F494589

General Info

Members Datasets Scaffolds Average Seq Length
1529 533 3058 199

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10464690|Ga0105237_104646901
Length 240
Sequence MFVRRAAHRWSCYDAHGRRKAWGKRMLQSFTPSLLPAYAAALAFGYLCGSVPFGLIITRLAGTRDIRSIGSGNIGATNVLRTGRKGLAAATLVGDALKGTFAVLAIYYYYGPEYRYFAHDLAIPAAFGAFLGHLFPVWLGFKGGKGVATYIGLLLALAWPVAIAFCLVWLAVAAATRYSSLAALVASAATPFALWLLGYWPEPALFALLTALLWIMHRANIARLVNGTEGKIGKTTASET

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
152 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
153 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
154 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
155 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
156 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
157 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
160 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
161 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
162 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
259 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
260 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
262 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
263 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
264 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
265 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
266 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
267 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
268 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
269 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
270 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
273 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
274 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
275 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
278 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
279 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
280 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
281 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
282 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
283 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
284 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
285 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
286 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
287 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
288 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
289 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
290 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
291 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
292 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
293 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
294 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
295 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
297 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
298 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
299 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
300 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
301 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
302 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
303 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
304 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
305 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
306 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
307 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
308 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
309 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
310 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
311 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
312 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
314 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
315 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
316 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
317 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
318 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
319 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
321 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
322 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
323 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
324 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
325 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
326 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
327 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
328 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
329 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
330 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
331 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
332 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
333 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
334 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
337 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
340 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
345 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
348 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
351 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
352 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
353 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
354 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
355 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
356 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
359 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
360 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
361 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
365 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
366 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
367 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
373 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
374 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
375 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
376 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
377 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
378 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
379 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
380 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
381 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
382 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
383 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
384 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
385 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
386 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
387 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
388 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
391 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
392 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
393 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
394 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
395 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
396 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
397 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
398 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
399 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
400 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
401 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
402 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
403 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
404 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
405 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
406 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
407 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
408 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
409 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
410 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
411 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
412 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
413 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
414 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
415 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
416 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
417 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
418 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
419 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
420 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
421 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
422 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
423 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
424 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
425 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
426 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
427 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
428 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
429 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
430 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
431 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
432 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
433 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
434 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
435 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
436 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
437 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
438 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
439 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
440 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
441 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
442 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
443 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
444 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
445 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
454 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
455 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
456 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
457 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
458 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
459 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
460 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
461 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
462 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
463 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
464 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
465 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
466 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
467 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
470 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
471 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
476 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
479 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
480 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
481 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
482 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
483 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
484 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
485 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
486 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
487 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
488 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
489 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
490 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
491 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
492 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
493 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
494 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
495 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
496 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
497 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
498 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
