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 294 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 295 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 296 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 297 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 298 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 299 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 300 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 301 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 302 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 303 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 304 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 305 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 306 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 307 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 308 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 309 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 310 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 311 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 312 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 313 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 314 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 315 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 316 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 317 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 318 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 319 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 320 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 321 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 322 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 323 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 324 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 325 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 326 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 327 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 328 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 329 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 330 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 331 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 332 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 333 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 334 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 335 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 336 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 337 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 338 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 339 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 340 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 341 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 342 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 343 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 344 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 345 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 346 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 347 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 348 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 349 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 350 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 351 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 352 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 353 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 354 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 355 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 356 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 357 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 358 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 359 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 360 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 361 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 362 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 363 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 364 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 365 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 366 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 367 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 368 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 369 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 370 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 371 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 372 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 373 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 374 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 375 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 376 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 377 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 378 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 379 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 380 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 381 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 382 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 383 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 384 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 385 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 386 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 387 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 388 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 389 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 390 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 391 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 392 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 393 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 394 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 395 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 396 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 397 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 398 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 399 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 400 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 401 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 402 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 403 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 404 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 405 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 406 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 407 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 408 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 409 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 410 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 411 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 412 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 413 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 414 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 415 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 416 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 417 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 418 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 419 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 420 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 421 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 422 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 423 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 424 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 425 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 426 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 427 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 428 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 429 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 430 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 431 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 432 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 433 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 434 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 435 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 436 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 437 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 438 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 439 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 440 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 441 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 442 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 443 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 444 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 445 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 446 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 447 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 448 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 449 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 450 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 451 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 452 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 453 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 454 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 455 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 456 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 457 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 458 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 459 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 460 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 461 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 462 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 463 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 464 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 465 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 466 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 467 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 468 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 469 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 470 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 471 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 472 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 473 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 474 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 475 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 476 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 477 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 478 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 479 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 480 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 481 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 482 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 483 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 484 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 485 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 486 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 487 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 488 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 489 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 490 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 491 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 492 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 493 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 494 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 495 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 496 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 497 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 498 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 499 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 500 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 501 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 502 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 503 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 504 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 505 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 506 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 507 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 508 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 509 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 510 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 511 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 512 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 513 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 514 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 515 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 516 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 517 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 518 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 519 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 520 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 521 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 522 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 523 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 524 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 525 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 526 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 527 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 528 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 529 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 530 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 531 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 532 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 533 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 534 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 535 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 536 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 537 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 538 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 539 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 540 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 541 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 542 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 543 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 544 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 545 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 546 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 547 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 548 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 549 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 550 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 551 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 552 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 553 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 554 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 555 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 556 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 557 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 558 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 559 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 560 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 561 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 562 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 563 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 564 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 565 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 566 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 567 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 568 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 569 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 570 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 571 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 572 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 573 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 574 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 575 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 576 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 577 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 578 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 579 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 580 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 581 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 582 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 583 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 584 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 585 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 586 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 587 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 588 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 589 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 590 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 591 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 592 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 593 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 594 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 595 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 596 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 597 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 598 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 600 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 601 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 602 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 603 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 604 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 606 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 607 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 608 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 609 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 611 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 612 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 613 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 614 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 615 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 616 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 617 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 618 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 619 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 620 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 621 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 622 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 623 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 624 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 625 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 626 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 627 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 628 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 629 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 630 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 631 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 632 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 633 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 634 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 635 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 636 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 637 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 638 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 639 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 640 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 641 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 642 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 643 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 644 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 645 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 646 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 647 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 648 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 649 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 650 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 651 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 652 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 653 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 654 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 655 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 656 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 657 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 658 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 659 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 660 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 661 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 662 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 663 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 665 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 666 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 667 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 668 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 669 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 670 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 671 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 672 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 673 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 674 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 675 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 676 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 677 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 678 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 679 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 680 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 681 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 682 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 683 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 684 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 685 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 686 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 687 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 688 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 689 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 690 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 691 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 692 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 693 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 694 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 695 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 696 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 697 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 698 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 699 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 700 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 702 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 703 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 704 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 705 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 706 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 707 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 708 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 709 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 710 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 711 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 712 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 713 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 714 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 715 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 716 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 717 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 718 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 719 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 720 