499 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
500 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
501 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
502 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
503 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
504 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
505 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
506 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
507 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
508 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
509 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
510 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
511 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
512 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
513 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
514 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
515 2773857925 Microvirga vignae BR3299 Isolate Unclassified
516 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
517 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
518 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
519 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
520 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
521 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
522 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
523 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
524 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
525 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
526 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
527 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
528 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
529 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
530 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
531 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
532 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
533 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0.13
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0.39
Rhizoplane 8.11
Rhizosphere 85.02
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10464690 3300009545 Bacteria 1271
2 2214856315 2209111006 Bacteria 8009
3 ARcpr5oldR_c000202 3300000041 Bacteria 10028
4 ARSoilYngRDRAFT_c00201 3300000042 Bacteria 9997
5 ARcpr5yngRDRAFT_c000176 3300000043 Bacteria 10012
6 ARSoilOldRDRAFT_c000187 3300000044 Bacteria 10022
7 ARCol0oldRDRAFT_c02347 3300000045 Bacteria 870
8 ARCol0yngRDRAFT_1000204 3300000652 Bacteria 10000
9 JGI24032J14994_100577 3300001430 Bacteria 1912
10 JGI24752J21851_1004412 3300001976 Bacteria 1845
11 JGI24746J21847_1002942 3300001977 Bacteria 2681
12 JGI24739J22299_10012807 3300001989 Bacteria 3074
13 JGI24737J22298_10003419 3300001990 Bacteria 5615
14 JGI24737J22298_10031013 3300001990 Bacteria 1670
15 JGI24743J22301_10004649 3300001991 Bacteria 2248
16 JGI24750J21931_1002092 3300002070 Bacteria 2428
17 JGI24748J21848_1003313 3300002074 Bacteria 1837
18 JGI24738J21930_10002133 3300002075 Bacteria 5275
19 JGI24738J21930_10002848 3300002075 Bacteria 4431
20 JGI24738J21930_10011716 3300002075 Bacteria 1924
21 JGI24744J21845_10013759 3300002077 Bacteria 1630
22 JGI24033J26618_1002523 3300002155 Bacteria 1880
23 JGI24034J26672_10001569 3300002239 Bacteria 3046
24 JGI24034J26672_10004883 3300002239 Bacteria 1910
25 JGI24742J22300_10006556 3300002244 Bacteria 1921
26 JGI24742J22300_10007189 3300002244 Bacteria 1836
27 Ga0006562J51391_1072694 3300003578 Bacteria 5040
28 Ga0065716_1002368 3300005277 Bacteria 1848
29 Ga0065704_10005364 3300005289 Bacteria 3677
30 Ga0065712_10002565 3300005290 Bacteria 10146
31 Ga0065715_10000602 3300005293 Bacteria 13727
32 Ga0065715_10000779 3300005293 Bacteria 11809
33 Ga0065707_10119681 3300005295 Bacteria 2153
34 Ga0065707_10519568 3300005295 Bacteria 743
35 Ga0070658_10304524 3300005327 Bacteria 1359
36 Ga0070658_10542866 3300005327 Bacteria 1006
37 Ga0070676_10000170 3300005328 Bacteria 26484
38 Ga0070676_10048243 3300005328 Bacteria 2489
39 Ga0070676_10055775 3300005328 Bacteria 2333
40 Ga0070683_100007194 3300005329 Bacteria 9385
41 Ga0070683_100025517 3300005329 Bacteria 5309
42 Ga0070683_100267388 3300005329 Bacteria 1626
43 Ga0070683_100776329 3300005329 Bacteria 918
44 Ga0070690_100000533 3300005330 Bacteria 19053
45 Ga0070690_100007785 3300005330 Bacteria 6140
46 Ga0070690_100037856 3300005330 Bacteria 3041
47 Ga0070690_100375674 3300005330 Bacteria 1038
48 Ga0070670_100001563 3300005331 Bacteria 18448
49 Ga0070670_100007710 3300005331 Bacteria 9151
50 Ga0070670_100018981 3300005331 Bacteria 5897
51 Ga0070670_100183906 3300005331 Bacteria 1814
52 Ga0070677_10000320 3300005333 Bacteria 16762
53 Ga0068869_100000181 3300005334 Bacteria 32256
54 Ga0068869_100014062 3300005334 Bacteria 5341
55 Ga0068869_100023059 3300005334 Bacteria 4294
56 Ga0068869_100079064 3300005334 Bacteria 2450
57 Ga0068869_100081008 3300005334 Bacteria 2423
58 Ga0068869_100464313 3300005334 Bacteria 1051
59 Ga0068869_100555443 3300005334 Bacteria 965
60 Ga0068869_100580816 3300005334 Bacteria 945
61 Ga0068869_100956081 3300005334 Bacteria 744
62 Ga0070666_10000893 3300005335 Bacteria 18149
63 Ga0070666_10021002 3300005335 Bacteria 4228
64 Ga0070666_10109278 3300005335 Bacteria 1911
65 Ga0070666_10336369 3300005335 Bacteria 1079
66 Ga0070680_100016082 3300005336 Bacteria 5878
67 Ga0070680_100203803 3300005336 Bacteria 1668
68 Ga0070680_100359363 3300005336 Bacteria 1239
69 Ga0070680_100397581 3300005336 Bacteria 1174
70 Ga0070680_100650272 3300005336 Bacteria 906
71 Ga0070682_100000573 3300005337 Bacteria 22607
72 Ga0070682_100000903 3300005337 Bacteria 17347
73 Ga0070682_100016960 3300005337 Bacteria 4240
74 Ga0070682_100044961 3300005337 Bacteria 2735
75 Ga0070682_100171307 3300005337 Bacteria 1509
76 Ga0068868_100000287 3300005338 Bacteria 33828
77 Ga0068868_100002842 3300005338 Bacteria 11998
78 Ga0068868_100053941 3300005338 Bacteria 3167
79 Ga0068868_100078297 3300005338 Bacteria 2646
80 Ga0068868_100143378 3300005338 Bacteria 1963
81 Ga0068868_100511377 3300005338 Bacteria 1053
82 Ga0070660_100003177 3300005339 Bacteria 11288
83 Ga0070660_100023149 3300005339 Bacteria 4601
84 Ga0070660_100379450 3300005339 Bacteria 1167
85 Ga0070689_100000136 3300005340 Bacteria 42853
86 Ga0070689_100001256 3300005340 Bacteria 16143
87 Ga0070689_100018095 3300005340 Bacteria 5184
88 Ga0070689_100549246 3300005340 Bacteria 995
89 Ga0070691_10000085 3300005341 Bacteria 26262
90 Ga0070691_10000418 3300005341 Bacteria 15566
91 Ga0070691_10323580 3300005341 Bacteria 849
92 Ga0070687_100002615 3300005343 Bacteria 6803
93 Ga0070687_100011861 3300005343 Bacteria 3828
94 Ga0070687_100219702 3300005343 Bacteria 1163
95 Ga0070661_100002616 3300005344 Bacteria 12337
96 Ga0070661_100520801 3300005344 Bacteria 954
97 Ga0070661_100705230 3300005344 Bacteria 822
98 Ga0070661_100894393 3300005344 Bacteria 733
99 Ga0070692_10002091 3300005345 Bacteria 7619
100 Ga0070692_10010746 3300005345 Bacteria 4180
101 Ga0070692_10083630 3300005345 Bacteria 1723
102 Ga0070668_100000188 3300005347 Bacteria 40404
103 Ga0070668_100001169 3300005347 Bacteria 18553
104 Ga0070668_100303584 3300005347 Bacteria 1339
105 Ga0070668_100639276 3300005347 Bacteria 934
106 Ga0070669_100001556 3300005353 Bacteria 16608
107 Ga0070669_100019772 3300005353 Bacteria 4812
108 Ga0070669_100023221 3300005353 Bacteria 4441
109 Ga0070669_101043520 3300005353 Bacteria 703
110 Ga0070675_100038119 3300005354 Bacteria 3916
111 Ga0070675_100045291 3300005354 Bacteria 3599
112 Ga0070675_100049831 3300005354 Bacteria 3438
113 Ga0070671_100005621 3300005355 Bacteria 9984
114 Ga0070671_100008445 3300005355 Bacteria 8256
115 Ga0070671_100085669 3300005355 Bacteria 2636
116 Ga0070671_100484614 3300005355 Bacteria 1063
117 Ga0070671_100619743 3300005355 Bacteria 936
118 Ga0070671_101024128 3300005355 Bacteria 724
119 Ga0070674_100032220 3300005356 Bacteria 3479
120 Ga0070674_100039583 3300005356 Bacteria 3184
121 Ga0070674_100044252 3300005356 Bacteria 3034
122 Ga0070674_100216926 3300005356 Bacteria 1486
123 Ga0070674_101064527 3300005356 Bacteria 713
124 Ga0070673_100000191 3300005364 Bacteria 30135
125 Ga0070673_100003390 3300005364 Bacteria 9911
126 Ga0070688_100000981 3300005365 Bacteria 14298
127 Ga0070688_100009109 3300005365 Bacteria 5414
128 Ga0070688_100067111 3300005365 Bacteria 2284
129 Ga0070688_100113882 3300005365 Bacteria 1802
130 Ga0070688_100141008 3300005365 Bacteria 1637
131 Ga0070688_100152339 3300005365 Bacteria 1581
132 Ga0070688_100214272 3300005365 Bacteria 1354
133 Ga0070688_100559243 3300005365 Bacteria 871
134 Ga0070659_100001504 3300005366 Bacteria 16803
135 Ga0070659_100041455 3300005366 Bacteria 3598
136 Ga0070659_100306809 3300005366 Bacteria 1325
137 Ga0070667_100001681 3300005367 Bacteria 19789
138 Ga0070667_100032349 3300005367 Bacteria 4362
139 Ga0070667_100062837 3300005367 Bacteria 3146
140 Ga0070667_100168830 3300005367 Bacteria 1930
141 Ga0070667_100183834 3300005367 Bacteria 1849
142 Ga0070667_100236644 3300005367 Bacteria 1629
143 Ga0070667_100365985 3300005367 Bacteria 1307
144 Ga0070703_10014931 3300005406 Bacteria 2217
145 Ga0070709_10004792 3300005434 Bacteria 7307
146 Ga0070709_10015140 3300005434 Bacteria 4382
147 Ga0070709_10029345 3300005434 Bacteria 3289
148 Ga0070709_10204030 3300005434 Bacteria 1402
149 Ga0070709_10775126 3300005434 Bacteria 751
150 Ga0070714_100009596 3300005435 Bacteria 7616
151 Ga0070714_100009986 3300005435 Bacteria 7485
152 Ga0070713_100010983 3300005436 Bacteria 6569
153 Ga0070713_100296138 3300005436 Bacteria 1488
154 Ga0070710_10005069 3300005437 Bacteria 6236
155 Ga0070710_10010865 3300005437 Bacteria 4483
156 Ga0070710_10024828 3300005437 Bacteria 3166
157 Ga0070710_10401382 3300005437 Bacteria 919
158 Ga0070701_10000454 3300005438 Bacteria 14002
159 Ga0070701_10001284 3300005438 Bacteria 9228
160 Ga0070701_10046339 3300005438 Bacteria 2234
161 Ga0070711_100000961 3300005439 Bacteria 15267
162 Ga0070711_100034363 3300005439 Bacteria 3381
163 Ga0070711_100099922 3300005439 Bacteria 2109
164 Ga0070711_100140869 3300005439 Bacteria 1808
165 Ga0070705_100006964 3300005440 Bacteria 5557
166 Ga0070705_100009498 3300005440 Bacteria 4838
167 Ga0070705_100014665 3300005440 Bacteria 4037
168 Ga0070705_100149248 3300005440 Bacteria 1549
169 Ga0070705_100364976 3300005440 Bacteria 1058
170 Ga0070700_100001181 3300005441 Bacteria 12914
171 Ga0070700_100004996 3300005441 Bacteria 6987
172 Ga0070700_100026485 3300005441 Bacteria 3424
173 Ga0070700_100046465 3300005441 Bacteria 2682
174 Ga0070694_100000659 3300005444 Bacteria 19066
175 Ga0070694_100005471 3300005444 Bacteria 7691
176 Ga0070694_100026966 3300005444 Bacteria 3727
177 Ga0070694_100168255 3300005444 Bacteria 1613
178 Ga0070694_100258671 3300005444 Bacteria 1320
179 Ga0070708_100012815 3300005445 Bacteria 6849
180 Ga0070708_100217296 3300005445 Bacteria 1792
181 Ga0070708_100301609 3300005445 Bacteria 1508
182 Ga0070708_100541419 3300005445 Bacteria 1098
183 Ga0070663_100001220 3300005455 Bacteria 14123
184 Ga0070663_100001277 3300005455 Bacteria 13788
185 Ga0070663_100020947 3300005455 Bacteria 4338
186 Ga0070663_100026167 3300005455 Bacteria 3948
187 Ga0070663_100084716 3300005455 Bacteria 2337
188 Ga0070663_100256998 3300005455 Bacteria 1384
189 Ga0070663_100544340 3300005455 Bacteria 969
190 Ga0070678_100000682 3300005456 Bacteria 16729
191 Ga0070678_100051447 3300005456 Bacteria 2986
192 Ga0070678_100098678 3300005456 Bacteria 2259
193 Ga0070678_100547881 3300005456 Bacteria 1026
194 Ga0070678_100684868 3300005456 Bacteria 922
195 Ga0070662_100000339 3300005457 Bacteria 28034
196 Ga0070662_100009258 3300005457 Bacteria 6435
197 Ga0070662_100025609 3300005457 Bacteria 4075
198 Ga0070662_100049937 3300005457 Bacteria 3017
199 Ga0070681_10002441 3300005458 Bacteria 17015
200 Ga0070681_10024612 3300005458 Bacteria 6057
201 Ga0070681_10045062 3300005458 Bacteria 4414
202 Ga0068867_100003651 3300005459 Bacteria 10826
203 Ga0068867_100005776 3300005459 Bacteria 8778
204 Ga0068867_100066847 3300005459 Bacteria 2678
205 Ga0068867_100119450 3300005459 Bacteria 2035