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 721 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 722 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 723 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 724 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 725 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 726 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 727 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 728 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 729 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 730 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 731 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 732 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 733 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 734 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 735 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 736 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 737 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 738 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 739 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 740 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 741 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 742 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 743 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 744 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 745 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 746 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 747 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 748 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 749 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 750 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 751 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 752 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 753 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 754 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 755 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 756 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 757 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 758 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 759 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 760 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 761 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 762 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 763 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 764 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 765 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 766 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 767 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 768 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 769 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 770 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 771 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 772 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 773 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 774 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 775 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 776 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 777 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 808 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 809 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 814 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 815 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 816 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 817 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 819 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 820 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 821 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 822 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 823 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 824 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 825 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 826 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 827 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 828 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 829 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 830 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 831 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 832 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 833 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 834 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 835 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 836 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 837 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 838 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 839 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 840 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 841 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 842 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 843 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 844 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 845 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 846 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 847 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 848 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 849 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 850 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 851 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 852 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 853 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 854 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 855 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 856 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 857 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 858 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 859 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 860 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 861 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 862 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 863 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 864 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 865 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 866 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 867 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 868 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 869 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 870 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 871 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 872 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 873 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 874 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 875 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 876 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 877 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 878 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 879 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 880 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 881 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 882 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 883 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 884 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 885 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 886 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 887 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 888 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 889 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 890 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 891 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 892 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 893 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 894 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 895 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 896 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 897 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 899 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 900 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 901 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 902 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 903 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 904 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 905 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 906 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 907 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 908 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 909 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 910 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 911 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 912 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 913 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 914 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 915 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 916 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 917 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 918 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 919 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 920 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 921 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 922 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 923 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 924 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 925 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 926 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 927 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 928 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 929 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 930 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 931 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 932 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 933 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 934 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 935 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 936 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 937 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 938 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 939 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 940 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 941 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 942 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 943 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 944 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 945 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 946 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 947 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 948 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 949 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 950 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 951 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 952 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 953 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 954 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 955 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 956 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 957 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 958 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 959 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 960 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 961 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 962 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 963 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 964 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 965 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 966 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 967 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 968 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 969 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 970 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 971 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 972 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 973 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 974 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 975 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 976 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 977 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 978 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 979 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 980 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 981 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 982 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 983 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 984 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 58.57 |
| Metatranscriptomes | 0 |
| Isolates | 41.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 14.19 |
| Nodule | 32.5 |
| Rhizoplane | 2.75 |
| Rhizosphere | 35.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10000407 | 3300002067 | Bacteria | 15061 |
| 2 | JGI25155J39150_1000047 | 3300002704 | Bacteria | 80068 |
| 3 | JGI25156J39149_1000069 | 3300002705 | Bacteria | 81255 |
| 4 | JGI25156J39149_1000078 | 3300002705 | Bacteria | 74254 |
| 5 | JGI25162J39368_1000184 | 3300002737 | Bacteria | 67069 |
| 6 | JGI25162J39368_1001511 | 3300002737 | Bacteria | 12072 |
| 7 | JGI25154J39366_1000091 | 3300002738 | Bacteria | 80948 |
| 8 | JGI25154J39366_1000105 | 3300002738 | Bacteria | 74254 |
| 9 | JGI25157J39369_1000085 | 3300002741 | Bacteria | 81255 |
| 10 | JGI25157J39369_1000098 | 3300002741 | Bacteria | 74254 |
| 11 | JGI25152J39213_1000318 | 3300002773 | Bacteria | 31015 |
| 12 | JGI25152J39213_1020291 | 3300002773 | Bacteria | 1189 |
| 13 | JGI25150J39212_1000103 | 3300002774 | Bacteria | 49029 |
| 14 | JGI25150J39212_1000223 | 3300002774 | Bacteria | 31015 |
| 15 | JGI25151J46595_10000085 | 3300003187 | Bacteria | 127212 |
| 16 | JGI25151J46595_10000337 | 3300003187 | Bacteria | 50281 |
| 17 | JGI25151J46595_10000442 | 3300003187 | Bacteria | 40576 |
| 18 | JGI25151J46595_10000481 | 3300003187 | Bacteria | 37750 |
| 19 | JGI25406J46586_10046501 | 3300003203 | Bacteria | 1486 |
| 20 | JGI25406J46586_10067921 | 3300003203 | Bacteria | 1127 |
| 21 | JGI25165J46597_1000163 | 3300003214 | Bacteria | 104693 |
| 22 | JGI25165J46597_1000505 | 3300003214 | Bacteria | 37462 |
| 23 | JGI25165J46597_1004580 | 3300003214 | Bacteria | 2917 |
| 24 | JGI25153J46596_10001557 | 3300003215 | Bacteria | 13610 |
| 25 | JGI25153J46596_10001705 | 3300003215 | Bacteria | 13039 |
| 26 | JGI25153J46596_10002607 | 3300003215 | Bacteria | 10314 |
| 27 | JGI25153J46596_10007007 | 3300003215 | Bacteria | 5612 |
| 28 | JGI25153J46596_10016829 | 3300003215 | Bacteria | 2910 |
| 29 | JGI25153J46596_10047318 | 3300003215 | Bacteria | 1266 |
| 30 | rootL2_10000436 | 3300003322 | Bacteria | 30353 |
| 31 | rootL2_10229133 | 3300003322 | Bacteria | 2342 |
| 32 | rootH1_10013159 | 3300003323 | Bacteria | 10352 |
| 33 | rootH1_10020411 | 3300003323 | Bacteria | 3603 |
| 34 | rootH1_10130821 | 3300003323 | Bacteria | 2490 |
| 35 | rootH1_10233468 | 3300003323 | Bacteria | 1282 |
| 36 | JGI25160J50197_1000040 | 3300003354 | Bacteria | 154507 |
| 37 | JGI25160J50197_1000042 | 3300003354 | Bacteria | 149808 |
| 38 | JGI25160J50197_1002870 | 3300003354 | Bacteria | 7886 |
| 39 | JGI25160J50197_1027272 | 3300003354 | Bacteria | 1558 |
| 40 | JGI25161J50226_1000023 | 3300003374 | Bacteria | 154507 |
| 41 | JGI25161J50226_1002292 | 3300003374 | Bacteria | 4998 |
| 42 | Ga0055526_1001366 | 3300003771 | Bacteria | 17474 |
| 43 | Ga0055526_1002425 | 3300003771 | Bacteria | 12630 |
| 44 | Ga0055526_1005586 | 3300003771 | Bacteria | 7168 |
| 45 | Ga0055526_1054777 | 3300003771 | Bacteria | 884 |
| 46 | Ga0055524_1001200 | 3300003775 | Bacteria | 15379 |
| 47 | Ga0055524_1002365 | 3300003775 | Bacteria | 9812 |
| 48 | Ga0055524_1006515 | 3300003775 | Bacteria | 5055 |
| 49 | Ga0055524_1018578 | 3300003775 | Bacteria | 2409 |
| 50 | Ga0055524_1033400 | 3300003775 | Bacteria | 1441 |
| 51 | Ga0055528_1000684 | 3300003790 | Bacteria | 24218 |
| 52 | Ga0055528_1001834 | 3300003790 | Bacteria | 12128 |
| 53 | Ga0055528_1001856 | 3300003790 | Bacteria | 12030 |
| 54 | Ga0055528_1032308 | 3300003790 | Bacteria | 1339 |
| 55 | Ga0055528_1040001 | 3300003790 | Bacteria | 1063 |
| 56 | Ga0055540_1000066 | 3300003792 | Bacteria | 122947 |
| 57 | Ga0055540_1003244 | 3300003792 | Bacteria | 7973 |
| 58 | Ga0055540_1004899 | 3300003792 | Bacteria | 5846 |
| 59 | Ga0055540_1008406 | 3300003792 | Bacteria | 3723 |
| 60 | Ga0055540_1013560 | 3300003792 | Bacteria | 2483 |
| 61 | Ga0055531_10001262 | 3300003794 | Bacteria | 19144 |
| 62 | Ga0058692_1001181 | 3300003856 | Bacteria | 10020 |
| 63 | Ga0058692_1001802 | 3300003856 | Bacteria | 7558 |
| 64 | Ga0055543_1000123 | 3300004625 | Bacteria | 64977 |
| 65 | Ga0055543_1001035 | 3300004625 | Bacteria | 12362 |
| 66 | Ga0055543_1001548 | 3300004625 | Bacteria | 8926 |
| 67 | Ga0055543_1001620 | 3300004625 | Bacteria | 8595 |
| 68 | Ga0065165_1000484 | 3300005262 | Bacteria | 61542 |
| 69 | Ga0065165_1010245 | 3300005262 | Bacteria | 4082 |
| 70 | Ga0070658_10177806 | 3300005327 | Bacteria | 1790 |
| 71 | Ga0070676_10279281 | 3300005328 | Bacteria | 1125 |
| 72 | Ga0070683_100134214 | 3300005329 | Bacteria | 2343 |
| 73 | Ga0070670_100023690 | 3300005331 | Bacteria | 5284 |
| 74 | Ga0070670_100218563 | 3300005331 | Bacteria | 1658 |
| 75 | Ga0070677_10013535 | 3300005333 | Bacteria | 2855 |
| 76 | Ga0070666_10133810 | 3300005335 | Bacteria | 1724 |
| 77 | Ga0068868_100016759 | 3300005338 | Bacteria | 5448 |
| 78 | Ga0070689_100064391 | 3300005340 | Bacteria | 2853 |
| 79 | Ga0070675_100052192 | 3300005354 | Bacteria | 3361 |
| 80 | Ga0070675_100053659 | 3300005354 | Bacteria | 3316 |
| 81 | Ga0070671_100043262 | 3300005355 | Bacteria | 3743 |
| 82 | Ga0070671_100161529 | 3300005355 | Bacteria | 1894 |
| 83 | Ga0070674_100002557 | 3300005356 | Bacteria | 10071 |
| 84 | Ga0070674_100083437 | 3300005356 | Bacteria | 2289 |
| 85 | Ga0070674_100266129 | 3300005356 | Bacteria | 1353 |
| 86 | Ga0070673_100133648 | 3300005364 | Bacteria | 2085 |
| 87 | Ga0070673_100166883 | 3300005364 | Bacteria | 1876 |
| 88 | Ga0070688_100171018 | 3300005365 | Bacteria | 1500 |
| 89 | Ga0070688_100269308 | 3300005365 | Bacteria | 1220 |
| 90 | Ga0070659_100611932 | 3300005366 | Bacteria | 937 |
| 91 | Ga0070709_10222278 | 3300005434 | Bacteria | 1347 |
| 92 | Ga0070713_100395117 | 3300005436 | Bacteria | 1290 |
| 93 | Ga0070711_100097584 | 3300005439 | Bacteria | 2131 |
| 94 | Ga0070705_100466455 | 3300005440 | Bacteria | 951 |
| 95 | Ga0070663_100058323 | 3300005455 | Bacteria | 2772 |
| 96 | Ga0070663_100112169 | 3300005455 | Bacteria | 2050 |
| 97 | Ga0070678_100012048 | 3300005456 | Bacteria | 5359 |
| 98 | Ga0070678_100052246 | 3300005456 | Bacteria | 2966 |
| 99 | Ga0070662_100029491 | 3300005457 | Bacteria | 3829 |
| 100 | Ga0068867_100160797 | 3300005459 | Bacteria | 1771 |
| 101 | Ga0070684_100068103 | 3300005535 | Bacteria | 3128 |
| 102 | Ga0070684_100246082 | 3300005535 | Bacteria | 1634 |
| 103 | Ga0068853_100157987 | 3300005539 | Bacteria | 2044 |
| 104 | Ga0068853_100572991 | 3300005539 | Bacteria | 1071 |
| 105 | Ga0070672_100051962 | 3300005543 | Bacteria | 3198 |
| 106 | Ga0070686_100089375 | 3300005544 | Bacteria | 2058 |
| 107 | Ga0070693_100129750 | 3300005547 | Bacteria | 1574 |
| 108 | Ga0070665_100060258 | 3300005548 | Bacteria | 3804 |
| 109 | Ga0070665_100088407 | 3300005548 | Bacteria | 3104 |
| 110 | Ga0070665_100106701 | 3300005548 | Bacteria | 2803 |
| 111 | Ga0070665_100114284 | 3300005548 | Bacteria | 2702 |
| 112 | Ga0070665_100118935 | 3300005548 | Bacteria | 2644 |
| 113 | Ga0070665_100149826 | 3300005548 | Bacteria | 2336 |
| 114 | Ga0070665_100490496 | 3300005548 | Bacteria | 1239 |
| 115 | Ga0070665_100557771 | 3300005548 | Bacteria | 1158 |
| 116 | Ga0068855_100068261 | 3300005563 | Bacteria | 4139 |
| 117 | Ga0068855_100535566 | 3300005563 | Bacteria | 1269 |
| 118 | Ga0070664_100092885 | 3300005564 | Bacteria | 2614 |
| 119 | Ga0068857_100167948 | 3300005577 | Bacteria | 1993 |
| 120 | Ga0068854_100232482 | 3300005578 | Bacteria | 1464 |
| 121 | Ga0068854_100357008 | 3300005578 | Bacteria | 1198 |
| 122 | Ga0068854_100479637 | 3300005578 | Bacteria | 1044 |
| 123 | Ga0068856_100034675 | 3300005614 | Bacteria | 4943 |
| 124 | Ga0068856_100290762 | 3300005614 | Bacteria | 1651 |
| 125 | Ga0068852_100018103 | 3300005616 | Bacteria | 5543 |
| 126 | Ga0068852_100096814 | 3300005616 | Bacteria | 2653 |
| 127 | Ga0068852_100216615 | 3300005616 | Bacteria | 1819 |
| 128 | Ga0068859_100026378 | 3300005617 | Bacteria | 5826 |
| 129 | Ga0068859_100113037 | 3300005617 | Bacteria | 2779 |
| 130 | Ga0068864_100013581 | 3300005618 | Bacteria | 6750 |
| 131 | Ga0068864_100102635 | 3300005618 | Bacteria | 2538 |
| 132 | Ga0068866_10031507 | 3300005718 | Bacteria | 2555 |
| 133 | Ga0068861_100008832 | 3300005719 | Bacteria | 6943 |
| 134 | Ga0068861_100264312 | 3300005719 | Bacteria | 1474 |
| 135 | Ga0068863_100218476 | 3300005841 | Bacteria | 1836 |
| 136 | Ga0068858_100734354 | 3300005842 | Bacteria | 961 |
| 137 | Ga0068860_100094627 | 3300005843 | Bacteria | 2847 |
| 138 | Ga0068860_100575769 | 3300005843 | Bacteria | 1130 |
| 139 | Ga0068862_100082809 | 3300005844 | Bacteria | 2785 |
| 140 | Ga0081455_10161595 | 3300005937 | Bacteria | 1716 |
| 141 | Ga0081455_10413796 | 3300005937 | Bacteria | 932 |
| 142 | Ga0081540_1003572 | 3300005983 | Bacteria | 12223 |
| 143 | Ga0081540_1043689 | 3300005983 | Bacteria | 2295 |
| 144 | Ga0081539_10002462 | 3300005985 | Bacteria | 26092 |
| 145 | Ga0081539_10003922 | 3300005985 | Bacteria | 17277 |
| 146 | Ga0070717_10075006 | 3300006028 | Bacteria | 2828 |
| 147 | Ga0075365_10001142 | 3300006038 | Bacteria | 11631 |
| 148 | Ga0075365_10045745 | 3300006038 | Bacteria | 2872 |
| 149 | Ga0075365_10132740 | 3300006038 | Bacteria | 1724 |
| 150 | Ga0075365_10170912 | 3300006038 | Bacteria | 1517 |
| 151 | Ga0075368_10005890 | 3300006042 | Bacteria | 4244 |
| 152 | Ga0075363_100025077 | 3300006048 | Bacteria | 3037 |
| 153 | Ga0075363_100067595 | 3300006048 | Bacteria | 1937 |
| 154 | Ga0075363_100075634 | 3300006048 | Bacteria | 1835 |
| 155 | Ga0075363_100205310 | 3300006048 | Bacteria | 1127 |
| 156 | Ga0075363_100356798 | 3300006048 | Bacteria | 854 |
| 157 | Ga0075364_10000163 | 3300006051 | Bacteria | 29585 |
| 158 | Ga0075364_10003707 | 3300006051 | Bacteria | 8720 |
| 159 | Ga0075364_10157254 | 3300006051 | Bacteria | 1533 |
| 160 | Ga0075364_10205924 | 3300006051 | Bacteria | 1334 |
| 161 | Ga0075364_10358721 | 3300006051 | Bacteria | 994 |
| 162 | Ga0070712_100019610 | 3300006175 | Bacteria | 4414 |
| 163 | Ga0075367_10009766 | 3300006178 | Bacteria | 5026 |
| 164 | Ga0075367_10022280 | 3300006178 | Bacteria | 3551 |
| 165 | Ga0075367_10026904 | 3300006178 | Bacteria | 3267 |
| 166 | Ga0075367_10114506 | 3300006178 | Bacteria | 1658 |
| 167 | Ga0075369_10002248 | 3300006186 | Bacteria | 6849 |
| 168 | Ga0075369_10009890 | 3300006186 | Bacteria | 3719 |
| 169 | Ga0075369_10018083 | 3300006186 | Bacteria | 2867 |
| 170 | Ga0075369_10095470 | 3300006186 | Bacteria | 1330 |
| 171 | Ga0075369_10111914 | 3300006186 | Bacteria | 1231 |
| 172 | Ga0075366_10000625 | 3300006195 | Bacteria | 16631 |
| 173 | Ga0075366_10034805 | 3300006195 | Bacteria | 2968 |
| 174 | Ga0075366_10125527 | 3300006195 | Bacteria | 1548 |
| 175 | Ga0075366_10236868 | 3300006195 | Bacteria | 1112 |
| 176 | Ga0097621_100008954 | 3300006237 | Bacteria | 7240 |
| 177 | Ga0097621_100235015 | 3300006237 | Bacteria | 1601 |
| 178 | Ga0075370_10008891 | 3300006353 | Bacteria | 5188 |
| 179 | Ga0075370_10018822 | 3300006353 | Bacteria | 3750 |
| 180 | Ga0075370_10075573 | 3300006353 | Bacteria | 1931 |
| 181 | Ga0068871_100383618 | 3300006358 | Bacteria | 1249 |
| 182 | Ga0075428_100131340 | 3300006844 | Bacteria | 2724 |