206 Ga0070685_10001020 3300005466 Bacteria 15067
207 Ga0070685_10047091 3300005466 Bacteria 2478
208 Ga0070685_10116531 3300005466 Bacteria 1653
209 Ga0070685_10356442 3300005466 Bacteria 1001
210 Ga0070685_10551607 3300005466 Bacteria 823
211 Ga0070706_100409282 3300005467 Bacteria 1263
212 Ga0070707_100247698 3300005468 Bacteria 1734
213 Ga0070698_100520643 3300005471 Bacteria 1128
214 Ga0070699_100003740 3300005518 Bacteria 13438
215 Ga0070699_100005151 3300005518 Bacteria 11496
216 Ga0070699_100243455 3300005518 Bacteria 1606
217 Ga0070699_100265772 3300005518 Bacteria 1535
218 Ga0070679_100002397 3300005530 Bacteria 16994
219 Ga0070679_100205962 3300005530 Bacteria 1932
220 Ga0070679_100363214 3300005530 Bacteria 1395
221 Ga0070684_100023896 3300005535 Bacteria 5120
222 Ga0070684_100129882 3300005535 Bacteria 2272
223 Ga0070697_100180051 3300005536 Bacteria 1792
224 Ga0070697_100180676 3300005536 Bacteria 1788
225 Ga0068853_100002127 3300005539 Bacteria 14736
226 Ga0068853_100285340 3300005539 Bacteria 1522
227 Ga0068853_100363022 3300005539 Bacteria 1349
228 Ga0070672_100008180 3300005543 Bacteria 7146
229 Ga0070672_100104924 3300005543 Bacteria 2297
230 Ga0070672_100129901 3300005543 Bacteria 2069
231 Ga0070686_100000707 3300005544 Bacteria 19394
232 Ga0070686_100001852 3300005544 Bacteria 11801
233 Ga0070686_100010885 3300005544 Bacteria 5148
234 Ga0070686_100026881 3300005544 Bacteria 3477
235 Ga0070686_100043297 3300005544 Bacteria 2824
236 Ga0070695_100000995 3300005545 Bacteria 15425
237 Ga0070695_100017667 3300005545 Bacteria 4327
238 Ga0070695_100029096 3300005545 Bacteria 3431
239 Ga0070696_100000743 3300005546 Bacteria 20824
240 Ga0070696_100030172 3300005546 Bacteria 3711
241 Ga0070696_100059761 3300005546 Bacteria 2664
242 Ga0070696_100180766 3300005546 Bacteria 1565
243 Ga0070696_100196382 3300005546 Bacteria 1504
244 Ga0070696_100551444 3300005546 Bacteria 924
245 Ga0070693_100000993 3300005547 Bacteria 12644
246 Ga0070693_100003405 3300005547 Bacteria 7408
247 Ga0070693_100193224 3300005547 Bacteria 1318
248 Ga0070665_100011802 3300005548 Bacteria 8824
249 Ga0070665_100012968 3300005548 Bacteria 8394
250 Ga0070665_100015770 3300005548 Bacteria 7591
251 Ga0070665_100031231 3300005548 Bacteria 5361
252 Ga0070665_100172863 3300005548 Bacteria 2161
253 Ga0070665_100223967 3300005548 Bacteria 1881
254 Ga0070704_100000607 3300005549 Bacteria 17259
255 Ga0070704_100129790 3300005549 Bacteria 1951
256 Ga0070704_100179847 3300005549 Bacteria 1690
257 Ga0068855_100003471 3300005563 Bacteria 19298
258 Ga0068855_100012458 3300005563 Bacteria 10267
259 Ga0068855_100065612 3300005563 Bacteria 4232
260 Ga0070664_100044843 3300005564 Bacteria 3734
261 Ga0070664_100144557 3300005564 Bacteria 2097
262 Ga0070664_100163030 3300005564 Bacteria 1973
263 Ga0070664_100234239 3300005564 Bacteria 1647
264 Ga0070664_100485787 3300005564 Bacteria 1137
265 Ga0068857_100007472 3300005577 Bacteria 9408
266 Ga0068857_100288465 3300005577 Bacteria 1511
267 Ga0068854_100005622 3300005578 Bacteria 7920
268 Ga0068854_100007745 3300005578 Bacteria 6866
269 Ga0068854_100112874 3300005578 Bacteria 2052
270 Ga0068854_100444423 3300005578 Bacteria 1082
271 Ga0068856_100004777 3300005614 Bacteria 13428
272 Ga0068856_100059691 3300005614 Bacteria 3767
273 Ga0068856_100071204 3300005614 Bacteria 3441
274 Ga0070702_100000022 3300005615 Bacteria 44333
275 Ga0070702_100002122 3300005615 Bacteria 8421
276 Ga0070702_100046887 3300005615 Bacteria 2452
277 Ga0070702_100125969 3300005615 Bacteria 1611
278 Ga0070702_100141601 3300005615 Bacteria 1532
279 Ga0068852_100006412 3300005616 Bacteria 8501
280 Ga0068852_100073978 3300005616 Bacteria 2999
281 Ga0068852_100191180 3300005616 Bacteria 1932
282 Ga0068859_100002296 3300005617 Bacteria 19413
283 Ga0068859_100038396 3300005617 Bacteria 4804
284 Ga0068859_100043181 3300005617 Bacteria 4530
285 Ga0068859_100451919 3300005617 Bacteria 1381
286 Ga0068864_100002090 3300005618 Bacteria 16498
287 Ga0068864_100004252 3300005618 Bacteria 11784
288 Ga0068864_100030933 3300005618 Bacteria 4539
289 Ga0068866_10002715 3300005718 Bacteria 7301
290 Ga0068866_10010382 3300005718 Bacteria 3990
291 Ga0068866_10066835 3300005718 Bacteria 1885
292 Ga0068861_100001574 3300005719 Bacteria 14514
293 Ga0068861_100001910 3300005719 Bacteria 13413
294 Ga0068861_100142225 3300005719 Bacteria 1959
295 Ga0068861_100145140 3300005719 Bacteria 1941
296 Ga0068861_100456140 3300005719 Bacteria 1146
297 Ga0068861_100579863 3300005719 Bacteria 1026
298 Ga0068861_100596011 3300005719 Bacteria 1013
299 Ga0068851_10012493 3300005834 Bacteria 4005
300 Ga0068851_10244094 3300005834 Bacteria 1017
301 Ga0068870_10000133 3300005840 Bacteria 25631
302 Ga0068870_10078105 3300005840 Bacteria 1822
303 Ga0068870_10103020 3300005840 Bacteria 1617
304 Ga0068863_100001307 3300005841 Bacteria 24847
305 Ga0068863_100010858 3300005841 Bacteria 8831
306 Ga0068863_100050785 3300005841 Bacteria 3930
307 Ga0068863_100118460 3300005841 Bacteria 2524
308 Ga0068863_100156523 3300005841 Bacteria 2182
309 Ga0068858_100001450 3300005842 Bacteria 24400
310 Ga0068858_100029162 3300005842 Bacteria 5124
311 Ga0068858_100047364 3300005842 Bacteria 3985
312 Ga0068858_100055131 3300005842 Bacteria 3674
313 Ga0068858_100103118 3300005842 Bacteria 2661
314 Ga0068860_100003358 3300005843 Bacteria 16477
315 Ga0068860_100011366 3300005843 Bacteria 8773
316 Ga0068860_100040861 3300005843 Bacteria 4431
317 Ga0068860_100067009 3300005843 Bacteria 3411
318 Ga0068860_100119726 3300005843 Bacteria 2520
319 Ga0068860_100146466 3300005843 Bacteria 2272
320 Ga0068862_100006524 3300005844 Bacteria 9686
321 Ga0068862_100013206 3300005844 Bacteria 6830
322 Ga0068862_100188553 3300005844 Bacteria 1854
323 Ga0081455_10000009 3300005937 Bacteria 249885
324 Ga0081455_10006075 3300005937 Bacteria 13071
325 Ga0081455_10034040 3300005937 Bacteria 4570
326 Ga0081455_10039510 3300005937 Bacteria 4169
327 Ga0081455_10072301 3300005937 Bacteria 2856
328 Ga0081538_10001263 3300005981 Bacteria 26406
329 Ga0081540_1005549 3300005983 Bacteria 9399
330 Ga0081540_1007633 3300005983 Bacteria 7676
331 Ga0081540_1008834 3300005983 Bacteria 6997
332 Ga0081540_1015330 3300005983 Bacteria 4856
333 Ga0081540_1059689 3300005983 Bacteria 1829
334 Ga0070717_10012313 3300006028 Bacteria 6520
335 Ga0070717_10150544 3300006028 Bacteria 2013
336 Ga0075365_10034820 3300006038 Bacteria 3254
337 Ga0075365_10049225 3300006038 Bacteria 2776
338 Ga0075365_10063140 3300006038 Bacteria 2479
339 Ga0075365_10086232 3300006038 Bacteria 2134
340 Ga0075365_10393029 3300006038 Bacteria 978
341 Ga0075368_10062213 3300006042 Bacteria 1496
342 Ga0075363_100002157 3300006048 Bacteria 7916
343 Ga0075363_100038988 3300006048 Bacteria 2499
344 Ga0075364_10176770 3300006051 Bacteria 1444
345 Ga0075364_10281845 3300006051 Bacteria 1130
346 Ga0075364_10362623 3300006051 Bacteria 988
347 Ga0075432_10009083 3300006058 Bacteria 3386
348 Ga0075432_10050851 3300006058 Bacteria 1462
349 Ga0070715_10001233 3300006163 Bacteria 7360
350 Ga0070715_10001884 3300006163 Bacteria 6287
351 Ga0070715_10010881 3300006163 Bacteria 3256
352 Ga0070716_100001144 3300006173 Bacteria 11698
353 Ga0070716_100003890 3300006173 Bacteria 7086
354 Ga0070716_100225011 3300006173 Bacteria 1263
355 Ga0070712_100006971 3300006175 Bacteria 7045
356 Ga0070712_100012714 3300006175 Bacteria 5358
357 Ga0070712_100083832 3300006175 Bacteria 2316
358 Ga0070712_100150703 3300006175 Bacteria 1785
359 Ga0070712_100158544 3300006175 Bacteria 1745
360 Ga0070712_100519742 3300006175 Bacteria 1000
361 Ga0075362_10059913 3300006177 Bacteria 1720
362 Ga0075367_10017457 3300006178 Bacteria 3940
363 Ga0075367_10161551 3300006178 Bacteria 1393
364 Ga0075369_10009009 3300006186 Bacteria 3862
365 Ga0075427_10000933 3300006194 Bacteria 3598
366 Ga0075366_10095588 3300006195 Bacteria 1781
367 Ga0075366_10346061 3300006195 Bacteria 912
368 Ga0097621_100000616 3300006237 Bacteria 25167
369 Ga0097621_100067560 3300006237 Bacteria 2946
370 Ga0097621_100130845 3300006237 Bacteria 2136
371 Ga0097621_100451891 3300006237 Bacteria 1158
372 Ga0075370_10051098 3300006353 Bacteria 2345
373 Ga0075370_10405111 3300006353 Bacteria 818
374 Ga0068871_100016286 3300006358 Bacteria 5594
375 Ga0068871_100031874 3300006358 Bacteria 4159
376 Ga0068871_100045370 3300006358 Bacteria 3538
377 Ga0068871_100116665 3300006358 Bacteria 2251
378 Ga0075428_100009524 3300006844 Bacteria 10786
379 Ga0075428_100093645 3300006844 Bacteria 3276
380 Ga0075428_100319812 3300006844 Bacteria 1667
381 Ga0075428_100697545 3300006844 Bacteria 1081
382 Ga0075428_100914195 3300006844 Bacteria 931
383 Ga0075430_100053356 3300006846 Bacteria 3404
384 Ga0075430_100077845 3300006846 Bacteria 2780
385 Ga0075431_100004032 3300006847 Bacteria 14306
386 Ga0075431_100025139 3300006847 Bacteria 6104
387 Ga0075431_100312229 3300006847 Bacteria 1587
388 Ga0075433_10000876 3300006852 Bacteria 21135
389 Ga0075433_10061884 3300006852 Bacteria 3279
390 Ga0075433_10156830 3300006852 Bacteria 2025
391 Ga0075433_10327623 3300006852 Bacteria 1355
392 Ga0075433_10464983 3300006852 Bacteria 1115
393 Ga0075433_10975308 3300006852 Bacteria 738
394 Ga0075434_100003784 3300006871 Bacteria 13520
395 Ga0075434_100026789 3300006871 Bacteria 5653
396 Ga0075434_100056876 3300006871 Bacteria 3887
397 Ga0075434_100103418 3300006871 Bacteria 2856
398 Ga0075434_100237368 3300006871 Bacteria 1843
399 Ga0075434_100326636 3300006871 Bacteria 1555
400 Ga0075434_100453414 3300006871 Bacteria 1304
401 Ga0075434_100465532 3300006871 Bacteria 1285
402 Ga0075429_100178387 3300006880 Bacteria 1861
403 Ga0075429_100207320 3300006880 Bacteria 1717
404 Ga0068865_100001101 3300006881 Bacteria 15599
405 Ga0068865_100039979 3300006881 Bacteria 3184
406 Ga0068865_100053184 3300006881 Bacteria 2809
407 Ga0068865_100448001 3300006881 Bacteria 1067
408 Ga0075436_100027016 3300006914 Bacteria 3952
409 Ga0075436_100131444 3300006914 Bacteria 1756
410 Ga0075436_100254770 3300006914 Bacteria 1250
411 Ga0075436_100272646 3300006914 Bacteria 1209
412 Ga0097620_100002296 3300006931 Bacteria 19413
413 Ga0097620_100038394 3300006931 Bacteria 4804
414 Ga0097620_100043182 3300006931 Bacteria 4530
415 Ga0097620_100451932 3300006931 Bacteria 1381
416 Ga0075435_100020401 3300007076 Bacteria 5078
417 Ga0075435_100024050 3300007076 Bacteria 4721
418 Ga0075435_100032996 3300007076 Bacteria 4091
419 Ga0075435_100041844 3300007076 Bacteria 3663
420 Ga0075435_100063268 3300007076 Bacteria 3005
421 Ga0075435_100114060 3300007076 Bacteria 2250
422 Ga0075435_100117179 3300007076 Bacteria 2219
423 Ga0099795_10000155 3300007788 Bacteria 11496
424 Ga0105251_10037175 3300009011 Bacteria 2391
425 Ga0105251_10051478 3300009011 Bacteria 1964
426 Ga0105244_10061434 3300009036 Bacteria 1891
427 Ga0105250_10026850 3300009092 Bacteria 2320
428 Ga0105250_10137392 3300009092 Bacteria 1012
429 Ga0105250_10327236 3300009092 Bacteria 667
430 Ga0105240_10011690 3300009093 Bacteria 12198
431 Ga0105240_10031786 3300009093 Bacteria 6839
432 Ga0105240_11715710 3300009093 Bacteria 655
433 Ga0111539_10003401 3300009094 Bacteria 20957
434 Ga0111539_10035433 3300009094 Bacteria 6042
435 Ga0111539_10042647 3300009094 Bacteria 5446
436 Ga0111539_10171638 3300009094 Bacteria 2533
437 Ga0111539_10174268 3300009094 Bacteria 2513
438 Ga0111539_10391019 3300009094 Bacteria 1619
439 Ga0111539_11144462 3300009094 Bacteria 904
440 Ga0111539_12097479 3300009094 Bacteria 656
441 Ga0105245_10002367 3300009098 Bacteria 17040
442 Ga0105245_10056051 3300009098 Bacteria 3541
443 Ga0105245_10157650 3300009098 Bacteria 2151
444 Ga0105245_10601755 3300009098 Bacteria 1126
445 Ga0105247_10001141 3300009101 Bacteria 19671
446 Ga0105247_10007741 3300009101 Bacteria 6574
447 Ga0105247_10008319 3300009101 Bacteria 6328
448 Ga0105247_10011047 3300009101 Bacteria 5448
449 Ga0105247_10018808 3300009101 Bacteria 4147
450 Ga0105247_10028441 3300009101 Bacteria 3383
451 Ga0105247_10775489 3300009101 Bacteria 729
452 Ga0114129_10018611 3300009147 Bacteria 9888
453 Ga0114129_10058921 3300009147 Bacteria 5370
454 Ga0114129_10141666 3300009147 Bacteria 3295
455 Ga0114129_10207555 3300009147 Bacteria 2650