| 183 | Ga0075431_100028716 | 3300006847 | Bacteria | 5719 |
| 184 | Ga0075429_100119094 | 3300006880 | Bacteria | 2307 |
| 185 | Ga0097620_100026378 | 3300006931 | Bacteria | 5826 |
| 186 | Ga0097620_100113037 | 3300006931 | Bacteria | 2779 |
| 187 | Ga0079104_1000086 | 3300006946 | Bacteria | 136260 |
| 188 | Ga0079104_1018423 | 3300006946 | Bacteria | 1977 |
| 189 | Ga0099826_10003912 | 3300006948 | Bacteria | 10289 |
| 190 | Ga0099826_10005440 | 3300006948 | Bacteria | 9133 |
| 191 | Ga0099826_10164118 | 3300006948 | Bacteria | 1255 |
| 192 | Ga0105251_10001562 | 3300009011 | Bacteria | 19609 |
| 193 | Ga0105240_10000214 | 3300009093 | Bacteria | 117038 |
| 194 | Ga0105240_10000805 | 3300009093 | Bacteria | 56899 |
| 195 | Ga0105240_10006510 | 3300009093 | Bacteria | 17157 |
| 196 | Ga0105240_10550112 | 3300009093 | Bacteria | 1277 |
| 197 | Ga0105240_11115568 | 3300009093 | Bacteria | 839 |
| 198 | Ga0111539_10089994 | 3300009094 | Bacteria | 3607 |
| 199 | Ga0105245_10011711 | 3300009098 | Bacteria | 7633 |
| 200 | Ga0105245_10129365 | 3300009098 | Bacteria | 2367 |
| 201 | Ga0105245_10213355 | 3300009098 | Bacteria | 1859 |
| 202 | Ga0105247_10136853 | 3300009101 | Bacteria | 1601 |
| 203 | Ga0105243_10024296 | 3300009148 | Bacteria | 4622 |
| 204 | Ga0105243_10173480 | 3300009148 | Bacteria | 1870 |
| 205 | Ga0105241_10008631 | 3300009174 | Bacteria | 7489 |
| 206 | Ga0105248_10005586 | 3300009177 | Bacteria | 13824 |
| 207 | Ga0105248_10342177 | 3300009177 | Bacteria | 1684 |
| 208 | Ga0105237_10001263 | 3300009545 | Bacteria | 33774 |
| 209 | Ga0105237_10002236 | 3300009545 | Bacteria | 24170 |
| 210 | Ga0105237_10034873 | 3300009545 | Bacteria | 5092 |
| 211 | Ga0105237_10113948 | 3300009545 | Bacteria | 2696 |
| 212 | Ga0105237_10290018 | 3300009545 | Bacteria | 1639 |
| 213 | Ga0105237_10420753 | 3300009545 | Bacteria | 1341 |
| 214 | Ga0105238_10006455 | 3300009551 | Bacteria | 11662 |
| 215 | Ga0105238_10036176 | 3300009551 | Bacteria | 5018 |
| 216 | Ga0105238_10263197 | 3300009551 | Bacteria | 1704 |
| 217 | Ga0123341_1000005 | 3300009765 | Bacteria | 150422 |
| 218 | Ga0105239_10000952 | 3300010375 | Bacteria | 40803 |
| 219 | Ga0105239_10025522 | 3300010375 | Bacteria | 6505 |
| 220 | Ga0105239_10042797 | 3300010375 | Bacteria | 4962 |
| 221 | Ga0105239_11120350 | 3300010375 | Bacteria | 906 |
| 222 | Ga0105246_10003827 | 3300011119 | Bacteria | 9123 |
| 223 | Ga0105246_10432763 | 3300011119 | Bacteria | 1101 |
| 224 | Ga0157322_1002570 | 3300012490 | Bacteria | 1036 |
| 225 | Ga0157371_10000219 | 3300013102 | Bacteria | 83847 |
| 226 | Ga0157370_10002266 | 3300013104 | Bacteria | 23363 |
| 227 | Ga0157370_10060520 | 3300013104 | Bacteria | 3595 |
| 228 | Ga0157369_10048441 | 3300013105 | Bacteria | 4612 |
| 229 | Ga0157374_10159332 | 3300013296 | Bacteria | 2198 |
| 230 | Ga0157378_10047353 | 3300013297 | Bacteria | 3823 |
| 231 | Ga0163162_10024359 | 3300013306 | Bacteria | 5971 |
| 232 | Ga0157375_10357964 | 3300013308 | Bacteria | 1625 |
| 233 | Ga0157375_10649497 | 3300013308 | Bacteria | 1211 |
| 234 | Ga0163163_10373201 | 3300014325 | Bacteria | 1484 |
| 235 | Ga0157377_10344917 | 3300014745 | Bacteria | 997 |
| 236 | Ga0157376_10063103 | 3300014969 | Bacteria | 3120 |
| 237 | Ga0182007_10002152 | 3300015262 | Bacteria | 10020 |
| 238 | Ga0182005_1022000 | 3300015265 | Bacteria | 1747 |
| 239 | Ga0163161_10089613 | 3300017792 | Bacteria | 2275 |
| 240 | Ga0214544_1000018 | 3300021320 | Bacteria | 187095 |
| 241 | Ga0214542_1000081 | 3300021321 | Bacteria | 121242 |
| 242 | Ga0214542_1003702 | 3300021321 | Bacteria | 30842 |
| 243 | Ga0214542_1019910 | 3300021321 | Bacteria | 5110 |
| 244 | Ga0214543_1000005 | 3300021327 | Bacteria | 454523 |
| 245 | Ga0214543_1000042 | 3300021327 | Bacteria | 164433 |
| 246 | Ga0214543_1003409 | 3300021327 | Bacteria | 30837 |
| 247 | Ga0213876_10017486 | 3300021384 | Bacteria | 3786 |
| 248 | Ga0228711_1030140 | 3300022739 | Bacteria | 2864 |
| 249 | Ga0228710_1017381 | 3300022740 | Bacteria | 7177 |
| 250 | Ga0228710_1021493 | 3300022740 | Bacteria | 5197 |
| 251 | Ga0228710_1022699 | 3300022740 | Bacteria | 4759 |
| 252 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 253 | Ga0209435_100058 | 3300025206 | Bacteria | 81307 |
| 254 | Ga0209436_100949 | 3300025208 | Bacteria | 11425 |
| 255 | Ga0209437_100095 | 3300025233 | Bacteria | 236997 |
| 256 | Ga0209437_100239 | 3300025233 | Bacteria | 89942 |
| 257 | Ga0207425_1000065 | 3300025245 | Bacteria | 127264 |
| 258 | Ga0207425_1000263 | 3300025245 | Bacteria | 38917 |
| 259 | Ga0207425_1003396 | 3300025245 | Bacteria | 5111 |
| 260 | Ga0207425_1003978 | 3300025245 | Bacteria | 4547 |
| 261 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 262 | Ga0209646_1000178 | 3300025246 | Bacteria | 81307 |
| 263 | Ga0209646_1005995 | 3300025246 | Bacteria | 2071 |
| 264 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 265 | Ga0209026_1000208 | 3300025250 | Bacteria | 81307 |
| 266 | Ga0209677_100248 | 3300025253 | Bacteria | 36912 |
| 267 | Ga0209148_1000302 | 3300025254 | Bacteria | 70861 |
| 268 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 269 | Ga0209759_1000242 | 3300025256 | Bacteria | 81307 |
| 270 | Ga0209129_1000132 | 3300025258 | Bacteria | 127262 |
| 271 | Ga0209129_1000305 | 3300025258 | Bacteria | 44613 |
| 272 | Ga0209129_1000350 | 3300025258 | Bacteria | 38917 |
| 273 | Ga0209129_1000852 | 3300025258 | Bacteria | 19125 |
| 274 | Ga0209233_1000117 | 3300025261 | Bacteria | 236984 |
| 275 | Ga0209233_1000245 | 3300025261 | Bacteria | 89961 |
| 276 | Ga0209233_1000340 | 3300025261 | Bacteria | 45824 |
| 277 | Ga0209455_1000986 | 3300025272 | Bacteria | 14388 |
| 278 | Ga0209673_1000020 | 3300025273 | Bacteria | 430653 |
| 279 | Ga0209673_1000433 | 3300025273 | Bacteria | 72554 |
| 280 | Ga0209673_1001173 | 3300025273 | Bacteria | 28378 |
| 281 | Ga0209673_1002509 | 3300025273 | Bacteria | 12617 |
| 282 | Ga0209673_1007944 | 3300025273 | Bacteria | 4791 |
| 283 | Ga0209673_1010504 | 3300025273 | Bacteria | 3898 |
| 284 | Ga0209673_1021485 | 3300025273 | Bacteria | 2255 |
| 285 | Ga0209130_1000075 | 3300025284 | Bacteria | 171698 |
| 286 | Ga0209130_1000142 | 3300025284 | Bacteria | 114724 |
| 287 | Ga0209130_1016079 | 3300025284 | Bacteria | 1822 |
| 288 | Ga0209675_1022469 | 3300025291 | Bacteria | 1656 |
| 289 | Ga0209676_1065061 | 3300025292 | Bacteria | 889 |
| 290 | Ga0209025_1000081 | 3300025294 | Bacteria | 265899 |
| 291 | Ga0209025_1000247 | 3300025294 | Bacteria | 127264 |
| 292 | Ga0209025_1000603 | 3300025294 | Bacteria | 64824 |
| 293 | Ga0209025_1000996 | 3300025294 | Bacteria | 41994 |
| 294 | Ga0209025_1047278 | 3300025294 | Bacteria | 1759 |
| 295 | Ga0209564_1000114 | 3300025295 | Bacteria | 209934 |
| 296 | Ga0209564_1000722 | 3300025295 | Bacteria | 47441 |
| 297 | Ga0209564_1001882 | 3300025295 | Bacteria | 18900 |
| 298 | Ga0209564_1010318 | 3300025295 | Bacteria | 4322 |
| 299 | Ga0209564_1013756 | 3300025295 | Bacteria | 3411 |
| 300 | Ga0209758_1000076 | 3300025297 | Bacteria | 270615 |
| 301 | Ga0209758_1000130 | 3300025297 | Bacteria | 184456 |
| 302 | Ga0209758_1000212 | 3300025297 | Bacteria | 127597 |
| 303 | Ga0209758_1001278 | 3300025297 | Bacteria | 31046 |
| 304 | Ga0209758_1004022 | 3300025297 | Bacteria | 12682 |
| 305 | Ga0209758_1005376 | 3300025297 | Bacteria | 9915 |
| 306 | Ga0209758_1008129 | 3300025297 | Bacteria | 6897 |
| 307 | Ga0209758_1013138 | 3300025297 | Bacteria | 4549 |
| 308 | Ga0209758_1013694 | 3300025297 | Bacteria | 4394 |
| 309 | Ga0209256_1000123 | 3300025299 | Bacteria | 165547 |
| 310 | Ga0209256_1000175 | 3300025299 | Bacteria | 127671 |
| 311 | Ga0209256_1001407 | 3300025299 | Bacteria | 25000 |
| 312 | Ga0209256_1007753 | 3300025299 | Bacteria | 5194 |
| 313 | Ga0209256_1009511 | 3300025299 | Bacteria | 4249 |
| 314 | Ga0209256_1016219 | 3300025299 | Bacteria | 2554 |
| 315 | Ga0207426_1000076 | 3300025302 | Bacteria | 320851 |
| 316 | Ga0207426_1000163 | 3300025302 | Bacteria | 171698 |
| 317 | Ga0207426_1000169 | 3300025302 | Bacteria | 164859 |
| 318 | Ga0207426_1000285 | 3300025302 | Bacteria | 102879 |
| 319 | Ga0207426_1003057 | 3300025302 | Bacteria | 9636 |
| 320 | Ga0207426_1007406 | 3300025302 | Bacteria | 4602 |
| 321 | Ga0209051_1000038 | 3300025303 | Bacteria | 320926 |
| 322 | Ga0209051_1001529 | 3300025303 | Bacteria | 19259 |
| 323 | Ga0209051_1004437 | 3300025303 | Bacteria | 8646 |
| 324 | Ga0209051_1018859 | 3300025303 | Bacteria | 3036 |
| 325 | Ga0209051_1028520 | 3300025303 | Bacteria | 2203 |
| 326 | Ga0209257_1008419 | 3300025304 | Bacteria | 5871 |
| 327 | Ga0209257_1023815 | 3300025304 | Bacteria | 2138 |
| 328 | Ga0207713_1008595 | 3300025735 | Bacteria | 5854 |
| 329 | Ga0207682_10002344 | 3300025893 | Bacteria | 8541 |
| 330 | Ga0207688_10358253 | 3300025901 | Bacteria | 900 |
| 331 | Ga0207680_10111345 | 3300025903 | Bacteria | 1776 |
| 332 | Ga0207680_10168458 | 3300025903 | Bacteria | 1474 |
| 333 | Ga0207647_10010687 | 3300025904 | Bacteria | 6469 |
| 334 | Ga0207699_10036981 | 3300025906 | Bacteria | 2786 |
| 335 | Ga0207699_10052109 | 3300025906 | Bacteria | 2421 |
| 336 | Ga0207645_10159361 | 3300025907 | Bacteria | 1476 |
| 337 | Ga0207643_10138773 | 3300025908 | Bacteria | 1451 |
| 338 | Ga0207705_10164807 | 3300025909 | Bacteria | 1666 |
| 339 | Ga0207654_10008524 | 3300025911 | Bacteria | 5189 |
| 340 | Ga0207654_10038596 | 3300025911 | Bacteria | 2681 |
| 341 | Ga0207707_10126352 | 3300025912 | Bacteria | 2236 |
| 342 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 343 | Ga0207695_10000373 | 3300025913 | Bacteria | 101687 |
| 344 | Ga0207695_10010120 | 3300025913 | Bacteria | 11574 |
| 345 | Ga0207695_10596650 | 3300025913 | Bacteria | 985 |
| 346 | Ga0207671_10000536 | 3300025914 | Bacteria | 51271 |
| 347 | Ga0207671_10002957 | 3300025914 | Bacteria | 17487 |
| 348 | Ga0207671_10024472 | 3300025914 | Bacteria | 4540 |
| 349 | Ga0207671_10313655 | 3300025914 | Bacteria | 1240 |
| 350 | Ga0207693_10030293 | 3300025915 | Bacteria | 4273 |
| 351 | Ga0207662_10061301 | 3300025918 | Bacteria | 2258 |
| 352 | Ga0207652_10245167 | 3300025921 | Bacteria | 1615 |
| 353 | Ga0207694_10280625 | 3300025924 | Bacteria | 1368 |
| 354 | Ga0207650_10015477 | 3300025925 | Bacteria | 5313 |
| 355 | Ga0207650_10252327 | 3300025925 | Bacteria | 1428 |
| 356 | Ga0207659_10381238 | 3300025926 | Bacteria | 1176 |
| 357 | Ga0207687_10005665 | 3300025927 | Bacteria | 8253 |
| 358 | Ga0207687_10251689 | 3300025927 | Bacteria | 1405 |
| 359 | Ga0207700_10205169 | 3300025928 | Bacteria | 1663 |
| 360 | Ga0207644_10210718 | 3300025931 | Bacteria | 1536 |
| 361 | Ga0207644_10236585 | 3300025931 | Bacteria | 1453 |
| 362 | Ga0207706_10048925 | 3300025933 | Bacteria | 3738 |
| 363 | Ga0207709_10016371 | 3300025935 | Bacteria | 4121 |
| 364 | Ga0207709_10155966 | 3300025935 | Bacteria | 1587 |
| 365 | Ga0207670_10165741 | 3300025936 | Bacteria | 1653 |
| 366 | Ga0207669_10007097 | 3300025937 | Bacteria | 5157 |
| 367 | Ga0207669_10024754 | 3300025937 | Bacteria | 3232 |
| 368 | Ga0207669_10128743 | 3300025937 | Bacteria | 1735 |
| 369 | Ga0207691_10032439 | 3300025940 | Bacteria | 4868 |
| 370 | Ga0207689_10237554 | 3300025942 | Bacteria | 1506 |
| 371 | Ga0207661_10616618 | 3300025944 | Bacteria | 996 |
| 372 | Ga0207679_10254620 | 3300025945 | Bacteria | 1494 |
| 373 | Ga0207667_10689577 | 3300025949 | Bacteria | 1024 |
| 374 | Ga0207640_10428823 | 3300025981 | Bacteria | 1084 |
| 375 | Ga0207640_10830322 | 3300025981 | Bacteria | 803 |
| 376 | Ga0207677_10011073 | 3300026023 | Bacteria | 5126 |
| 377 | Ga0207677_10752342 | 3300026023 | Bacteria | 869 |
| 378 | Ga0207639_10088753 | 3300026041 | Bacteria | 2468 |
| 379 | Ga0207639_10540986 | 3300026041 | Bacteria | 1068 |
| 380 | Ga0207678_10005398 | 3300026067 | Bacteria | 11452 |
| 381 | Ga0207678_10083708 | 3300026067 | Bacteria | 2729 |
| 382 | Ga0207678_10269217 | 3300026067 | Bacteria | 1461 |
| 383 | Ga0207708_10615201 | 3300026075 | Bacteria | 921 |
| 384 | Ga0207702_10824140 | 3300026078 | Bacteria | 918 |
| 385 | Ga0207648_10003173 | 3300026089 | Bacteria | 17320 |
| 386 | Ga0207676_10010301 | 3300026095 | Bacteria | 6655 |
| 387 | Ga0207674_10101536 | 3300026116 | Bacteria | 2857 |
| 388 | Ga0207675_100039144 | 3300026118 | Bacteria | 4425 |
| 389 | Ga0207683_10008735 | 3300026121 | Bacteria | 8650 |
| 390 | Ga0207683_10094456 | 3300026121 | Bacteria | 2665 |
| 391 | Ga0207683_10102807 | 3300026121 | Bacteria | 2552 |
| 392 | Ga0207683_10599713 | 3300026121 | Bacteria | 1019 |
| 393 | Ga0207698_10094138 | 3300026142 | Bacteria | 2462 |
| 394 | Ga0207698_10098968 | 3300026142 | Bacteria | 2411 |
| 395 | Ga0209281_1000920 | 3300027111 | Bacteria | 24429 |
| 396 | Ga0209281_1005534 | 3300027111 | Bacteria | 3490 |
| 397 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 398 | Ga0209371_1001218 | 3300027312 | Bacteria | 18553 |
| 399 | Ga0209371_1006004 | 3300027312 | Bacteria | 4640 |
| 400 | Ga0209282_1000230 | 3300027666 | Bacteria | 28914 |
| 401 | Ga0209282_1056745 | 3300027666 | Bacteria | 2207 |
| 402 | Ga0209282_1061294 | 3300027666 | Bacteria | 2095 |
| 403 | Ga0209813_10015067 | 3300027866 | Bacteria | 2089 |
| 404 | Ga0207428_10112287 | 3300027907 | Bacteria | 2096 |
| 405 | Ga0268266_10004161 | 3300028379 | Bacteria | 13950 |
| 406 | Ga0268266_10025419 | 3300028379 | Bacteria | 5038 |
| 407 | Ga0268266_10061548 | 3300028379 | Bacteria | 3237 |
| 408 | Ga0268266_10087731 | 3300028379 | Bacteria | 2722 |
| 409 | Ga0268266_10147600 | 3300028379 | Bacteria | 2116 |
| 410 | Ga0268265_10497480 | 3300028380 | Bacteria | 1148 |
| 411 | Ga0268264_10918964 | 3300028381 | Bacteria | 879 |
| 412 | Ga0265319_1003086 | 3300028563 | Bacteria | 8810 |
| 413 | Ga0265334_10007422 | 3300028573 | Bacteria | 4702 |
| 414 | Ga0265318_10007706 | 3300028577 | Bacteria | 4846 |
| 415 | Ga0265318_10042860 | 3300028577 | Bacteria | 1716 |
| 416 | Ga0265323_10002112 | 3300028653 | Bacteria | 9280 |
| 417 | Ga0265336_10000380 | 3300028666 | Bacteria | 28330 |
| 418 | Ga0307517_10136150 | 3300028786 | Bacteria | 1746 |
| 419 | Ga0307515_10000136 | 3300028794 | Bacteria | 174265 |
| 420 | Ga0307515_10040124 | 3300028794 | Bacteria | 7413 |
| 421 | Ga0307515_10137421 | 3300028794 | Bacteria | 2646 |
| 422 | Ga0265338_10000024 | 3300028800 | Bacteria | 297778 |
| 423 | Ga0265324_10001715 | 3300029957 | Bacteria | 12057 |
| 424 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 425 | Ga0268256_1003362 | 3300030500 | Bacteria | 7263 |
| 426 | Ga0268256_1006002 | 3300030500 | Bacteria | 4631 |
| 427 | Ga0316181_1155915 | 3300030744 | Bacteria | 2193 |
| 428 | Ga0265330_10080351 | 3300031235 | Bacteria | 1405 |
| 429 | Ga0265320_10069558 | 3300031240 | Bacteria | 1661 |
| 430 | Ga0265329_10040216 | 3300031242 | Bacteria | 1500 |
| 431 | Ga0265340_10146663 | 3300031247 | Bacteria | 1077 |
| 432 | Ga0265316_10162139 | 3300031344 | Bacteria | 1671 |
| 433 | Ga0307513_10005749 | 3300031456 | Bacteria | 16317 |
| 434 | Ga0307513_10185244 | 3300031456 | Bacteria | 1940 |
| 435 | Ga0307513_10216888 | 3300031456 | Bacteria | 1739 |
| 436 | Ga0307513_10278847 | 3300031456 | Bacteria | 1450 |
| 437 | Ga0307513_10422899 | 3300031456 | Bacteria | 1062 |
| 438 | Ga0307509_10065476 | 3300031507 | Bacteria | 3815 |
| 439 | Ga0307408_100185781 | 3300031548 | Bacteria | 1671 |
| 440 | Ga0265313_10005060 | 3300031595 | Bacteria | 9824 |
| 441 | Ga0307508_10126581 | 3300031616 | Bacteria | 2157 |
| 442 | Ga0307508_10285224 | 3300031616 | Bacteria | 1245 |
| 443 | Ga0265314_10022794 | 3300031711 | Bacteria | 4792 |
| 444 | Ga0265342_10013991 | 3300031712 | Bacteria | 5345 |
| 445 | Ga0265342_10040204 | 3300031712 | Bacteria | 2837 |
| 446 | Ga0316576_10061783 | 3300031727 | Bacteria | 2746 |
| 447 | Ga0307516_10002345 | 3300031730 | Bacteria | 25420 |
| 448 | Ga0307516_10052706 | 3300031730 | Bacteria | 3981 |
| 449 | Ga0307405_10045830 | 3300031731 | Bacteria | 2682 |
| 450 | Ga0307405_10055308 | 3300031731 | Bacteria | 2483 |
| 451 | Ga0307405_10125562 | 3300031731 | Bacteria | 1764 |
| 452 | Ga0315914_1016454 | 3300031967 | Bacteria | 7240 |
| 453 | Ga0315914_1036005 | 3300031967 | Bacteria | 1995 |
| 454 | Ga0307409_100963183 | 3300031995 | Bacteria | 870 |
| 455 | Ga0307414_10309009 | 3300032004 | Bacteria | 1341 |
| 456 | Ga0307510_10003141 | 3300033180 | Bacteria | 19142 |
| 457 | Ga0315913_1013022 | 3300033430 | Bacteria | 9141 |
| 458 | Ga0315913_1029943 | 3300033430 | Bacteria | 3930 |
| 459 | Ga0315915_1000368 | 3300033464 | Bacteria | 44095 |
| 460 | Ga0315915_1021320 | 3300033464 | Bacteria | 5269 |
| 461 | Ga0373958_0015886 | 3300034819 | Bacteria | 1336 |
| 462 | Ga0373939_0045701 | 3300035114 | Bacteria | 1338 |
| 463 | Ga0373953_0195012 | 3300035117 | Bacteria | 875 |
| 464 | Ga0373931_0258265 | 3300035691 | Bacteria | 1062 |
| 465 | Ga0373927_0000586 | 3300035695 | Bacteria | 27726 |
| 466 | Ga0373927_0000835 | 3300035695 | Bacteria | 23617 |
| 467 | Ga0373927_0148667 | 3300035695 | Bacteria | 1534 |
| 468 | Ga0373947_0028775 | 3300035725 | Bacteria | 3259 |
| 469 | Ga0373925_0002089 | 3300037068 | Bacteria | 16413 |
| 470 | Ga0373925_0260398 | 3300037068 | Bacteria | 1393 |
| 471 | Ga0373925_0628844 | 3300037068 | Bacteria | 884 |
| 472 | Ga0436364_0053771 | 3300037853 | Bacteria | 1104 |
| 473 | Ga0436364_0166030 | 3300037853 | Bacteria | 1168 |
| 474 | Ga0436364_0569494 | 3300037853 | Bacteria | 1170 |
| 475 | Ga0400483_277886 | 3300039062 | Bacteria | 8296 |
| 476 | Ga0400483_284574 | 3300039062 | Bacteria | 1773 |
| 477 | Ga0436365_0110753 | 3300039437 | Bacteria | 4434 |
| 478 | Ga0436365_0173076 | 3300039437 | Bacteria | 9946 |
| 479 | Ga0436365_1627531 | 3300039437 | Bacteria | 1361 |
| 480 | Ga0436363_1341968 | 3300039450 | Bacteria | 801 |
| 481 | Ga0439436_0022618 | 3300041404 | Bacteria | 1862 |
| 482 | Ga0439466_0082958 | 3300041411 | Bacteria | 1010 |
| 483 | Ga0439465_0014474 | 3300041413 | Bacteria | 2458 |
| 484 | Ga0439465_0102753 | 3300041413 | Bacteria | 988 |
| 485 | Ga0451793_1613516 | 3300041452 | Bacteria | 1042 |
| 486 | Ga0451807_1532728 | 3300041486 | Bacteria | 1083 |
| 487 | Ga0451833_0571278 | 3300041491 | Bacteria | 1254 |
| 488 | Ga0451835_0341194 | 3300041492 | Bacteria | 3083 |
| 489 | Ga0451839_0553209 | 3300041496 | Bacteria | 1535 |
| 490 | Ga0451847_0247730 | 3300041503 | Bacteria | 2122 |
| 491 | Ga0451849_0247574 | 3300041505 | Bacteria | 1131 |
| 492 | Ga0451851_1205047 | 3300041507 | Bacteria | 3460 |
| 493 | Ga0451855_1407221 | 3300041511 | Bacteria | 1068 |
| 494 | Ga0451855_1443745 | 3300041511 | Bacteria | 2364 |
| 495 | Ga0439449_0055506 | 3300042007 | Bacteria | 1463 |
| 496 | Ga0466963_0005475 | 3300044694 | Bacteria | 7434 |
| 497 | Ga0466963_0063382 | 3300044694 | Bacteria | 2474 |
| 498 | Ga0466963_0250738 | 3300044694 | Bacteria | 1242 |
| 499 | Ga0466970_0000198 | 3300044765 | Bacteria | 29185 |
| 500 | Ga0466957_0065990 | 3300044842 | Bacteria | 2230 |
| 501 | Ga0466957_0125938 | 3300044842 | Bacteria | 1637 |
| 502 | Ga0466959_0060121 | 3300045049 | Bacteria | 2765 |
| 503 | Ga0451576_0215639 | 3300045051 | Bacteria | 2004 |
| 504 | Ga0466958_0073454 | 3300045836 | Bacteria | 2095 |
| 505 | Ga0466958_0155327 | 3300045836 | Bacteria | 1444 |
| 506 | Ga0466967_0082659 | 3300045976 | Bacteria | 2903 |
| 507 | Ga0466967_0082967 | 3300045976 | Bacteria | 2898 |
| 508 | Ga0466967_0762071 | 3300045976 | Bacteria | 960 |
| 509 | Ga0495617_010437 | 3300046452 | Bacteria | 3182 |
| 510 | Ga0495617_040889 | 3300046452 | Bacteria | 1550 |
| 511 | Ga0495603_0007832 | 3300046455 | Bacteria | 6441 |
| 512 | Ga0495603_0022026 | 3300046455 | Bacteria | 3859 |
| 513 | Ga0495590_0003083 | 3300046457 | Bacteria | 6820 |
| 514 | Ga0495590_0071797 | 3300046457 | Bacteria | 1215 |
| 515 | Ga0495638_0000163 | 3300046460 | Bacteria | 103363 |
| 516 | Ga0495638_0004790 | 3300046460 | Bacteria | 10202 |
| 517 | Ga0495638_0013376 | 3300046460 | Bacteria | 5588 |
| 518 | Ga0495638_0016087 | 3300046460 | Bacteria | 5013 |
| 519 | Ga0495638_0019892 | 3300046460 | Bacteria | 4439 |
| 520 | Ga0495638_0067375 | 3300046460 | Bacteria | 2198 |
| 521 | Ga0495605_0037800 | 3300046474 | Bacteria | 2425 |
| 522 | Ga0495662_0001363 | 3300046476 | Bacteria | 12078 |
| 523 | Ga0495664_0010526 | 3300046477 | Bacteria | 5192 |
| 524 | Ga0495664_0112455 | 3300046477 | Bacteria | 1644 |
| 525 | Ga0495584_0005808 | 3300046491 | Bacteria | 6505 |
| 526 | Ga0495585_0025689 | 3300046492 | Bacteria | 3370 |
| 527 | Ga0495585_0036386 | 3300046492 | Bacteria | 2777 |
| 528 | Ga0495585_0165717 | 3300046492 | Bacteria | 1144 |
| 529 | Ga0495607_0003436 | 3300046501 | Bacteria | 12123 |
| 530 | Ga0495607_0025977 | 3300046501 | Bacteria | 3637 |
| 531 | Ga0495583_0001051 | 3300046506 | Bacteria | 31052 |
| 532 | Ga0495583_0004011 | 3300046506 | Bacteria | 10852 |
| 533 | Ga0495583_0032865 | 3300046506 | Bacteria | 2501 |
| 534 | Ga0495606_0000587 | 3300046507 | Bacteria | 57743 |
| 535 | Ga0495606_0002496 | 3300046507 | Bacteria | 21251 |
| 536 | Ga0495606_0008984 | 3300046507 | Bacteria | 8549 |
| 537 | Ga0495606_0060068 | 3300046507 | Bacteria | 2436 |
| 538 | Ga0495606_0232012 | 3300046507 | Bacteria | 1034 |
| 539 | Ga0495610_0001529 | 3300046512 | Bacteria | 20383 |
| 540 | Ga0495610_0052509 | 3300046512 | Bacteria | 1978 |
| 541 | Ga0495610_0085183 | 3300046512 | Bacteria | 1443 |
| 542 | Ga0495616_0016322 | 3300046513 | Bacteria | 4114 |
| 543 | Ga0495616_0023527 | 3300046513 | Bacteria | 3313 |
| 544 | Ga0495616_0071258 | 3300046513 | Bacteria | 1681 |
| 545 | Ga0495616_0132125 | 3300046513 | Bacteria | 1143 |
| 546 | Ga0495620_0005142 | 3300046515 | Bacteria | 7321 |
| 547 | Ga0495620_0010070 | 3300046515 | Bacteria | 4998 |
| 548 | Ga0495620_0015518 | 3300046515 | Bacteria | 3843 |
| 549 | Ga0495628_0301490 | 3300046516 | Bacteria | 1186 |
| 550 | Ga0495631_0004695 | 3300046518 | Bacteria | 7223 |
| 551 | Ga0495631_0030541 | 3300046518 | Bacteria | 2444 |
| 552 | Ga0495631_0106583 | 3300046518 | Bacteria | 1205 |
| 553 | Ga0495632_0005967 | 3300046519 | Bacteria | 7934 |
| 554 | Ga0495632_0047523 | 3300046519 | Bacteria | 2128 |
| 555 | Ga0495632_0053803 | 3300046519 | Bacteria | 1975 |
| 556 | Ga0495632_0071159 | 3300046519 | Bacteria | 1671 |
| 557 | Ga0495632_0205384 | 3300046519 | Bacteria | 895 |
| 558 | Ga0495637_0005721 | 3300046520 | Bacteria | 6301 |
| 559 | Ga0495637_0018620 | 3300046520 | Bacteria | 3219 |
| 560 | Ga0495643_0006217 | 3300046522 | Bacteria | 7921 |
| 561 | Ga0495643_0007516 | 3300046522 | Bacteria | 7010 |
| 562 | Ga0495643_0127844 | 3300046522 | Bacteria | 1278 |
| 563 | Ga0495648_0023237 | 3300046524 | Bacteria | 4251 |
| 564 | Ga0495648_0033138 | 3300046524 | Bacteria | 3379 |
| 565 | Ga0495648_0068506 | 3300046524 | Bacteria | 2070 |
| 566 | Ga0495654_0113790 | 3300046530 | Bacteria | 1232 |
| 567 | Ga0495609_0086015 | 3300046538 | Bacteria | 1371 |
| 568 | Ga0495621_0002234 | 3300046539 | Bacteria | 5178 |
| 569 | Ga0495597_0011209 | 3300046542 | Bacteria | 4349 |
| 570 | Ga0495597_0023590 | 3300046542 | Bacteria | 2845 |
| 571 | Ga0495622_0014155 | 3300046557 | Bacteria | 3703 |
| 572 | Ga0495633_0028246 | 3300046558 | Bacteria | 2736 |
| 573 | Ga0495633_0042165 | 3300046558 | Bacteria | 2169 |
| 574 | Ga0495633_0065690 | 3300046558 | Bacteria | 1695 |
| 575 | Ga0495633_0206685 | 3300046558 | Bacteria | 900 |
| 576 | Ga0495667_0145153 | 3300046559 | Bacteria | 1529 |
| 577 | Ga0495668_0010371 | 3300046616 | Bacteria | 5639 |
| 578 | Ga0495668_0039097 | 3300046616 | Bacteria | 2649 |
| 579 | Ga0495668_0094347 | 3300046616 | Bacteria | 1638 |
| 580 | Ga0495668_0127022 | 3300046616 | Bacteria | 1396 |
| 581 | Ga0495634_0060986 | 3300046642 | Bacteria | 2509 |
| 582 | Ga0495611_0025199 | 3300046648 | Bacteria | 2591 |
| 583 | Ga0495611_0042804 | 3300046648 | Bacteria | 2023 |
| 584 | Ga0495611_0085902 | 3300046648 | Bacteria | 1451 |
| 585 | Ga0495611_0155919 | 3300046648 | Bacteria | 1066 |
| 586 | Ga0495625_0003905 | 3300046660 | Bacteria | 14369 |
| 587 | Ga0495625_0016210 | 3300046660 | Bacteria | 5871 |
| 588 | Ga0495625_0027749 | 3300046660 | Bacteria | 4255 |
| 589 | Ga0495625_0031718 | 3300046660 | Bacteria | 3928 |
| 590 | Ga0495625_0115398 | 3300046660 | Bacteria | 1832 |
| 591 | Ga0495625_0126032 | 3300046660 | Bacteria | 1738 |
| 592 | Ga0495625_0283942 | 3300046660 | Bacteria | 1064 |
| 593 | Ga0495635_0432912 | 3300046663 | Bacteria | 871 |
| 594 | Ga0495661_0038796 | 3300046665 | Bacteria | 2964 |
| 595 | Ga0495661_0060919 | 3300046665 | Bacteria | 2241 |
| 596 | Ga0495661_0172149 | 3300046665 | Bacteria | 1154 |
| 597 | Ga0495588_0001445 | 3300046674 | Bacteria | 10174 |
| 598 | Ga0495588_0194200 | 3300046674 | Bacteria | 1072 |
| 599 | Ga0495588_0201788 | 3300046674 | Bacteria | 1050 |
| 600 | Ga0495657_0036996 | 3300046675 | Bacteria | 3368 |
| 601 | Ga0495646_0224196 | 3300046680 | Bacteria | 1015 |
| 602 | Ga0495624_0120943 | 3300046690 | Bacteria | 1608 |
| 603 | Ga0495624_0261952 | 3300046690 | Bacteria | 1045 |
| 604 | Ga0495670_0216136 | 3300046691 | Bacteria | 1018 |
| 605 | Ga0495671_0090095 | 3300046692 | Bacteria | 1501 |
| 606 | Ga0495649_0001088 | 3300046694 | Bacteria | 21190 |
| 607 | Ga0495649_0006784 | 3300046694 | Bacteria | 7091 |
| 608 | Ga0495589_0139562 | 3300046794 | Bacteria | 1161 |
| 609 | Ga0495589_0147371 | 3300046794 | Bacteria | 1125 |
| 610 | Ga0495600_0025386 | 3300046809 | Bacteria | 3819 |
| 611 | Ga0495660_0019134 | 3300046810 | Bacteria | 3931 |
| 612 | Ga0495660_0124616 | 3300046810 | Bacteria | 1299 |
| 613 | Ga0495660_0143079 | 3300046810 | Bacteria | 1188 |
| 614 | Ga0495660_0150619 | 3300046810 | Bacteria | 1149 |
| 615 | Ga0495604_0014117 | 3300047317 | Bacteria | 6369 |
| 616 | Ga0495604_0065353 | 3300047317 | Bacteria | 2769 |
| 617 | Ga0495604_0232088 | 3300047317 | Bacteria | 1265 |
| 618 | Ga0495636_0139330 | 3300047318 | Bacteria | 1082 |
| 619 | Ga0495674_0021339 | 3300047319 | Bacteria | 5991 |
| 620 | Ga0495672_0013154 | 3300047320 | Bacteria | 5723 |
| 621 | Ga0495676_0064476 | 3300047321 | Bacteria | 2848 |
| 622 | Ga0495683_0000019 | 3300047323 | Bacteria | 183206 |
| 623 | Ga0495683_0001428 | 3300047323 | Bacteria | 15720 |
| 624 | Ga0495683_0089086 | 3300047323 | Bacteria | 1497 |
| 625 | Ga0495687_005208 | 3300047443 | Bacteria | 8390 |
| 626 | Ga0495687_007825 | 3300047443 | Bacteria | 6222 |
| 627 | Ga0495687_034450 | 3300047443 | Bacteria | 2288 |
| 628 | Ga0495687_044962 | 3300047443 | Bacteria | 1915 |
| 629 | Ga0495675_0255054 | 3300047444 | Bacteria | 1052 |
| 630 | Ga0495677_0077817 | 3300047445 | Bacteria | 1241 |
| 631 | Ga0495685_069886 | 3300047447 | Bacteria | 1177 |
| 632 | Ga0495673_0020859 | 3300047469 | Bacteria | 3252 |
| 633 | Ga0495681_0001049 | 3300047470 | Bacteria | 21067 |
| 634 | Ga0495681_0012798 | 3300047470 | Bacteria | 4908 |
| 635 | Ga0495681_0037532 | 3300047470 | Bacteria | 2385 |
| 636 | Ga0495684_0233194 | 3300047471 | Bacteria | 1345 |
| 637 | Ga0495686_0016723 | 3300047472 | Bacteria | 4965 |
| 638 | Ga0495686_0084786 | 3300047472 | Bacteria | 1930 |
| 639 | Ga0495602_0077089 | 3300048088 | Bacteria | 2822 |
| 640 | Ga0495615_0095846 | 3300048090 | Bacteria | 832 |
| 641 | Ga0496100_0010828 | 3300048903 | Bacteria | 5174 |
| 642 | Ga0496100_0212612 | 3300048903 | Bacteria | 1415 |
| 643 | Ga0496100_0246288 | 3300048903 | Bacteria | 1321 |
| 644 | Ga0496101_0001581 | 3300048904 | Bacteria | 13660 |
| 645 | Ga0496101_0334881 | 3300048904 | Bacteria | 1188 |
| 646 | Ga0496101_0419381 | 3300048904 | Bacteria | 1055 |
| 647 | Ga0496102_0000981 | 3300048905 | Bacteria | 26837 |
| 648 | Ga0496102_0028748 | 3300048905 | Bacteria | 4969 |
| 649 | Ga0496102_0128750 | 3300048905 | Bacteria | 2368 |
| 650 | Ga0496102_0566923 | 3300048905 | Bacteria | 1058 |
| 651 | Ga0496103_0000660 | 3300048906 | Bacteria | 26094 |
| 652 | Ga0496103_0007016 | 3300048906 | Bacteria | 6724 |
| 653 | Ga0496104_0009153 | 3300048907 | Bacteria | 8806 |
| 654 | Ga0496104_0090320 | 3300048907 | Bacteria | 2927 |
| 655 | Ga0496104_0337955 | 3300048907 | Bacteria | 1419 |
| 656 | Ga0496105_0043416 | 3300048908 | Bacteria | 3708 |
| 657 | Ga0496106_0003138 | 3300048909 | Bacteria | 12329 |
| 658 | Ga0496107_0005547 | 3300048910 | Bacteria | 8640 |
| 659 | Ga0496107_0008447 | 3300048910 | Bacteria | 7128 |
| 660 | Ga0496107_0056883 | 3300048910 | Bacteria | 2827 |
| 661 | Ga0496107_0088138 | 3300048910 | Bacteria | 2266 |
| 662 | Ga0496109_0414861 | 3300048912 | Bacteria | 1272 |
| 663 | Ga0496109_0505124 | 3300048912 | Bacteria | 1141 |
| 664 | Ga0496110_0001494 | 3300048913 | Bacteria | 16951 |
| 665 | Ga0496110_0166024 | 3300048913 | Bacteria | 2002 |
| 666 | Ga0496110_0388877 | 3300048913 | Bacteria | 1271 |
| 667 | Ga0496110_0603936 | 3300048913 | Bacteria | 995 |
| 668 | Ga0496111_0015312 | 3300048914 | Bacteria | 5262 |
| 669 | Ga0496111_0179915 | 3300048914 | Bacteria | 1572 |
| 670 | Ga0496112_0000725 | 3300048915 | Bacteria | 22888 |
| 671 | Ga0496112_0063607 | 3300048915 | Bacteria | 3640 |
| 672 | Ga0496113_0005964 | 3300048916 | Bacteria | 7664 |
| 673 | Ga0496113_0215652 | 3300048916 | Bacteria | 1529 |
| 674 | Ga0496113_0599322 | 3300048916 | Bacteria | 882 |
| 675 | Ga0496116_0001582 | 3300048919 | Bacteria | 25058 |
| 676 | Ga0496116_0009211 | 3300048919 | Bacteria | 8451 |
| 677 | Ga0496116_0013691 | 3300048919 | Bacteria | 6522 |
| 678 | Ga0496116_0048276 | 3300048919 | Bacteria | 2858 |
| 679 | Ga0496116_0160273 | 3300048919 | Bacteria | 1235 |
| 680 | Ga0496116_0162245 | 3300048919 | Bacteria | 1224 |
| 681 | Ga0496117_0000066 | 3300048920 | Bacteria | 253534 |
| 682 | Ga0496117_0017198 | 3300048920 | Bacteria | 6051 |
| 683 | Ga0496117_0030766 | 3300048920 | Bacteria | 4111 |
| 684 | Ga0496117_0069530 | 3300048920 | Bacteria | 2370 |
| 685 | Ga0496118_0004078 | 3300048921 | Bacteria | 17718 |
| 686 | Ga0496118_0008608 | 3300048921 | Bacteria | 10502 |
| 687 | Ga0496118_0016332 | 3300048921 | Bacteria | 6814 |
| 688 | Ga0496118_0026933 | 3300048921 | Bacteria | 4880 |
| 689 | Ga0496118_0033704 | 3300048921 | Bacteria | 4195 |
| 690 | Ga0496118_0072878 | 3300048921 | Bacteria | 2464 |
| 691 | Ga0496118_0119959 | 3300048921 | Bacteria | 1718 |
| 692 | Ga0496119_0009811 | 3300048922 | Bacteria | 8144 |
| 693 | Ga0496119_0032320 | 3300048922 | Bacteria | 3489 |
| 694 | Ga0496119_0037363 | 3300048922 | Bacteria | 3155 |
| 695 | Ga0496119_0039298 | 3300048922 | Bacteria | 3042 |
| 696 | Ga0496119_0062063 | 3300048922 | Bacteria | 2228 |
| 697 | Ga0496119_0114470 | 3300048922 | Bacteria | 1492 |
| 698 | Ga0496120_0001197 | 3300048923 | Bacteria | 32900 |
| 699 | Ga0496120_0019205 | 3300048923 | Bacteria | 4379 |
| 700 | Ga0496120_0070270 | 3300048923 | Bacteria | 1926 |
| 701 | Ga0496120_0180914 | 3300048923 | Bacteria | 1035 |
| 702 | Ga0496120_0238017 | 3300048923 | Bacteria | 861 |
| 703 | Ga0496121_0000615 | 3300048924 | Bacteria | 66351 |
| 704 | Ga0496121_0003840 | 3300048924 | Bacteria | 20896 |
| 705 | Ga0496121_0015935 | 3300048924 | Bacteria | 7806 |
| 706 | Ga0496121_0018594 | 3300048924 | Bacteria | 6997 |
| 707 | Ga0496121_0038400 | 3300048924 | Bacteria | 4242 |
| 708 | Ga0496121_0121865 | 3300048924 | Bacteria | 1968 |
| 709 | Ga0496121_0132257 | 3300048924 | Bacteria | 1865 |
| 710 | Ga0496121_0157257 | 3300048924 | Bacteria | 1666 |
| 711 | Ga0496121_0157259 | 3300048924 | Bacteria | 1666 |
| 712 | Ga0496121_0248924 | 3300048924 | Bacteria | 1234 |
| 713 | Ga0496122_0000057 | 3300048925 | Bacteria | 253452 |
| 714 | Ga0496122_0002747 | 3300048925 | Bacteria | 24310 |
| 715 | Ga0496122_0003713 | 3300048925 | Bacteria | 19738 |
| 716 | Ga0496122_0009846 | 3300048925 | Bacteria | 9971 |
| 717 | Ga0496122_0026519 | 3300048925 | Bacteria | 4992 |
| 718 | Ga0496122_0028627 | 3300048925 | Bacteria | 4720 |
| 719 | Ga0496122_0052995 | 3300048925 | Bacteria | 3062 |
| 720 | Ga0496122_0063578 | 3300048925 | Bacteria | 2691 |
| 721 | Ga0496123_0000096 | 3300048926 | Bacteria | 173914 |
| 722 | Ga0496123_0005115 | 3300048926 | Bacteria | 13384 |
| 723 | Ga0496123_0010599 | 3300048926 | Bacteria | 8114 |
| 724 | Ga0496123_0015702 | 3300048926 | Bacteria | 6195 |
| 725 | Ga0496123_0078056 | 3300048926 | Bacteria | 2030 |
| 726 | Ga0496123_0100979 | 3300048926 | Bacteria | 1678 |
| 727 | Ga0496124_0000254 | 3300048927 | Bacteria | 103551 |
| 728 | Ga0496124_0004690 | 3300048927 | Bacteria | 15797 |
| 729 | Ga0496124_0006914 | 3300048927 | Bacteria | 12193 |
| 730 | Ga0496124_0019276 | 3300048927 | Bacteria | 6357 |
| 731 | Ga0496124_0026204 | 3300048927 | Bacteria | 5262 |
| 732 | Ga0496124_0043889 | 3300048927 | Bacteria | 3840 |
| 733 | Ga0496124_0206261 | 3300048927 | Bacteria | 1490 |
| 734 | Ga0496124_0233676 | 3300048927 | Bacteria | 1372 |
| 735 | Ga0496124_0297912 | 3300048927 | Bacteria | 1166 |
| 736 | Ga0496125_0000101 | 3300048928 | Bacteria | 202248 |
| 737 | Ga0496125_0000692 | 3300048928 | Bacteria | 55634 |
| 738 | Ga0496125_0005881 | 3300048928 | Bacteria | 13458 |
| 739 | Ga0496125_0008410 | 3300048928 | Bacteria | 10808 |
| 740 | Ga0496125_0011332 | 3300048928 | Bacteria | 8929 |
| 741 | Ga0496125_0012374 | 3300048928 | Bacteria | 8475 |
| 742 | Ga0496125_0015257 | 3300048928 | Bacteria | 7435 |
| 743 | Ga0496125_0020272 | 3300048928 | Bacteria | 6243 |
| 744 | Ga0496125_0069639 | 3300048928 | Bacteria | 2759 |
| 745 | Ga0496125_0090250 | 3300048928 | Bacteria | 2301 |
| 746 | Ga0496125_0169730 | 3300048928 | Bacteria | 1468 |
| 747 | Ga0496125_0216956 | 3300048928 | Bacteria | 1236 |
| 748 | Ga0496126_0000430 | 3300048929 | Bacteria | 84663 |
| 749 | Ga0496126_0010075 | 3300048929 | Bacteria | 9969 |
| 750 | Ga0496126_0011352 | 3300048929 | Bacteria | 9235 |
| 751 | Ga0496126_0016806 | 3300048929 | Bacteria | 7304 |
| 752 | Ga0496126_0058498 | 3300048929 | Bacteria | 3474 |
| 753 | Ga0496126_0121496 | 3300048929 | Bacteria | 2264 |
| 754 | Ga0496126_0155255 | 3300048929 | Bacteria | 1959 |
| 755 | Ga0496126_0189864 | 3300048929 | Bacteria | 1741 |
| 756 | Ga0495678_066936 | 3300049459 | Bacteria | 1328 |
| 757 | Ga0501031_0000010 | 3300049568 | Bacteria | 146435 |
| 758 | Ga0501031_0046808 | 3300049568 | Bacteria | 2820 |
| 759 | Ga0501031_0330206 | 3300049568 | Bacteria | 987 |
| 760 | Ga0501032_0000023 | 3300049569 | Bacteria | 146435 |
| 761 | Ga0501032_0050973 | 3300049569 | Bacteria | 2791 |
| 762 | Ga0501032_0091610 | 3300049569 | Bacteria | 2016 |
| 763 | Ga0501032_0162988 | 3300049569 | Bacteria | 1464 |
| 764 | Ga0501033_0000104 | 3300049570 | Bacteria | 81029 |
| 765 | Ga0501033_0032233 | 3300049570 | Bacteria | 3935 |
| 766 | Ga0501033_0060283 | 3300049570 | Bacteria | 2800 |
| 767 | Ga0501033_0173527 | 3300049570 | Bacteria | 1548 |
| 768 | Ga0501033_0195001 | 3300049570 | Bacteria | 1448 |
| 769 | Ga0501034_0000116 | 3300049571 | Bacteria | 146442 |
| 770 | Ga0501034_0201244 | 3300049571 | Bacteria | 1949 |
| 771 | Ga0501034_0391046 | 3300049571 | Bacteria | 1314 |
| 772 | Ga0501034_0512905 | 3300049571 | Bacteria | 1111 |
| 773 | Ga0501036_0000015 | 3300049572 | Bacteria | 146442 |
| 774 | Ga0501036_0043555 | 3300049572 | Bacteria | 3801 |
| 775 | Ga0501036_0170914 | 3300049572 | Bacteria | 1831 |
| 776 | Ga0501037_0000023 | 3300049573 | Bacteria | 146542 |
| 777 | Ga0501038_0000025 | 3300049574 | Bacteria | 146542 |
| 778 | Ga0501038_0135794 | 3300049574 | Bacteria | 2015 |
| 779 | Ga0501038_0535945 | 3300049574 | Bacteria | 892 |
| 780 | Ga0501039_0000037 | 3300049575 | Bacteria | 122286 |
| 781 | Ga0501039_0455757 | 3300049575 | Bacteria | 1004 |
| 782 | Ga0501040_0005598 | 3300049576 | Bacteria | 8116 |
| 783 | Ga0501043_0000070 | 3300049579 | Bacteria | 89839 |
| 784 | Ga0501043_0016194 | 3300049579 | Bacteria | 5848 |
| 785 | Ga0501043_0242350 | 3300049579 | Bacteria | 1390 |
| 786 | Ga0501043_0352806 | 3300049579 | Bacteria | 1117 |
| 787 | Ga0501046_0013466 | 3300049580 | Bacteria | 6924 |
| 788 | Ga0501046_0219006 | 3300049580 | Bacteria | 1410 |
| 789 | Ga0501047_0001244 | 3300049581 | Bacteria | 25242 |
| 790 | Ga0501047_0115506 | 3300049581 | Bacteria | 2566 |
| 791 | Ga0501047_0382359 | 3300049581 | Bacteria | 1242 |
| 792 | Ga0501047_0413634 | 3300049581 | Bacteria | 1180 |
| 793 | Ga0501070_0017965 | 3300049586 | Bacteria | 5936 |
| 794 | Ga0501070_0054954 | 3300049586 | Bacteria | 3301 |
| 795 | Ga0501070_0140247 | 3300049586 | Bacteria | 1996 |
| 796 | Ga0501070_0190247 | 3300049586 | Bacteria | 1687 |
| 797 | Ga0501072_0004650 | 3300049588 | Bacteria | 10450 |
| 798 | Ga0501073_0057589 | 3300049589 | Bacteria | 2717 |
| 799 | Ga0501074_0046189 | 3300049590 | Bacteria | 3149 |
| 800 | Ga0501238_016681 | 3300049671 | Bacteria | 1019 |
| 801 | Ga0501080_0113468 | 3300049742 | Bacteria | 2512 |
| 802 | Ga0501083_0111763 | 3300049744 | Bacteria | 1796 |
| 803 | Ga0501083_0177523 | 3300049744 | Bacteria | 1391 |
| 804 | Ga0501280_001581 | 3300049776 | Bacteria | 4093 |
| 805 | Ga0501035_0000074 | 3300049822 | Bacteria | 122269 |
| 806 | Ga0501035_0005429 | 3300049822 | Bacteria | 12055 |
| 807 | Ga0501035_0009467 | 3300049822 | Bacteria | 9057 |
| 808 | Ga0501035_0030307 | 3300049822 | Bacteria | 4932 |
| 809 | Ga0501035_0161435 | 3300049822 | Bacteria | 1939 |
| 810 | Ga0501035_0161442 | 3300049822 | Bacteria | 1939 |
| 811 | Ga0501035_0532923 | 3300049822 | Bacteria | 963 |
| 812 | Ga0501044_0000069 | 3300049823 | Bacteria | 125974 |
| 813 | Ga0501044_0030918 | 3300049823 | Bacteria | 5639 |
| 814 | Ga0501044_0079267 | 3300049823 | Bacteria | 3328 |
| 815 | Ga0501044_0231637 | 3300049823 | Bacteria | 1794 |
| 816 | Ga0501044_0286245 | 3300049823 | Bacteria | 1580 |
| 817 | Ga0501045_0128427 | 3300049824 | Bacteria | 1884 |
| 818 | nmdc:mga03683_16660_c2 | 3300050489 | Bacteria | 2389 |
| 819 | nmdc:mga03683_179392_c1 | 3300050489 | Bacteria | 966 |
| 820 | nmdc:mga03683_91543_c1 | 3300050489 | Bacteria | 1326 |
| 821 | nmdc:mga00v17_14_c1 | 3300050491 | Bacteria | 126589 |
| 822 | nmdc:mga00v17_59_c2 | 3300050491 | Bacteria | 33192 |
| 823 | nmdc:mga00v17_9569_c1 | 3300050491 | Bacteria | 5251 |
| 824 | nmdc:mga0yw44_135029_c1 | 3300050492 | Bacteria | 1600 |
| 825 | nmdc:mga0yw44_14452_c1 | 3300050492 | Bacteria | 4193 |
| 826 | nmdc:mga0yw44_155595_c1 | 3300050492 | Bacteria | 1494 |
| 827 | nmdc:mga0yw44_163822_c1 | 3300050492 | Bacteria | 1457 |
| 828 | nmdc:mga0yw44_23882_c1 | 3300050492 | Bacteria | 3451 |
| 829 | nmdc:mga0yw44_68031_c1 | 3300050492 | Bacteria | 2202 |
| 830 | nmdc:mga0yw44_7224_c1 | 3300050492 | Bacteria | 5444 |
| 831 | nmdc:mga0k408_12529_c1 | 3300050493 | Bacteria | 4637 |
| 832 | nmdc:mga0k408_14833_c1 | 3300050493 | Bacteria | 4301 |
| 833 | nmdc:mga06z11_134020_c1 | 3300050494 | Bacteria | 1394 |
| 834 | nmdc:mga06z11_136330_c1 | 3300050494 | Bacteria | 1383 |
| 835 | nmdc:mga06z11_15017_c1 | 3300050494 | Bacteria | 3447 |
| 836 | nmdc:mga06z11_97845_c1 | 3300050494 | Bacteria | 1605 |
| 837 | nmdc:mga04h51_31977_c1 | 3300050495 | Bacteria | 1666 |
| 838 | nmdc:mga04h51_32080_c1 | 3300050495 | Bacteria | 1664 |
| 839 | nmdc:mga07m45_68339_c1 | 3300050496 | Bacteria | 2020 |
| 840 | nmdc:mga09592_112096_c1 | 3300050508 | Bacteria | 2340 |
| 841 | nmdc:mga0sz30_100424_c1 | 3300050516 | Bacteria | 1264 |
| 842 | nmdc:mga0sz30_14265_c1 | 3300050516 | Bacteria | 3125 |
| 843 | nmdc:mga0sz30_145567_c1 | 3300050516 | Bacteria | 1047 |
| 844 | nmdc:mga0sz30_578_c1 | 3300050516 | Bacteria | 13792 |
| 845 | nmdc:mga0sz30_9773_c1 | 3300050516 | Bacteria | 3657 |
| 846 | Ga0495601_0136999 | 3300053077 | Bacteria | 1596 |
| 847 | Ga0495601_0165302 | 3300053077 | Bacteria | 1446 |
| 848 | Ga0495612_0165626 | 3300053078 | Bacteria | 966 |
| 849 | Ga0500610_0035282 | 3300053079 | Bacteria | 2564 |
| 850 | Ga0500610_0053619 | 3300053079 | Bacteria | 2102 |
| 851 | Ga0495595_0119664 | 3300053084 | Bacteria | 1282 |
| 852 | Ga0495619_0043876 | 3300053085 | Bacteria | 2933 |
| 853 | Ga0495619_0066957 | 3300053085 | Bacteria | 2397 |
| 854 | Ga0500578_0053825 | 3300053086 | Bacteria | 2576 |
| 855 | Ga0500643_011296 | 3300053087 | Bacteria | 3265 |
| 856 | Ga0500641_0009976 | 3300053096 | Bacteria | 3424 |
| 857 | Ga0500560_000150 | 3300053107 | Bacteria | 7775 |
| 858 | Ga0500594_0006924 | 3300053118 | Bacteria | 2556 |
| 859 | Ga0500595_009740 | 3300053119 | Bacteria | 3862 |
| 860 | Ga0500595_044034 | 3300053119 | Bacteria | 1417 |
| 861 | Ga0500608_115540 | 3300053122 | Bacteria | 1225 |
| 862 | Ga0500618_001078 | 3300053125 | Bacteria | 13432 |
| 863 | Ga0500618_001226 | 3300053125 | Bacteria | 12014 |
| 864 | Ga0500658_0000486 | 3300053134 | Bacteria | 16965 |
| 865 | Ga0500658_0069685 | 3300053134 | Bacteria | 1481 |
| 866 | Ga0500659_0073849 | 3300053135 | Bacteria | 1802 |
| 867 | Ga0500561_0000021 | 3300053137 | Bacteria | 39116 |
| 868 | Ga0500568_0000587 | 3300053139 | Bacteria | 26463 |
| 869 | Ga0500573_0003975 | 3300053140 | Bacteria | 7720 |
| 870 | Ga0500577_0042717 | 3300053142 | Bacteria | 1662 |
| 871 | Ga0500590_000124 | 3300053148 | Bacteria | 21215 |
| 872 | Ga0500604_0002852 | 3300053151 | Bacteria | 4691 |
| 873 | Ga0500604_0066999 | 3300053151 | Bacteria | 1138 |
| 874 | Ga0500616_0000094 | 3300053153 | Bacteria | 181038 |
| 875 | Ga0500616_0001233 | 3300053153 | Bacteria | 25673 |
| 876 | Ga0500616_0003199 | 3300053153 | Bacteria | 12737 |
| 877 | Ga0500624_000889 | 3300053157 | Bacteria | 6433 |
| 878 | Ga0500627_0002037 | 3300053158 | Bacteria | 5842 |
| 879 | Ga0500627_0034904 | 3300053158 | Bacteria | 2135 |
| 880 | Ga0500634_0000008 | 3300053161 | Bacteria | 152203 |
| 881 | Ga0500634_0007871 | 3300053161 | Bacteria | 5292 |
| 882 | Ga0500636_0000027 | 3300053177 | Bacteria | 83029 |
| 883 | Ga0500636_0000679 | 3300053177 | Bacteria | 18258 |
| 884 | Ga0500636_0093545 | 3300053177 | Bacteria | 1719 |
| 885 | Ga0500611_001114 | 3300053727 | Bacteria | 2858 |
| 886 | Ga0500611_010675 | 3300053727 | Bacteria | 1496 |
| 887 | Ga0500611_017532 | 3300053727 | Bacteria | 1306 |
| 888 | Ga0500645_028297 | 3300053730 | Bacteria | 1697 |
| 889 | Ga0500596_002261 | 3300053735 | Bacteria | 3815 |
| 890 | Ga0501084_0057528 | 3300054114 | Bacteria | 3253 |
| 891 | Ga0501082_0000007 | 3300060353 | Bacteria | 126506 |
| 892 | Ga0501082_0362003 | 3300060353 | Bacteria | 1265 |
| 893 | Ga0501082_0582473 | 3300060353 | Bacteria | 979 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100064391 | Ga0070689_1000643913 | 191 |
| 2 | 3300005365 | Ga0070688_100269308 | Ga0070688_1002693082 | 191 |
| 3 | 3300014745 | Ga0157377_10344917 | Ga0157377_103449172 | 191 |
| 4 | 3300025918 | Ga0207662_10061301 | Ga0207662_100613013 | 191 |
| 5 | 3300025936 | Ga0207670_10165741 | Ga0207670_101657412 | 191 |
| 6 | 3300026075 | Ga0207708_10615201 | Ga0207708_106152011 | 191 |
| 7 | 3300005366 | Ga0070659_100611932 | Ga0070659_1006119321 | 192 |
| 8 | 3300021384 | Ga0213876_10017486 | Ga0213876_100174862 | 197 |
| 9 | 3300025927 | Ga0207687_10251689 | Ga0207687_102516892 | 199 |
| 10 | 3300039437 | Ga0436365_0110753 | Ga0436365_0110753_1992_2765 | 199 |
| 11 | 3300005548 | Ga0070665_100557771 | Ga0070665_1005577713 | 200 |
| 12 | 3300005578 | Ga0068854_100232482 | Ga0068854_1002324822 | 200 |
| 13 | 3300048904 | Ga0496101_0334881 | Ga0496101_0334881_228_995 | 200 |
| 14 | 3300048919 | Ga0496116_0048276 | Ga0496116_0048276_557_1324 | 200 |
| 15 | 3300048921 | Ga0496118_0016332 | Ga0496118_0016332_3821_4588 | 200 |
| 16 | 3300048925 | Ga0496122_0003713 | Ga0496122_0003713_3332_4099 | 200 |
| 17 | 3300048926 | Ga0496123_0015702 | Ga0496123_0015702_532_1299 | 200 |
| 18 | 3300005436 | Ga0070713_100395117 | Ga0070713_1003951172 | 201 |
| 19 | 3300005439 | Ga0070711_100097584 | Ga0070711_1000975842 | 201 |
| 20 | 3300006175 | Ga0070712_100019610 | Ga0070712_1000196103 | 201 |
| 21 | 3300025906 | Ga0207699_10036981 | Ga0207699_100369812 | 201 |
| 22 | 3300025915 | Ga0207693_10030293 | Ga0207693_100302933 | 201 |
| 23 | 3300025928 | Ga0207700_10205169 | Ga0207700_102051692 | 201 |
| 24 | 3300005356 | Ga0070674_100266129 | Ga0070674_1002661292 | 203 |
| 25 | 3300017792 | Ga0163161_10089613 | Ga0163161_100896133 | 203 |
| 26 | 3300025937 | Ga0207669_10128743 | Ga0207669_101287432 | 203 |
| 27 | 3300025914 | Ga0207671_10313655 | Ga0207671_103136552 | 205 |
| 28 | 3300045051 | Ga0451576_0215639 | Ga0451576_0215639_112_873 | 205 |
| 29 | 3300025981 | Ga0207640_10830322 | Ga0207640_108303221 | 206 |
| 30 | 3300035117 | Ga0373953_0195012 | Ga0373953_0195012_52_819 | 208 |
| 31 | 3300035695 | Ga0373927_0000586 | Ga0373927_0000586_4221_4988 | 208 |
| 32 | 3300035725 | Ga0373947_0028775 | Ga0373947_0028775_260_1027 | 208 |
| 33 | 3300037068 | Ga0373925_0260398 | Ga0373925_0260398_610_1377 | 208 |
| 34 | 3300046477 | Ga0495664_0010526 | Ga0495664_0010526_3605_4372 | 208 |
| 35 | 3300047319 | Ga0495674_0021339 | Ga0495674_0021339_518_1285 | 208 |
| 36 | 3300047471 | Ga0495684_0233194 | Ga0495684_0233194_208_975 | 208 |
| 37 | 3300013308 | Ga0157375_10649497 | Ga0157375_106494972 | 209 |
| 38 | 3300028380 | Ga0268265_10497480 | Ga0268265_104974802 | 209 |
| 39 | 3300028381 | Ga0268264_10918964 | Ga0268264_109189641 | 209 |
| 40 | 3300011119 | Ga0105246_10432763 | Ga0105246_104327631 | 212 |
| 41 | 3300013297 | Ga0157378_10047353 | Ga0157378_100473533 | 214 |
| 42 | 3300037853 | Ga0436364_0053771 | Ga0436364_0053771_23_667 | 214 |
| 43 | 3300025908 | Ga0207643_10138773 | Ga0207643_101387732 | 215 |
| 44 | 3300031616 | Ga0307508_10285224 | Ga0307508_102852242 | 215 |
| 45 | 3300046452 | Ga0495617_040889 | Ga0495617_040889_265_1032 | 215 |
| 46 | 3300046492 | Ga0495585_0036386 | Ga0495585_0036386_1023_1790 | 215 |
| 47 | 3300047445 | Ga0495677_0077817 | Ga0495677_0077817_172_939 | 215 |
| 48 | 3300048929 | Ga0496126_0189864 | Ga0496126_0189864_557_1324 | 215 |
| 49 | 3300005355 | Ga0070671_100043262 | Ga0070671_1000432622 | 216 |
| 50 | 3300005614 | Ga0068856_100290762 | Ga0068856_1002907621 | 216 |
| 51 | 3300005616 | Ga0068852_100018103 | Ga0068852_1000181034 | 216 |
| 52 | 3300005718 | Ga0068866_10031507 | Ga0068866_100315072 | 216 |
| 53 | 3300005843 | Ga0068860_100575769 | Ga0068860_1005757692 | 216 |
| 54 | 3300010375 | Ga0105239_10025522 | Ga0105239_100255227 | 216 |
| 55 | 3300031507 | Ga0307509_10065476 | Ga0307509_100654763 | 216 |
| 56 | 3300031730 | Ga0307516_10052706 | Ga0307516_100527062 | 216 |
| 57 | 3300031731 | Ga0307405_10125562 | Ga0307405_101255622 | 216 |
| 58 | 3300034819 | Ga0373958_0015886 | Ga0373958_0015886_393_1160 | 216 |
| 59 | 3300035114 | Ga0373939_0045701 | Ga0373939_0045701_404_1171 | 216 |
| 60 | 3300048910 | Ga0496107_0008447 | Ga0496107_0008447_3535_4302 | 216 |
| 61 | 3300053078 | Ga0495612_0165626 | Ga0495612_0165626_49_816 | 216 |
| 62 | 3300031456 | Ga0307513_10185244 | Ga0307513_101852442 | 219 |
| 63 | 3300046518 | Ga0495631_0030541 | Ga0495631_0030541_23_703 | 219 |
| 64 | 3300013296 | Ga0157374_10159332 | Ga0157374_101593321 | 220 |
| 65 | 3300031730 | Ga0307516_10002345 | Ga0307516_1000234510 | 220 |
| 66 | 3300048921 | Ga0496118_0119959 | Ga0496118_0119959_981_1697 | 220 |
| 67 | 3300049570 | Ga0501033_0173527 | Ga0501033_0173527_518_1267 | 220 |
| 68 | 3300049581 | Ga0501047_0382359 | Ga0501047_0382359_427_1176 | 220 |
| 69 | 3300049822 | Ga0501035_0030307 | Ga0501035_0030307_2080_2829 | 220 |
| 70 | 3300049823 | Ga0501044_0079267 | Ga0501044_0079267_518_1267 | 220 |
| 71 | 3300002737 | JGI25162J39368_1000184 | JGI25162J39368_100018448 | 222 |
| 72 | 3300003214 | JGI25165J46597_1000163 | JGI25165J46597_10001633 | 222 |
| 73 | 3300005614 | Ga0068856_100034675 | Ga0068856_1000346755 | 222 |
| 74 | 3300025233 | Ga0209437_100095 | Ga0209437_100095205 | 222 |
| 75 | 3300025246 | Ga0209646_1005995 | Ga0209646_10059952 | 222 |
| 76 | 3300025261 | Ga0209233_1000117 | Ga0209233_1000117205 | 222 |
| 77 | 3300025901 | Ga0207688_10358253 | Ga0207688_103582531 | 222 |
| 78 | 3300048922 | Ga0496119_0039298 | Ga0496119_0039298_1416_2174 | 222 |
| 79 | 3300048923 | Ga0496120_0070270 | Ga0496120_0070270_306_1064 | 222 |
| 80 | 3300048925 | Ga0496122_0026519 | Ga0496122_0026519_886_1644 | 222 |
| 81 | 3300048927 | Ga0496124_0206261 | Ga0496124_0206261_440_1198 | 222 |
| 82 | 3300005328 | Ga0070676_10279281 | Ga0070676_102792812 | 223 |
| 83 | 3300045976 | Ga0466967_0082659 | Ga0466967_0082659_1460_2230 | 223 |
| 84 | 3300053122 | Ga0500608_115540 | Ga0500608_115540_383_1138 | 223 |
| 85 | 3300005365 | Ga0070688_100171018 | Ga0070688_1001710181 | 224 |
| 86 | 3300003215 | JGI25153J46596_10016829 | JGI25153J46596_100168292 | 226 |
| 87 | 3300003792 | Ga0055540_1003244 | Ga0055540_10032442 | 226 |
| 88 | 3300003794 | Ga0055531_10001262 | Ga0055531_100012628 | 226 |
| 89 | 3300005331 | Ga0070670_100218563 | Ga0070670_1002185631 | 226 |
| 90 | 3300005333 | Ga0070677_10013535 | Ga0070677_100135354 | 226 |
| 91 | 3300005335 | Ga0070666_10133810 | Ga0070666_101338102 | 226 |
| 92 | 3300005356 | Ga0070674_100002557 | Ga0070674_1000025572 | 226 |