456 Ga0114129_10679670 3300009147 Bacteria 1325
457 Ga0105243_10000417 3300009148 Bacteria 44794
458 Ga0105243_10002317 3300009148 Bacteria 15945
459 Ga0105243_10015545 3300009148 Bacteria 5753
460 Ga0105241_10000456 3300009174 Bacteria 30774
461 Ga0105241_10003767 3300009174 Bacteria 11245
462 Ga0105241_10072284 3300009174 Bacteria 2680
463 Ga0105241_10205607 3300009174 Bacteria 1647
464 Ga0105241_10344256 3300009174 Bacteria 1293
465 Ga0105242_10000990 3300009176 Bacteria 22224
466 Ga0105242_10002247 3300009176 Bacteria 15232
467 Ga0105242_10137941 3300009176 Bacteria 2113
468 Ga0105242_10329538 3300009176 Bacteria 1403
469 Ga0105242_10600087 3300009176 Bacteria 1063
470 Ga0105242_10816779 3300009176 Bacteria 924
471 Ga0105248_10000293 3300009177 Bacteria 59383
472 Ga0105248_10013733 3300009177 Bacteria 8914
473 Ga0105248_10047103 3300009177 Bacteria 4834
474 Ga0105248_10064060 3300009177 Bacteria 4127
475 Ga0105248_10067752 3300009177 Bacteria 4007
476 Ga0105248_10083940 3300009177 Bacteria 3583
477 Ga0105248_10089844 3300009177 Bacteria 3458
478 Ga0105248_10198164 3300009177 Bacteria 2262
479 Ga0105248_10955660 3300009177 Bacteria 968
480 Ga0105237_10000712 3300009545 Bacteria 46011
481 Ga0105237_10024092 3300009545 Bacteria 6227
482 Ga0105237_10338448 3300009545 Bacteria 1509
483 Ga0105238_10008146 3300009551 Bacteria 10483
484 Ga0105238_10088824 3300009551 Bacteria 3077
485 Ga0105238_10757331 3300009551 Bacteria 985
486 Ga0105249_10001033 3300009553 Bacteria 24619
487 Ga0105249_10025232 3300009553 Bacteria 5348
488 Ga0105249_10049172 3300009553 Bacteria 3845
489 Ga0105249_10137387 3300009553 Bacteria 2341
490 Ga0099796_10000545 3300010159 Bacteria 6436
491 Ga0105239_10024373 3300010375 Bacteria 6666
492 Ga0105239_10121234 3300010375 Bacteria 2904
493 Ga0105239_10135993 3300010375 Bacteria 2736
494 Ga0105239_10402983 3300010375 Bacteria 1548
495 Ga0105246_10000118 3300011119 Bacteria 35893
496 Ga0105246_10001800 3300011119 Bacteria 12824
497 Ga0105246_10030840 3300011119 Bacteria 3544
498 Ga0105246_10237213 3300011119 Bacteria 1440
499 Ga0105246_10466612 3300011119 Bacteria 1065
500 Ga0157344_1000799 3300012476 Bacteria 1343
501 Ga0157346_1002141 3300012480 Bacteria 1002
502 Ga0157335_1002311 3300012492 Bacteria 1140
503 Ga0157341_1006083 3300012494 Bacteria 924
504 Ga0157313_1001600 3300012503 Bacteria 1245
505 Ga0157316_1003972 3300012510 Bacteria 1097
506 Ga0157338_1011623 3300012515 Bacteria 908
507 Ga0157373_10027665 3300013100 Bacteria 4091
508 Ga0157373_10619101 3300013100 Bacteria 789
509 Ga0157371_10005561 3300013102 Bacteria 10597
510 Ga0157371_10164975 3300013102 Bacteria 1582
511 Ga0157370_10014874 3300013104 Bacteria 7940
512 Ga0157369_10034660 3300013105 Bacteria 5537
513 Ga0157369_10524924 3300013105 Bacteria 1225
514 Ga0157374_10004169 3300013296 Bacteria 12136
515 Ga0157374_10067658 3300013296 Bacteria 3359
516 Ga0157374_10068417 3300013296 Bacteria 3341
517 Ga0157374_10775036 3300013296 Bacteria 974
518 Ga0157378_10000643 3300013297 Bacteria 32822
519 Ga0157378_10047383 3300013297 Bacteria 3822
520 Ga0157378_10075985 3300013297 Bacteria 3025
521 Ga0157378_10369456 3300013297 Bacteria 1406
522 Ga0163162_10003401 3300013306 Bacteria 15185
523 Ga0163162_10009748 3300013306 Bacteria 9350
524 Ga0163162_10009782 3300013306 Bacteria 9332
525 Ga0163162_10181804 3300013306 Bacteria 2229
526 Ga0163162_10206364 3300013306 Bacteria 2094
527 Ga0163162_10285414 3300013306 Bacteria 1782
528 Ga0163162_10622692 3300013306 Bacteria 1204
529 Ga0163162_10661123 3300013306 Bacteria 1168
530 Ga0163162_11180439 3300013306 Bacteria 868
531 Ga0157372_10001248 3300013307 Bacteria 27510
532 Ga0157372_10014509 3300013307 Bacteria 8432
533 Ga0157372_10116252 3300013307 Bacteria 3067
534 Ga0157372_10405850 3300013307 Bacteria 1588
535 Ga0157375_10002635 3300013308 Bacteria 15534
536 Ga0157375_10039024 3300013308 Bacteria 4565
537 Ga0157375_10063052 3300013308 Bacteria 3686
538 Ga0157375_10124184 3300013308 Bacteria 2694
539 Ga0157375_10419068 3300013308 Bacteria 1505
540 Ga0157375_10461012 3300013308 Bacteria 1436
541 Ga0163163_10005028 3300014325 Bacteria 11396
542 Ga0163163_10005155 3300014325 Bacteria 11267
543 Ga0163163_10047249 3300014325 Bacteria 4231
544 Ga0163163_10096909 3300014325 Bacteria 2970
545 Ga0163163_10176164 3300014325 Bacteria 2185
546 Ga0163163_10196977 3300014325 Bacteria 2063
547 Ga0163163_10227523 3300014325 Bacteria 1914
548 Ga0163163_10471930 3300014325 Bacteria 1315
549 Ga0157380_10001138 3300014326 Bacteria 17181
550 Ga0157380_10001301 3300014326 Bacteria 16225
551 Ga0157380_10449421 3300014326 Bacteria 1237
552 Ga0157380_10492797 3300014326 Bacteria 1188
553 Ga0157380_10554899 3300014326 Bacteria 1128
554 Ga0157377_10000982 3300014745 Bacteria 12022
555 Ga0157377_10001682 3300014745 Bacteria 9646
556 Ga0157377_10024270 3300014745 Bacteria 3222
557 Ga0157377_10117432 3300014745 Bacteria 1608
558 Ga0157377_10321503 3300014745 Bacteria 1028
559 Ga0157379_10000275 3300014968 Bacteria 40524
560 Ga0157379_10000933 3300014968 Bacteria 23653
561 Ga0157379_10010341 3300014968 Bacteria 8127
562 Ga0157379_10018203 3300014968 Bacteria 6190
563 Ga0157379_10097828 3300014968 Bacteria 2635
564 Ga0157379_10162654 3300014968 Bacteria 2015
565 Ga0157379_10173780 3300014968 Bacteria 1945
566 Ga0157376_10001069 3300014969 Bacteria 17936
567 Ga0157376_10001767 3300014969 Bacteria 14394
568 Ga0157376_10033668 3300014969 Bacteria 4128
569 Ga0157376_10067815 3300014969 Bacteria 3018
570 Ga0157376_10225758 3300014969 Bacteria 1737
571 Ga0157376_10714668 3300014969 Bacteria 1008
572 Ga0157376_10910733 3300014969 Bacteria 898
573 Ga0163161_10044631 3300017792 Bacteria 3193
574 Ga0163161_10115761 3300017792 Bacteria 2010
575 Ga0163161_10138728 3300017792 Bacteria 1840
576 Ga0228598_1003451 3300024227 Bacteria 3400
577 Ga0209677_100646 3300025253 Bacteria 18446
578 Ga0207666_1000149 3300025271 Bacteria 10831
579 Ga0207673_1000068 3300025290 Bacteria 8898
580 Ga0209758_1016560 3300025297 Bacteria 3735
581 Ga0207697_10012080 3300025315 Bacteria 3635
582 Ga0207697_10012377 3300025315 Bacteria 3578
583 Ga0207697_10028933 3300025315 Bacteria 2267
584 Ga0207697_10167940 3300025315 Bacteria 959
585 Ga0207656_10063337 3300025321 Bacteria 1627
586 Ga0207653_10003139 3300025885 Bacteria 5228
587 Ga0207682_10000695 3300025893 Bacteria 15627
588 Ga0207692_10087236 3300025898 Bacteria 1683
589 Ga0207642_10000453 3300025899 Bacteria 12480
590 Ga0207710_10011822 3300025900 Bacteria 3672
591 Ga0207710_10027741 3300025900 Bacteria 2454
592 Ga0207710_10044901 3300025900 Bacteria 1969
593 Ga0207710_10048741 3300025900 Bacteria 1896
594 Ga0207710_10314770 3300025900 Bacteria 793
595 Ga0207688_10000764 3300025901 Bacteria 15995
596 Ga0207688_10008788 3300025901 Bacteria 5496
597 Ga0207688_10064883 3300025901 Bacteria 2062
598 Ga0207680_10044492 3300025903 Bacteria 2611
599 Ga0207680_10056057 3300025903 Bacteria 2379
600 Ga0207680_10137513 3300025903 Bacteria 1616
601 Ga0207680_10240928 3300025903 Bacteria 1246
602 Ga0207680_10431973 3300025903 Bacteria 933
603 Ga0207647_10001565 3300025904 Bacteria 17590
604 Ga0207647_10022486 3300025904 Bacteria 4185
605 Ga0207647_10030550 3300025904 Bacteria 3473
606 Ga0207685_10008128 3300025905 Bacteria 2969
607 Ga0207685_10055588 3300025905 Bacteria 1546
608 Ga0207699_10029787 3300025906 Bacteria 3047
609 Ga0207699_10052606 3300025906 Bacteria 2411
610 Ga0207699_10304265 3300025906 Bacteria 1114
611 Ga0207645_10019429 3300025907 Bacteria 4453
612 Ga0207645_10035619 3300025907 Bacteria 3196
613 Ga0207645_10131127 3300025907 Bacteria 1631
614 Ga0207645_10197517 3300025907 Bacteria 1323
615 Ga0207643_10000523 3300025908 Bacteria 24625
616 Ga0207643_10013330 3300025908 Bacteria 4449
617 Ga0207643_10103051 3300025908 Bacteria 1675
618 Ga0207705_10396043 3300025909 Bacteria 1068
619 Ga0207684_10167323 3300025910 Bacteria 1895
620 Ga0207654_10001610 3300025911 Bacteria 11830
621 Ga0207654_10053975 3300025911 Bacteria 2322
622 Ga0207654_10123326 3300025911 Bacteria 1630
623 Ga0207654_10165849 3300025911 Bacteria 1430
624 Ga0207707_10001147 3300025912 Bacteria 25092
625 Ga0207707_10051812 3300025912 Bacteria 3574
626 Ga0207707_10338101 3300025912 Bacteria 1298
627 Ga0207695_10136425 3300025913 Bacteria 2406
628 Ga0207671_10130803 3300025914 Bacteria 1926
629 Ga0207693_10000703 3300025915 Bacteria 30046
630 Ga0207693_10003911 3300025915 Bacteria 12683
631 Ga0207693_10010627 3300025915 Bacteria 7469
632 Ga0207693_10041415 3300025915 Bacteria 3626
633 Ga0207663_10001248 3300025916 Bacteria 11772
634 Ga0207663_10160475 3300025916 Bacteria 1586
635 Ga0207663_10185141 3300025916 Bacteria 1490
636 Ga0207663_10292068 3300025916 Bacteria 1215
637 Ga0207660_10028108 3300025917 Bacteria 3845
638 Ga0207660_10102335 3300025917 Bacteria 2141
639 Ga0207660_10590809 3300025917 Bacteria 904
640 Ga0207662_10002213 3300025918 Bacteria 9693
641 Ga0207662_10020777 3300025918 Bacteria 3748
642 Ga0207662_10083908 3300025918 Bacteria 1948
643 Ga0207662_10097343 3300025918 Bacteria 1819
644 Ga0207662_10128515 3300025918 Bacteria 1595
645 Ga0207657_10000304 3300025919 Bacteria 52135
646 Ga0207657_10056806 3300025919 Bacteria 3375
647 Ga0207657_10076719 3300025919 Bacteria 2818
648 Ga0207657_10243994 3300025919 Bacteria 1433
649 Ga0207657_10349052 3300025919 Bacteria 1167
650 Ga0207649_10000142 3300025920 Bacteria 60023
651 Ga0207649_10002403 3300025920 Bacteria 10501
652 Ga0207649_10085151 3300025920 Bacteria 2056
653 Ga0207649_10271214 3300025920 Bacteria 1230
654 Ga0207649_10274574 3300025920 Bacteria 1223
655 Ga0207652_10002021 3300025921 Bacteria 17491
656 Ga0207652_10043155 3300025921 Bacteria 3840
657 Ga0207652_10092880 3300025921 Bacteria 2655
658 Ga0207646_10168325 3300025922 Bacteria 1979
659 Ga0207681_10020796 3300025923 Bacteria 4164
660 Ga0207681_10044828 3300025923 Bacteria 2965
661 Ga0207681_10090654 3300025923 Bacteria 2182
662 Ga0207681_10100954 3300025923 Bacteria 2081
663 Ga0207694_10009066 3300025924 Bacteria 7507
664 Ga0207694_10166927 3300025924 Bacteria 1781
665 Ga0207694_10517013 3300025924 Bacteria 1000
666 Ga0207650_10002366 3300025925 Bacteria 13121
667 Ga0207650_10069957 3300025925 Bacteria 2637
668 Ga0207650_10095801 3300025925 Bacteria 2275
669 Ga0207650_10156525 3300025925 Bacteria 1802
670 Ga0207659_10000078 3300025926 Bacteria 61403
671 Ga0207687_10001882 3300025927 Bacteria 14454
672 Ga0207687_10002377 3300025927 Bacteria 12775
673 Ga0207700_10048631 3300025928 Bacteria 3150
674 Ga0207700_10103473 3300025928 Bacteria 2276
675 Ga0207700_10456861 3300025928 Bacteria 1126
676 Ga0207664_10232042 3300025929 Bacteria 1604
677 Ga0207664_10259026 3300025929 Bacteria 1520
678 Ga0207644_10001431 3300025931 Bacteria 15367
679 Ga0207644_10026921 3300025931 Bacteria 3969
680 Ga0207644_10668146 3300025931 Bacteria 865
681 Ga0207690_10002633 3300025932 Bacteria 10810
682 Ga0207690_10003254 3300025932 Bacteria 9744
683 Ga0207690_10233063 3300025932 Bacteria 1414
684 Ga0207690_10345735 3300025932 Bacteria 1175
685 Ga0207706_10000263 3300025933 Bacteria 57106
686 Ga0207706_10120424 3300025933 Bacteria 2307
687 Ga0207706_10134940 3300025933 Bacteria 2171
688 Ga0207706_10235601 3300025933 Bacteria 1600
689 Ga0207686_10003396 3300025934 Bacteria 8551
690 Ga0207686_10027400 3300025934 Bacteria 3337
691 Ga0207686_10310464 3300025934 Bacteria 1174
692 Ga0207709_10004092 3300025935 Bacteria 8489
693 Ga0207709_10009025 3300025935 Bacteria 5498
694 Ga0207709_10036935 3300025935 Bacteria 2899
695 Ga0207709_10437622 3300025935 Bacteria 1008
696 Ga0207670_10003694 3300025936 Bacteria 8121
697 Ga0207670_10004344 3300025936 Bacteria 7619
698 Ga0207670_10147585 3300025936 Bacteria 1741
699 Ga0207670_10217252 3300025936 Bacteria 1461
700 Ga0207669_10001025 3300025937 Bacteria 11929
701 Ga0207669_10001156 3300025937 Bacteria 11247
702 Ga0207669_10138591 3300025937 Bacteria 1685
703 Ga0207669_10263326 3300025937 Bacteria 1291
704 Ga0207669_10335748 3300025937 Bacteria 1162
705 Ga0207704_10085875 3300025938 Bacteria 2050
706 Ga0207704_10274213 3300025938 Bacteria 1279
707 Ga0207704_10397170 3300025938 Bacteria 1087
708 Ga0207665_10000219 3300025939 Bacteria 38754