| 93 | 3300005364 | Ga0070673_100133648 | Ga0070673_1001336482 | 226 |
| 94 | 3300005456 | Ga0070678_100012048 | Ga0070678_1000120482 | 226 |
| 95 | 3300005459 | Ga0068867_100160797 | Ga0068867_1001607972 | 226 |
| 96 | 3300005543 | Ga0070672_100051962 | Ga0070672_1000519625 | 226 |
| 97 | 3300005544 | Ga0070686_100089375 | Ga0070686_1000893752 | 226 |
| 98 | 3300009098 | Ga0105245_10213355 | Ga0105245_102133553 | 226 |
| 99 | 3300013308 | Ga0157375_10357964 | Ga0157375_103579642 | 226 |
| 100 | 3300025292 | Ga0209676_1065061 | Ga0209676_10650611 | 226 |
| 101 | 3300025297 | Ga0209758_1000130 | Ga0209758_1000130120 | 226 |
| 102 | 3300025303 | Ga0209051_1018859 | Ga0209051_10188593 | 226 |
| 103 | 3300025893 | Ga0207682_10002344 | Ga0207682_100023445 | 226 |
| 104 | 3300025903 | Ga0207680_10168458 | Ga0207680_101684582 | 226 |
| 105 | 3300025931 | Ga0207644_10236585 | Ga0207644_102365852 | 226 |
| 106 | 3300025937 | Ga0207669_10007097 | Ga0207669_100070974 | 226 |
| 107 | 3300025940 | Ga0207691_10032439 | Ga0207691_100324394 | 226 |
| 108 | 3300026089 | Ga0207648_10003173 | Ga0207648_100031738 | 226 |
| 109 | 3300026121 | Ga0207683_10094456 | Ga0207683_100944562 | 226 |
| 110 | 3300046539 | Ga0495621_0002234 | Ga0495621_0002234_3066_3821 | 226 |
| 111 | 3300046460 | Ga0495638_0067375 | Ga0495638_0067375_48_803 | 227 |
| 112 | 3300046518 | Ga0495631_0106583 | Ga0495631_0106583_431_1168 | 227 |
| 113 | 3300046660 | Ga0495625_0115398 | Ga0495625_0115398_280_1017 | 227 |
| 114 | 3300046810 | Ga0495660_0150619 | Ga0495660_0150619_184_921 | 227 |
| 115 | 3300053151 | Ga0500604_0002852 | Ga0500604_0002852_344_1081 | 227 |
| 116 | 3300053158 | Ga0500627_0002037 | Ga0500627_0002037_1512_2249 | 227 |
| 117 | 3300053727 | Ga0500611_010675 | Ga0500611_010675_410_1147 | 227 |
| 118 | iso_pu_bacteria | 2551306091 | 2551729657 | 227 |
| 119 | iso_pu_bacteria | 2643221591 | 2643964904 | 227 |
| 120 | 3300053079 | Ga0500610_0035282 | Ga0500610_0035282_1738_2493 | 228 |
| 121 | iso_pu_bacteria | 3004334049 | 3004336426 | 228 |
| 122 | iso_pu_bacteria | 2509276019 | 2509377288 | 229 |
| 123 | iso_pu_bacteria | 2510917028 | 2511184240 | 229 |
| 124 | iso_pu_bacteria | 2511231052 | 2511499348 | 229 |
| 125 | iso_pu_bacteria | 2512875026 | 2512975419 | 229 |
| 126 | iso_pu_bacteria | 2513237086 | 2513585471 | 229 |
| 127 | iso_pu_bacteria | 2513237089 | 2513606643 | 229 |
| 128 | iso_pu_bacteria | 2513237104 | 2513721638 | 229 |
| 129 | iso_pu_bacteria | 2513237156 | 2513988833 | 229 |
| 130 | iso_pu_bacteria | 2513237160 | 2514008671 | 229 |
| 131 | iso_pu_bacteria | 2516143018 | 2516208041 | 229 |
| 132 | iso_pu_bacteria | 2516653046 | 2516898308 | 229 |
| 133 | iso_pu_bacteria | 2517487022 | 2517567011 | 229 |
| 134 | iso_pu_bacteria | 2534681796 | 2535514390 | 229 |
| 135 | iso_pu_bacteria | 2537561587 | 2537875401 | 229 |
| 136 | iso_pu_bacteria | 2551306084 | 2551676934 | 229 |
| 137 | iso_pu_bacteria | 2551306085 | 2551686815 | 229 |
| 138 | iso_pu_bacteria | 2551306090 | 2551720857 | 229 |
| 139 | iso_pu_bacteria | 2554235003 | 2554244877 | 229 |
| 140 | iso_pu_bacteria | 2558860100 | 2558862187 | 229 |
| 141 | iso_pu_bacteria | 2558860242 | 2559297289 | 229 |
| 142 | iso_pu_bacteria | 2600255279 | 2601611608 | 229 |
| 143 | iso_pu_bacteria | 2600255308 | 2601748840 | 229 |
| 144 | iso_pu_bacteria | 2643221582 | 2643921830 | 229 |
| 145 | iso_pu_bacteria | 2643221599 | 2644003592 | 229 |
| 146 | iso_pu_bacteria | 2643221618 | 2644109738 | 229 |
| 147 | iso_pu_bacteria | 2643221626 | 2644149056 | 229 |
| 148 | iso_pu_bacteria | 2643221655 | 2644312616 | 229 |
| 149 | iso_pu_bacteria | 2643221659 | 2644336833 | 229 |
| 150 | iso_pu_bacteria | 2643221693 | 2644519798 | 229 |
| 151 | iso_pu_bacteria | 2643221698 | 2644540932 | 229 |
| 152 | iso_pu_bacteria | 2643221712 | 2644618347 | 229 |
| 153 | iso_pu_bacteria | 2657244999 | 2657686219 | 229 |
| 154 | iso_pu_bacteria | 2690316117 | 2692319485 | 229 |
| 155 | iso_pu_bacteria | 2751185821 | 2753461933 | 229 |
| 156 | iso_pu_bacteria | 2775507049 | 2776915070 | 229 |
| 157 | iso_pu_bacteria | 2791355082 | 2792583746 | 229 |
| 158 | iso_pu_bacteria | 2791355091 | 2792623280 | 229 |
| 159 | iso_pu_bacteria | 2791355092 | 2792629406 | 229 |
| 160 | iso_pu_bacteria | 2791355094 | 2792642095 | 229 |
| 161 | iso_pu_bacteria | 2802428858 | 2802721129 | 229 |
| 162 | iso_pu_bacteria | 2802428859 | 2802728375 | 229 |
| 163 | iso_pu_bacteria | 2802428860 | 2802734083 | 229 |
| 164 | iso_pu_bacteria | 2802428861 | 2802740467 | 229 |
| 165 | iso_pu_bacteria | 2802428862 | 2802746749 | 229 |
| 166 | iso_pu_bacteria | 2802428863 | 2802753604 | 229 |
| 167 | iso_pu_bacteria | 2802429268 | 2804755084 | 229 |
| 168 | iso_pu_bacteria | 2808606387 | 2808988753 | 229 |
| 169 | iso_pu_bacteria | 2818991439 | 2819561383 | 229 |
| 170 | iso_pu_bacteria | 2838675328 | 2838679465 | 229 |
| 171 | iso_pu_bacteria | 2838714209 | 2838718822 | 229 |
| 172 | iso_pu_bacteria | 2838719591 | 2838723820 | 229 |
| 173 | iso_pu_bacteria | 2838724970 | 2838729143 | 229 |
| 174 | iso_pu_bacteria | 2841846520 | 2841851089 | 229 |
| 175 | iso_pu_bacteria | 2841859092 | 2841863894 | 229 |
| 176 | iso_pu_bacteria | 2842124991 | 2842129840 | 229 |
| 177 | iso_pu_bacteria | 2842130223 | 2842134416 | 229 |
| 178 | iso_pu_bacteria | 2842152218 | 2842156412 | 229 |
| 179 | iso_pu_bacteria | 2842170452 | 2842175067 | 229 |
| 180 | iso_pu_bacteria | 2842175837 | 2842179984 | 229 |
| 181 | iso_pu_bacteria | 2842187318 | 2842191598 | 229 |
| 182 | iso_pu_bacteria | 2842211629 | 2842215915 | 229 |
| 183 | iso_pu_bacteria | 2842224351 | 2842228585 | 229 |
| 184 | iso_pu_bacteria | 2842515876 | 2842520676 | 229 |
| 185 | iso_pu_bacteria | 2844163670 | 2844164395 | 229 |
| 186 | iso_pu_bacteria | 2847417321 | 2847422013 | 229 |
| 187 | iso_pu_bacteria | 2848992105 | 2848996988 | 229 |
| 188 | iso_pu_bacteria | 2850079185 | 2850085426 | 229 |
| 189 | iso_pu_bacteria | 2854916844 | 2854922032 | 229 |
| 190 | iso_pu_bacteria | 2855825444 | 2855830147 | 229 |
| 191 | iso_pu_bacteria | 2855839649 | 2855845037 | 229 |
| 192 | iso_pu_bacteria | 2855872281 | 2855874983 | 229 |
| 193 | iso_pu_bacteria | 2858800743 | 2858804290 | 229 |
| 194 | iso_pu_bacteria | 2896384573 | 2896390478 | 229 |
| 195 | iso_pu_bacteria | 2899275550 | 2899275631 | 229 |
| 196 | iso_pu_bacteria | 2899792073 | 2899794940 | 229 |
| 197 | iso_pu_bacteria | 2899845264 | 2899850432 | 229 |
| 198 | iso_pu_bacteria | 2913295892 | 2913297030 | 229 |
| 199 | iso_pu_bacteria | 2915980308 | 2915983377 | 229 |
| 200 | iso_pu_bacteria | 2915993759 | 2915995998 | 229 |
| 201 | iso_pu_bacteria | 2916007675 | 2916008073 | 229 |
| 202 | iso_pu_bacteria | 2916014648 | 2916017235 | 229 |
| 203 | iso_pu_bacteria | 2916035215 | 2916040970 | 229 |
| 204 | iso_pu_bacteria | 2916061851 | 2916065529 | 229 |
| 205 | iso_pu_bacteria | 2916068649 | 2916071195 | 229 |
| 206 | iso_pu_bacteria | 2919114240 | 2919118804 | 229 |
| 207 | iso_pu_bacteria | 2921201388 | 2921207868 | 229 |
| 208 | iso_pu_bacteria | 2921237296 | 2921238081 | 229 |
| 209 | iso_pu_bacteria | 2921244191 | 2921246534 | 229 |
| 210 | iso_pu_bacteria | 2921250672 | 2921255213 | 229 |
| 211 | iso_pu_bacteria | 2921282425 | 2921284089 | 229 |
| 212 | iso_pu_bacteria | 2921289301 | 2921292938 | 229 |
| 213 | iso_pu_bacteria | 2921296804 | 2921297395 | 229 |
| 214 | iso_pu_bacteria | 2924144063 | 2924146805 | 229 |
| 215 | iso_pu_bacteria | 2924150972 | 2924153037 | 229 |
| 216 | iso_pu_bacteria | 2924158325 | 2924161442 | 229 |
| 217 | iso_pu_bacteria | 2924165586 | 2924169334 | 229 |
| 218 | iso_pu_bacteria | 2924186466 | 2924190453 | 229 |
| 219 | iso_pu_bacteria | 2924193448 | 2924199213 | 229 |
| 220 | iso_pu_bacteria | 2924200457 | 2924203196 | 229 |
| 221 | iso_pu_bacteria | 2924207177 | 2924213416 | 229 |
| 222 | iso_pu_bacteria | 2924214083 | 2924219647 | 229 |
| 223 | iso_pu_bacteria | 2924228884 | 2924232636 | 229 |
| 224 | iso_pu_bacteria | 2926754445 | 2926758175 | 229 |
| 225 | iso_pu_bacteria | 2926760298 | 2926764258 | 229 |
| 226 | iso_pu_bacteria | 2933006813 | 2933011186 | 229 |
| 227 | iso_pu_bacteria | 2933594066 | 2933598987 | 229 |
| 228 | iso_pu_bacteria | 2937002841 | 2937006256 | 229 |
| 229 | iso_pu_bacteria | 2937016420 | 2937019861 | 229 |
| 230 | iso_pu_bacteria | 2937029754 | 2937032140 | 229 |
| 231 | iso_pu_bacteria | 2937036028 | 2937042320 | 229 |
| 232 | iso_pu_bacteria | 2937049772 | 2937056567 | 229 |
| 233 | iso_pu_bacteria | 2937056579 | 2937058819 | 229 |
| 234 | iso_pu_bacteria | 2937078374 | 2937081918 | 229 |
| 235 | iso_pu_bacteria | 2937084907 | 2937089628 | 229 |
| 236 | iso_pu_bacteria | 2937091812 | 2937092646 | 229 |
| 237 | iso_pu_bacteria | 2937098957 | 2937100227 | 229 |
| 238 | iso_pu_bacteria | 2937106411 | 2937112334 | 229 |
| 239 | iso_pu_bacteria | 2957375807 | 2957380224 | 229 |
| 240 | iso_pu_bacteria | 2957388812 | 2957391205 | 229 |
| 241 | iso_pu_bacteria | 2957422303 | 2957427884 | 229 |
| 242 | iso_pu_bacteria | 2957430029 | 2957433681 | 229 |
| 243 | iso_pu_bacteria | 2957437181 | 2957437989 | 229 |
| 244 | iso_pu_bacteria | 2957457609 | 2957464613 | 229 |
| 245 | iso_pu_bacteria | 2957464669 | 2957467156 | 229 |
| 246 | iso_pu_bacteria | 2957471148 | 2957473777 | 229 |
| 247 | iso_pu_bacteria | 2957498199 | 2957505016 | 229 |
| 248 | iso_pu_bacteria | 2957505466 | 2957510732 | 229 |
| 249 | iso_pu_bacteria | 2960584000 | 2960589746 | 229 |
| 250 | iso_pu_bacteria | 2960591022 | 2960592944 | 229 |
| 251 | iso_pu_bacteria | 2960603979 | 2960606722 | 229 |
| 252 | iso_pu_bacteria | 2960624210 | 2960627802 | 229 |
| 253 | iso_pu_bacteria | 2960631154 | 2960633611 | 229 |
| 254 | iso_pu_bacteria | 2960637947 | 2960641315 | 229 |
| 255 | iso_pu_bacteria | 2960645483 | 2960649461 | 229 |
| 256 | iso_pu_bacteria | 2960652885 | 2960653339 | 229 |
| 257 | iso_pu_bacteria | 2960680706 | 2960683958 | 229 |
| 258 | iso_pu_bacteria | 2960687367 | 2960689837 | 229 |
| 259 | iso_pu_bacteria | 2960693952 | 2960699093 | 229 |
| 260 | iso_pu_bacteria | 2964607997 | 2964612723 | 229 |
| 261 | iso_pu_bacteria | 2964621998 | 2964623859 | 229 |
| 262 | iso_pu_bacteria | 2964643177 | 2964649192 | 229 |
| 263 | iso_pu_bacteria | 2964649959 | 2964653306 | 229 |
| 264 | iso_pu_bacteria | 2964656573 | 2964659816 | 229 |
| 265 | iso_pu_bacteria | 2964663802 | 2964667781 | 229 |
| 266 | iso_pu_bacteria | 2964678106 | 2964680252 | 229 |
| 267 | iso_pu_bacteria | 2964685014 | 2964686636 | 229 |
| 268 | iso_pu_bacteria | 2964691889 | 2964698636 | 229 |
| 269 | iso_pu_bacteria | 2964705432 | 2964708276 | 229 |
| 270 | iso_pu_bacteria | 2964705432 | 2964708327 | 229 |
| 271 | iso_pu_bacteria | 2964719344 | 2964725224 | 229 |
| 272 | iso_pu_bacteria | 2967664464 | 2967668774 | 229 |
| 273 | iso_pu_bacteria | 2967671571 | 2967678269 | 229 |
| 274 | iso_pu_bacteria | 2967678726 | 2967685701 | 229 |
| 275 | iso_pu_bacteria | 2967686174 | 2967690765 | 229 |
| 276 | iso_pu_bacteria | 2967693043 | 2967699123 | 229 |
| 277 | iso_pu_bacteria | 2967699805 | 2967706256 | 229 |
| 278 | iso_pu_bacteria | 2967714385 | 2967718061 | 229 |
| 279 | iso_pu_bacteria | 2967721400 | 2967724484 | 229 |
| 280 | iso_pu_bacteria | 2967728569 | 2967733731 | 229 |
| 281 | iso_pu_bacteria | 2967735183 | 2967738122 | 229 |
| 282 | iso_pu_bacteria | 2967742019 | 2967747538 | 229 |
| 283 | iso_pu_bacteria | 2967748971 | 2967754335 | 229 |
| 284 | iso_pu_bacteria | 2967762386 | 2967766698 | 229 |
| 285 | iso_pu_bacteria | 2967769361 | 2967773642 | 229 |
| 286 | iso_pu_bacteria | 2970019648 | 2970020436 | 229 |
| 287 | iso_pu_bacteria | 2970026789 | 2970030273 | 229 |
| 288 | iso_pu_bacteria | 2970040964 | 2970047235 | 229 |
| 289 | iso_pu_bacteria | 2970047711 | 2970051372 | 229 |
| 290 | iso_pu_bacteria | 2970054988 | 2970060829 | 229 |
| 291 | iso_pu_bacteria | 2970061556 | 2970063613 | 229 |
| 292 | iso_pu_bacteria | 2970088815 | 2970091475 | 229 |
| 293 | iso_pu_bacteria | 2970109326 | 2970112503 | 229 |
| 294 | iso_pu_bacteria | 2970116247 | 2970121795 | 229 |
| 295 | iso_pu_bacteria | 2970122695 | 2970128010 | 229 |
| 296 | iso_pu_bacteria | 2970129317 | 2970135088 | 229 |
| 297 | iso_pu_bacteria | 2970143518 | 2970148386 | 229 |
| 298 | iso_pu_bacteria | 2970149975 | 2970154655 | 229 |
| 299 | iso_pu_bacteria | 2970156795 | 2970161849 | 229 |
| 300 | iso_pu_bacteria | 2970164137 | 2970169863 | 229 |
| 301 | iso_pu_bacteria | 2970170962 | 2970174895 | 229 |
| 302 | iso_pu_bacteria | 2970184632 | 2970188626 | 229 |
| 303 | iso_pu_bacteria | 2970191845 | 2970195704 | 229 |
| 304 | iso_pu_bacteria | 2977530762 | 2977536504 | 229 |
| 305 | iso_pu_bacteria | 2977537788 | 2977541219 | 229 |
| 306 | iso_pu_bacteria | 2977544691 | 2977549901 | 229 |
| 307 | iso_pu_bacteria | 2977551784 | 2977558084 | 229 |
| 308 | iso_pu_bacteria | 2977558990 | 2977560789 | 229 |
| 309 | iso_pu_bacteria | 2977572785 | 2977578847 | 229 |
| 310 | iso_pu_bacteria | 2977579622 | 2977585304 | 229 |
| 311 | iso_pu_bacteria | 2977858184 | 2977859516 | 229 |
| 312 | iso_pu_bacteria | 2979089926 | 2979090641 | 229 |
| 313 | iso_pu_bacteria | 2979095461 | 2979096165 | 229 |
| 314 | iso_pu_bacteria | 2979100975 | 2979101692 | 229 |
| 315 | iso_pu_bacteria | 2984509177 | 2984510355 | 229 |
| 316 | iso_pu_bacteria | 2984518228 | 2984518940 | 229 |
| 317 | iso_pu_bacteria | 2984537506 | 2984538703 | 229 |
| 318 | iso_pu_bacteria | 2984601300 | 2984605411 | 229 |
| 319 | iso_pu_bacteria | 2996887358 | 2996891452 | 229 |
| 320 | iso_pu_bacteria | 3005452660 | 3005458390 | 229 |
| 321 | iso_pu_bacteria | 3005718088 | 3005718497 | 229 |
| 322 | iso_pu_bacteria | 648276728 | 648741035 | 229 |
| 323 | iso_pu_bacteria | 8003999396 | 8004005601 | 229 |
| 324 | iso_pu_bacteria | 8004445564 | 8004449259 | 229 |
| 325 | iso_pu_bacteria | 8005258706 | 8005264003 | 229 |
| 326 | iso_pu_bacteria | 8005321885 | 8005325979 | 229 |
| 327 | iso_pu_bacteria | 8005542996 | 8005543023 | 229 |
| 328 | iso_pu_bacteria | 8018150411 | 8018150865 | 229 |
| 329 | iso_pu_bacteria | 8049293176 | 8049298120 | 229 |
| 330 | iso_pu_bacteria | 8054558443 | 8054562357 | 229 |
| 331 | 3300005329 | Ga0070683_100134214 | Ga0070683_1001342142 | 230 |
| 332 | 3300005547 | Ga0070693_100129750 | Ga0070693_1001297502 | 230 |
| 333 | 3300025944 | Ga0207661_10616618 | Ga0207661_106166182 | 230 |
| 334 | 3300048914 | Ga0496111_0179915 | Ga0496111_0179915_660_1406 | 230 |
| 335 | 3300048915 | Ga0496112_0063607 | Ga0496112_0063607_1625_2371 | 230 |
| 336 | 3300048916 | Ga0496113_0599322 | Ga0496113_0599322_70_816 | 230 |
| 337 | iso_pu_bacteria | 2510461069 | 2510842991 | 230 |
| 338 | iso_pu_bacteria | 2510917022 | 2511136989 | 230 |
| 339 | iso_pu_bacteria | 2513237144 | 2513913912 | 230 |
| 340 | iso_pu_bacteria | 2513237146 | 2513927849 | 230 |
| 341 | iso_pu_bacteria | 2524023209 | 2524461537 | 230 |
| 342 | iso_pu_bacteria | 2582581299 | 2585232153 | 230 |
| 343 | iso_pu_bacteria | 2582581307 | 2585272261 | 230 |
| 344 | iso_pu_bacteria | 2582581308 | 2585282650 | 230 |
| 345 | iso_pu_bacteria | 2582581316 | 2585335718 | 230 |
| 346 | iso_pu_bacteria | 2582581866 | 2585395778 | 230 |
| 347 | iso_pu_bacteria | 2585427527 | 2585536853 | 230 |
| 348 | iso_pu_bacteria | 2585427530 | 2585555568 | 230 |
| 349 | iso_pu_bacteria | 2585427531 | 2585561675 | 230 |
| 350 | iso_pu_bacteria | 2585427590 | 2585825059 | 230 |
| 351 | iso_pu_bacteria | 2585427608 | 2585899523 | 230 |
| 352 | iso_pu_bacteria | 2585427609 | 2585906903 | 230 |
| 353 | iso_pu_bacteria | 2585428125 | 2587982324 | 230 |
| 354 | iso_pu_bacteria | 2599185170 | 2599416720 | 230 |
| 355 | iso_pu_bacteria | 2615840626 | 2616310189 | 230 |
| 356 | iso_pu_bacteria | 2615840698 | 2616551350 | 230 |
| 357 | iso_pu_bacteria | 2617270742 | 2617380900 | 230 |
| 358 | iso_pu_bacteria | 2643221558 | 2643814585 | 230 |
| 359 | iso_pu_bacteria | 2643221634 | 2644196204 | 230 |
| 360 | iso_pu_bacteria | 2667528174 | 2671114972 | 230 |
| 361 | iso_pu_bacteria | 2767802442 | 2770199367 | 230 |
| 362 | iso_pu_bacteria | 2775506902 | 2776268390 | 230 |
| 363 | iso_pu_bacteria | 2775506904 | 2776283217 | 230 |
| 364 | iso_pu_bacteria | 2775507266 | 2778176907 | 230 |
| 365 | iso_pu_bacteria | 2818991272 | 2819244842 | 230 |
| 366 | iso_pu_bacteria | 2818991448 | 2819607467 | 230 |
| 367 | iso_pu_bacteria | 2818991453 | 2819643897 | 230 |
| 368 | iso_pu_bacteria | 2838029111 | 2838031957 | 230 |
| 369 | iso_pu_bacteria | 2838661181 | 2838662136 | 230 |
| 370 | iso_pu_bacteria | 2842298080 | 2842303117 | 230 |
| 371 | iso_pu_bacteria | 2842357229 | 2842361407 | 230 |
| 372 | iso_pu_bacteria | 2842475841 | 2842478689 | 230 |
| 373 | iso_pu_bacteria | 2842482326 | 2842486403 | 230 |
| 374 | iso_pu_bacteria | 2842502639 | 2842505992 | 230 |
| 375 | iso_pu_bacteria | 2842509118 | 2842513577 | 230 |
| 376 | iso_pu_bacteria | 2852387548 | 2852393407 | 230 |
| 377 | iso_pu_bacteria | 2919408235 | 2919411882 | 230 |
| 378 | iso_pu_bacteria | 2923556063 | 2923559055 | 230 |
| 379 | iso_pu_bacteria | 2933016740 | 2933021161 | 230 |
| 380 | iso_pu_bacteria | 2989776772 | 2989780884 | 230 |
| 381 | iso_pu_bacteria | 3005416602 | 3005418102 | 230 |
| 382 | iso_pu_bacteria | 8005246636 | 8005250567 | 230 |
| 383 | iso_pu_bacteria | 8005314921 | 8005317947 | 230 |
| 384 | iso_pu_bacteria | 8005484373 | 8005486135 | 230 |
| 385 | iso_pu_bacteria | 8005645114 | 8005650968 | 230 |
| 386 | iso_pu_bacteria | 8005682033 | 8005688250 | 230 |
| 387 | iso_pu_bacteria | 8055431914 | 8055434836 | 230 |
| 388 | iso_pu_bacteria | 8057575449 | 8057579342 | 230 |
| 389 | 3300003323 | rootH1_10233468 | rootH1_102334682 | 231 |
| 390 | 3300005327 | Ga0070658_10177806 | Ga0070658_101778062 | 231 |
| 391 | 3300025909 | Ga0207705_10164807 | Ga0207705_101648072 | 231 |
| 392 | 3300031731 | Ga0307405_10045830 | Ga0307405_100458301 | 231 |
| 393 | 3300049569 | Ga0501032_0050973 | Ga0501032_0050973_1714_2463 | 231 |
| 394 | 3300049569 | Ga0501032_0162988 | Ga0501032_0162988_399_1148 | 231 |
| 395 | 3300049574 | Ga0501038_0535945 | Ga0501038_0535945_92_841 | 231 |
| 396 | 3300049580 | Ga0501046_0013466 | Ga0501046_0013466_4959_5708 | 231 |
| 397 | 3300049586 | Ga0501070_0190247 | Ga0501070_0190247_216_965 | 231 |
| 398 | 3300003203 | JGI25406J46586_10067921 | JGI25406J46586_100679211 | 232 |
| 399 | 3300005539 | Ga0068853_100572991 | Ga0068853_1005729911 | 232 |
| 400 | 3300005985 | Ga0081539_10003922 | Ga0081539_100039226 | 232 |
| 401 | 3300009093 | Ga0105240_11115568 | Ga0105240_111155681 | 232 |
| 402 | 3300009545 | Ga0105237_10113948 | Ga0105237_101139483 | 232 |
| 403 | 3300009551 | Ga0105238_10036176 | Ga0105238_100361762 | 232 |
| 404 | 3300010375 | Ga0105239_11120350 | Ga0105239_111203501 | 232 |
| 405 | 3300025913 | Ga0207695_10596650 | Ga0207695_105966501 | 232 |
| 406 | 3300026041 | Ga0207639_10540986 | Ga0207639_105409861 | 232 |
| 407 | 3300026078 | Ga0207702_10824140 | Ga0207702_108241401 | 232 |
| 408 | 3300039437 | Ga0436365_0173076 | Ga0436365_0173076_560_1312 | 232 |
| 409 | 3300039450 | Ga0436363_1341968 | Ga0436363_1341968_32_784 | 232 |
| 410 | 3300044694 | Ga0466963_0250738 | Ga0466963_0250738_373_1125 | 232 |
| 411 | 3300044842 | Ga0466957_0125938 | Ga0466957_0125938_349_1101 | 232 |
| 412 | 3300045836 | Ga0466958_0155327 | Ga0466958_0155327_402_1154 | 232 |
| 413 | 3300045976 | Ga0466967_0762071 | Ga0466967_0762071_156_908 | 232 |
| 414 | iso_pu_bacteria | 2509276033 | 2509441889 | 232 |
| 415 | iso_pu_bacteria | 2510065019 | 2510137486 | 232 |
| 416 | iso_pu_bacteria | 2510461076 | 2510893384 | 232 |
| 417 | iso_pu_bacteria | 2513237084 | 2513572134 | 232 |
| 418 | iso_pu_bacteria | 2513237085 | 2513575956 | 232 |
| 419 | iso_pu_bacteria | 2513237093 | 2513633610 | 232 |
| 420 | iso_pu_bacteria | 2513237103 | 2513712200 | 232 |
| 421 | iso_pu_bacteria | 2513237162 | 2514019165 | 232 |
| 422 | iso_pu_bacteria | 2515075009 | 2515109557 | 232 |
| 423 | iso_pu_bacteria | 2515154113 | 2515634324 | 232 |
| 424 | iso_pu_bacteria | 2515154114 | 2515641797 | 232 |
| 425 | iso_pu_bacteria | 2515154116 | 2515658935 | 232 |
| 426 | iso_pu_bacteria | 2515154134 | 2515742632 | 232 |
| 427 | iso_pu_bacteria | 2516653077 | 2517042624 | 232 |
| 428 | iso_pu_bacteria | 2516653085 | 2517081413 | 232 |
| 429 | iso_pu_bacteria | 2517093000 | 2517100204 | 232 |
| 430 | iso_pu_bacteria | 2517287029 | 2517411185 | 232 |
| 431 | iso_pu_bacteria | 2519899620 | 2520380173 | 232 |
| 432 | iso_pu_bacteria | 2529292951 | 2530648626 | 232 |
| 433 | iso_pu_bacteria | 2585427526 | 2585526500 | 232 |
| 434 | iso_pu_bacteria | 2585427528 | 2585538794 | 232 |
| 435 | iso_pu_bacteria | 2585427593 | 2585836745 | 232 |
| 436 | iso_pu_bacteria | 2615840624 | 2616294336 | 232 |
| 437 | iso_pu_bacteria | 2643221643 | 2644241894 | 232 |
| 438 | iso_pu_bacteria | 2718217882 | 2719184174 | 232 |
| 439 | iso_pu_bacteria | 2718217927 | 2719389917 | 232 |
| 440 | iso_pu_bacteria | 2718217997 | 2719669517 | 232 |
| 441 | iso_pu_bacteria | 2718218009 | 2719729747 | 232 |
| 442 | iso_pu_bacteria | 2718218199 | 2720494533 | 232 |
| 443 | iso_pu_bacteria | 2718218232 | 2720610869 | 232 |
| 444 | iso_pu_bacteria | 2718218233 | 2720616747 | 232 |
| 445 | iso_pu_bacteria | 2718218235 | 2720628104 | 232 |
| 446 | iso_pu_bacteria | 2718218269 | 2720771684 | 232 |
| 447 | iso_pu_bacteria | 2718218363 | 2721143997 | 232 |
| 448 | iso_pu_bacteria | 2718218365 | 2721156685 | 232 |
| 449 | iso_pu_bacteria | 2718218366 | 2721161372 | 232 |
| 450 | iso_pu_bacteria | 2718218423 | 2721403556 | 232 |
| 451 | iso_pu_bacteria | 2721755514 | 2722837325 | 232 |
| 452 | iso_pu_bacteria | 2721755556 | 2723030947 | 232 |
| 453 | iso_pu_bacteria | 2721755684 | 2723563447 | 232 |
| 454 | iso_pu_bacteria | 2721755685 | 2723571438 | 232 |
| 455 | iso_pu_bacteria | 2721755809 | 2724035132 | 232 |
| 456 | iso_pu_bacteria | 2721755810 | 2724040901 | 232 |
| 457 | iso_pu_bacteria | 2721755819 | 2724087233 | 232 |
| 458 | iso_pu_bacteria | 2721755822 | 2724100944 | 232 |
| 459 | iso_pu_bacteria | 2721755823 | 2724108187 | 232 |
| 460 | iso_pu_bacteria | 2724679232 | 2725946351 | 232 |
| 461 | iso_pu_bacteria | 2728369352 | 2730105413 | 232 |
| 462 | iso_pu_bacteria | 2728369365 | 2730162314 | 232 |
| 463 | iso_pu_bacteria | 2728369397 | 2730295446 | 232 |
| 464 | iso_pu_bacteria | 2738541333 | 2739034216 | 232 |
| 465 | iso_pu_bacteria | 2765235942 | 2766068250 | 232 |
| 466 | iso_pu_bacteria | 2775506901 | 2776266411 | 232 |
| 467 | iso_pu_bacteria | 2791355256 | 2793295830 | 232 |
| 468 | iso_pu_bacteria | 2791355259 | 2793312772 | 232 |
| 469 | iso_pu_bacteria | 2791355260 | 2793321912 | 232 |
| 470 | iso_pu_bacteria | 2791355261 | 2793326842 | 232 |
| 471 | iso_pu_bacteria | 2791355262 | 2793334675 | 232 |
| 472 | iso_pu_bacteria | 2791355263 | 2793340710 | 232 |
| 473 | iso_pu_bacteria | 2791355264 | 2793348633 | 232 |
| 474 | iso_pu_bacteria | 2791355265 | 2793354258 | 232 |
| 475 | iso_pu_bacteria | 2791355267 | 2793367321 | 232 |
| 476 | iso_pu_bacteria | 2802429605 | 2805929737 | 232 |
| 477 | iso_pu_bacteria | 2802429606 | 2805933085 | 232 |
| 478 | iso_pu_bacteria | 2802429633 | 2806043016 | 232 |
| 479 | iso_pu_bacteria | 2802429634 | 2806050969 | 232 |
| 480 | iso_pu_bacteria | 2802429635 | 2806057863 | 232 |
| 481 | iso_pu_bacteria | 2802429636 | 2806065421 | 232 |
| 482 | iso_pu_bacteria | 2802429637 | 2806075338 | 232 |
| 483 | iso_pu_bacteria | 2838016132 | 2838019582 | 232 |
| 484 | iso_pu_bacteria | 2838022645 | 2838028462 | 232 |
| 485 | iso_pu_bacteria | 2838061910 | 2838066369 | 232 |
| 486 | iso_pu_bacteria | 2838068647 | 2838072451 | 232 |
| 487 | iso_pu_bacteria | 2838668709 | 2838669026 | 232 |
| 488 | iso_pu_bacteria | 2838686498 | 2838688431 | 232 |
| 489 | iso_pu_bacteria | 2838701080 | 2838701314 | 232 |
| 490 | iso_pu_bacteria | 2838729681 | 2838734434 | 232 |
| 491 | iso_pu_bacteria | 2838742623 | 2838746893 | 232 |
| 492 | iso_pu_bacteria | 2841851746 | 2841852172 | 232 |
| 493 | iso_pu_bacteria | 2842110456 | 2842111643 | 232 |
| 494 | iso_pu_bacteria | 2842146304 | 2842146621 | 232 |
| 495 | iso_pu_bacteria | 2842156927 | 2842158753 | 232 |
| 496 | iso_pu_bacteria | 2842163707 | 2842166182 | 232 |
| 497 | iso_pu_bacteria | 2842180545 | 2842182367 | 232 |
| 498 | iso_pu_bacteria | 2842192696 | 2842193985 | 232 |
| 499 | iso_pu_bacteria | 2842198810 | 2842204434 | 232 |
| 500 | iso_pu_bacteria | 2842205361 | 2842208570 | 232 |