709 Ga0207665_10001692 3300025939 Bacteria 14821
710 Ga0207665_10010841 3300025939 Bacteria 5984
711 Ga0207665_10041611 3300025939 Bacteria 3069
712 Ga0207691_10002753 3300025940 Bacteria 17136
713 Ga0207691_10008131 3300025940 Bacteria 10069
714 Ga0207691_10064975 3300025940 Bacteria 3304
715 Ga0207691_10159568 3300025940 Bacteria 1979
716 Ga0207711_10008692 3300025941 Bacteria 8496
717 Ga0207711_10037167 3300025941 Bacteria 4134
718 Ga0207711_10040516 3300025941 Bacteria 3963
719 Ga0207711_10089107 3300025941 Bacteria 2710
720 Ga0207711_10567174 3300025941 Bacteria 1059
721 Ga0207689_10001399 3300025942 Bacteria 23007
722 Ga0207689_10010207 3300025942 Bacteria 8094
723 Ga0207689_10013204 3300025942 Bacteria 7050
724 Ga0207689_10073515 3300025942 Bacteria 2808
725 Ga0207689_10076767 3300025942 Bacteria 2746
726 Ga0207689_10236575 3300025942 Bacteria 1510
727 Ga0207689_10668585 3300025942 Bacteria 875
728 Ga0207661_10001264 3300025944 Bacteria 16911
729 Ga0207661_10027285 3300025944 Bacteria 4361
730 Ga0207679_10000064 3300025945 Bacteria 98118
731 Ga0207679_10043430 3300025945 Bacteria 3236
732 Ga0207679_10458704 3300025945 Bacteria 1131
733 Ga0207667_10106805 3300025949 Bacteria 2888
734 Ga0207667_10173810 3300025949 Bacteria 2213
735 Ga0207651_10000420 3300025960 Bacteria 18070
736 Ga0207651_10000820 3300025960 Bacteria 13434
737 Ga0207651_10197490 3300025960 Bacteria 1609
738 Ga0207651_10984408 3300025960 Bacteria 753
739 Ga0207712_10001661 3300025961 Bacteria 14931
740 Ga0207712_10013354 3300025961 Bacteria 5264
741 Ga0207712_10150750 3300025961 Bacteria 1796
742 Ga0207712_10685475 3300025961 Bacteria 893
743 Ga0207668_10000965 3300025972 Bacteria 17301
744 Ga0207668_10025031 3300025972 Bacteria 3858
745 Ga0207668_10047738 3300025972 Bacteria 2933
746 Ga0207668_10102696 3300025972 Bacteria 2127
747 Ga0207668_10257439 3300025972 Bacteria 1420
748 Ga0207668_10542324 3300025972 Bacteria 1006
749 Ga0207640_10001755 3300025981 Bacteria 11643
750 Ga0207640_10039179 3300025981 Bacteria 2997
751 Ga0207640_10819529 3300025981 Bacteria 808
752 Ga0207658_10037471 3300025986 Bacteria 3485
753 Ga0207677_10023844 3300026023 Bacteria 3788
754 Ga0207677_10088811 3300026023 Bacteria 2242
755 Ga0207677_10457550 3300026023 Bacteria 1095
756 Ga0207703_10005045 3300026035 Bacteria 10699
757 Ga0207703_10008946 3300026035 Bacteria 7887
758 Ga0207703_10044466 3300026035 Bacteria 3569
759 Ga0207703_10152745 3300026035 Bacteria 2015
760 Ga0207703_10240532 3300026035 Bacteria 1627
761 Ga0207703_10283672 3300026035 Bacteria 1505
762 Ga0207639_10019760 3300026041 Bacteria 4810
763 Ga0207639_10051164 3300026041 Bacteria 3141
764 Ga0207639_10265540 3300026041 Bacteria 1503
765 Ga0207639_10823749 3300026041 Bacteria 865
766 Ga0207678_10000209 3300026067 Bacteria 51832
767 Ga0207678_10010183 3300026067 Bacteria 8254
768 Ga0207678_10021975 3300026067 Bacteria 5592
769 Ga0207678_10034530 3300026067 Bacteria 4404
770 Ga0207678_10039287 3300026067 Bacteria 4107
771 Ga0207678_10056658 3300026067 Bacteria 3373
772 Ga0207678_10087331 3300026067 Bacteria 2665
773 Ga0207678_10120747 3300026067 Bacteria 2236
774 Ga0207678_10751888 3300026067 Bacteria 859
775 Ga0207708_10000953 3300026075 Bacteria 21674
776 Ga0207708_10002721 3300026075 Bacteria 12989
777 Ga0207708_10020852 3300026075 Bacteria 4944
778 Ga0207708_10193379 3300026075 Bacteria 1620
779 Ga0207702_10003767 3300026078 Bacteria 13697
780 Ga0207702_10007071 3300026078 Bacteria 9599
781 Ga0207702_10044708 3300026078 Bacteria 3723
782 Ga0207641_10007322 3300026088 Bacteria 9193
783 Ga0207641_10034057 3300026088 Bacteria 4234
784 Ga0207641_10200868 3300026088 Bacteria 1838
785 Ga0207641_10235182 3300026088 Bacteria 1705
786 Ga0207641_10802363 3300026088 Bacteria 931
787 Ga0207648_10013547 3300026089 Bacteria 7581
788 Ga0207648_10024588 3300026089 Bacteria 5374
789 Ga0207648_10082742 3300026089 Bacteria 2799
790 Ga0207648_10248865 3300026089 Bacteria 1584
791 Ga0207676_10000079 3300026095 Bacteria 94811
792 Ga0207676_10023198 3300026095 Bacteria 4573
793 Ga0207676_10081013 3300026095 Bacteria 2636
794 Ga0207676_10304493 3300026095 Bacteria 1456
795 Ga0207676_10530292 3300026095 Bacteria 1122
796 Ga0207676_10720567 3300026095 Bacteria 968
797 Ga0207674_10000719 3300026116 Bacteria 43313
798 Ga0207674_10013028 3300026116 Bacteria 9263
799 Ga0207674_10049956 3300026116 Bacteria 4275
800 Ga0207674_10303652 3300026116 Bacteria 1545
801 Ga0207674_10401253 3300026116 Bacteria 1325
802 Ga0207675_100001925 3300026118 Bacteria 20707
803 Ga0207675_100030016 3300026118 Bacteria 5061
804 Ga0207675_100030051 3300026118 Bacteria 5058
805 Ga0207675_100043624 3300026118 Bacteria 4188
806 Ga0207675_100095437 3300026118 Bacteria 2798
807 Ga0207675_100140676 3300026118 Bacteria 2293
808 Ga0207675_100314621 3300026118 Bacteria 1527
809 Ga0207683_10000037 3300026121 Bacteria 100920
810 Ga0207683_10038116 3300026121 Bacteria 4187
811 Ga0207683_10038529 3300026121 Bacteria 4167
812 Ga0207683_10794664 3300026121 Bacteria 878
813 Ga0207698_10725543 3300026142 Bacteria 991
814 Ga0209984_1025295 3300027424 Bacteria 826
815 Ga0210000_1010455 3300027462 Bacteria 1373
816 Ga0209179_1000126 3300027512 Bacteria 8526
817 Ga0210002_1000055 3300027617 Bacteria 17399
818 Ga0209971_1002180 3300027682 Bacteria 4760
819 Ga0209966_1003905 3300027695 Bacteria 2517
820 Ga0209966_1047260 3300027695 Bacteria 909
821 Ga0209998_10001005 3300027717 Bacteria 7098
822 Ga0209998_10012476 3300027717 Bacteria 1764
823 Ga0209974_10003776 3300027876 Bacteria 5426
824 Ga0209974_10006247 3300027876 Bacteria 4167
825 Ga0207428_10000216 3300027907 Bacteria 79777
826 Ga0207428_10000947 3300027907 Bacteria 32277
827 Ga0207428_10029008 3300027907 Bacteria 4592
828 Ga0207428_10034068 3300027907 Bacteria 4177
829 Ga0207428_10209350 3300027907 Bacteria 1465
830 Ga0268266_10002460 3300028379 Bacteria 19801
831 Ga0268266_10004625 3300028379 Bacteria 13124
832 Ga0268266_10028531 3300028379 Bacteria 4742
833 Ga0268266_10159548 3300028379 Bacteria 2039
834 Ga0268266_10222290 3300028379 Bacteria 1736
835 Ga0268266_10426394 3300028379 Bacteria 1257
836 Ga0268266_10865929 3300028379 Bacteria 873
837 Ga0268265_10001593 3300028380 Bacteria 18775
838 Ga0268265_10033810 3300028380 Bacteria 3720
839 Ga0268265_10078341 3300028380 Bacteria 2599
840 Ga0268265_10170919 3300028380 Bacteria 1857
841 Ga0268265_10220075 3300028380 Bacteria 1660
842 Ga0268265_10251496 3300028380 Bacteria 1565
843 Ga0268265_10424725 3300028380 Bacteria 1235
844 Ga0268264_10002487 3300028381 Bacteria 16198
845 Ga0268264_10071239 3300028381 Bacteria 2944
846 Ga0268264_10279821 3300028381 Bacteria 1562
847 Ga0268264_10769378 3300028381 Bacteria 960
848 Ga0307515_10458819 3300028794 Bacteria 889
849 Ga0265338_10016356 3300028800 Bacteria 8078
850 Ga0265760_10103908 3300031090 Bacteria 900
851 Ga0265330_10078554 3300031235 Bacteria 1423
852 Ga0265332_10001833 3300031238 Bacteria 11347
853 Ga0265332_10078189 3300031238 Bacteria 1405
854 Ga0265325_10000104 3300031241 Bacteria 59692
855 Ga0265325_10108939 3300031241 Bacteria 1348
856 Ga0265325_10139555 3300031241 Bacteria 1154
857 Ga0265325_10151187 3300031241 Bacteria 1098
858 Ga0265329_10084020 3300031242 Bacteria 1008
859 Ga0265340_10000912 3300031247 Bacteria 16766
860 Ga0265340_10023714 3300031247 Bacteria 3127
861 Ga0265340_10035724 3300031247 Bacteria 2467
862 Ga0265340_10066991 3300031247 Bacteria 1707
863 Ga0265339_10001873 3300031249 Bacteria 15436
864 Ga0265339_10040092 3300031249 Bacteria 2604
865 Ga0265339_10394257 3300031249 Bacteria 647
866 Ga0265327_10038056 3300031251 Bacteria 2628
867 Ga0265316_10173377 3300031344 Bacteria 1608
868 Ga0265313_10042774 3300031595 Bacteria 2222
869 Ga0316575_10027893 3300031665 Bacteria 2198
870 Ga0316575_10068149 3300031665 Bacteria 1427
871 Ga0265314_10009907 3300031711 Bacteria 7994
872 Ga0265314_10104897 3300031711 Bacteria 1809
873 Ga0265314_10237494 3300031711 Bacteria 1053
874 Ga0265342_10000011 3300031712 Bacteria 208435
875 Ga0265342_10004591 3300031712 Bacteria 10776
876 Ga0265342_10043958 3300031712 Bacteria 2694
877 Ga0316576_10009892 3300031727 Bacteria 6173
878 Ga0307413_10438084 3300031824 Bacteria 1034
879 Ga0307410_10653654 3300031852 Bacteria 882
880 Ga0307416_101000481 3300032002 Bacteria 939
881 Ga0307411_11102927 3300032005 Bacteria 715
882 Ga0307415_100759077 3300032126 Bacteria 881
883 Ga0316583_10060620 3300032133 Bacteria 1326
884 Ga0307510_10000998 3300033180 Bacteria 30010
885 Ga0307510_10070845 3300033180 Bacteria 3478
886 Ga0373948_0024827 3300034817 Bacteria 1172
887 Ga0373950_0001326 3300034818 Bacteria 3210
888 Ga0373950_0032256 3300034818 Bacteria 974
889 Ga0373958_0001110 3300034819 Bacteria 3557
890 Ga0373958_0024100 3300034819 Bacteria 1149
891 Ga0373959_0037895 3300034820 Bacteria 1000
892 Ga0373938_0011760 3300034957 Bacteria 1633
893 Ga0373926_0038931 3300035083 Bacteria 1694
894 Ga0373928_0000621 3300035084 Bacteria 6974
895 Ga0373929_0035100 3300035085 Bacteria 1090
896 Ga0373929_0043985 3300035085 Bacteria 1001
897 Ga0373934_0026332 3300035086 Bacteria 2256
898 Ga0373934_0156211 3300035086 Bacteria 935
899 Ga0373940_0020800 3300035088 Bacteria 1670
900 Ga0373940_0082408 3300035088 Bacteria 953
901 Ga0373944_0004381 3300035089 Bacteria 3674
902 Ga0373944_0051511 3300035089 Bacteria 1298
903 Ga0373949_0054052 3300035090 Bacteria 1018
904 Ga0373951_0025972 3300035091 Bacteria 1362
905 Ga0373951_0088153 3300035091 Bacteria 811
906 Ga0373952_0001248 3300035092 Bacteria 4636
907 Ga0373952_0001666 3300035092 Bacteria 4041
908 Ga0373923_0095776 3300035111 Bacteria 1303
909 Ga0373932_0003010 3300035112 Bacteria 4126
910 Ga0373936_0027457 3300035113 Bacteria 2232
911 Ga0373936_0092131 3300035113 Bacteria 1272
912 Ga0373936_0226977 3300035113 Bacteria 830
913 Ga0373939_0001456 3300035114 Bacteria 5728
914 Ga0373939_0002110 3300035114 Bacteria 4738
915 Ga0373939_0182499 3300035114 Bacteria 784
916 Ga0373941_0000073 3300035115 Bacteria 16016
917 Ga0373945_0003925 3300035116 Bacteria 4702
918 Ga0373945_0032058 3300035116 Bacteria 1860
919 Ga0373945_0070449 3300035116 Bacteria 1322
920 Ga0373945_0138105 3300035116 Bacteria 981
921 Ga0373954_0011780 3300035118 Bacteria 3881
922 Ga0373954_0019118 3300035118 Bacteria 3088
923 Ga0373954_0047850 3300035118 Bacteria 2002
924 Ga0373956_0142368 3300035119 Bacteria 1126
925 Ga0373956_0267467 3300035119 Bacteria 813
926 Ga0373960_0007900 3300035121 Bacteria 2533
927 Ga0373960_0047852 3300035121 Bacteria 1260
928 Ga0373960_0097727 3300035121 Bacteria 948
929 Ga0373960_0206990 3300035121 Bacteria 696
930 Ga0373943_0147418 3300035170 Bacteria 1272
931 Ga0373946_0011386 3300035171 Bacteria 3318
932 Ga0373946_0058208 3300035171 Bacteria 1636
933 Ga0373946_0100684 3300035171 Bacteria 1295
934 Ga0373946_0161101 3300035171 Bacteria 1053
935 Ga0373955_0000596 3300035172 Bacteria 15397
936 Ga0373955_0008707 3300035172 Bacteria 4723
937 Ga0373955_0286793 3300035172 Bacteria 991
938 Ga0373955_0349460 3300035172 Bacteria 895
939 Ga0373942_0004460 3300035207 Bacteria 3247
940 Ga0373942_0031940 3300035207 Bacteria 1396
941 Ga0373961_0002214 3300035241 Bacteria 5141
942 Ga0373961_0002508 3300035241 Bacteria 4739
943 Ga0373961_0028782 3300035241 Bacteria 1534
944 Ga0373962_0011700 3300035242 Bacteria 2202
945 Ga0373962_0038433 3300035242 Bacteria 1339
946 Ga0373962_0127147 3300035242 Bacteria 818
947 Ga0373924_0133752 3300035410 Bacteria 1079
948 Ga0373931_0007352 3300035691 Bacteria 5184
949 Ga0373931_0041535 3300035691 Bacteria 2416
950 Ga0373931_0094083 3300035691 Bacteria 1675
951 Ga0373931_0136999 3300035691 Bacteria 1414
952 Ga0373931_0163090 3300035691 Bacteria 1308
953 Ga0373931_0188535 3300035691 Bacteria 1225
954 Ga0373931_0402821 3300035691 Bacteria 867
955 Ga0373935_0023521 3300035692 Bacteria 3786
956 Ga0373935_0035954 3300035692 Bacteria 3094
957 Ga0373935_0088837 3300035692 Bacteria 2020
958 Ga0373935_0179385 3300035692 Bacteria 1453
959 Ga0373935_0219916 3300035692 Bacteria 1319
960 Ga0373935_0224761 3300035692 Bacteria 1305
961 Ga0373935_0287333 3300035692 Bacteria 1159
962 Ga0373935_0361731 3300035692 Bacteria 1036
963 Ga0373927_0041206 3300035695 Bacteria 2995
964 Ga0373933_0050540 3300035724 Bacteria 2482
965 Ga0373947_0001465 3300035725 Bacteria 14517
966 Ga0373947_0054777 3300035725 Bacteria 2407
967 Ga0373947_0070451 3300035725 Bacteria 2142
968 Ga0373937_0003886 3300036401 Bacteria 12639
969 Ga0373937_0098200 3300036401 Bacteria 2716
970 Ga0373937_0420970 3300036401 Bacteria 1268
971 Ga0373937_1137856 3300036401 Bacteria 729
972 Ga0316582_0311503 3300036647 Bacteria 1082
973 Ga0316584_0013488 3300036712 Bacteria 5786
974 Ga0373925_0276660 3300037068 Bacteria 1351
975 Ga0373925_0402494 3300037068 Bacteria 1116
976 Ga0373925_0475603 3300037068 Bacteria 1024
977 Ga0373925_0744496 3300037068 Bacteria 808
978 Ga0395899_0013207 3300037312 Bacteria 6318
979 Ga0395899_0072948 3300037312 Bacteria 2511
980 Ga0395899_0181356 3300037312 Bacteria 1478
981 Ga0395900_0003303 3300037418 Bacteria 17453
982 Ga0395900_0005284 3300037418 Bacteria 13537
983 Ga0395900_0018616 3300037418 Bacteria 7082
984 Ga0395900_0083563 3300037418 Bacteria 3280
985 Ga0395900_0242349 3300037418 Bacteria 1808
986 Ga0395900_0279491 3300037418 Bacteria 1662
987 Ga0395900_1154503 3300037418 Bacteria 691
988 Ga0395898_0007949 3300037466 Bacteria 11250
989 Ga0395898_0013960 3300037466 Bacteria 8254
990 Ga0395898_0051498 3300037466 Bacteria 4026
991 Ga0395898_0097387 3300037466 Bacteria 2825
992 Ga0395898_0132734 3300037466 Bacteria 2384
993 Ga0395905_0002720 3300037471 Bacteria 19373
994 Ga0395905_0023923 3300037471 Bacteria 5767
995 Ga0395905_0224049 3300037471 Bacteria 1759
996 Ga0395905_0538647 3300037471 Bacteria 1068
997 Ga0395905_0930992 3300037471 Bacteria 772
998 Ga0436364_1400093 3300037853 Bacteria 1564
999 Ga0395901_0011535 3300038443 Bacteria 8954
1000 Ga0395901_0032978 3300038443 Bacteria 5343
1001 Ga0395901_0126562 3300038443 Bacteria 2685
1002 Ga0395901_0173159 3300038443 Bacteria 2264
1003 Ga0395901_0173764 3300038443 Bacteria 2260
1004 Ga0242420_001294 3300038996 Bacteria 3291
1005 Ga0436365_0222599 3300039437 Bacteria 829
1006 Ga0436361_0008631 3300039447 Bacteria 2212
1007 Ga0436361_0134221 3300039447 Bacteria 1943
1008 Ga0436361_0134613 3300039447 Bacteria 2505
1009 Ga0436363_0373741 3300039450 Bacteria 1388
1010 Ga0439465_0100894 3300041413 Bacteria 996
1011 Ga0439450_032555 3300042008 Bacteria 1178
1012 Ga0439463_005398 3300042016 Bacteria 3175
1013 Ga0439464_0008117 3300042439 Bacteria 2753
1014 Ga0451577_0057746 3300042876 Bacteria 3459
1015 Ga0451577_0320187 3300042876 Bacteria 1406
1016 Ga0453684_0083097 3300044712 Bacteria 3987
1017 Ga0466968_0269607 3300044735 Bacteria 812
1018 Ga0451576_0056877 3300045051 Bacteria 4089
1019 Ga0466967_0970447 3300045976 Bacteria 846
1020 Ga0495617_045430 3300046452 Bacteria 1464
1021 Ga0495592_0019655 3300046454 Bacteria 5138
1022 Ga0495592_0069788 3300046454 Bacteria 2561
1023 Ga0495592_0070753 3300046454 Bacteria 2540
1024 Ga0495603_0007479 3300046455 Bacteria 6569
1025 Ga0495603_0033777 3300046455 Bacteria 3077
1026 Ga0495603_0037649 3300046455 Bacteria 2902
1027 Ga0495603_0056689 3300046455 Bacteria 2319
1028 Ga0495603_0057399 3300046455 Bacteria 2303
1029 Ga0495603_0182940 3300046455 Bacteria 1212
1030 Ga0495603_0273410 3300046455 Bacteria 971
1031 Ga0495590_0251140 3300046457 Bacteria 658
1032 Ga0495629_0001773 3300046459 Bacteria 16935
1033 Ga0495629_0003853 3300046459 Bacteria 11310
1034 Ga0495629_0013360 3300046459 Bacteria 5924
1035 Ga0495629_0036202 3300046459 Bacteria 3485
1036 Ga0495629_0086389 3300046459 Bacteria 2188
1037 Ga0495629_0121691 3300046459 Bacteria 1818
1038 Ga0495638_0010149 3300046460 Bacteria 6559
1039 Ga0495638_0040049 3300046460 Bacteria 2970
1040 Ga0495638_0070326 3300046460 Bacteria 2143
1041 Ga0495638_0152367 3300046460 Bacteria 1340
1042 Ga0495641_0011539 3300046461 Bacteria 5023
1043 Ga0495641_0013912 3300046461 Bacteria 4386
1044 Ga0495641_0017570 3300046461 Bacteria 3722
1045 Ga0495641_0067695 3300046461 Bacteria 1606
1046 Ga0495651_0000921 3300046462 Bacteria 22808
1047 Ga0495651_0067157 3300046462 Bacteria 2736
1048 Ga0495651_0084924 3300046462 Bacteria 2384
1049 Ga0495653_0005157 3300046463 Bacteria 10610
1050 Ga0495653_0288821 3300046463 Bacteria 1074
1051 Ga0495580_0000835 3300046472 Bacteria 26710
1052 Ga0495580_0028360 3300046472 Bacteria 4068
1053 Ga0495580_0084572 3300046472 Bacteria 2210
1054 Ga0495580_0407193 3300046472 Bacteria 916
1055 Ga0495582_0007761 3300046473 Bacteria 5933
1056 Ga0495582_0051422 3300046473 Bacteria 2271
1057 Ga0495582_0069273 3300046473 Bacteria 1950
1058 Ga0495582_0334637 3300046473 Bacteria 871
1059 Ga0495639_0012808 3300046475 Bacteria 3618
1060 Ga0495639_0026424 3300046475 Bacteria 2566
1061 Ga0495639_0032725 3300046475 Bacteria 2320
1062 Ga0495639_0048671 3300046475 Bacteria 1923
1063 Ga0495662_0009375 3300046476 Bacteria 4803
1064 Ga0495662_0129337 3300046476 Bacteria 1241
1065 Ga0495664_0031811 3300046477 Bacteria 3093
1066 Ga0495584_0021018 3300046491 Bacteria 3315
1067 Ga0495584_0187363 3300046491 Bacteria 1051
1068 Ga0495584_0222717 3300046491 Bacteria 959
1069 Ga0495585_0011751 3300046492 Bacteria 5175
1070 Ga0495585_0048246 3300046492 Bacteria 2368
1071 Ga0495594_0020228 3300046499 Bacteria 3544
1072 Ga0495594_0035972 3300046499 Bacteria 2699
1073 Ga0495594_0138431 3300046499 Bacteria 1380
1074 Ga0495594_0242279 3300046499 Bacteria 1028
1075 Ga0495594_0277211 3300046499 Bacteria 955
1076 Ga0495607_0020287 3300046501 Bacteria 4205
1077 Ga0495608_0021603 3300046511 Bacteria 4417
1078 Ga0495610_0087255 3300046512 Bacteria 1420
1079 Ga0495616_0133607 3300046513 Bacteria 1135
1080 Ga0495618_0062799 3300046514 Bacteria 2357
1081 Ga0495618_0175740 3300046514 Bacteria 1362
1082 Ga0495620_0106144 3300046515 Bacteria 1116
1083 Ga0495620_0199018 3300046515 Bacteria 771
1084 Ga0495628_0014081 3300046516 Bacteria 6713
1085 Ga0495630_0014066 3300046517 Bacteria 5823
1086 Ga0495630_0025494 3300046517 Bacteria 4373
1087 Ga0495630_0179847 3300046517 Bacteria 1612
1088 Ga0495632_0078302 3300046519 Bacteria 1579
1089 Ga0495632_0111294 3300046519 Bacteria 1285
1090 Ga0495632_0406252 3300046519 Bacteria 594
1091 Ga0495644_0003443 3300046523 Bacteria 6261
1092 Ga0495644_0134612 3300046523 Bacteria 942
1093 Ga0495648_0167164 3300046524 Bacteria 1131
1094 Ga0495648_0285712 3300046524 Bacteria 780
1095 Ga0495663_0094872 3300046525 Bacteria 976
1096 Ga0495666_0010494 3300046526 Bacteria 4619
1097 Ga0495666_0036764 3300046526 Bacteria 2384
1098 Ga0495666_0116339 3300046526 Bacteria 1254
1099 Ga0495652_0010378 3300046529 Bacteria 8442
1100 Ga0495652_0116472 3300046529 Bacteria 2139
1101 Ga0495652_0222660 3300046529 Bacteria 1417
1102 Ga0495652_0469597 3300046529 Bacteria 877
1103 Ga0495665_0016582 3300046531 Bacteria 3968
1104 Ga0495665_0075432 3300046531 Bacteria 1775
1105 Ga0495665_0145503 3300046531 Bacteria 1238
1106 Ga0495665_0228019 3300046531 Bacteria 962
1107 Ga0495640_0082760 3300046533 Bacteria 2130
1108 Ga0495640_0087133 3300046533 Bacteria 2066
1109 Ga0495640_0311774 3300046533 Bacteria 976
1110 Ga0495586_0077699 3300046535 Bacteria 1820
1111 Ga0495586_0381647 3300046535 Bacteria 810
1112 Ga0495587_0001768 3300046536 Bacteria 14451
1113 Ga0495587_0130519 3300046536 Bacteria 1436
1114 Ga0495598_0001247 3300046537 Bacteria 4951
1115 Ga0495598_0088230 3300046537 Bacteria 1007
1116 Ga0495621_0106772 3300046539 Bacteria 1070
1117 Ga0495645_0127864 3300046543 Bacteria 1784
1118 Ga0495645_0135379 3300046543 Bacteria 1724
1119 Ga0495645_0218645 3300046543 Bacteria 1282
1120 Ga0495622_0000576 3300046557 Bacteria 22007
1121 Ga0495622_0016818 3300046557 Bacteria 3407
1122 Ga0495622_0144157 3300046557 Bacteria 1080
1123 Ga0495633_0015379 3300046558 Bacteria 3971
1124 Ga0495633_0050252 3300046558 Bacteria 1966
1125 Ga0495667_0003339 3300046559 Bacteria 10747
1126 Ga0495667_0003637 3300046559 Bacteria 10371
1127 Ga0495667_0534727 3300046559 Bacteria 733
1128 Ga0495656_0035741 3300046615 Bacteria 2042
1129 Ga0495656_0161462 3300046615 Bacteria 1089
1130 Ga0495668_0126421 3300046616 Bacteria 1399
1131 Ga0495634_0050997 3300046642 Bacteria 2777
1132 Ga0495634_0115116 3300046642 Bacteria 1726
1133 Ga0495634_0297486 3300046642 Bacteria 976
1134 Ga0495611_0052551 3300046648 Bacteria 1838
1135 Ga0495611_0176422 3300046648 Bacteria 998
1136 Ga0495611_0202767 3300046648 Bacteria 925
1137 Ga0495625_0177779 3300046660 Bacteria 1417
1138 Ga0495625_0503512 3300046660 Bacteria 740
1139 Ga0495635_0010530 3300046663 Bacteria 6472
1140 Ga0495635_0029945 3300046663 Bacteria 3784
1141 Ga0495635_0033322 3300046663 Bacteria 3573
1142 Ga0495635_0037535 3300046663 Bacteria 3354
1143 Ga0495635_0105746 3300046663 Bacteria 1923
1144 Ga0495659_0003402 3300046664 Bacteria 5087
1145 Ga0495659_0050049 3300046664 Bacteria 1519
1146 Ga0495661_0076857 3300046665 Bacteria 1936
1147 Ga0495661_0169881 3300046665 Bacteria 1164
1148 Ga0495588_0013011 3300046674 Bacteria 3953
1149 Ga0495588_0086347 3300046674 Bacteria 1641
1150 Ga0495588_0121709 3300046674 Bacteria 1375
1151 Ga0495588_0159101 3300046674 Bacteria 1194
1152 Ga0495657_0039832 3300046675 Bacteria 3227
1153 Ga0495599_0002940 3300046678 Bacteria 9906
1154 Ga0495599_0042206 3300046678 Bacteria 2862
1155 Ga0495623_0029465 3300046679 Bacteria 3532
1156 Ga0495646_0014858 3300046680 Bacteria 4945
1157 Ga0495646_0165214 3300046680 Bacteria 1223
1158 Ga0495647_0001850 3300046681 Bacteria 6562
1159 Ga0495647_0036932 3300046681 Bacteria 1841
1160 Ga0495647_0101203 3300046681 Bacteria 1193
1161 Ga0495658_0000874 3300046683 Bacteria 16183
1162 Ga0495658_0014876 3300046683 Bacteria 3983
1163 Ga0495658_0065055 3300046683 Bacteria 2102
1164 Ga0495658_0168145 3300046683 Bacteria 1355
1165 Ga0495658_0175442 3300046683 Bacteria 1328
1166 Ga0495658_0284388 3300046683 Bacteria 1044
1167 Ga0495613_0001504 3300046689 Bacteria 17747
1168 Ga0495613_0020707 3300046689 Bacteria 4903
1169 Ga0495613_0032939 3300046689 Bacteria 3850
1170 Ga0495613_0185829 3300046689 Bacteria 1470
1171 Ga0495624_0035314 3300046690 Bacteria 3227
1172 Ga0495624_0123376 3300046690 Bacteria 1590
1173 Ga0495624_0364417 3300046690 Bacteria 869
1174 Ga0495670_0003793 3300046691 Bacteria 7426
1175 Ga0495670_0010427 3300046691 Bacteria 4565
1176 Ga0495670_0013237 3300046691 Bacteria 4057
1177 Ga0495671_0110284 3300046692 Bacteria 1344
1178 Ga0495649_0155117 3300046694 Bacteria 1202
1179 Ga0495649_0277895 3300046694 Bacteria 856
1180 Ga0495589_0029954 3300046794 Bacteria 2743
1181 Ga0495589_0060396 3300046794 Bacteria 1862
1182 Ga0495589_0086457 3300046794 Bacteria 1523
1183 Ga0495600_0012176 3300046809 Bacteria 5372
1184 Ga0495600_0092106 3300046809 Bacteria 1977
1185 Ga0495600_0094688 3300046809 Bacteria 1947
1186 Ga0495600_0225776 3300046809 Bacteria 1197
1187 Ga0495600_0598294 3300046809 Bacteria 670
1188 Ga0495581_0007632 3300047315 Bacteria 6258
1189 Ga0495581_0022957 3300047315 Bacteria 3613
1190 Ga0495581_0028023 3300047315 Bacteria 3265
1191 Ga0495581_0392897 3300047315 Bacteria 809
1192 Ga0495604_0217693 3300047317 Bacteria 1316
1193 Ga0495636_0026545 3300047318 Bacteria 2356
1194 Ga0495636_0204644 3300047318 Bacteria 902
1195 Ga0495674_0062320 3300047319 Bacteria 3248
1196 Ga0495674_0073520 3300047319 Bacteria 2946
1197 Ga0495674_0140303 3300047319 Bacteria 2032
1198 Ga0495674_0301131 3300047319 Bacteria 1309
1199 Ga0495676_0030696 3300047321 Bacteria 4555
1200 Ga0495676_0038359 3300047321 Bacteria 3978
1201 Ga0495676_0043807 3300047321 Bacteria 3658
1202 Ga0495676_0092609 3300047321 Bacteria 2256
1203 Ga0495676_0261048 3300047321 Bacteria 1178
1204 Ga0495680_0047510 3300047322 Bacteria 3376
1205 Ga0495680_0071429 3300047322 Bacteria 2643
1206 Ga0495680_0076614 3300047322 Bacteria 2535
1207 Ga0495680_0082709 3300047322 Bacteria 2422
1208 Ga0495680_0112322 3300047322 Bacteria 2018
1209 Ga0495683_0114933 3300047323 Bacteria 1282
1210 Ga0495687_001479 3300047443 Bacteria 21478
1211 Ga0495675_0206297 3300047444 Bacteria 1194
1212 Ga0495677_0038434 3300047445 Bacteria 1749
1213 Ga0495677_0168394 3300047445 Bacteria 847
1214 Ga0495685_096831 3300047447 Bacteria 975
1215 Ga0495673_0108827 3300047469 Bacteria 1111
1216 Ga0495684_0002658 3300047471 Bacteria 14168
1217 Ga0495684_0101159 3300047471 Bacteria 2179