| 501 | iso_pu_bacteria | 2842229732 | 2842234620 | 232 |
| 502 | iso_pu_bacteria | 2842243621 | 2842248353 | 232 |
| 503 | iso_pu_bacteria | 2842250916 | 2842251149 | 232 |
| 504 | iso_pu_bacteria | 2842257432 | 2842262474 | 232 |
| 505 | iso_pu_bacteria | 2842271015 | 2842272619 | 232 |
| 506 | iso_pu_bacteria | 2842278818 | 2842282084 | 232 |
| 507 | iso_pu_bacteria | 2842285085 | 2842289129 | 232 |
| 508 | iso_pu_bacteria | 2842304105 | 2842307940 | 232 |
| 509 | iso_pu_bacteria | 2842311132 | 2842313175 | 232 |
| 510 | iso_pu_bacteria | 2842317721 | 2842319398 | 232 |
| 511 | iso_pu_bacteria | 2842402390 | 2842407335 | 232 |
| 512 | iso_pu_bacteria | 2842409023 | 2842413416 | 232 |
| 513 | iso_pu_bacteria | 2842415677 | 2842420059 | 232 |
| 514 | iso_pu_bacteria | 2842422224 | 2842426101 | 232 |
| 515 | iso_pu_bacteria | 2842428310 | 2842430245 | 232 |
| 516 | iso_pu_bacteria | 2842441272 | 2842442803 | 232 |
| 517 | iso_pu_bacteria | 2842447887 | 2842452520 | 232 |
| 518 | iso_pu_bacteria | 2842462802 | 2842464679 | 232 |
| 519 | iso_pu_bacteria | 2842469257 | 2842470953 | 232 |
| 520 | iso_pu_bacteria | 2842489311 | 2842490747 | 232 |
| 521 | iso_pu_bacteria | 2842495871 | 2842498840 | 232 |
| 522 | iso_pu_bacteria | 2844454524 | 2844461517 | 232 |
| 523 | iso_pu_bacteria | 2857516855 | 2857520661 | 232 |
| 524 | iso_pu_bacteria | 2933570622 | 2933574390 | 232 |
| 525 | iso_pu_bacteria | 2933586486 | 2933590849 | 232 |
| 526 | iso_pu_bacteria | 2935901341 | 2935907668 | 232 |
| 527 | iso_pu_bacteria | 2936367885 | 2936370801 | 232 |
| 528 | iso_pu_bacteria | 2936381700 | 2936382497 | 232 |
| 529 | iso_pu_bacteria | 2996336353 | 2996338482 | 232 |
| 530 | iso_pu_bacteria | 2996893221 | 2996894866 | 232 |
| 531 | iso_pu_bacteria | 639633055 | 639650982 | 232 |
| 532 | iso_pu_bacteria | 8005275841 | 8005276040 | 232 |
| 533 | iso_pu_bacteria | 8005282627 | 8005287277 | 232 |
| 534 | iso_pu_bacteria | 8005289223 | 8005289980 | 232 |
| 535 | iso_pu_bacteria | 8005301065 | 8005307358 | 232 |
| 536 | iso_pu_bacteria | 8005307578 | 8005312014 | 232 |
| 537 | iso_pu_bacteria | 8005382845 | 8005389334 | 232 |
| 538 | iso_pu_bacteria | 8005395548 | 8005396803 | 232 |
| 539 | iso_pu_bacteria | 8005430974 | 8005435673 | 232 |
| 540 | iso_pu_bacteria | 8005460587 | 8005466178 | 232 |
| 541 | iso_pu_bacteria | 8005497431 | 8005503416 | 232 |
| 542 | iso_pu_bacteria | 8005556819 | 8005563316 | 232 |
| 543 | iso_pu_bacteria | 8005563573 | 8005564878 | 232 |
| 544 | iso_pu_bacteria | 8005570704 | 8005575867 | 232 |
| 545 | iso_pu_bacteria | 8005619151 | 8005625719 | 232 |
| 546 | iso_pu_bacteria | 8005626139 | 8005631976 | 232 |
| 547 | iso_pu_bacteria | 8005668836 | 8005675294 | 232 |
| 548 | iso_pu_bacteria | 8005688590 | 8005688647 | 232 |
| 549 | iso_pu_bacteria | 8005695170 | 8005695376 | 232 |
| 550 | iso_pu_bacteria | 8018127388 | 8018134651 | 232 |
| 551 | iso_pu_bacteria | 8018163183 | 8018169730 | 232 |
| 552 | iso_pu_bacteria | 8018176218 | 8018180624 | 232 |
| 553 | iso_pu_bacteria | 8023680758 | 8023686004 | 232 |
| 554 | iso_pu_bacteria | 8024479707 | 8024485399 | 232 |
| 555 | iso_pu_bacteria | 8024486573 | 8024488881 | 232 |
| 556 | iso_pu_bacteria | 8024501048 | 8024507049 | 232 |
| 557 | iso_pu_bacteria | 8056375014 | 8056381870 | 232 |
| 558 | iso_pu_bacteria | 8056382006 | 8056385387 | 232 |
| 559 | iso_pu_bacteria | 8057874678 | 8057876275 | 232 |
| 560 | 3300002773 | JGI25152J39213_1020291 | JGI25152J39213_10202912 | 233 |
| 561 | 3300003187 | JGI25151J46595_10000442 | JGI25151J46595_100004424 | 233 |
| 562 | 3300003215 | JGI25153J46596_10001705 | JGI25153J46596_100017059 | 233 |
| 563 | 3300003323 | rootH1_10020411 | rootH1_100204112 | 233 |
| 564 | 3300003771 | Ga0055526_1002425 | Ga0055526_10024252 | 233 |
| 565 | 3300003775 | Ga0055524_1006515 | Ga0055524_10065154 | 233 |
| 566 | 3300003790 | Ga0055528_1001856 | Ga0055528_10018569 | 233 |
| 567 | 3300003792 | Ga0055540_1004899 | Ga0055540_10048992 | 233 |
| 568 | 3300003792 | Ga0055540_1013560 | Ga0055540_10135602 | 233 |
| 569 | 3300003856 | Ga0058692_1001181 | Ga0058692_10011813 | 233 |
| 570 | 3300003856 | Ga0058692_1001802 | Ga0058692_10018022 | 233 |
| 571 | 3300005354 | Ga0070675_100052192 | Ga0070675_1000521922 | 233 |
| 572 | 3300005548 | Ga0070665_100114284 | Ga0070665_1001142843 | 233 |
| 573 | 3300005577 | Ga0068857_100167948 | Ga0068857_1001679482 | 233 |
| 574 | 3300005616 | Ga0068852_100096814 | Ga0068852_1000968143 | 233 |
| 575 | 3300005617 | Ga0068859_100113037 | Ga0068859_1001130372 | 233 |
| 576 | 3300005618 | Ga0068864_100102635 | Ga0068864_1001026352 | 233 |
| 577 | 3300006048 | Ga0075363_100025077 | Ga0075363_1000250772 | 233 |
| 578 | 3300006048 | Ga0075363_100075634 | Ga0075363_1000756342 | 233 |
| 579 | 3300006048 | Ga0075363_100356798 | Ga0075363_1003567981 | 233 |
| 580 | 3300006051 | Ga0075364_10003707 | Ga0075364_100037072 | 233 |
| 581 | 3300006051 | Ga0075364_10157254 | Ga0075364_101572541 | 233 |
| 582 | 3300006178 | Ga0075367_10022280 | Ga0075367_100222803 | 233 |
| 583 | 3300006178 | Ga0075367_10114506 | Ga0075367_101145062 | 233 |
| 584 | 3300006186 | Ga0075369_10009890 | Ga0075369_100098902 | 233 |
| 585 | 3300006186 | Ga0075369_10018083 | Ga0075369_100180834 | 233 |
| 586 | 3300006195 | Ga0075366_10000625 | Ga0075366_100006257 | 233 |
| 587 | 3300006195 | Ga0075366_10034805 | Ga0075366_100348052 | 233 |
| 588 | 3300006195 | Ga0075366_10236868 | Ga0075366_102368681 | 233 |
| 589 | 3300006353 | Ga0075370_10075573 | Ga0075370_100755732 | 233 |
| 590 | 3300006358 | Ga0068871_100383618 | Ga0068871_1003836182 | 233 |
| 591 | 3300006844 | Ga0075428_100131340 | Ga0075428_1001313403 | 233 |
| 592 | 3300006931 | Ga0097620_100113037 | Ga0097620_1001130372 | 233 |
| 593 | 3300006946 | Ga0079104_1018423 | Ga0079104_10184232 | 233 |
| 594 | 3300006948 | Ga0099826_10003912 | Ga0099826_100039127 | 233 |
| 595 | 3300006948 | Ga0099826_10005440 | Ga0099826_100054406 | 233 |
| 596 | 3300006948 | Ga0099826_10164118 | Ga0099826_101641182 | 233 |
| 597 | 3300009093 | Ga0105240_10006510 | Ga0105240_100065102 | 233 |
| 598 | 3300009094 | Ga0111539_10089994 | Ga0111539_100899942 | 233 |
| 599 | 3300009098 | Ga0105245_10011711 | Ga0105245_100117116 | 233 |
| 600 | 3300009148 | Ga0105243_10024296 | Ga0105243_100242962 | 233 |
| 601 | 3300009148 | Ga0105243_10173480 | Ga0105243_101734802 | 233 |
| 602 | 3300009545 | Ga0105237_10001263 | Ga0105237_100012632 | 233 |
| 603 | 3300009551 | Ga0105238_10263197 | Ga0105238_102631972 | 233 |
| 604 | 3300010375 | Ga0105239_10042797 | Ga0105239_100427974 | 233 |
| 605 | 3300013102 | Ga0157371_10000219 | Ga0157371_1000021921 | 233 |
| 606 | 3300013104 | Ga0157370_10002266 | Ga0157370_100022668 | 233 |
| 607 | 3300014325 | Ga0163163_10373201 | Ga0163163_103732012 | 233 |
| 608 | 3300021320 | Ga0214544_1000018 | Ga0214544_1000018149 | 233 |
| 609 | 3300021321 | Ga0214542_1000081 | Ga0214542_1000081118 | 233 |
| 610 | 3300021321 | Ga0214542_1019910 | Ga0214542_10199104 | 233 |
| 611 | 3300021327 | Ga0214543_1000005 | Ga0214543_1000005193 | 233 |
| 612 | 3300021327 | Ga0214543_1000042 | Ga0214543_1000042161 | 233 |
| 613 | 3300022739 | Ga0228711_1030140 | Ga0228711_10301405 | 233 |
| 614 | 3300022740 | Ga0228710_1017381 | Ga0228710_10173817 | 233 |
| 615 | 3300022740 | Ga0228710_1021493 | Ga0228710_10214935 | 233 |
| 616 | 3300022740 | Ga0228710_1022699 | Ga0228710_10226994 | 233 |
| 617 | 3300025245 | Ga0207425_1003396 | Ga0207425_10033965 | 233 |
| 618 | 3300025258 | Ga0209129_1000305 | Ga0209129_100030522 | 233 |
| 619 | 3300025273 | Ga0209673_1002509 | Ga0209673_10025092 | 233 |
| 620 | 3300025291 | Ga0209675_1022469 | Ga0209675_10224692 | 233 |
| 621 | 3300025294 | Ga0209025_1000081 | Ga0209025_1000081192 | 233 |
| 622 | 3300025295 | Ga0209564_1001882 | Ga0209564_100188213 | 233 |
| 623 | 3300025297 | Ga0209758_1000076 | Ga0209758_1000076174 | 233 |
| 624 | 3300025297 | Ga0209758_1008129 | Ga0209758_10081294 | 233 |
| 625 | 3300025299 | Ga0209256_1007753 | Ga0209256_10077532 | 233 |
| 626 | 3300025303 | Ga0209051_1004437 | Ga0209051_10044376 | 233 |
| 627 | 3300025903 | Ga0207680_10111345 | Ga0207680_101113452 | 233 |
| 628 | 3300025911 | Ga0207654_10038596 | Ga0207654_100385961 | 233 |
| 629 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008391 | 233 |
| 630 | 3300025924 | Ga0207694_10280625 | Ga0207694_102806252 | 233 |
| 631 | 3300025925 | Ga0207650_10252327 | Ga0207650_102523272 | 233 |
| 632 | 3300025935 | Ga0207709_10016371 | Ga0207709_100163712 | 233 |
| 633 | 3300025935 | Ga0207709_10155966 | Ga0207709_101559662 | 233 |
| 634 | 3300025942 | Ga0207689_10237554 | Ga0207689_102375542 | 233 |
| 635 | 3300026023 | Ga0207677_10752342 | Ga0207677_107523421 | 233 |
| 636 | 3300026095 | Ga0207676_10010301 | Ga0207676_100103014 | 233 |
| 637 | 3300026116 | Ga0207674_10101536 | Ga0207674_101015362 | 233 |
| 638 | 3300026142 | Ga0207698_10094138 | Ga0207698_100941382 | 233 |
| 639 | 3300027111 | Ga0209281_1000920 | Ga0209281_100092019 | 233 |
| 640 | 3300027111 | Ga0209281_1005534 | Ga0209281_10055343 | 233 |
| 641 | 3300027312 | Ga0209371_1000035 | Ga0209371_100003591 | 233 |
| 642 | 3300027312 | Ga0209371_1001218 | Ga0209371_100121814 | 233 |
| 643 | 3300027666 | Ga0209282_1000230 | Ga0209282_100023022 | 233 |
| 644 | 3300027666 | Ga0209282_1056745 | Ga0209282_10567452 | 233 |
| 645 | 3300027666 | Ga0209282_1061294 | Ga0209282_10612944 | 233 |
| 646 | 3300027866 | Ga0209813_10015067 | Ga0209813_100150672 | 233 |
| 647 | 3300027907 | Ga0207428_10112287 | Ga0207428_101122872 | 233 |
| 648 | 3300028379 | Ga0268266_10087731 | Ga0268266_100877313 | 233 |
| 649 | 3300028563 | Ga0265319_1003086 | Ga0265319_10030862 | 233 |
| 650 | 3300028573 | Ga0265334_10007422 | Ga0265334_100074228 | 233 |
| 651 | 3300028577 | Ga0265318_10007706 | Ga0265318_100077063 | 233 |
| 652 | 3300028577 | Ga0265318_10042860 | Ga0265318_100428602 | 233 |
| 653 | 3300028653 | Ga0265323_10002112 | Ga0265323_100021123 | 233 |
| 654 | 3300028666 | Ga0265336_10000380 | Ga0265336_100003809 | 233 |
| 655 | 3300028800 | Ga0265338_10000024 | Ga0265338_10000024177 | 233 |
| 656 | 3300029957 | Ga0265324_10001715 | Ga0265324_100017159 | 233 |
| 657 | 3300030500 | Ga0268256_1000037 | Ga0268256_100003790 | 233 |
| 658 | 3300030500 | Ga0268256_1003362 | Ga0268256_10033627 | 233 |
| 659 | 3300030744 | Ga0316181_1155915 | Ga0316181_11559151 | 233 |
| 660 | 3300031235 | Ga0265330_10080351 | Ga0265330_100803512 | 233 |
| 661 | 3300031240 | Ga0265320_10069558 | Ga0265320_100695582 | 233 |
| 662 | 3300031242 | Ga0265329_10040216 | Ga0265329_100402161 | 233 |
| 663 | 3300031247 | Ga0265340_10146663 | Ga0265340_101466632 | 233 |
| 664 | 3300031344 | Ga0265316_10162139 | Ga0265316_101621392 | 233 |
| 665 | 3300031456 | Ga0307513_10216888 | Ga0307513_102168882 | 233 |
| 666 | 3300031595 | Ga0265313_10005060 | Ga0265313_100050608 | 233 |
| 667 | 3300031711 | Ga0265314_10022794 | Ga0265314_100227943 | 233 |
| 668 | 3300031712 | Ga0265342_10013991 | Ga0265342_100139912 | 233 |
| 669 | 3300031712 | Ga0265342_10040204 | Ga0265342_100402041 | 233 |
| 670 | 3300031967 | Ga0315914_1016454 | Ga0315914_10164543 | 233 |
| 671 | 3300031967 | Ga0315914_1036005 | Ga0315914_10360051 | 233 |
| 672 | 3300033430 | Ga0315913_1013022 | Ga0315913_10130227 | 233 |
| 673 | 3300033430 | Ga0315913_1029943 | Ga0315913_10299434 | 233 |
| 674 | 3300033464 | Ga0315915_1000368 | Ga0315915_10003687 | 233 |
| 675 | 3300033464 | Ga0315915_1021320 | Ga0315915_10213207 | 233 |
| 676 | 3300039437 | Ga0436365_1627531 | Ga0436365_1627531_593_1348 | 233 |
| 677 | 3300041411 | Ga0439466_0082958 | Ga0439466_0082958_100_855 | 233 |
| 678 | 3300044694 | Ga0466963_0063382 | Ga0466963_0063382_320_1075 | 233 |
| 679 | 3300046516 | Ga0495628_0301490 | Ga0495628_0301490_229_984 | 233 |
| 680 | 3300046522 | Ga0495643_0127844 | Ga0495643_0127844_342_1157 | 233 |
| 681 | 3300046524 | Ga0495648_0023237 | Ga0495648_0023237_2177_2932 | 233 |
| 682 | 3300046558 | Ga0495633_0028246 | Ga0495633_0028246_10_825 | 233 |
| 683 | 3300046663 | Ga0495635_0432912 | Ga0495635_0432912_35_790 | 233 |
| 684 | 3300046674 | Ga0495588_0001445 | Ga0495588_0001445_3199_4014 | 233 |
| 685 | 3300046680 | Ga0495646_0224196 | Ga0495646_0224196_156_911 | 233 |
| 686 | 3300046690 | Ga0495624_0261952 | Ga0495624_0261952_243_998 | 233 |
| 687 | 3300046692 | Ga0495671_0090095 | Ga0495671_0090095_293_1108 | 233 |
| 688 | 3300047317 | Ga0495604_0232088 | Ga0495604_0232088_77_832 | 233 |
| 689 | 3300047470 | Ga0495681_0001049 | Ga0495681_0001049_14843_15658 | 233 |
| 690 | 3300047472 | Ga0495686_0016723 | Ga0495686_0016723_2944_3699 | 233 |
| 691 | 3300048090 | Ga0495615_0095846 | Ga0495615_0095846_66_821 | 233 |
| 692 | 3300048903 | Ga0496100_0212612 | Ga0496100_0212612_522_1277 | 233 |
| 693 | 3300048903 | Ga0496100_0246288 | Ga0496100_0246288_434_1189 | 233 |
| 694 | 3300048905 | Ga0496102_0566923 | Ga0496102_0566923_180_935 | 233 |
| 695 | 3300048907 | Ga0496104_0090320 | Ga0496104_0090320_1988_2803 | 233 |
| 696 | 3300048919 | Ga0496116_0013691 | Ga0496116_0013691_3326_4141 | 233 |
| 697 | 3300048920 | Ga0496117_0000066 | Ga0496117_0000066_97110_97925 | 233 |
| 698 | 3300048922 | Ga0496119_0009811 | Ga0496119_0009811_7257_8072 | 233 |
| 699 | 3300048922 | Ga0496119_0062063 | Ga0496119_0062063_387_1202 | 233 |
| 700 | 3300048923 | Ga0496120_0001197 | Ga0496120_0001197_19478_20293 | 233 |
| 701 | 3300048925 | Ga0496122_0000057 | Ga0496122_0000057_155525_156340 | 233 |
| 702 | 3300048926 | Ga0496123_0000096 | Ga0496123_0000096_17575_18390 | 233 |
| 703 | 3300048927 | Ga0496124_0019276 | Ga0496124_0019276_81_896 | 233 |
| 704 | 3300048927 | Ga0496124_0043889 | Ga0496124_0043889_440_1195 | 233 |
| 705 | 3300048928 | Ga0496125_0008410 | Ga0496125_0008410_2198_3013 | 233 |
| 706 | 3300048928 | Ga0496125_0169730 | Ga0496125_0169730_54_869 | 233 |
| 707 | 3300048929 | Ga0496126_0000430 | Ga0496126_0000430_14801_15556 | 233 |
| 708 | 3300049568 | Ga0501031_0000010 | Ga0501031_0000010_89207_89962 | 233 |
| 709 | 3300049568 | Ga0501031_0046808 | Ga0501031_0046808_1242_1997 | 233 |
| 710 | 3300049569 | Ga0501032_0000023 | Ga0501032_0000023_56474_57229 | 233 |
| 711 | 3300049569 | Ga0501032_0091610 | Ga0501032_0091610_802_1557 | 233 |
| 712 | 3300049570 | Ga0501033_0000104 | Ga0501033_0000104_44277_45032 | 233 |
| 713 | 3300049570 | Ga0501033_0032233 | Ga0501033_0032233_994_1749 | 233 |
| 714 | 3300049571 | Ga0501034_0000116 | Ga0501034_0000116_89214_89969 | 233 |
| 715 | 3300049571 | Ga0501034_0201244 | Ga0501034_0201244_17_772 | 233 |
| 716 | 3300049571 | Ga0501034_0391046 | Ga0501034_0391046_499_1254 | 233 |
| 717 | 3300049572 | Ga0501036_0000015 | Ga0501036_0000015_89214_89969 | 233 |
| 718 | 3300049572 | Ga0501036_0170914 | Ga0501036_0170914_149_904 | 233 |
| 719 | 3300049573 | Ga0501037_0000023 | Ga0501037_0000023_89314_90069 | 233 |
| 720 | 3300049574 | Ga0501038_0000025 | Ga0501038_0000025_89314_90069 | 233 |
| 721 | 3300049575 | Ga0501039_0000037 | Ga0501039_0000037_89214_89969 | 233 |
| 722 | 3300049576 | Ga0501040_0005598 | Ga0501040_0005598_5159_5914 | 233 |
| 723 | 3300049579 | Ga0501043_0000070 | Ga0501043_0000070_32650_33405 | 233 |
| 724 | 3300049579 | Ga0501043_0016194 | Ga0501043_0016194_1844_2599 | 233 |
| 725 | 3300049580 | Ga0501046_0219006 | Ga0501046_0219006_528_1283 | 233 |
| 726 | 3300049581 | Ga0501047_0001244 | Ga0501047_0001244_14957_15712 | 233 |
| 727 | 3300049588 | Ga0501072_0004650 | Ga0501072_0004650_1490_2245 | 233 |
| 728 | 3300049744 | Ga0501083_0177523 | Ga0501083_0177523_565_1320 | 233 |
| 729 | 3300049776 | Ga0501280_001581 | Ga0501280_001581_218_973 | 233 |
| 730 | 3300049822 | Ga0501035_0000074 | Ga0501035_0000074_89195_89950 | 233 |
| 731 | 3300049822 | Ga0501035_0161435 | Ga0501035_0161435_819_1574 | 233 |
| 732 | 3300049823 | Ga0501044_0000069 | Ga0501044_0000069_36006_36761 | 233 |
| 733 | 3300049824 | Ga0501045_0128427 | Ga0501045_0128427_447_1202 | 233 |
| 734 | 3300050489 | nmdc:mga03683_16660_c2 | nmdc:mga03683_16660_c2_336_1091 | 233 |
| 735 | 3300050489 | nmdc:mga03683_179392_c1 | nmdc:mga03683_179392_c1_81_896 | 233 |
| 736 | 3300050491 | nmdc:mga00v17_59_c2 | nmdc:mga00v17_59_c2_81_896 | 233 |
| 737 | 3300050492 | nmdc:mga0yw44_23882_c1 | nmdc:mga0yw44_23882_c1_2126_2881 | 233 |
| 738 | 3300050492 | nmdc:mga0yw44_68031_c1 | nmdc:mga0yw44_68031_c1_1292_2080 | 233 |
| 739 | 3300050492 | nmdc:mga0yw44_7224_c1 | nmdc:mga0yw44_7224_c1_2494_3309 | 233 |
| 740 | 3300050493 | nmdc:mga0k408_12529_c1 | nmdc:mga0k408_12529_c1_1085_1840 | 233 |
| 741 | 3300050494 | nmdc:mga06z11_134020_c1 | nmdc:mga06z11_134020_c1_472_1227 | 233 |
| 742 | 3300050494 | nmdc:mga06z11_136330_c1 | nmdc:mga06z11_136330_c1_604_1359 | 233 |
| 743 | 3300050494 | nmdc:mga06z11_15017_c1 | nmdc:mga06z11_15017_c1_1540_2355 | 233 |
| 744 | 3300050495 | nmdc:mga04h51_32080_c1 | nmdc:mga04h51_32080_c1_807_1622 | 233 |
| 745 | 3300050496 | nmdc:mga07m45_68339_c1 | nmdc:mga07m45_68339_c1_144_932 | 233 |
| 746 | 3300050516 | nmdc:mga0sz30_100424_c1 | nmdc:mga0sz30_100424_c1_143_931 | 233 |
| 747 | 3300050516 | nmdc:mga0sz30_14265_c1 | nmdc:mga0sz30_14265_c1_1817_2572 | 233 |
| 748 | 3300050516 | nmdc:mga0sz30_145567_c1 | nmdc:mga0sz30_145567_c1_236_991 | 233 |
| 749 | 3300050516 | nmdc:mga0sz30_578_c1 | nmdc:mga0sz30_578_c1_4509_5324 | 233 |
| 750 | 3300053107 | Ga0500560_000150 | Ga0500560_000150_2358_3173 | 233 |
| 751 | 3300053119 | Ga0500595_044034 | Ga0500595_044034_399_1154 | 233 |
| 752 | 3300053137 | Ga0500561_0000021 | Ga0500561_0000021_16582_17397 | 233 |
| 753 | 3300053157 | Ga0500624_000889 | Ga0500624_000889_4739_5554 | 233 |
| 754 | 3300053161 | Ga0500634_0000008 | Ga0500634_0000008_56039_56794 | 233 |
| 755 | 3300053161 | Ga0500634_0007871 | Ga0500634_0007871_3864_4619 | 233 |
| 756 | 3300053177 | Ga0500636_0000027 | Ga0500636_0000027_67426_68181 | 233 |
| 757 | 3300053177 | Ga0500636_0000679 | Ga0500636_0000679_259_1014 | 233 |
| 758 | 3300054114 | Ga0501084_0057528 | Ga0501084_0057528_1139_1894 | 233 |
| 759 | 3300060353 | Ga0501082_0000007 | Ga0501082_0000007_5115_5870 | 233 |
| 760 | 3300060353 | Ga0501082_0362003 | Ga0501082_0362003_489_1244 | 233 |
| 761 | iso_pu_bacteria | 2508501050 | 2508730178 | 233 |
| 762 | iso_pu_bacteria | 2509276018 | 2509367898 | 233 |
| 763 | iso_pu_bacteria | 2510065059 | 2510315580 | 233 |
| 764 | iso_pu_bacteria | 2510461069 | 2510842124 | 233 |
| 765 | iso_pu_bacteria | 2510917026 | 2511169060 | 233 |
| 766 | iso_pu_bacteria | 2510917030 | 2511193654 | 233 |
| 767 | iso_pu_bacteria | 2512047086 | 2512531381 | 233 |
| 768 | iso_pu_bacteria | 2513237088 | 2513595508 | 233 |
| 769 | iso_pu_bacteria | 2513237101 | 2513693476 | 233 |
| 770 | iso_pu_bacteria | 2513237138 | 2513871194 | 233 |
| 771 | iso_pu_bacteria | 2513237159 | 2513999069 | 233 |
| 772 | iso_pu_bacteria | 2558860983 | 2561468753 | 233 |
| 773 | iso_pu_bacteria | 2582581283 | 2585166619 | 233 |
| 774 | iso_pu_bacteria | 2582581294 | 2585204660 | 233 |
| 775 | iso_pu_bacteria | 2582581294 | 2585205387 | 233 |
| 776 | iso_pu_bacteria | 2582581298 | 2585221985 | 233 |
| 777 | iso_pu_bacteria | 2582581304 | 2585255439 | 233 |
| 778 | iso_pu_bacteria | 2582581306 | 2585269245 | 233 |
| 779 | iso_pu_bacteria | 2582581865 | 2585390759 | 233 |
| 780 | iso_pu_bacteria | 2582581867 | 2585403010 | 233 |
| 781 | iso_pu_bacteria | 2585427529 | 2585545062 | 233 |
| 782 | iso_pu_bacteria | 2585427590 | 2585820014 | 233 |
| 783 | iso_pu_bacteria | 2585427594 | 2585842451 | 233 |
| 784 | iso_pu_bacteria | 2585427633 | 2585992750 | 233 |
| 785 | iso_pu_bacteria | 2585427634 | 2586003412 | 233 |
| 786 | iso_pu_bacteria | 2599185210 | 2599605093 | 233 |
| 787 | iso_pu_bacteria | 2643221595 | 2643986868 | 233 |
| 788 | iso_pu_bacteria | 2643221607 | 2644052325 | 233 |
| 789 | iso_pu_bacteria | 2643221627 | 2644156289 | 233 |
| 790 | iso_pu_bacteria | 2643221636 | 2644201292 | 233 |
| 791 | iso_pu_bacteria | 2643221686 | 2644484603 | 233 |
| 792 | iso_pu_bacteria | 2643221688 | 2644494989 | 233 |
| 793 | iso_pu_bacteria | 2687453392 | 2688598373 | 233 |
| 794 | iso_pu_bacteria | 2721755755 | 2723848370 | 233 |
| 795 | iso_pu_bacteria | 2738541293 | 2738802563 | 233 |
| 796 | iso_pu_bacteria | 2756170246 | 2756672534 | 233 |
| 797 | iso_pu_bacteria | 2775506901 | 2776265153 | 233 |
| 798 | iso_pu_bacteria | 2791355123 | 2792752721 | 233 |
| 799 | iso_pu_bacteria | 2791355199 | 2793082820 | 233 |
| 800 | iso_pu_bacteria | 2821123053 | 2821126912 | 233 |
| 801 | iso_pu_bacteria | 2821123053 | 2821128914 | 233 |
| 802 | iso_pu_bacteria | 2824679649 | 2824682712 | 233 |
| 803 | iso_pu_bacteria | 2838074704 | 2838080054 | 233 |
| 804 | iso_pu_bacteria | 2841734538 | 2841739124 | 233 |
| 805 | iso_pu_bacteria | 2842521101 | 2842524813 | 233 |
| 806 | iso_pu_bacteria | 2844002411 | 2844007505 | 233 |
| 807 | iso_pu_bacteria | 2844009547 | 2844013626 | 233 |
| 808 | iso_pu_bacteria | 2856328259 | 2856334491 | 233 |
| 809 | iso_pu_bacteria | 2856334872 | 2856340387 | 233 |
| 810 | iso_pu_bacteria | 2857367948 | 2857372772 | 233 |
| 811 | iso_pu_bacteria | 2857531043 | 2857537795 | 233 |
| 812 | iso_pu_bacteria | 2869169390 | 2869171642 | 233 |
| 813 | iso_pu_bacteria | 2869169390 | 2869173370 | 233 |
| 814 | iso_pu_bacteria | 2869234852 | 2869240008 | 233 |
| 815 | iso_pu_bacteria | 2869234852 | 2869240400 | 233 |
| 816 | iso_pu_bacteria | 2869242130 | 2869245463 | 233 |
| 817 | iso_pu_bacteria | 2869242130 | 2869248822 | 233 |
| 818 | iso_pu_bacteria | 2869249662 | 2869253293 | 233 |
| 819 | iso_pu_bacteria | 2869256925 | 2869260823 | 233 |
| 820 | iso_pu_bacteria | 2869264136 | 2869268056 | 233 |
| 821 | iso_pu_bacteria | 2869271264 | 2869276458 | 233 |
| 822 | iso_pu_bacteria | 2871435913 | 2871439798 | 233 |
| 823 | iso_pu_bacteria | 2871451962 | 2871459504 | 233 |
| 824 | iso_pu_bacteria | 2871459585 | 2871466794 | 233 |
| 825 | iso_pu_bacteria | 2871466892 | 2871468279 | 233 |
| 826 | iso_pu_bacteria | 2871474448 | 2871475478 | 233 |
| 827 | iso_pu_bacteria | 2871481445 | 2871482906 | 233 |
| 828 | iso_pu_bacteria | 2871481445 | 2871485380 | 233 |
| 829 | iso_pu_bacteria | 2874109183 | 2874112557 | 233 |
| 830 | iso_pu_bacteria | 2874109183 | 2874116396 | 233 |
| 831 | iso_pu_bacteria | 2874116593 | 2874116782 | 233 |
| 832 | iso_pu_bacteria | 2874116593 | 2874116906 | 233 |
| 833 | iso_pu_bacteria | 2874131515 | 2874134486 | 233 |
| 834 | iso_pu_bacteria | 2874162495 | 2874164498 | 233 |
| 835 | iso_pu_bacteria | 2874168670 | 2874169141 | 233 |
| 836 | iso_pu_bacteria | 2874168670 | 2874169782 | 233 |
| 837 | iso_pu_bacteria | 2874604998 | 2874608666 | 233 |
| 838 | iso_pu_bacteria | 2876386047 | 2876388016 | 233 |
| 839 | iso_pu_bacteria | 2876386047 | 2876390862 | 233 |
| 840 | iso_pu_bacteria | 2876399893 | 2876403655 | 233 |
| 841 | iso_pu_bacteria | 2876420981 | 2876426911 | 233 |
| 842 | iso_pu_bacteria | 2876420981 | 2876427747 | 233 |
| 843 | iso_pu_bacteria | 2876808645 | 2876817132 | 233 |
| 844 | iso_pu_bacteria | 2878730984 | 2878732783 | 233 |
| 845 | iso_pu_bacteria | 2878730984 | 2878735884 | 233 |
| 846 | iso_pu_bacteria | 2878774303 | 2878774692 | 233 |
| 847 | iso_pu_bacteria | 2878781027 | 2878781635 | 233 |
| 848 | iso_pu_bacteria | 2878788777 | 2878795837 | 233 |
| 849 | iso_pu_bacteria | 2879110137 | 2879117867 | 233 |
| 850 | iso_pu_bacteria | 2881665667 | 2881669988 | 233 |
| 851 | iso_pu_bacteria | 2882632389 | 2882640232 | 233 |
| 852 | iso_pu_bacteria | 2889033259 | 2889037081 | 233 |
| 853 | iso_pu_bacteria | 2894652903 | 2894657491 | 233 |
| 854 | iso_pu_bacteria | 2896384573 | 2896389295 | 233 |
| 855 | iso_pu_bacteria | 2899803654 | 2899805736 | 233 |
| 856 | iso_pu_bacteria | 2899803654 | 2899807083 | 233 |
| 857 | iso_pu_bacteria | 2903513507 | 2903517494 | 233 |
| 858 | iso_pu_bacteria | 2906363423 | 2906365642 | 233 |
| 859 | iso_pu_bacteria | 2906370794 | 2906374191 | 233 |
| 860 | iso_pu_bacteria | 2906378014 | 2906382769 | 233 |
| 861 | iso_pu_bacteria | 2906401398 | 2906401744 | 233 |
| 862 | iso_pu_bacteria | 2906401398 | 2906401987 | 233 |
| 863 | iso_pu_bacteria | 2906408224 | 2906408830 | 233 |
| 864 | iso_pu_bacteria | 2906427513 | 2906433661 | 233 |
| 865 | iso_pu_bacteria | 2906427513 | 2906435464 | 233 |
| 866 | iso_pu_bacteria | 2913295892 | 2913298887 | 233 |
| 867 | iso_pu_bacteria | 2919100787 | 2919102532 | 233 |
| 868 | iso_pu_bacteria | 2919171160 | 2919174443 | 233 |
| 869 | iso_pu_bacteria | 2919171160 | 2919177142 | 233 |