1218 Ga0495684_0334461 3300047471 Bacteria 1079
1219 Ga0495686_0298381 3300047472 Bacteria 890
1220 Ga0495593_0002967 3300047673 Bacteria 10205
1221 Ga0495593_0033479 3300047673 Bacteria 2798
1222 Ga0495593_0139249 3300047673 Bacteria 1229
1223 Ga0495602_0000618 3300048088 Bacteria 33441
1224 Ga0495602_0009515 3300048088 Bacteria 10102
1225 Ga0495602_0118855 3300048088 Bacteria 2131
1226 Ga0495614_0154867 3300048089 Bacteria 1023
1227 Ga0495626_0037215 3300048091 Bacteria 2314
1228 Ga0496100_0001418 3300048903 Bacteria 11725
1229 Ga0496100_0018933 3300048903 Bacteria 4097
1230 Ga0496100_0027178 3300048903 Bacteria 3516
1231 Ga0496100_0058013 3300048903 Bacteria 2538
1232 Ga0496100_0116480 3300048903 Bacteria 1865
1233 Ga0496100_0167121 3300048903 Bacteria 1581
1234 Ga0496100_0459083 3300048903 Bacteria 977
1235 Ga0496101_0007889 3300048904 Bacteria 6928
1236 Ga0496101_0023336 3300048904 Bacteria 4272
1237 Ga0496101_0024749 3300048904 Bacteria 4159
1238 Ga0496101_0220075 3300048904 Bacteria 1473
1239 Ga0496101_0545065 3300048904 Bacteria 917
1240 Ga0496102_0005977 3300048905 Bacteria 10367
1241 Ga0496102_0027192 3300048905 Bacteria 5109
1242 Ga0496102_0052345 3300048905 Bacteria 3720
1243 Ga0496102_0071148 3300048905 Bacteria 3193
1244 Ga0496102_0161964 3300048905 Bacteria 2104
1245 Ga0496102_0172508 3300048905 Bacteria 2036
1246 Ga0496102_0182708 3300048905 Bacteria 1976
1247 Ga0496102_0192167 3300048905 Bacteria 1924
1248 Ga0496102_0375422 3300048905 Bacteria 1338
1249 Ga0496102_0434974 3300048905 Bacteria 1231
1250 Ga0496102_0545390 3300048905 Bacteria 1082
1251 Ga0496102_0686753 3300048905 Bacteria 947
1252 Ga0496103_0001402 3300048906 Bacteria 16210
1253 Ga0496103_0031407 3300048906 Bacteria 3235
1254 Ga0496103_0047272 3300048906 Bacteria 2659
1255 Ga0496103_0052786 3300048906 Bacteria 2518
1256 Ga0496103_0119580 3300048906 Bacteria 1677
1257 Ga0496103_0490539 3300048906 Bacteria 786
1258 Ga0496104_0000196 3300048907 Bacteria 53901
1259 Ga0496104_0004505 3300048907 Bacteria 12141
1260 Ga0496104_0023771 3300048907 Bacteria 5635
1261 Ga0496104_0041962 3300048907 Bacteria 4290
1262 Ga0496104_0066033 3300048907 Bacteria 3435
1263 Ga0496104_0096220 3300048907 Bacteria 2832
1264 Ga0496104_0263190 3300048907 Bacteria 1637
1265 Ga0496104_0367667 3300048907 Bacteria 1351
1266 Ga0496104_0406672 3300048907 Bacteria 1273
1267 Ga0496104_1472259 3300048907 Bacteria 584
1268 Ga0496105_0002714 3300048908 Bacteria 12911
1269 Ga0496105_0002806 3300048908 Bacteria 12740
1270 Ga0496105_0023768 3300048908 Bacteria 4975
1271 Ga0496105_0146095 3300048908 Bacteria 1945
1272 Ga0496105_0466777 3300048908 Bacteria 995
1273 Ga0496106_0048565 3300048909 Bacteria 3195
1274 Ga0496106_0049066 3300048909 Bacteria 3179
1275 Ga0496106_0050298 3300048909 Bacteria 3141
1276 Ga0496106_0074338 3300048909 Bacteria 2601
1277 Ga0496106_0094473 3300048909 Bacteria 2312
1278 Ga0496106_0142856 3300048909 Bacteria 1884
1279 Ga0496107_0001255 3300048910 Bacteria 15528
1280 Ga0496107_0002765 3300048910 Bacteria 11554
1281 Ga0496107_0010054 3300048910 Bacteria 6563
1282 Ga0496107_0015989 3300048910 Bacteria 5264
1283 Ga0496107_0019262 3300048910 Bacteria 4815
1284 Ga0496107_0037460 3300048910 Bacteria 3480
1285 Ga0496107_0041642 3300048910 Bacteria 3298
1286 Ga0496107_0441785 3300048910 Bacteria 967
1287 Ga0496107_0548652 3300048910 Bacteria 856
1288 Ga0496108_0002196 3300048911 Bacteria 15629
1289 Ga0496108_0010961 3300048911 Bacteria 7362
1290 Ga0496108_0013177 3300048911 Bacteria 6738
1291 Ga0496108_0041626 3300048911 Bacteria 3836
1292 Ga0496108_0173597 3300048911 Bacteria 1865
1293 Ga0496108_0177570 3300048911 Bacteria 1844
1294 Ga0496108_0191409 3300048911 Bacteria 1773
1295 Ga0496108_0251862 3300048911 Bacteria 1536
1296 Ga0496109_0001302 3300048912 Bacteria 20645
1297 Ga0496109_0010523 3300048912 Bacteria 7906
1298 Ga0496109_0018777 3300048912 Bacteria 6081
1299 Ga0496109_0043056 3300048912 Bacteria 4092
1300 Ga0496109_0068663 3300048912 Bacteria 3248
1301 Ga0496109_0307001 3300048912 Bacteria 1496
1302 Ga0496109_0547109 3300048912 Bacteria 1092
1303 Ga0496110_0043581 3300048913 Bacteria 3918
1304 Ga0496110_0065153 3300048913 Bacteria 3221
1305 Ga0496110_0072015 3300048913 Bacteria 3066
1306 Ga0496110_0170325 3300048913 Bacteria 1975
1307 Ga0496110_0231374 3300048913 Bacteria 1681
1308 Ga0496110_0276644 3300048913 Bacteria 1528
1309 Ga0496110_0426971 3300048913 Bacteria 1208
1310 Ga0496110_0449951 3300048913 Bacteria 1174
1311 Ga0496111_0002435 3300048914 Bacteria 11236
1312 Ga0496111_0008814 3300048914 Bacteria 6700
1313 Ga0496111_0024822 3300048914 Bacteria 4227
1314 Ga0496111_0064305 3300048914 Bacteria 2661
1315 Ga0496111_0226974 3300048914 Bacteria 1387
1316 Ga0496111_0333231 3300048914 Bacteria 1123
1317 Ga0496112_0004880 3300048915 Bacteria 11467
1318 Ga0496112_0005955 3300048915 Bacteria 10636
1319 Ga0496112_0046232 3300048915 Bacteria 4268
1320 Ga0496112_0055656 3300048915 Bacteria 3890
1321 Ga0496112_0075751 3300048915 Bacteria 3327
1322 Ga0496112_0076321 3300048915 Bacteria 3314
1323 Ga0496112_0092714 3300048915 Bacteria 2990
1324 Ga0496112_0133256 3300048915 Bacteria 2455
1325 Ga0496112_0393785 3300048915 Bacteria 1325
1326 Ga0496112_1236967 3300048915 Bacteria 663
1327 Ga0496113_0000394 3300048916 Bacteria 21064
1328 Ga0496113_0002343 3300048916 Bacteria 10959
1329 Ga0496113_0027510 3300048916 Bacteria 4078
1330 Ga0496113_0031970 3300048916 Bacteria 3822
1331 Ga0496113_0064283 3300048916 Bacteria 2774
1332 Ga0496113_0351528 3300048916 Bacteria 1182
1333 Ga0496114_0004563 3300048917 Bacteria 10757
1334 Ga0496114_0011722 3300048917 Bacteria 7011
1335 Ga0496114_0018298 3300048917 Bacteria 5664
1336 Ga0496114_0035965 3300048917 Bacteria 4092
1337 Ga0496114_0081983 3300048917 Bacteria 2725
1338 Ga0496114_0126945 3300048917 Bacteria 2199
1339 Ga0496114_0678046 3300048917 Bacteria 905
1340 Ga0496114_0787267 3300048917 Bacteria 829
1341 Ga0496114_1064643 3300048917 Bacteria 693
1342 Ga0496115_0004440 3300048918 Bacteria 10168
1343 Ga0496115_0005793 3300048918 Bacteria 8995
1344 Ga0496115_0015657 3300048918 Bacteria 5757
1345 Ga0496115_0187663 3300048918 Unclassified 1708
1346 Ga0496115_0214545 3300048918 Bacteria 1589
1347 Ga0496115_0267824 3300048918 Bacteria 1404
1348 Ga0496115_0396035 3300048918 Bacteria 1121
1349 Ga0496115_0484603 3300048918 Bacteria 995
1350 Ga0496116_0182617 3300048919 Bacteria 1121
1351 Ga0496118_0021970 3300048921 Bacteria 5595
1352 Ga0496119_0046748 3300048922 Bacteria 2699
1353 Ga0496121_0065288 3300048924 Bacteria 2962
1354 Ga0496121_0150220 3300048924 Bacteria 1715
1355 Ga0496121_0201088 3300048924 Bacteria 1420
1356 Ga0496121_0261538 3300048924 Bacteria 1194
1357 Ga0496121_0484065 3300048924 Bacteria 789
1358 Ga0496121_0521610 3300048924 Bacteria 749
1359 Ga0496122_0010630 3300048925 Bacteria 9454
1360 Ga0496123_0000699 3300048926 Bacteria 55169
1361 Ga0496124_0150105 3300048927 Bacteria 1829
1362 Ga0496124_0190898 3300048927 Bacteria 1568
1363 Ga0496125_0109970 3300048928 Bacteria 2000
1364 Ga0496126_0007417 3300048929 Bacteria 12031
1365 Ga0496126_0402706 3300048929 Bacteria 1109
1366 Ga0496126_0534638 3300048929 Bacteria 932
1367 Ga0501032_0065356 3300049569 Bacteria 2433
1368 Ga0501034_0065644 3300049571 Bacteria 3642
1369 Ga0501038_0103883 3300049574 Bacteria 2362
1370 Ga0501040_0024567 3300049576 Bacteria 4044
1371 Ga0501041_0096977 3300049577 Bacteria 1823
1372 Ga0501041_0629797 3300049577 Bacteria 685
1373 Ga0501043_0077627 3300049579 Bacteria 2609
1374 Ga0501047_0004728 3300049581 Bacteria 12808
1375 Ga0501048_0485860 3300049582 Bacteria 885
1376 Ga0501067_0163228 3300049583 Bacteria 1241
1377 Ga0501068_0223224 3300049584 Bacteria 1198
1378 Ga0501068_0375953 3300049584 Bacteria 915
1379 Ga0501070_0025239 3300049586 Bacteria 4983
1380 Ga0501070_0186440 3300049586 Bacteria 1706
1381 Ga0501071_0591937 3300049587 Bacteria 853
1382 Ga0501071_0658462 3300049587 Bacteria 806
1383 Ga0501072_0135586 3300049588 Bacteria 1963
1384 Ga0501073_0001633 3300049589 Bacteria 16626
1385 Ga0501074_0547975 3300049590 Bacteria 819
1386 Ga0501075_0030457 3300049591 Bacteria 3997
1387 Ga0501075_0062556 3300049591 Bacteria 2805
1388 Ga0501076_0109343 3300049592 Bacteria 2234
1389 Ga0501077_0014892 3300049593 Bacteria 4889
1390 Ga0501079_0010682 3300049741 Bacteria 6991
1391 Ga0501080_0163363 3300049742 Bacteria 2056
1392 Ga0501080_0253719 3300049742 Bacteria 1604
1393 Ga0501081_0008617 3300049743 Bacteria 6627
1394 Ga0501083_0093812 3300049744 Bacteria 1982
1395 Ga0501083_0095920 3300049744 Bacteria 1957
1396 Ga0501083_0112649 3300049744 Bacteria 1788
1397 Ga0501083_0126768 3300049744 Bacteria 1673
1398 Ga0501035_0224155 3300049822 Bacteria 1604
1399 Ga0501044_0006753 3300049823 Bacteria 12649
1400 Ga0501044_0037948 3300049823 Bacteria 5034
1401 Ga0501044_0346930 3300049823 Bacteria 1405
1402 Ga0501044_0365650 3300049823 Bacteria 1360
1403 Ga0501045_0701279 3300049824 Bacteria 747
1404 nmdc:mga03683_67278_c1 3300050489 Bacteria 1525
1405 nmdc:mga03n38_473825_c1 3300050490 Bacteria 699
1406 nmdc:mga03n38_57888_c1 3300050490 Bacteria 1754
1407 nmdc:mga03n38_900_c1 3300050490 Bacteria 8001
1408 nmdc:mga00v17_216763_c1 3300050491 Bacteria 1239
1409 nmdc:mga0yw44_149487_c1 3300050492 Bacteria 1523
1410 nmdc:mga0yw44_20390_c1 3300050492 Bacteria 3678
1411 nmdc:mga0yw44_2168_c1 3300050492 Bacteria 8242
1412 nmdc:mga0yw44_239384_c1 3300050492 Bacteria 1206
1413 nmdc:mga0k408_110847_c1 3300050493 Bacteria 1622
1414 nmdc:mga0k408_148432_c1 3300050493 Bacteria 1396
1415 nmdc:mga0k408_216802_c1 3300050493 Bacteria 1143
1416 nmdc:mga0k408_459212_c1 3300050493 Bacteria 756
1417 nmdc:mga0k408_493957_c1 3300050493 Bacteria 725
1418 nmdc:mga06z11_385242_c1 3300050494 Bacteria 843
1419 nmdc:mga04h51_35073_c1 3300050495 Bacteria 1606
1420 nmdc:mga04h51_57703_c1 3300050495 Bacteria 1321
1421 nmdc:mga07m45_83242_c1 3300050496 Bacteria 1828
1422 nmdc:mga05p37_129848_c1 3300050507 Bacteria 3092
1423 nmdc:mga05p37_4032_c1 3300050507 Bacteria 5627
1424 nmdc:mga05p37_465051_c1 3300050507 Bacteria 1461
1425 nmdc:mga05p37_595196_c1 3300050507 Bacteria 1249
1426 nmdc:mga05p37_92337_c1 3300050507 Bacteria 3730
1427 nmdc:mga09592_143025_c1 3300050508 Bacteria 2062
1428 nmdc:mga09592_4710_c1 3300050508 Bacteria 11047
1429 nmdc:mga0qj67_150443_c1 3300050509 Bacteria 1888
1430 nmdc:mga0qj67_552735_c1 3300050509 Bacteria 923
1431 nmdc:mga0qj67_646987_c1 3300050509 Bacteria 843
1432 nmdc:mga0qj67_768_c1 3300050509 Bacteria 21815
1433 nmdc:mga06r32_117900_c1 3300050510 Bacteria 2617
1434 nmdc:mga06r32_427368_c1 3300050510 Bacteria 1306
1435 nmdc:mga08y16_13725_c1 3300050511 Bacteria 8530
1436 nmdc:mga08y16_1880010_c1 3300050511 Bacteria 550
1437 nmdc:mga08y16_2116_c1 3300050511 Bacteria 20352
1438 nmdc:mga08y16_321381_c1 3300050511 Bacteria 1593
1439 nmdc:mga08y16_342219_c1 3300050511 Bacteria 1537
1440 nmdc:mga08y16_67671_c1 3300050511 Bacteria 3726
1441 nmdc:mga08y16_77404_c1 3300050511 Bacteria 3468
1442 nmdc:mga0n895_125016_c1 3300050512 Bacteria 2596
1443 nmdc:mga0n895_167480_c1 3300050512 Bacteria 2229
1444 nmdc:mga0n895_211894_c1 3300050512 Bacteria 1968
1445 nmdc:mga0n895_226459_c1 3300050512 Bacteria 1898
1446 nmdc:mga0n895_408739_c1 3300050512 Bacteria 1373
1447 nmdc:mga0rr50_1039_c1 3300050513 Bacteria 15047
1448 nmdc:mga0rr50_19830_c1 3300050513 Bacteria 4549
1449 nmdc:mga0rr50_379266_c1 3300050513 Bacteria 1192
1450 nmdc:mga0rr50_42391_c1 3300050513 Bacteria 3323
1451 nmdc:mga0rr50_85712_c1 3300050513 Bacteria 2442
1452 nmdc:mga0rr50_989646_c1 3300050513 Bacteria 717
1453 nmdc:mga08x19_114924_c1 3300050514 Bacteria 1798
1454 nmdc:mga08x19_157864_c1 3300050514 Bacteria 1539
1455 nmdc:mga08x19_38172_c1 3300050514 Bacteria 3050
1456 nmdc:mga08x19_50158_c1 3300050514 Bacteria 2678
1457 nmdc:mga0a205_12523_c1 3300050515 Bacteria 7851
1458 nmdc:mga0a205_153815_c1 3300050515 Bacteria 2199
1459 nmdc:mga0a205_293311_c1 3300050515 Bacteria 1501
1460 nmdc:mga0a205_719_c1 3300050515 Bacteria 26646
1461 nmdc:mga0sz30_16211_c1 3300050516 Bacteria 2955
1462 Ga0495601_0040671 3300053077 Bacteria 2912
1463 Ga0495601_0224068 3300053077 Bacteria 1228
1464 Ga0495601_0321479 3300053077 Bacteria 1007
1465 Ga0495612_0000795 3300053078 Bacteria 12832
1466 Ga0495612_0001561 3300053078 Bacteria 9432
1467 Ga0495612_0045685 3300053078 Bacteria 1793
1468 Ga0495612_0088008 3300053078 Bacteria 1311
1469 Ga0495655_0048895 3300053083 Bacteria 1111
1470 Ga0495595_0001780 3300053084 Bacteria 8401
1471 Ga0495595_0009392 3300053084 Bacteria 4045
1472 Ga0495595_0108490 3300053084 Bacteria 1344
1473 Ga0495595_0231695 3300053084 Bacteria 923
1474 Ga0495595_0247532 3300053084 Bacteria 892
1475 Ga0495619_0001605 3300053085 Bacteria 14871
1476 Ga0495619_0002808 3300053085 Bacteria 11348
1477 Ga0495619_0010084 3300053085 Bacteria 5948
1478 Ga0495619_0016499 3300053085 Bacteria 4676
1479 Ga0495619_0017496 3300053085 Bacteria 4538
1480 Ga0495619_0027239 3300053085 Bacteria 3680
1481 Ga0500643_068097 3300053087 Bacteria 990
1482 Ga0500644_0002004 3300053088 Bacteria 5187
1483 Ga0500646_0031443 3300053090 Bacteria 1461
1484 Ga0500583_0085791 3300053092 Bacteria 1527
1485 Ga0500583_0102302 3300053092 Bacteria 1404
1486 Ga0500566_0175753 3300053094 Bacteria 1103
1487 Ga0500566_0332379 3300053094 Bacteria 703
1488 Ga0500641_0002828 3300053096 Bacteria 6153
1489 Ga0500650_0242138 3300053098 Bacteria 811
1490 Ga0500555_093027 3300053103 Bacteria 773
1491 Ga0500593_000274 3300053117 Bacteria 21119
1492 Ga0500595_000002 3300053119 Bacteria 1074388
1493 Ga0500595_001169 3300053119 Bacteria 14529
1494 Ga0500595_008303 3300053119 Bacteria 4249
1495 Ga0500652_019791 3300053131 Bacteria 2507
1496 Ga0500652_094295 3300053131 Bacteria 1250
1497 Ga0500655_011673 3300053133 Bacteria 1594
1498 Ga0500658_0438589 3300053134 Bacteria 595
1499 Ga0500577_0065741 3300053142 Bacteria 1409
1500 Ga0500616_0000002 3300053153 Bacteria 1611257
1501 Ga0500616_0169368 3300053153 Bacteria 993
1502 Ga0500645_000410 3300053730 Bacteria 30009
1503 Ga0501084_0119599 3300054114 Bacteria 2214
1504 Ga0501082_0009855 3300060353 Bacteria 8233
1505 Ga0501082_0057803 3300060353 Bacteria 3341
1506 Ga0501082_0359557 3300060353 Bacteria 1270
1507 2643756579 2643221547 Bacteria 4740017
1508 2723845924 2721755755 Bacteria 8322773
1509 2765465450 2765235802 Bacteria 5618596
1510 2770197687 2767802442 Bacteria 5747986
1511 2774868500 2773857925 Bacteria 6472445
1512 2776271712 2775506902 Bacteria 6208009
1513 2776279775 2775506904 Bacteria 5954060
1514 2828305786 2828305725 Bacteria 4916900
1515 2839995691 2839993093 Bacteria 5512535
1516 2840769965 2840764183 Bacteria 6358399
1517 2842872802 2842871566 Bacteria 4827117
1518 2874609423 2874604998 Bacteria 7834745
1519 2876813191 2876808645 Bacteria 8824342
1520 2879110355 2879110137 Bacteria 8907982
1521 2882460511 2882456835 Bacteria 6863978
1522 2894654623 2894652903 Bacteria 4587256
1523 2904581592 2904578770 Bacteria 5302906
1524 2919122826 2919119836 Bacteria 5208557
1525 2922392233 2922386360 Bacteria 7017218
1526 3003672326 3003665799 Bacteria 7279786
1527 8006990550 8006984368 Bacteria 9651211
1528 8006996307 8006994254 Bacteria 8309700
1529 8056695786 8056689827 Bacteria 6712655
1530 Ga0105237_10464690
1531 2214856315
1532 ARcpr5oldR_c000202
1533 ARSoilYngRDRAFT_c00201
1534 ARcpr5yngRDRAFT_c000176
1535 ARSoilOldRDRAFT_c000187
1536 ARCol0oldRDRAFT_c02347
1537 ARCol0yngRDRAFT_1000204
1538 JGI24032J14994_100577
1539 JGI24752J21851_1004412
1540 JGI24746J21847_1002942
1541 JGI24739J22299_10012807
1542 JGI24737J22298_10003419
1543 JGI24737J22298_10031013
1544 JGI24743J22301_10004649
1545 JGI24750J21931_1002092
1546 JGI24748J21848_1003313
1547 JGI24738J21930_10002133
1548 JGI24738J21930_10002848
1549 JGI24738J21930_10011716
1550 JGI24744J21845_10013759
1551 JGI24033J26618_1002523
1552 JGI24034J26672_10001569
1553 JGI24034J26672_10004883
1554 JGI24742J22300_10006556
1555 JGI24742J22300_10007189
1556 Ga0006562J51391_1072694
1557 Ga0065716_1002368
1558 Ga0065704_10005364
1559 Ga0065712_10002565
1560 Ga0065715_10000602
1561 Ga0065715_10000779
1562 Ga0065707_10119681
1563 Ga0065707_10519568
1564 Ga0070658_10304524
1565 Ga0070658_10542866
1566 Ga0070676_10000170
1567 Ga0070676_10048243
1568 Ga0070676_10055775
1569 Ga0070683_100007194
1570 Ga0070683_100025517
1571 Ga0070683_100267388
1572 Ga0070683_100776329
1573 Ga0070690_100000533
1574 Ga0070690_100007785
1575 Ga0070690_100037856
1576 Ga0070690_100375674
1577 Ga0070670_100001563
1578 Ga0070670_100007710
1579 Ga0070670_100018981
1580 Ga0070670_100183906
1581 Ga0070677_10000320
1582 Ga0068869_100000181
1583 Ga0068869_100014062
1584 Ga0068869_100023059
1585 Ga0068869_100079064
1586 Ga0068869_100081008
1587 Ga0068869_100464313
1588 Ga0068869_100555443
1589 Ga0068869_100580816
1590 Ga0068869_100956081
1591 Ga0070666_10000893
1592 Ga0070666_10021002
1593 Ga0070666_10109278
1594 Ga0070666_10336369
1595 Ga0070680_100016082
1596 Ga0070680_100203803
1597 Ga0070680_100359363
1598 Ga0070680_100397581
1599 Ga0070680_100650272
1600 Ga0070682_100000573
1601 Ga0070682_100000903
1602 Ga0070682_100016960
1603 Ga0070682_100044961
1604 Ga0070682_100171307
1605 Ga0068868_100000287
1606 Ga0068868_100002842
1607 Ga0068868_100053941
1608 Ga0068868_100078297
1609 Ga0068868_100143378
1610 Ga0068868_100511377
1611 Ga0070660_100003177
1612 Ga0070660_100023149
1613 Ga0070660_100379450
1614 Ga0070689_100000136
1615 Ga0070689_100001256
1616 Ga0070689_100018095
1617 Ga0070689_100549246
1618 Ga0070691_10000085
1619 Ga0070691_10000418
1620 Ga0070691_10323580
1621 Ga0070687_100002615
1622 Ga0070687_100011861
1623 Ga0070687_100219702
1624 Ga0070661_100002616
1625 Ga0070661_100520801
1626 Ga0070661_100705230
1627 Ga0070661_100894393
1628 Ga0070692_10002091
1629 Ga0070692_10010746
1630 Ga0070692_10083630
1631 Ga0070668_100000188
1632 Ga0070668_100001169
1633 Ga0070668_100303584
1634 Ga0070668_100639276
1635 Ga0070669_100001556
1636 Ga0070669_100019772
1637 Ga0070669_100023221
1638 Ga0070669_101043520
1639 Ga0070675_100038119
1640 Ga0070675_100045291
1641 Ga0070675_100049831
1642 Ga0070671_100005621
1643 Ga0070671_100008445
1644 Ga0070671_100085669
1645 Ga0070671_100484614
1646 Ga0070671_100619743
1647 Ga0070671_101024128
1648 Ga0070674_100032220
1649 Ga0070674_100039583
1650 Ga0070674_100044252
1651 Ga0070674_100216926
1652 Ga0070674_101064527
1653 Ga0070673_100000191
1654 Ga0070673_100003390
1655 Ga0070688_100000981
1656 Ga0070688_100009109
1657 Ga0070688_100067111
1658 Ga0070688_100113882
1659 Ga0070688_100141008
1660 Ga0070688_100152339
1661 Ga0070688_100214272
1662 Ga0070688_100559243
1663 Ga0070659_100001504
1664 Ga0070659_100041455
1665 Ga0070659_100306809
1666 Ga0070667_100001681
1667 Ga0070667_100032349
1668 Ga0070667_100062837
1669 Ga0070667_100168830
1670 Ga0070667_100183834
1671 Ga0070667_100236644
1672 Ga0070667_100365985
1673 Ga0070703_10014931
1674 Ga0070709_10004792
1675 Ga0070709_10015140
1676 Ga0070709_10029345
1677 Ga0070709_10204030
1678 Ga0070709_10775126
1679 Ga0070714_100009596
1680 Ga0070714_100009986
1681 Ga0070713_100010983
1682 Ga0070713_100296138
1683 Ga0070710_10005069
1684 Ga0070710_10010865
1685 Ga0070710_10024828
1686 Ga0070710_10401382
1687 Ga0070701_10000454
1688 Ga0070701_10001284
1689 Ga0070701_10046339
1690 Ga0070711_100000961
1691 Ga0070711_100034363
1692 Ga0070711_100099922
1693 Ga0070711_100140869
1694 Ga0070705_100006964
1695 Ga0070705_100009498
1696 Ga0070705_100014665
1697 Ga0070705_100149248
1698 Ga0070705_100364976
1699 Ga0070700_100001181
1700 Ga0070700_100004996
1701 Ga0070700_100026485
1702 Ga0070700_100046465
1703 Ga0070694_100000659
1704 Ga0070694_100005471
1705 Ga0070694_100026966
1706 Ga0070694_100168255
1707 Ga0070694_100258671
1708 Ga0070708_100012815
1709 Ga0070708_100217296
1710 Ga0070708_100301609
1711 Ga0070708_100541419
1712 Ga0070663_100001220
1713 Ga0070663_100001277
1714 Ga0070663_100020947
1715 Ga0070663_100026167
1716 Ga0070663_100084716
1717 Ga0070663_100256998
1718 Ga0070663_100544340
1719 Ga0070678_100000682
1720 Ga0070678_100051447
1721 Ga0070678_100098678
1722 Ga0070678_100547881
1723 Ga0070678_100684868
1724 Ga0070662_100000339
1725 Ga0070662_100009258
1726 Ga0070662_100025609
1727 Ga0070662_100049937
1728 Ga0070681_10002441
1729 Ga0070681_10024612
1730 Ga0070681_10045062
1731 Ga0068867_100003651
1732 Ga0068867_100005776
1733 Ga0068867_100066847
1734 Ga0068867_100119450
1735 Ga0070685_10001020
1736 Ga0070685_10047091
1737 Ga0070685_10116531
1738 Ga0070685_10356442
1739 Ga0070685_10551607
1740 Ga0070706_100409282
1741 Ga0070707_100247698
1742 Ga0070698_100520643
1743 Ga0070699_100003740
1744 Ga0070699_100005151
1745 Ga0070699_100243455
1746 Ga0070699_100265772
1747 Ga0070679_100002397
1748 Ga0070679_100205962
1749 Ga0070679_100363214
1750 Ga0070684_100023896
1751 Ga0070684_100129882
1752 Ga0070697_100180051
1753 Ga0070697_100180676
1754 Ga0068853_100002127
1755 Ga0068853_100285340
1756 Ga0068853_100363022
1757 Ga0070672_100008180
1758 Ga0070672_100104924
1759 Ga0070672_100129901
1760 Ga0070686_100000707
1761 Ga0070686_100001852
1762 Ga0070686_100010885
1763 Ga0070686_100026881
1764 Ga0070686_100043297
1765 Ga0070695_100000995
1766 Ga0070695_100017667
1767 Ga0070695_100029096
1768 Ga0070696_100000743
1769 Ga0070696_100030172
1770 Ga0070696_100059761
1771 Ga0070696_100180766
1772 Ga0070696_100196382
1773 Ga0070696_100551444
1774 Ga0070693_100000993
1775 Ga0070693_100003405
1776 Ga0070693_100193224
1777 Ga0070665_100011802
1778 Ga0070665_100012968
1779 Ga0070665_100015770
1780 Ga0070665_100031231
1781 Ga0070665_100172863
1782 Ga0070665_100223967
1783 Ga0070704_100000607
1784 Ga0070704_100129790
1785 Ga0070704_100179847
1786 Ga0068855_100003471
1787 Ga0068855_100012458
1788 Ga0068855_100065612
1789 Ga0070664_100044843
1790 Ga0070664_100144557
1791 Ga0070664_100163030
1792 Ga0070664_100234239
1793 Ga0070664_100485787
1794 Ga0068857_100007472
1795 Ga0068857_100288465
1796 Ga0068854_100005622
1797 Ga0068854_100007745
1798 Ga0068854_100112874
1799 Ga0068854_100444423
1800 Ga0068856_100004777
1801 Ga0068856_100059691
1802 Ga0068856_100071204
1803 Ga0070702_100000022
1804 Ga0070702_100002122
1805 Ga0070702_100046887
1806 Ga0070702_100125969
1807 Ga0070702_100141601
1808 Ga0068852_100006412
1809 Ga0068852_100073978
1810 Ga0068852_100191180
1811 Ga0068859_100002296
1812 Ga0068859_100038396
1813 Ga0068859_100043181
1814 Ga0068859_100451919
1815 Ga0068864_100002090
1816 Ga0068864_100004252
1817 Ga0068864_100030933
1818 Ga0068866_10002715
1819 Ga0068866_10010382
1820 Ga0068866_10066835
1821 Ga0068861_100001574
1822 Ga0068861_100001910
1823 Ga0068861_100142225
1824 Ga0068861_100145140
1825 Ga0068861_100456140
1826 Ga0068861_100579863
1827 Ga0068861_100596011
1828 Ga0068851_10012493
1829 Ga0068851_10244094
1830 Ga0068870_10000133
1831 Ga0068870_10078105
1832 Ga0068870_10103020
1833 Ga0068863_100001307
1834 Ga0068863_100010858
1835 Ga0068863_100050785
1836 Ga0068863_100118460
1837 Ga0068863_100156523
1838 Ga0068858_100001450
1839 Ga0068858_100029162
1840 Ga0068858_100047364
1841 Ga0068858_100055131
1842 Ga0068858_100103118
1843 Ga0068860_100003358
1844 Ga0068860_100011366
1845 Ga0068860_100040861
1846 Ga0068860_100067009
1847 Ga0068860_100119726
1848 Ga0068860_100146466
1849 Ga0068862_100006524
1850 Ga0068862_100013206
1851 Ga0068862_100188553
1852 Ga0081455_10000009
1853 Ga0081455_10006075
1854 Ga0081455_10034040
1855 Ga0081455_10039510
1856 Ga0081455_10072301
1857 Ga0081538_10001263
1858 Ga0081540_1005549
1859 Ga0081540_1007633
1860 Ga0081540_1008834
1861 Ga0081540_1015330
1862 Ga0081540_1059689
1863 Ga0070717_10012313
1864 Ga0070717_10150544
1865 Ga0075365_10034820
1866 Ga0075365_10049225
1867 Ga0075365_10063140
1868 Ga0075365_10086232
1869 Ga0075365_10393029
1870 Ga0075368_10062213
1871 Ga0075363_100002157
1872 Ga0075363_100038988
1873 Ga0075364_10176770
1874 Ga0075364_10281845
1875 Ga0075364_10362623
1876 Ga0075432_10009083
1877 Ga0075432_10050851
1878 Ga0070715_10001233
1879 Ga0070715_10001884
1880 Ga0070715_10010881
1881 Ga0070716_100001144
1882 Ga0070716_100003890
1883 Ga0070716_100225011
1884 Ga0070712_100006971
1885 Ga0070712_100012714
1886 Ga0070712_100083832
1887 Ga0070712_100150703
1888 Ga0070712_100158544
1889 Ga0070712_100519742
1890 Ga0075362_10059913
1891 Ga0075367_10017457
1892 Ga0075367_10161551
1893 Ga0075369_10009009
1894 Ga0075427_10000933
1895 Ga0075366_10095588
1896 Ga0075