| 870 | iso_pu_bacteria | 2920760137 | 2920762603 | 233 |
| 871 | iso_pu_bacteria | 2922151315 | 2922153400 | 233 |
| 872 | iso_pu_bacteria | 2922172374 | 2922175308 | 233 |
| 873 | iso_pu_bacteria | 2922178524 | 2922182892 | 233 |
| 874 | iso_pu_bacteria | 2922361189 | 2922361200 | 233 |
| 875 | iso_pu_bacteria | 2922393267 | 2922394480 | 233 |
| 876 | iso_pu_bacteria | 2923556063 | 2923559695 | 233 |
| 877 | iso_pu_bacteria | 2924710171 | 2924717599 | 233 |
| 878 | iso_pu_bacteria | 2924733363 | 2924735865 | 233 |
| 879 | iso_pu_bacteria | 2924741084 | 2924744084 | 233 |
| 880 | iso_pu_bacteria | 2924741084 | 2924747365 | 233 |
| 881 | iso_pu_bacteria | 2924748358 | 2924749355 | 233 |
| 882 | iso_pu_bacteria | 2933011516 | 2933016275 | 233 |
| 883 | iso_pu_bacteria | 2937836603 | 2937839312 | 233 |
| 884 | iso_pu_bacteria | 2937861824 | 2937862955 | 233 |
| 885 | iso_pu_bacteria | 2937861824 | 2937868408 | 233 |
| 886 | iso_pu_bacteria | 2937868953 | 2937870263 | 233 |
| 887 | iso_pu_bacteria | 2937980651 | 2937986403 | 233 |
| 888 | iso_pu_bacteria | 2937980651 | 2937987236 | 233 |
| 889 | iso_pu_bacteria | 2939669807 | 2939671917 | 233 |
| 890 | iso_pu_bacteria | 2958071322 | 2958072048 | 233 |
| 891 | iso_pu_bacteria | 2958108152 | 2958110484 | 233 |
| 892 | iso_pu_bacteria | 2958108152 | 2958113267 | 233 |
| 893 | iso_pu_bacteria | 2958158011 | 2958161508 | 233 |
| 894 | iso_pu_bacteria | 2961136820 | 2961143148 | 233 |
| 895 | iso_pu_bacteria | 2961183825 | 2961184347 | 233 |
| 896 | iso_pu_bacteria | 2961183825 | 2961186098 | 233 |
| 897 | iso_pu_bacteria | 2965025482 | 2965031828 | 233 |
| 898 | iso_pu_bacteria | 2965032056 | 2965035160 | 233 |
| 899 | iso_pu_bacteria | 2965040258 | 2965045349 | 233 |
| 900 | iso_pu_bacteria | 2965047637 | 2965054831 | 233 |
| 901 | iso_pu_bacteria | 2965089291 | 2965096007 | 233 |
| 902 | iso_pu_bacteria | 2965102966 | 2965107843 | 233 |
| 903 | iso_pu_bacteria | 2965110997 | 2965118971 | 233 |
| 904 | iso_pu_bacteria | 2968138860 | 2968142182 | 233 |
| 905 | iso_pu_bacteria | 2970489779 | 2970492955 | 233 |
| 906 | iso_pu_bacteria | 2970510686 | 2970517028 | 233 |
| 907 | iso_pu_bacteria | 2970510686 | 2970517397 | 233 |
| 908 | iso_pu_bacteria | 2970532167 | 2970534599 | 233 |
| 909 | iso_pu_bacteria | 2970532167 | 2970535158 | 233 |
| 910 | iso_pu_bacteria | 2970547951 | 2970548932 | 233 |
| 911 | iso_pu_bacteria | 2970619444 | 2970623012 | 233 |
| 912 | iso_pu_bacteria | 2970627176 | 2970627521 | 233 |
| 913 | iso_pu_bacteria | 2970627176 | 2970628771 | 233 |
| 914 | iso_pu_bacteria | 2977851361 | 2977855843 | 233 |
| 915 | iso_pu_bacteria | 2977851361 | 2977856645 | 233 |
| 916 | iso_pu_bacteria | 2977864932 | 2977868549 | 233 |
| 917 | iso_pu_bacteria | 2977872689 | 2977873300 | 233 |
| 918 | iso_pu_bacteria | 2977898635 | 2977900042 | 233 |
| 919 | iso_pu_bacteria | 2977907340 | 2977909233 | 233 |
| 920 | iso_pu_bacteria | 2977907340 | 2977909783 | 233 |
| 921 | iso_pu_bacteria | 2977915119 | 2977915475 | 233 |
| 922 | iso_pu_bacteria | 2977935797 | 2977936089 | 233 |
| 923 | iso_pu_bacteria | 2977950692 | 2977954852 | 233 |
| 924 | iso_pu_bacteria | 2977957713 | 2977963007 | 233 |
| 925 | iso_pu_bacteria | 2979764755 | 2979769424 | 233 |
| 926 | iso_pu_bacteria | 2979764755 | 2979770302 | 233 |
| 927 | iso_pu_bacteria | 2979772303 | 2979774188 | 233 |
| 928 | iso_pu_bacteria | 2979772303 | 2979777985 | 233 |
| 929 | iso_pu_bacteria | 2979793036 | 2979794100 | 233 |
| 930 | iso_pu_bacteria | 2987645492 | 2987649581 | 233 |
| 931 | iso_pu_bacteria | 2987673487 | 2987680839 | 233 |
| 932 | iso_pu_bacteria | 2996386984 | 2996392274 | 233 |
| 933 | iso_pu_bacteria | 3003665799 | 3003667402 | 233 |
| 934 | iso_pu_bacteria | 3003930520 | 3003935026 | 233 |
| 935 | iso_pu_bacteria | 3004167301 | 3004168822 | 233 |
| 936 | iso_pu_bacteria | 3004195979 | 3004201254 | 233 |
| 937 | iso_pu_bacteria | 3004232784 | 3004236089 | 233 |
| 938 | iso_pu_bacteria | 3004232784 | 3004237087 | 233 |
| 939 | iso_pu_bacteria | 3004239961 | 3004240027 | 233 |
| 940 | iso_pu_bacteria | 3004248173 | 3004249091 | 233 |
| 941 | iso_pu_bacteria | 3004248173 | 3004253925 | 233 |
| 942 | iso_pu_bacteria | 3004268573 | 3004274863 | 233 |
| 943 | iso_pu_bacteria | 3005594810 | 3005597920 | 233 |
| 944 | iso_pu_bacteria | 643692032 | 643824077 | 233 |
| 945 | iso_pu_bacteria | 649633066 | 649872901 | 233 |
| 946 | iso_pu_bacteria | 650716007 | 650843720 | 233 |
| 947 | iso_pu_bacteria | 8003570095 | 8003574019 | 233 |
| 948 | iso_pu_bacteria | 8004300914 | 8004303841 | 233 |
| 949 | iso_pu_bacteria | 8004312739 | 8004317421 | 233 |
| 950 | iso_pu_bacteria | 8004361976 | 8004362213 | 233 |
| 951 | iso_pu_bacteria | 8004633249 | 8004638652 | 233 |
| 952 | iso_pu_bacteria | 8004695233 | 8004700865 | 233 |
| 953 | iso_pu_bacteria | 8004727605 | 8004728658 | 233 |
| 954 | iso_pu_bacteria | 8004727605 | 8004729819 | 233 |
| 955 | iso_pu_bacteria | 8006964411 | 8006967944 | 233 |
| 956 | iso_pu_bacteria | 8006984368 | 8006984761 | 233 |
| 957 | iso_pu_bacteria | 8006994254 | 8006999691 | 233 |
| 958 | 3300002704 | JGI25155J39150_1000047 | JGI25155J39150_100004746 | 234 |
| 959 | 3300002705 | JGI25156J39149_1000069 | JGI25156J39149_100006948 | 234 |
| 960 | 3300002737 | JGI25162J39368_1001511 | JGI25162J39368_10015119 | 234 |
| 961 | 3300002738 | JGI25154J39366_1000091 | JGI25154J39366_100009126 | 234 |
| 962 | 3300002741 | JGI25157J39369_1000085 | JGI25157J39369_100008548 | 234 |
| 963 | 3300003214 | JGI25165J46597_1000505 | JGI25165J46597_100050510 | 234 |
| 964 | 3300003214 | JGI25165J46597_1004580 | JGI25165J46597_10045803 | 234 |
| 965 | 3300003215 | JGI25153J46596_10047318 | JGI25153J46596_100473182 | 234 |
| 966 | 3300003322 | rootL2_10000436 | rootL2_100004368 | 234 |
| 967 | 3300003322 | rootL2_10229133 | rootL2_102291333 | 234 |
| 968 | 3300003323 | rootH1_10130821 | rootH1_101308213 | 234 |
| 969 | 3300003354 | JGI25160J50197_1000040 | JGI25160J50197_1000040143 | 234 |
| 970 | 3300003374 | JGI25161J50226_1000023 | JGI25161J50226_1000023143 | 234 |
| 971 | 3300004625 | Ga0055543_1001620 | Ga0055543_10016205 | 234 |
| 972 | 3300005262 | Ga0065165_1000484 | Ga0065165_100048461 | 234 |
| 973 | 3300005563 | Ga0068855_100535566 | Ga0068855_1005355662 | 234 |
| 974 | 3300006353 | Ga0075370_10008891 | Ga0075370_100088912 | 234 |
| 975 | 3300009093 | Ga0105240_10000214 | Ga0105240_10000214116 | 234 |
| 976 | 3300009545 | Ga0105237_10034873 | Ga0105237_100348735 | 234 |
| 977 | 3300013104 | Ga0157370_10060520 | Ga0157370_100605203 | 234 |
| 978 | 3300013105 | Ga0157369_10048441 | Ga0157369_100484413 | 234 |
| 979 | 3300015262 | Ga0182007_10002152 | Ga0182007_100021525 | 234 |
| 980 | 3300015265 | Ga0182005_1022000 | Ga0182005_10220002 | 234 |
| 981 | 3300025206 | Ga0209435_100058 | Ga0209435_10005827 | 234 |
| 982 | 3300025233 | Ga0209437_100239 | Ga0209437_10023955 | 234 |
| 983 | 3300025246 | Ga0209646_1000178 | Ga0209646_100017827 | 234 |
| 984 | 3300025250 | Ga0209026_1000208 | Ga0209026_100020827 | 234 |
| 985 | 3300025253 | Ga0209677_100248 | Ga0209677_10024833 | 234 |
| 986 | 3300025256 | Ga0209759_1000242 | Ga0209759_100024227 | 234 |
| 987 | 3300025261 | Ga0209233_1000245 | Ga0209233_100024527 | 234 |
| 988 | 3300025261 | Ga0209233_1000340 | Ga0209233_100034036 | 234 |
| 989 | 3300025284 | Ga0209130_1000142 | Ga0209130_1000142109 | 234 |
| 990 | 3300025297 | Ga0209758_1005376 | Ga0209758_10053765 | 234 |
| 991 | 3300025302 | Ga0207426_1000076 | Ga0207426_1000076295 | 234 |
| 992 | 3300025913 | Ga0207695_10000373 | Ga0207695_1000037399 | 234 |
| 993 | 3300025914 | Ga0207671_10000536 | Ga0207671_1000053641 | 234 |
| 994 | 3300025949 | Ga0207667_10689577 | Ga0207667_106895772 | 234 |
| 995 | 3300025981 | Ga0207640_10428823 | Ga0207640_104288232 | 234 |
| 996 | 3300027312 | Ga0209371_1006004 | Ga0209371_10060042 | 234 |
| 997 | 3300030500 | Ga0268256_1006002 | Ga0268256_10060022 | 234 |
| 998 | 3300031727 | Ga0316576_10061783 | Ga0316576_100617833 | 234 |
| 999 | 3300042007 | Ga0439449_0055506 | Ga0439449_0055506_197_955 | 234 |
| 1000 | 3300044694 | Ga0466963_0005475 | Ga0466963_0005475_5538_6296 | 234 |
| 1001 | 3300044765 | Ga0466970_0000198 | Ga0466970_0000198_22489_23247 | 234 |
| 1002 | 3300044842 | Ga0466957_0065990 | Ga0466957_0065990_931_1689 | 234 |
| 1003 | 3300045836 | Ga0466958_0073454 | Ga0466958_0073454_1283_2041 | 234 |
| 1004 | 3300045976 | Ga0466967_0082967 | Ga0466967_0082967_869_1627 | 234 |
| 1005 | 3300046506 | Ga0495583_0001051 | Ga0495583_0001051_24621_25379 | 234 |
| 1006 | 3300046522 | Ga0495643_0007516 | Ga0495643_0007516_2360_3118 | 234 |
| 1007 | 3300046660 | Ga0495625_0016210 | Ga0495625_0016210_3710_4468 | 234 |
| 1008 | 3300046665 | Ga0495661_0172149 | Ga0495661_0172149_293_1054 | 234 |
| 1009 | 3300047443 | Ga0495687_007825 | Ga0495687_007825_1663_2421 | 234 |
| 1010 | 3300047443 | Ga0495687_044962 | Ga0495687_044962_302_1060 | 234 |
| 1011 | 3300048905 | Ga0496102_0028748 | Ga0496102_0028748_104_862 | 234 |
| 1012 | 3300048906 | Ga0496103_0007016 | Ga0496103_0007016_2898_3656 | 234 |
| 1013 | 3300048910 | Ga0496107_0088138 | Ga0496107_0088138_377_1135 | 234 |
| 1014 | 3300048920 | Ga0496117_0030766 | Ga0496117_0030766_2828_3586 | 234 |
| 1015 | 3300048921 | Ga0496118_0026933 | Ga0496118_0026933_3597_4355 | 234 |
| 1016 | 3300048922 | Ga0496119_0032320 | Ga0496119_0032320_2049_2807 | 234 |
| 1017 | 3300048922 | Ga0496119_0114470 | Ga0496119_0114470_497_1267 | 234 |
| 1018 | 3300048923 | Ga0496120_0019205 | Ga0496120_0019205_820_1578 | 234 |
| 1019 | 3300048924 | Ga0496121_0121865 | Ga0496121_0121865_992_1762 | 234 |
| 1020 | 3300048924 | Ga0496121_0132257 | Ga0496121_0132257_249_1019 | 234 |
| 1021 | 3300048924 | Ga0496121_0157257 | Ga0496121_0157257_14_772 | 234 |
| 1022 | 3300048924 | Ga0496121_0157259 | Ga0496121_0157259_895_1653 | 234 |
| 1023 | 3300048925 | Ga0496122_0028627 | Ga0496122_0028627_432_1190 | 234 |
| 1024 | 3300048926 | Ga0496123_0005115 | Ga0496123_0005115_445_1203 | 234 |
| 1025 | 3300048927 | Ga0496124_0006914 | Ga0496124_0006914_11012_11770 | 234 |
| 1026 | 3300048927 | Ga0496124_0297912 | Ga0496124_0297912_110_868 | 234 |
| 1027 | 3300048928 | Ga0496125_0020272 | Ga0496125_0020272_2214_2972 | 234 |
| 1028 | 3300048928 | Ga0496125_0069639 | Ga0496125_0069639_996_1754 | 234 |
| 1029 | 3300048928 | Ga0496125_0090250 | Ga0496125_0090250_328_1098 | 234 |
| 1030 | 3300048929 | Ga0496126_0010075 | Ga0496126_0010075_8553_9311 | 234 |
| 1031 | 3300048929 | Ga0496126_0058498 | Ga0496126_0058498_46_804 | 234 |
| 1032 | iso_pu_bacteria | 2582581298 | 2585226287 | 234 |
| 1033 | iso_pu_bacteria | 2585427529 | 2585548793 | 234 |
| 1034 | iso_pu_bacteria | 2643221591 | 2643963161 | 234 |
| 1035 | iso_pu_bacteria | 2838035591 | 2838036829 | 234 |
| 1036 | iso_pu_bacteria | 2924762789 | 2924765042 | 234 |
| 1037 | iso_pu_bacteria | 2937822353 | 2937824374 | 234 |
| 1038 | iso_pu_bacteria | 2987666974 | 2987667948 | 234 |
| 1039 | 3300005983 | Ga0081540_1003572 | Ga0081540_10035726 | 235 |
| 1040 | 3300031616 | Ga0307508_10126581 | Ga0307508_101265812 | 235 |
| 1041 | 3300035691 | Ga0373931_0258265 | Ga0373931_0258265_30_791 | 235 |
| 1042 | 3300046515 | Ga0495620_0010070 | Ga0495620_0010070_2706_3467 | 235 |
| 1043 | 3300046794 | Ga0495589_0147371 | Ga0495589_0147371_137_898 | 235 |
| 1044 | 3300047323 | Ga0495683_0001428 | Ga0495683_0001428_3933_4694 | 235 |
| 1045 | 3300047469 | Ga0495673_0020859 | Ga0495673_0020859_1058_1819 | 235 |
| 1046 | 3300048903 | Ga0496100_0010828 | Ga0496100_0010828_1788_2549 | 235 |
| 1047 | 3300048904 | Ga0496101_0001581 | Ga0496101_0001581_11877_12638 | 235 |
| 1048 | 3300048905 | Ga0496102_0000981 | Ga0496102_0000981_17435_18196 | 235 |
| 1049 | 3300048906 | Ga0496103_0000660 | Ga0496103_0000660_15028_15789 | 235 |
| 1050 | 3300048907 | Ga0496104_0009153 | Ga0496104_0009153_5476_6237 | 235 |
| 1051 | 3300048909 | Ga0496106_0003138 | Ga0496106_0003138_3943_4704 | 235 |
| 1052 | 3300048910 | Ga0496107_0005547 | Ga0496107_0005547_1106_1867 | 235 |
| 1053 | 3300048912 | Ga0496109_0414861 | Ga0496109_0414861_68_829 | 235 |
| 1054 | 3300048913 | Ga0496110_0001494 | Ga0496110_0001494_861_1622 | 235 |
| 1055 | 3300048914 | Ga0496111_0015312 | Ga0496111_0015312_1619_2380 | 235 |
| 1056 | 3300048915 | Ga0496112_0000725 | Ga0496112_0000725_21233_21994 | 235 |
| 1057 | 3300048916 | Ga0496113_0005964 | Ga0496113_0005964_2994_3755 | 235 |
| 1058 | 3300048919 | Ga0496116_0001582 | Ga0496116_0001582_7838_8599 | 235 |
| 1059 | 3300048920 | Ga0496117_0069530 | Ga0496117_0069530_1465_2226 | 235 |
| 1060 | 3300048921 | Ga0496118_0072878 | Ga0496118_0072878_1435_2196 | 235 |
| 1061 | 3300048924 | Ga0496121_0038400 | Ga0496121_0038400_2488_3249 | 235 |
| 1062 | 3300048925 | Ga0496122_0002747 | Ga0496122_0002747_17653_18414 | 235 |
| 1063 | 3300048926 | Ga0496123_0010599 | Ga0496123_0010599_1630_2391 | 235 |
| 1064 | 3300048927 | Ga0496124_0004690 | Ga0496124_0004690_5233_5994 | 235 |
| 1065 | 3300048928 | Ga0496125_0011332 | Ga0496125_0011332_2519_3280 | 235 |
| 1066 | 3300053735 | Ga0500596_002261 | Ga0500596_002261_1014_1805 | 235 |
| 1067 | iso_pu_bacteria | 2510917030 | 2511194709 | 235 |
| 1068 | iso_pu_bacteria | 2585427528 | 2585538962 | 235 |
| 1069 | iso_pu_bacteria | 2585427593 | 2585836912 | 235 |
| 1070 | iso_pu_bacteria | 2802429633 | 2806043182 | 235 |
| 1071 | iso_pu_bacteria | 2802429634 | 2806051133 | 235 |
| 1072 | iso_pu_bacteria | 2802429635 | 2806057695 | 235 |
| 1073 | iso_pu_bacteria | 2802429636 | 2806065588 | 235 |
| 1074 | iso_pu_bacteria | 2802429637 | 2806075182 | 235 |
| 1075 | iso_pu_bacteria | 2902682994 | 2902687785 | 235 |
| 1076 | iso_pu_bacteria | 8005570704 | 8005576037 | 235 |
| 1077 | iso_pu_bacteria | 8054563764 | 8054565951 | 235 |
| 1078 | 3300003187 | JGI25151J46595_10000337 | JGI25151J46595_1000033725 | 236 |
| 1079 | 3300003203 | JGI25406J46586_10046501 | JGI25406J46586_100465012 | 236 |
| 1080 | 3300003215 | JGI25153J46596_10002607 | JGI25153J46596_100026074 | 236 |
| 1081 | 3300003354 | JGI25160J50197_1002870 | JGI25160J50197_10028701 | 236 |
| 1082 | 3300003374 | JGI25161J50226_1002292 | JGI25161J50226_10022923 | 236 |
| 1083 | 3300003771 | Ga0055526_1001366 | Ga0055526_10013666 | 236 |
| 1084 | 3300003771 | Ga0055526_1005586 | Ga0055526_10055866 | 236 |
| 1085 | 3300003771 | Ga0055526_1054777 | Ga0055526_10547771 | 236 |
| 1086 | 3300003775 | Ga0055524_1001200 | Ga0055524_100120010 | 236 |
| 1087 | 3300003775 | Ga0055524_1018578 | Ga0055524_10185782 | 236 |
| 1088 | 3300003775 | Ga0055524_1033400 | Ga0055524_10334002 | 236 |
| 1089 | 3300003790 | Ga0055528_1000684 | Ga0055528_100068411 | 236 |
| 1090 | 3300003790 | Ga0055528_1001834 | Ga0055528_10018346 | 236 |
| 1091 | 3300003790 | Ga0055528_1032308 | Ga0055528_10323082 | 236 |
| 1092 | 3300003790 | Ga0055528_1040001 | Ga0055528_10400011 | 236 |
| 1093 | 3300003792 | Ga0055540_1000066 | Ga0055540_1000066114 | 236 |
| 1094 | 3300003792 | Ga0055540_1008406 | Ga0055540_10084062 | 236 |
| 1095 | 3300004625 | Ga0055543_1001035 | Ga0055543_10010354 | 236 |
| 1096 | 3300005262 | Ga0065165_1010245 | Ga0065165_10102454 | 236 |
| 1097 | 3300005331 | Ga0070670_100023690 | Ga0070670_1000236905 | 236 |
| 1098 | 3300005985 | Ga0081539_10002462 | Ga0081539_1000246225 | 236 |
| 1099 | 3300006038 | Ga0075365_10001142 | Ga0075365_100011426 | 236 |
| 1100 | 3300006048 | Ga0075363_100067595 | Ga0075363_1000675951 | 236 |
| 1101 | 3300006178 | Ga0075367_10009766 | Ga0075367_100097663 | 236 |
| 1102 | 3300006186 | Ga0075369_10002248 | Ga0075369_100022483 | 236 |
| 1103 | 3300006353 | Ga0075370_10018822 | Ga0075370_100188224 | 236 |
| 1104 | 3300009765 | Ga0123341_1000005 | Ga0123341_100000531 | 236 |
| 1105 | 3300012490 | Ga0157322_1002570 | Ga0157322_10025702 | 236 |
| 1106 | 3300025245 | Ga0207425_1003978 | Ga0207425_10039784 | 236 |
| 1107 | 3300025258 | Ga0209129_1000852 | Ga0209129_100085211 | 236 |
| 1108 | 3300025273 | Ga0209673_1000020 | Ga0209673_1000020260 | 236 |
| 1109 | 3300025273 | Ga0209673_1000433 | Ga0209673_100043329 | 236 |
| 1110 | 3300025273 | Ga0209673_1001173 | Ga0209673_10011732 | 236 |
| 1111 | 3300025273 | Ga0209673_1021485 | Ga0209673_10214852 | 236 |
| 1112 | 3300025284 | Ga0209130_1016079 | Ga0209130_10160793 | 236 |
| 1113 | 3300025294 | Ga0209025_1000081 | Ga0209025_100008134 | 236 |
| 1114 | 3300025295 | Ga0209564_1000114 | Ga0209564_100011442 | 236 |
| 1115 | 3300025295 | Ga0209564_1000722 | Ga0209564_100072226 | 236 |
| 1116 | 3300025295 | Ga0209564_1013756 | Ga0209564_10137564 | 236 |
| 1117 | 3300025297 | Ga0209758_1000076 | Ga0209758_100007616 | 236 |
| 1118 | 3300025297 | Ga0209758_1004022 | Ga0209758_10040228 | 236 |
| 1119 | 3300025299 | Ga0209256_1000123 | Ga0209256_1000123140 | 236 |
| 1120 | 3300025299 | Ga0209256_1001407 | Ga0209256_100140716 | 236 |
| 1121 | 3300025299 | Ga0209256_1016219 | Ga0209256_10162191 | 236 |
| 1122 | 3300025302 | Ga0207426_1000169 | Ga0207426_1000169121 | 236 |
| 1123 | 3300025303 | Ga0209051_1000038 | Ga0209051_100003841 | 236 |
| 1124 | 3300025303 | Ga0209051_1001529 | Ga0209051_10015294 | 236 |
| 1125 | 3300025303 | Ga0209051_1028520 | Ga0209051_10285203 | 236 |
| 1126 | 3300025304 | Ga0209257_1008419 | Ga0209257_10084195 | 236 |
| 1127 | 3300025925 | Ga0207650_10015477 | Ga0207650_100154772 | 236 |
| 1128 | 3300035695 | Ga0373927_0000835 | Ga0373927_0000835_21884_22648 | 236 |
| 1129 | 3300037068 | Ga0373925_0002089 | Ga0373925_0002089_4892_5656 | 236 |
| 1130 | 3300039062 | Ga0400483_277886 | Ga0400483_277886_7345_8109 | 236 |
| 1131 | 3300039062 | Ga0400483_284574 | Ga0400483_284574_549_1313 | 236 |
| 1132 | 3300041413 | Ga0439465_0014474 | Ga0439465_0014474_396_1160 | 236 |
| 1133 | 3300041413 | Ga0439465_0102753 | Ga0439465_0102753_62_826 | 236 |
| 1134 | 3300041452 | Ga0451793_1613516 | Ga0451793_1613516_190_954 | 236 |
| 1135 | 3300041491 | Ga0451833_0571278 | Ga0451833_0571278_318_1082 | 236 |
| 1136 | 3300041492 | Ga0451835_0341194 | Ga0451835_0341194_2147_2911 | 236 |
| 1137 | 3300041496 | Ga0451839_0553209 | Ga0451839_0553209_18_782 | 236 |
| 1138 | 3300041503 | Ga0451847_0247730 | Ga0451847_0247730_1265_2029 | 236 |
| 1139 | 3300041505 | Ga0451849_0247574 | Ga0451849_0247574_142_906 | 236 |
| 1140 | 3300041507 | Ga0451851_1205047 | Ga0451851_1205047_2029_2793 | 236 |
| 1141 | 3300041511 | Ga0451855_1407221 | Ga0451855_1407221_161_925 | 236 |
| 1142 | 3300041511 | Ga0451855_1443745 | Ga0451855_1443745_212_976 | 236 |
| 1143 | 3300046476 | Ga0495662_0001363 | Ga0495662_0001363_9573_10337 | 236 |
| 1144 | 3300046477 | Ga0495664_0112455 | Ga0495664_0112455_731_1495 | 236 |
| 1145 | 3300046492 | Ga0495585_0025689 | Ga0495585_0025689_1255_2019 | 236 |
| 1146 | 3300046492 | Ga0495585_0165717 | Ga0495585_0165717_322_1086 | 236 |
| 1147 | 3300046507 | Ga0495606_0008984 | Ga0495606_0008984_4069_4833 | 236 |
| 1148 | 3300046507 | Ga0495606_0060068 | Ga0495606_0060068_842_1606 | 236 |
| 1149 | 3300046512 | Ga0495610_0052509 | Ga0495610_0052509_732_1496 | 236 |
| 1150 | 3300046513 | Ga0495616_0132125 | Ga0495616_0132125_126_890 | 236 |
| 1151 | 3300046515 | Ga0495620_0005142 | Ga0495620_0005142_4317_5081 | 236 |
| 1152 | 3300046519 | Ga0495632_0053803 | Ga0495632_0053803_733_1497 | 236 |
| 1153 | 3300046522 | Ga0495643_0006217 | Ga0495643_0006217_618_1382 | 236 |
| 1154 | 3300046524 | Ga0495648_0033138 | Ga0495648_0033138_2582_3346 | 236 |
| 1155 | 3300046538 | Ga0495609_0086015 | Ga0495609_0086015_259_1023 | 236 |
| 1156 | 3300046542 | Ga0495597_0023590 | Ga0495597_0023590_1539_2303 | 236 |
| 1157 | 3300046557 | Ga0495622_0014155 | Ga0495622_0014155_1746_2510 | 236 |
| 1158 | 3300046558 | Ga0495633_0065690 | Ga0495633_0065690_92_856 | 236 |
| 1159 | 3300046558 | Ga0495633_0206685 | Ga0495633_0206685_88_852 | 236 |
| 1160 | 3300046616 | Ga0495668_0127022 | Ga0495668_0127022_163_927 | 236 |
| 1161 | 3300046642 | Ga0495634_0060986 | Ga0495634_0060986_163_927 | 236 |
| 1162 | 3300046648 | Ga0495611_0025199 | Ga0495611_0025199_66_830 | 236 |
| 1163 | 3300046665 | Ga0495661_0038796 | Ga0495661_0038796_2006_2770 | 236 |
| 1164 | 3300046674 | Ga0495588_0194200 | Ga0495588_0194200_128_892 | 236 |
| 1165 | 3300046674 | Ga0495588_0201788 | Ga0495588_0201788_240_1004 | 236 |
| 1166 | 3300046690 | Ga0495624_0120943 | Ga0495624_0120943_362_1126 | 236 |
| 1167 | 3300046694 | Ga0495649_0006784 | Ga0495649_0006784_1402_2166 | 236 |
| 1168 | 3300046810 | Ga0495660_0019134 | Ga0495660_0019134_1960_2724 | 236 |
| 1169 | 3300047317 | Ga0495604_0065353 | Ga0495604_0065353_1402_2166 | 236 |
| 1170 | 3300047318 | Ga0495636_0139330 | Ga0495636_0139330_56_820 | 236 |
| 1171 | 3300047443 | Ga0495687_034450 | Ga0495687_034450_1295_2059 | 236 |
| 1172 | 3300047447 | Ga0495685_069886 | Ga0495685_069886_171_935 | 236 |
| 1173 | 3300047470 | Ga0495681_0037532 | Ga0495681_0037532_106_870 | 236 |
| 1174 | 3300047472 | Ga0495686_0084786 | Ga0495686_0084786_1031_1795 | 236 |
| 1175 | 3300048088 | Ga0495602_0077089 | Ga0495602_0077089_2016_2780 | 236 |
| 1176 | 3300048913 | Ga0496110_0166024 | Ga0496110_0166024_848_1612 | 236 |
| 1177 | 3300048921 | Ga0496118_0004078 | Ga0496118_0004078_5003_5767 | 236 |
| 1178 | 3300050492 | nmdc:mga0yw44_14452_c1 | nmdc:mga0yw44_14452_c1_2012_2776 | 236 |
| 1179 | 3300050494 | nmdc:mga06z11_97845_c1 | nmdc:mga06z11_97845_c1_521_1285 | 236 |
| 1180 | 3300050516 | nmdc:mga0sz30_9773_c1 | nmdc:mga0sz30_9773_c1_2261_3025 | 236 |
| 1181 | 3300053077 | Ga0495601_0165302 | Ga0495601_0165302_629_1393 | 236 |
| 1182 | 3300053086 | Ga0500578_0053825 | Ga0500578_0053825_1080_1844 | 236 |
| 1183 | 3300053087 | Ga0500643_011296 | Ga0500643_011296_1331_2095 | 236 |
| 1184 | 3300053134 | Ga0500658_0000486 | Ga0500658_0000486_15545_16309 | 236 |
| 1185 | 3300053135 | Ga0500659_0073849 | Ga0500659_0073849_928_1692 | 236 |
| 1186 | 3300053148 | Ga0500590_000124 | Ga0500590_000124_11330_12094 | 236 |
| 1187 | 3300053153 | Ga0500616_0003199 | Ga0500616_0003199_7266_8030 | 236 |
| 1188 | 3300002705 | JGI25156J39149_1000078 | JGI25156J39149_100007870 | 237 |
| 1189 | 3300002738 | JGI25154J39366_1000105 | JGI25154J39366_100010511 | 237 |
| 1190 | 3300002741 | JGI25157J39369_1000098 | JGI25157J39369_100009811 | 237 |
| 1191 | 3300002773 | JGI25152J39213_1000318 | JGI25152J39213_100031838 | 237 |
| 1192 | 3300002774 | JGI25150J39212_1000103 | JGI25150J39212_100010316 | 237 |
| 1193 | 3300002774 | JGI25150J39212_1000223 | JGI25150J39212_10002237 | 237 |
| 1194 | 3300003187 | JGI25151J46595_10000085 | JGI25151J46595_1000008591 | 237 |
| 1195 | 3300003187 | JGI25151J46595_10000481 | JGI25151J46595_1000048152 | 237 |
| 1196 | 3300003215 | JGI25153J46596_10001557 | JGI25153J46596_100015575 | 237 |
| 1197 | 3300003215 | JGI25153J46596_10007007 | JGI25153J46596_100070074 | 237 |
| 1198 | 3300003354 | JGI25160J50197_1000042 | JGI25160J50197_10000424 | 237 |
| 1199 | 3300003775 | Ga0055524_1002365 | Ga0055524_10023658 | 237 |
| 1200 | 3300004625 | Ga0055543_1000123 | Ga0055543_10001234 | 237 |
| 1201 | 3300005338 | Ga0068868_100016759 | Ga0068868_1000167593 | 237 |
| 1202 | 3300005354 | Ga0070675_100053659 | Ga0070675_1000536592 | 237 |
| 1203 | 3300005355 | Ga0070671_100161529 | Ga0070671_1001615291 | 237 |
| 1204 | 3300005356 | Ga0070674_100083437 | Ga0070674_1000834372 | 237 |
| 1205 | 3300005364 | Ga0070673_100166883 | Ga0070673_1001668832 | 237 |
| 1206 | 3300005434 | Ga0070709_10222278 | Ga0070709_102222782 | 237 |
| 1207 | 3300005440 | Ga0070705_100466455 | Ga0070705_1004664551 | 237 |
| 1208 | 3300005455 | Ga0070663_100058323 | Ga0070663_1000583232 | 237 |
| 1209 | 3300005455 | Ga0070663_100112169 | Ga0070663_1001121692 | 237 |
| 1210 | 3300005456 | Ga0070678_100052246 | Ga0070678_1000522462 | 237 |
| 1211 | 3300005457 | Ga0070662_100029491 | Ga0070662_1000294913 | 237 |
| 1212 | 3300005535 | Ga0070684_100246082 | Ga0070684_1002460821 | 237 |
| 1213 | 3300005539 | Ga0068853_100157987 | Ga0068853_1001579872 | 237 |
| 1214 | 3300005548 | Ga0070665_100060258 | Ga0070665_1000602583 | 237 |
| 1215 | 3300005548 | Ga0070665_100088407 | Ga0070665_1000884073 | 237 |
| 1216 | 3300005548 | Ga0070665_100118935 | Ga0070665_1001189355 | 237 |
| 1217 | 3300005548 | Ga0070665_100149826 | Ga0070665_1001498262 | 237 |
| 1218 | 3300005548 | Ga0070665_100490496 | Ga0070665_1004904962 | 237 |
| 1219 | 3300005563 | Ga0068855_100068261 | Ga0068855_1000682612 | 237 |
| 1220 | 3300005564 | Ga0070664_100092885 | Ga0070664_1000928852 | 237 |
| 1221 | 3300005578 | Ga0068854_100357008 | Ga0068854_1003570081 | 237 |
| 1222 | 3300005617 | Ga0068859_100026378 | Ga0068859_1000263782 | 237 |
| 1223 | 3300005618 | Ga0068864_100013581 | Ga0068864_1000135814 | 237 |
| 1224 | 3300005719 | Ga0068861_100008832 | Ga0068861_1000088325 | 237 |
| 1225 | 3300005719 | Ga0068861_100264312 | Ga0068861_1002643122 | 237 |
| 1226 | 3300005841 | Ga0068863_100218476 | Ga0068863_1002184762 | 237 |
| 1227 | 3300005842 | Ga0068858_100734354 | Ga0068858_1007343541 | 237 |
| 1228 | 3300005843 | Ga0068860_100094627 | Ga0068860_1000946272 | 237 |
| 1229 | 3300006028 | Ga0070717_10075006 | Ga0070717_100750061 | 237 |
| 1230 | 3300006038 | Ga0075365_10045745 | Ga0075365_100457452 | 237 |
| 1231 | 3300006038 | Ga0075365_10132740 | Ga0075365_101327403 | 237 |
| 1232 | 3300006038 | Ga0075365_10170912 | Ga0075365_101709122 | 237 |
| 1233 | 3300006042 | Ga0075368_10005890 | Ga0075368_100058902 | 237 |
| 1234 | 3300006048 | Ga0075363_100205310 | Ga0075363_1002053102 | 237 |
| 1235 | 3300006051 | Ga0075364_10000163 | Ga0075364_1000016329 | 237 |
| 1236 | 3300006051 | Ga0075364_10205924 | Ga0075364_102059242 | 237 |
| 1237 | 3300006051 | Ga0075364_10358721 | Ga0075364_103587211 | 237 |
| 1238 | 3300006186 | Ga0075369_10095470 | Ga0075369_100954702 | 237 |
| 1239 | 3300006186 | Ga0075369_10111914 | Ga0075369_101119142 | 237 |
| 1240 | 3300006195 | Ga0075366_10125527 | Ga0075366_101255272 | 237 |
| 1241 | 3300006237 | Ga0097621_100008954 | Ga0097621_1000089543 | 237 |
| 1242 | 3300006847 | Ga0075431_100028716 | Ga0075431_1000287162 | 237 |
| 1243 | 3300006880 | Ga0075429_100119094 | Ga0075429_1001190943 | 237 |
| 1244 | 3300006931 | Ga0097620_100026378 | Ga0097620_1000263783 | 237 |
| 1245 | 3300006946 | Ga0079104_1000086 | Ga0079104_1000086119 | 237 |
| 1246 | 3300009098 | Ga0105245_10129365 | Ga0105245_101293651 | 237 |
| 1247 | 3300009101 | Ga0105247_10136853 | Ga0105247_101368532 | 237 |
| 1248 | 3300009174 | Ga0105241_10008631 | Ga0105241_100086314 | 237 |
| 1249 | 3300009177 | Ga0105248_10005586 | Ga0105248_100055867 | 237 |
| 1250 | 3300009545 | Ga0105237_10290018 | Ga0105237_102900182 | 237 |
| 1251 | 3300009545 | Ga0105237_10420753 | Ga0105237_104207532 | 237 |
| 1252 | 3300011119 | Ga0105246_10003827 | Ga0105246_100038274 | 237 |
| 1253 | 3300013306 | Ga0163162_10024359 | Ga0163162_100243593 | 237 |
| 1254 | 3300014969 | Ga0157376_10063103 | Ga0157376_100631033 | 237 |
| 1255 | 3300021321 | Ga0214542_1003702 | Ga0214542_100370228 | 237 |
| 1256 | 3300021327 | Ga0214543_1003409 | Ga0214543_10034099 | 237 |
| 1257 | 3300025206 | Ga0209435_100010 | Ga0209435_100010312 | 237 |
| 1258 | 3300025208 | Ga0209436_100949 | Ga0209436_1009495 | 237 |
| 1259 | 3300025245 | Ga0207425_1000065 | Ga0207425_100006588 | 237 |
| 1260 | 3300025245 | Ga0207425_1000263 | Ga0207425_100026351 | 237 |
| 1261 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011830 | 237 |
| 1262 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001484 | 237 |
| 1263 | 3300025254 | Ga0209148_1000302 | Ga0209148_10003025 | 237 |
| 1264 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011461 | 237 |
| 1265 | 3300025258 | Ga0209129_1000132 | Ga0209129_100013288 | 237 |
| 1266 | 3300025258 | Ga0209129_1000350 | Ga0209129_100035051 | 237 |
| 1267 | 3300025272 | Ga0209455_1000986 | Ga0209455_10009867 | 237 |
| 1268 | 3300025273 | Ga0209673_1007944 | Ga0209673_10079443 | 237 |
| 1269 | 3300025273 | Ga0209673_1010504 | Ga0209673_10105042 | 237 |
| 1270 | 3300025284 | Ga0209130_1000075 | Ga0209130_10000755 | 237 |
| 1271 | 3300025294 | Ga0209025_1000247 | Ga0209025_100024788 | 237 |
| 1272 | 3300025294 | Ga0209025_1000603 | Ga0209025_100060381 | 237 |
| 1273 | 3300025294 | Ga0209025_1000996 | Ga0209025_100099634 | 237 |
| 1274 | 3300025295 | Ga0209564_1010318 | Ga0209564_10103184 | 237 |
| 1275 | 3300025297 | Ga0209758_1000212 | Ga0209758_100021289 | 237 |
| 1276 | 3300025297 | Ga0209758_1001278 | Ga0209758_10012787 | 237 |
| 1277 | 3300025297 | Ga0209758_1013138 | Ga0209758_10131384 | 237 |
| 1278 | 3300025297 | Ga0209758_1013694 | Ga0209758_10136943 | 237 |
| 1279 | 3300025299 | Ga0209256_1000175 | Ga0209256_100017592 | 237 |
| 1280 | 3300025299 | Ga0209256_1009511 | Ga0209256_10095112 | 237 |
| 1281 | 3300025302 | Ga0207426_1000163 | Ga0207426_10001635 | 237 |
| 1282 | 3300025302 | Ga0207426_1007406 | Ga0207426_10074065 | 237 |
| 1283 | 3300025304 | Ga0209257_1023815 | Ga0209257_10238153 | 237 |
| 1284 | 3300025906 | Ga0207699_10052109 | Ga0207699_100521093 | 237 |
| 1285 | 3300025907 | Ga0207645_10159361 | Ga0207645_101593612 | 237 |
| 1286 | 3300025911 | Ga0207654_10008524 | Ga0207654_100085243 | 237 |
| 1287 | 3300025914 | Ga0207671_10024472 | Ga0207671_100244722 | 237 |
| 1288 | 3300025926 | Ga0207659_10381238 | Ga0207659_103812381 | 237 |
| 1289 | 3300025927 | Ga0207687_10005665 | Ga0207687_100056655 | 237 |
| 1290 | 3300025931 | Ga0207644_10210718 | Ga0207644_102107181 | 237 |
| 1291 | 3300025933 | Ga0207706_10048925 | Ga0207706_100489252 | 237 |
| 1292 | 3300025937 | Ga0207669_10024754 | Ga0207669_100247542 | 237 |
| 1293 | 3300025945 | Ga0207679_10254620 | Ga0207679_102546202 | 237 |
| 1294 | 3300026023 | Ga0207677_10011073 | Ga0207677_100110734 | 237 |
| 1295 | 3300026041 | Ga0207639_10088753 | Ga0207639_100887532 | 237 |
| 1296 | 3300026067 | Ga0207678_10005398 | Ga0207678_100053985 | 237 |
| 1297 | 3300026067 | Ga0207678_10083708 | Ga0207678_100837082 | 237 |
| 1298 | 3300026118 | Ga0207675_100039144 | Ga0207675_1000391443 | 237 |
| 1299 | 3300026121 | Ga0207683_10008735 | Ga0207683_100087354 | 237 |
| 1300 | 3300026121 | Ga0207683_10102807 | Ga0207683_101028073 | 237 |
| 1301 | 3300028379 | Ga0268266_10004161 | Ga0268266_100041617 | 237 |
| 1302 | 3300028379 | Ga0268266_10025419 | Ga0268266_100254196 | 237 |
| 1303 | 3300028379 | Ga0268266_10061548 | Ga0268266_100615482 | 237 |
| 1304 | 3300028379 | Ga0268266_10147600 | Ga0268266_101476002 | 237 |
| 1305 | 3300028786 | Ga0307517_10136150 | Ga0307517_101361501 | 237 |
| 1306 | 3300028794 | Ga0307515_10000136 | Ga0307515_1000013631 | 237 |
| 1307 | 3300028794 | Ga0307515_10040124 | Ga0307515_100401247 | 237 |
| 1308 | 3300028794 | Ga0307515_10137421 | Ga0307515_101374212 | 237 |
| 1309 | 3300031456 | Ga0307513_10005749 | Ga0307513_100057496 | 237 |
| 1310 | 3300031456 | Ga0307513_10278847 | Ga0307513_102788472 | 237 |
| 1311 | 3300031548 | Ga0307408_100185781 | Ga0307408_1001857812 | 237 |
| 1312 | 3300031731 | Ga0307405_10055308 | Ga0307405_100553083 | 237 |
| 1313 | 3300031995 | Ga0307409_100963183 | Ga0307409_1009631831 | 237 |
| 1314 | 3300033180 | Ga0307510_10003141 | Ga0307510_100031416 | 237 |
| 1315 | 3300035695 | Ga0373927_0148667 | Ga0373927_0148667_132_899 | 237 |
| 1316 | 3300041404 | Ga0439436_0022618 | Ga0439436_0022618_103_870 | 237 |
| 1317 | 3300041486 | Ga0451807_1532728 | Ga0451807_1532728_168_935 | 237 |
| 1318 | 3300046460 | Ga0495638_0004790 | Ga0495638_0004790_1091_1858 | 237 |
| 1319 | 3300046460 | Ga0495638_0013376 | Ga0495638_0013376_4621_5388 | 237 |
| 1320 | 3300046460 | Ga0495638_0016087 | Ga0495638_0016087_1161_1928 | 237 |
| 1321 | 3300046460 | Ga0495638_0019892 | Ga0495638_0019892_1925_2692 | 237 |
| 1322 | 3300046507 | Ga0495606_0232012 | Ga0495606_0232012_22_789 | 237 |
| 1323 | 3300046512 | Ga0495610_0001529 | Ga0495610_0001529_14448_15215 | 237 |
| 1324 | 3300046519 | Ga0495632_0005967 | Ga0495632_0005967_6484_7251 | 237 |
| 1325 | 3300046558 | Ga0495633_0042165 | Ga0495633_0042165_10_777 | 237 |
| 1326 | 3300046559 | Ga0495667_0145153 | Ga0495667_0145153_74_841 | 237 |
| 1327 | 3300046616 | Ga0495668_0094347 | Ga0495668_0094347_111_878 | 237 |
| 1328 | 3300046660 | Ga0495625_0027749 | Ga0495625_0027749_3423_4190 | 237 |
| 1329 | 3300046660 | Ga0495625_0283942 | Ga0495625_0283942_280_1047 | 237 |
| 1330 | 3300046691 | Ga0495670_0216136 | Ga0495670_0216136_94_861 | 237 |
| 1331 | 3300047444 | Ga0495675_0255054 | Ga0495675_0255054_273_1040 | 237 |
| 1332 | 3300048904 | Ga0496101_0419381 | Ga0496101_0419381_92_859 | 237 |
| 1333 | 3300048905 | Ga0496102_0128750 | Ga0496102_0128750_1439_2206 | 237 |
| 1334 | 3300048907 | Ga0496104_0337955 | Ga0496104_0337955_206_973 | 237 |
| 1335 | 3300048912 | Ga0496109_0505124 | Ga0496109_0505124_48_815 | 237 |
| 1336 | 3300048913 | Ga0496110_0603936 | Ga0496110_0603936_100_867 | 237 |
| 1337 | 3300048916 | Ga0496113_0215652 | Ga0496113_0215652_438_1205 | 237 |
| 1338 | 3300048919 | Ga0496116_0009211 | Ga0496116_0009211_3159_3926 | 237 |
| 1339 | 3300048919 | Ga0496116_0160273 | Ga0496116_0160273_92_859 | 237 |
| 1340 | 3300048919 | Ga0496116_0162245 | Ga0496116_0162245_313_1080 | 237 |
| 1341 | 3300048920 | Ga0496117_0017198 | Ga0496117_0017198_5243_6010 | 237 |
| 1342 | 3300048921 | Ga0496118_0008608 | Ga0496118_0008608_5260_6027 | 237 |
| 1343 | 3300048921 | Ga0496118_0033704 | Ga0496118_0033704_1818_2585 | 237 |
| 1344 | 3300048922 | Ga0496119_0037363 | Ga0496119_0037363_696_1463 | 237 |
| 1345 | 3300048923 | Ga0496120_0180914 | Ga0496120_0180914_153_920 | 237 |
| 1346 | 3300048923 | Ga0496120_0238017 | Ga0496120_0238017_44_811 | 237 |
| 1347 | 3300048924 | Ga0496121_0018594 | Ga0496121_0018594_5244_6011 | 237 |
| 1348 | 3300048924 | Ga0496121_0248924 | Ga0496121_0248924_103_870 | 237 |
| 1349 | 3300048925 | Ga0496122_0009846 | Ga0496122_0009846_7774_8541 | 237 |
| 1350 | 3300048925 | Ga0496122_0052995 | Ga0496122_0052995_1300_2067 | 237 |
| 1351 | 3300048925 | Ga0496122_0063578 | Ga0496122_0063578_122_889 | 237 |
| 1352 | 3300048926 | Ga0496123_0078056 | Ga0496123_0078056_121_888 | 237 |
| 1353 | 3300048926 | Ga0496123_0100979 | Ga0496123_0100979_634_1401 | 237 |
| 1354 | 3300048927 | Ga0496124_0000254 | Ga0496124_0000254_100109_100876 | 237 |
| 1355 | 3300048927 | Ga0496124_0026204 | Ga0496124_0026204_1306_2073 | 237 |
| 1356 | 3300048928 | Ga0496125_0000101 | Ga0496125_0000101_32381_33148 | 237 |
| 1357 | 3300048928 | Ga0496125_0015257 | Ga0496125_0015257_5369_6136 | 237 |
| 1358 | 3300048928 | Ga0496125_0216956 | Ga0496125_0216956_73_840 | 237 |
| 1359 | 3300048929 | Ga0496126_0121496 | Ga0496126_0121496_405_1172 | 237 |
| 1360 | 3300048929 | Ga0496126_0155255 | Ga0496126_0155255_633_1400 | 237 |
| 1361 | 3300049570 | Ga0501033_0195001 | Ga0501033_0195001_157_924 | 237 |
| 1362 | 3300049579 | Ga0501043_0242350 | Ga0501043_0242350_387_1154 | 237 |
| 1363 | 3300049581 | Ga0501047_0115506 | Ga0501047_0115506_815_1582 | 237 |
| 1364 | 3300049586 | Ga0501070_0017965 | Ga0501070_0017965_2150_2917 | 237 |
| 1365 | 3300049589 | Ga0501073_0057589 | Ga0501073_0057589_1575_2342 | 237 |
| 1366 | 3300049590 | Ga0501074_0046189 | Ga0501074_0046189_899_1666 | 237 |
| 1367 | 3300049742 | Ga0501080_0113468 | Ga0501080_0113468_496_1263 | 237 |
| 1368 | 3300049822 | Ga0501035_0005429 | Ga0501035_0005429_6778_7545 | 237 |
| 1369 | 3300049822 | Ga0501035_0009467 | Ga0501035_0009467_6740_7507 | 237 |
| 1370 | 3300049823 | Ga0501044_0030918 | Ga0501044_0030918_3181_3948 | 237 |
| 1371 | 3300050491 | nmdc:mga00v17_9569_c1 | nmdc:mga00v17_9569_c1_2802_3569 | 237 |
| 1372 | 3300050492 | nmdc:mga0yw44_135029_c1 | nmdc:mga0yw44_135029_c1_57_824 | 237 |
| 1373 | 3300050492 | nmdc:mga0yw44_163822_c1 | nmdc:mga0yw44_163822_c1_286_1053 | 237 |
| 1374 | 3300050495 | nmdc:mga04h51_31977_c1 | nmdc:mga04h51_31977_c1_190_957 | 237 |
| 1375 | 3300050508 | nmdc:mga09592_112096_c1 | nmdc:mga09592_112096_c1_912_1679 | 237 |
| 1376 | 3300053077 | Ga0495601_0136999 | Ga0495601_0136999_287_1054 | 237 |
| 1377 | 3300053084 | Ga0495595_0119664 | Ga0495595_0119664_158_925 | 237 |
| 1378 | 3300053085 | Ga0495619_0043876 | Ga0495619_0043876_546_1313 | 237 |
| 1379 | 3300053096 | Ga0500641_0009976 | Ga0500641_0009976_767_1534 | 237 |
| 1380 | 3300053118 | Ga0500594_0006924 | Ga0500594_0006924_1718_2485 | 237 |
| 1381 | 3300053119 | Ga0500595_009740 | Ga0500595_009740_1876_2643 | 237 |
| 1382 | 3300053125 | Ga0500618_001078 | Ga0500618_001078_10170_10937 | 237 |
| 1383 | 3300053153 | Ga0500616_0000094 | Ga0500616_0000094_31894_32661 | 237 |
| 1384 | 3300053727 | Ga0500611_017532 | Ga0500611_017532_470_1237 | 237 |
| 1385 | 3300060353 | Ga0501082_0582473 | Ga0501082_0582473_201_968 | 237 |
| 1386 | iso_pu_bacteria | 2515154122 | 2515680483 | 237 |
| 1387 | 3300003323 | rootH1_10013159 | rootH1_100131598 | 238 |
| 1388 | 3300004625 | Ga0055543_1001548 | Ga0055543_10015486 | 238 |
| 1389 | 3300005578 | Ga0068854_100479637 | Ga0068854_1004796371 | 238 |
| 1390 | 3300005616 | Ga0068852_100216615 | Ga0068852_1002166152 | 238 |
| 1391 | 3300005844 | Ga0068862_100082809 | Ga0068862_1000828094 | 238 |
| 1392 | 3300005937 | Ga0081455_10413796 | Ga0081455_104137961 | 238 |
| 1393 | 3300006237 | Ga0097621_100235015 | Ga0097621_1002350152 | 238 |
| 1394 | 3300009093 | Ga0105240_10000805 | Ga0105240_1000080522 | 238 |
| 1395 | 3300009545 | Ga0105237_10002236 | Ga0105237_1000223610 | 238 |
| 1396 | 3300010375 | Ga0105239_10000952 | Ga0105239_1000095218 | 238 |
| 1397 | 3300025294 | Ga0209025_1047278 | Ga0209025_10472783 | 238 |
| 1398 | 3300025302 | Ga0207426_1000285 | Ga0207426_100028547 | 238 |
| 1399 | 3300025913 | Ga0207695_10010120 | Ga0207695_100101203 | 238 |
| 1400 | 3300025914 | Ga0207671_10002957 | Ga0207671_100029577 | 238 |
| 1401 | 3300026142 | Ga0207698_10098968 | Ga0207698_100989682 | 238 |
| 1402 | 3300031456 | Ga0307513_10422899 | Ga0307513_104228991 | 238 |
| 1403 | 3300037068 | Ga0373925_0628844 | Ga0373925_0628844_35_805 | 238 |
| 1404 | 3300046452 | Ga0495617_010437 | Ga0495617_010437_1231_2004 | 238 |
| 1405 | 3300046460 | Ga0495638_0000163 | Ga0495638_0000163_96682_97455 | 238 |
| 1406 | 3300046474 | Ga0495605_0037800 | Ga0495605_0037800_20_793 | 238 |
| 1407 | 3300046506 | Ga0495583_0004011 | Ga0495583_0004011_4163_4936 | 238 |
| 1408 | 3300046506 | Ga0495583_0032865 | Ga0495583_0032865_819_1592 | 238 |
| 1409 | 3300046512 | Ga0495610_0085183 | Ga0495610_0085183_64_861 | 238 |
| 1410 | 3300046513 | Ga0495616_0016322 | Ga0495616_0016322_2897_3670 | 238 |
| 1411 | 3300046513 | Ga0495616_0023527 | Ga0495616_0023527_2478_3251 | 238 |
| 1412 | 3300046515 | Ga0495620_0015518 | Ga0495620_0015518_2301_3074 | 238 |
| 1413 | 3300046518 | Ga0495631_0004695 | Ga0495631_0004695_6322_7095 | 238 |
| 1414 | 3300046519 | Ga0495632_0047523 | Ga0495632_0047523_453_1268 | 238 |
| 1415 | 3300046519 | Ga0495632_0205384 | Ga0495632_0205384_58_831 | 238 |
| 1416 | 3300046530 | Ga0495654_0113790 | Ga0495654_0113790_71_844 | 238 |
| 1417 | 3300046616 | Ga0495668_0010371 | Ga0495668_0010371_3325_4140 | 238 |
| 1418 | 3300046616 | Ga0495668_0039097 | Ga0495668_0039097_1203_1976 | 238 |
| 1419 | 3300046648 | Ga0495611_0042804 | Ga0495611_0042804_118_891 | 238 |
| 1420 | 3300046648 | Ga0495611_0155919 | Ga0495611_0155919_24_797 | 238 |
| 1421 | 3300046660 | Ga0495625_0003905 | Ga0495625_0003905_11261_12034 | 238 |
| 1422 | 3300046660 | Ga0495625_0031718 | Ga0495625_0031718_1653_2426 | 238 |
| 1423 | 3300046675 | Ga0495657_0036996 | Ga0495657_0036996_1578_2369 | 238 |
| 1424 | 3300046809 | Ga0495600_0025386 | Ga0495600_0025386_1697_2488 | 238 |
| 1425 | 3300046810 | Ga0495660_0124616 | Ga0495660_0124616_359_1174 | 238 |
| 1426 | 3300046810 | Ga0495660_0143079 | Ga0495660_0143079_92_862 | 238 |
| 1427 | 3300047317 | Ga0495604_0014117 | Ga0495604_0014117_715_1485 | 238 |
| 1428 | 3300047320 | Ga0495672_0013154 | Ga0495672_0013154_3721_4494 | 238 |
| 1429 | 3300047323 | Ga0495683_0089086 | Ga0495683_0089086_394_1167 | 238 |
| 1430 | 3300047443 | Ga0495687_005208 | Ga0495687_005208_6571_7344 | 238 |
| 1431 | 3300048913 | Ga0496110_0388877 | Ga0496110_0388877_97_867 | 238 |
| 1432 | 3300048924 | Ga0496121_0003840 | Ga0496121_0003840_18179_18994 | 238 |
| 1433 | 3300048928 | Ga0496125_0000692 | Ga0496125_0000692_5240_6010 | 238 |
| 1434 | 3300048928 | Ga0496125_0005881 | Ga0496125_0005881_2671_3441 | 238 |
| 1435 | 3300048929 | Ga0496126_0016806 | Ga0496126_0016806_170_940 | 238 |
| 1436 | 3300049459 | Ga0495678_066936 | Ga0495678_066936_94_867 | 238 |
| 1437 | 3300049568 | Ga0501031_0330206 | Ga0501031_0330206_130_900 | 238 |
| 1438 | 3300049570 | Ga0501033_0060283 | Ga0501033_0060283_2006_2776 | 238 |
| 1439 | 3300049571 | Ga0501034_0512905 | Ga0501034_0512905_105_875 | 238 |
| 1440 | 3300049572 | Ga0501036_0043555 | Ga0501036_0043555_962_1732 | 238 |
| 1441 | 3300049574 | Ga0501038_0135794 | Ga0501038_0135794_491_1261 | 238 |
| 1442 | 3300049575 | Ga0501039_0455757 | Ga0501039_0455757_151_921 | 238 |
| 1443 | 3300049586 | Ga0501070_0054954 | Ga0501070_0054954_675_1445 | 238 |
| 1444 | 3300049822 | Ga0501035_0532923 | Ga0501035_0532923_41_811 | 238 |
| 1445 | 3300049823 | Ga0501044_0286245 | Ga0501044_0286245_110_880 | 238 |
| 1446 | 3300053079 | Ga0500610_0053619 | Ga0500610_0053619_673_1446 | 238 |
| 1447 | 3300053085 | Ga0495619_0066957 | Ga0495619_0066957_1365_2156 | 238 |
| 1448 | 3300053134 | Ga0500658_0069685 | Ga0500658_0069685_602_1375 | 238 |
| 1449 | 3300053139 | Ga0500568_0000587 | Ga0500568_0000587_5896_6669 | 238 |
| 1450 | 3300053142 | Ga0500577_0042717 | Ga0500577_0042717_30_803 | 238 |
| 1451 | 3300053151 | Ga0500604_0066999 | Ga0500604_0066999_117_887 | 238 |
| 1452 | 3300053153 | Ga0500616_0001233 | Ga0500616_0001233_19004_19777 | 238 |
| 1453 | 3300053158 | Ga0500627_0034904 | Ga0500627_0034904_1220_2035 | 238 |
| 1454 | 3300053177 | Ga0500636_0093545 | Ga0500636_0093545_807_1577 | 238 |
| 1455 | 3300053727 | Ga0500611_001114 | Ga0500611_001114_1370_2140 | 238 |
| 1456 | iso_pu_bacteria | 2582581298 | 2585222091 | 238 |
| 1457 | iso_pu_bacteria | 2582581867 | 2585404165 | 238 |
| 1458 | iso_pu_bacteria | 2585427529 | 2585544956 | 238 |
| 1459 | iso_pu_bacteria | 2585427590 | 2585820669 | 238 |
| 1460 | iso_pu_bacteria | 2919171160 | 2919176573 | 238 |
| 1461 | 3300002067 | JGI24735J21928_10000407 | JGI24735J21928_1000040714 | 239 |
| 1462 | 3300003354 | JGI25160J50197_1027272 | JGI25160J50197_10272722 | 239 |
| 1463 | 3300005535 | Ga0070684_100068103 | Ga0070684_1000681032 | 239 |
| 1464 | 3300005548 | Ga0070665_100106701 | Ga0070665_1001067013 | 239 |
| 1465 | 3300005937 | Ga0081455_10161595 | Ga0081455_101615952 | 239 |
| 1466 | 3300005983 | Ga0081540_1043689 | Ga0081540_10436892 | 239 |
| 1467 | 3300006178 | Ga0075367_10026904 | Ga0075367_100269042 | 239 |
| 1468 | 3300009011 | Ga0105251_10001562 | Ga0105251_100015623 | 239 |
| 1469 | 3300009093 | Ga0105240_10550112 | Ga0105240_105501122 | 239 |
| 1470 | 3300009177 | Ga0105248_10342177 | Ga0105248_103421773 | 239 |
| 1471 | 3300009551 | Ga0105238_10006455 | Ga0105238_1000645512 | 239 |
| 1472 | 3300025302 | Ga0207426_1003057 | Ga0207426_10030576 | 239 |
| 1473 | 3300025735 | Ga0207713_1008595 | Ga0207713_10085955 | 239 |
| 1474 | 3300025904 | Ga0207647_10010687 | Ga0207647_100106874 | 239 |
| 1475 | 3300025912 | Ga0207707_10126352 | Ga0207707_101263523 | 239 |
| 1476 | 3300025921 | Ga0207652_10245167 | Ga0207652_102451671 | 239 |
| 1477 | 3300026067 | Ga0207678_10269217 | Ga0207678_102692173 | 239 |
| 1478 | 3300026121 | Ga0207683_10599713 | Ga0207683_105997131 | 239 |
| 1479 | 3300032004 | Ga0307414_10309009 | Ga0307414_103090092 | 239 |
| 1480 | 3300037853 | Ga0436364_0166030 | Ga0436364_0166030_36_842 | 239 |
| 1481 | 3300037853 | Ga0436364_0569494 | Ga0436364_0569494_299_1075 | 239 |
| 1482 | 3300045049 | Ga0466959_0060121 | Ga0466959_0060121_799_1644 | 239 |
| 1483 | 3300046455 | Ga0495603_0007832 | Ga0495603_0007832_4267_5046 | 239 |
| 1484 | 3300046455 | Ga0495603_0022026 | Ga0495603_0022026_1235_2008 | 239 |
| 1485 | 3300046457 | Ga0495590_0003083 | Ga0495590_0003083_1435_2208 | 239 |
| 1486 | 3300046457 | Ga0495590_0071797 | Ga0495590_0071797_98_877 | 239 |
| 1487 | 3300046491 | Ga0495584_0005808 | Ga0495584_0005808_1355_2128 | 239 |
| 1488 | 3300046501 | Ga0495607_0003436 | Ga0495607_0003436_4947_5720 | 239 |
| 1489 | 3300046501 | Ga0495607_0025977 | Ga0495607_0025977_140_913 | 239 |
| 1490 | 3300046507 | Ga0495606_0000587 | Ga0495606_0000587_41276_42049 | 239 |
| 1491 | 3300046507 | Ga0495606_0002496 | Ga0495606_0002496_4953_5729 | 239 |
| 1492 | 3300046513 | Ga0495616_0071258 | Ga0495616_0071258_355_1134 | 239 |
| 1493 | 3300046519 | Ga0495632_0071159 | Ga0495632_0071159_338_1117 | 239 |
| 1494 | 3300046520 | Ga0495637_0005721 | Ga0495637_0005721_1581_2354 | 239 |
| 1495 | 3300046520 | Ga0495637_0018620 | Ga0495637_0018620_1623_2396 | 239 |
| 1496 | 3300046524 | Ga0495648_0068506 | Ga0495648_0068506_349_1128 | 239 |
| 1497 | 3300046542 | Ga0495597_0011209 | Ga0495597_0011209_1093_1866 | 239 |
| 1498 | 3300046648 | Ga0495611_0085902 | Ga0495611_0085902_471_1250 | 239 |
| 1499 | 3300046660 | Ga0495625_0126032 | Ga0495625_0126032_127_906 | 239 |
| 1500 | 3300046665 | Ga0495661_0060919 | Ga0495661_0060919_169_942 | 239 |
| 1501 | 3300046694 | Ga0495649_0001088 | Ga0495649_0001088_6493_7266 | 239 |
| 1502 | 3300046794 | Ga0495589_0139562 | Ga0495589_0139562_46_825 | 239 |
| 1503 | 3300047321 | Ga0495676_0064476 | Ga0495676_0064476_1972_2745 | 239 |
| 1504 | 3300047323 | Ga0495683_0000019 | Ga0495683_0000019_47766_48539 | 239 |
| 1505 | 3300047470 | Ga0495681_0012798 | Ga0495681_0012798_2273_3046 | 239 |
| 1506 | 3300048908 | Ga0496105_0043416 | Ga0496105_0043416_982_1755 | 239 |
| 1507 | 3300048910 | Ga0496107_0056883 | Ga0496107_0056883_1267_2043 | 239 |
| 1508 | 3300048924 | Ga0496121_0000615 | Ga0496121_0000615_59707_60495 | 239 |
| 1509 | 3300048924 | Ga0496121_0015935 | Ga0496121_0015935_1097_1885 | 239 |
| 1510 | 3300048927 | Ga0496124_0233676 | Ga0496124_0233676_108_896 | 239 |
| 1511 | 3300048928 | Ga0496125_0012374 | Ga0496125_0012374_6416_7189 | 239 |
| 1512 | 3300048929 | Ga0496126_0011352 | Ga0496126_0011352_8227_9006 | 239 |
| 1513 | 3300049579 | Ga0501043_0352806 | Ga0501043_0352806_214_993 | 239 |
| 1514 | 3300049581 | Ga0501047_0413634 | Ga0501047_0413634_247_1026 | 239 |
| 1515 | 3300049586 | Ga0501070_0140247 | Ga0501070_0140247_13_792 | 239 |
| 1516 | 3300049671 | Ga0501238_016681 | Ga0501238_016681_137_925 | 239 |
| 1517 | 3300049744 | Ga0501083_0111763 | Ga0501083_0111763_887_1666 | 239 |
| 1518 | 3300049822 | Ga0501035_0161442 | Ga0501035_0161442_116_895 | 239 |
| 1519 | 3300049823 | Ga0501044_0231637 | Ga0501044_0231637_865_1644 | 239 |
| 1520 | 3300050489 | nmdc:mga03683_91543_c1 | nmdc:mga03683_91543_c1_407_1195 | 239 |
| 1521 | 3300050491 | nmdc:mga00v17_14_c1 | nmdc:mga00v17_14_c1_51442_52230 | 239 |
| 1522 | 3300050492 | nmdc:mga0yw44_155595_c1 | nmdc:mga0yw44_155595_c1_243_1016 | 239 |
| 1523 | 3300050493 | nmdc:mga0k408_14833_c1 | nmdc:mga0k408_14833_c1_339_1112 | 239 |
| 1524 | 3300053125 | Ga0500618_001226 | Ga0500618_001226_2887_3660 | 239 |
| 1525 | 3300053140 | Ga0500573_0003975 | Ga0500573_0003975_993_1787 | 239 |
| 1526 | 3300053730 | Ga0500645_028297 | Ga0500645_028297_329_1108 | 239 |
| 1527 | iso_pu_bacteria | 2513237351 | 2514586389 | 239 |
| 1528 | iso_pu_bacteria | 2885312484 | 2885318050 | 239 |
| 1529 | iso_pu_bacteria | 8056673599 | 8056676791 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yxf-assembly1.cif.gz_B | mups, a 3-oxoacyl (acp) reductase involved in mupirocin biosynthesis | 0.9536 | 49 | 235 |
| 5u9p-assembly1.cif.gz_C | crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate | 0.9531 | 4 | 239 |
| 5gwr-assembly1.cif.gz_D | 4-hydroxyisoleucine dehydrogenase complexed with nadh | 0.9426 | 50 | 237 |
| 4ixw-assembly1.cif.gz_B | halohydrin dehalogenase (hhec) bound to ethyl (2s)-oxiran-2-ylacetate | 0.9407 | 59 | 234 |
| 1pwz-assembly1.cif.gz_A | crystal structure of the haloalcohol dehalogenase hhec complexed with (r)-styrene oxide and chloride | 0.9404 | 59 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9649 | 70 | 235 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9612 | 80 | 179 | 3.40.50.720 |
| 4yxfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9536 | 49 | 235 | 3.40.50.720 |
| 5u9pA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9529 | 4 | 239 | 3.40.50.720 |
| af_Q21929_1_250_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9456 | 26 | 236 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D4L5B6-F1-model_v4 | Gluconate 5-dehydrogenase | 0.9744 | 45 | 239 |
GO:0016491
|
| AF-A0A847N440-F1-model_v4 | SDR family oxidoreductase | 0.9734 | 56 | 237 |
GO:0016491
|
| AF-A0A351Z7X1-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9702 | 51 | 237 |
GO:0016616
|
| AF-A0A3D2PK39-F1-model_v4 | deleted | 0.9702 | 62 | 239 |
|
| AF-X1X1W7-F1-model_v4 | deleted | 0.9678 | 35 | 239 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar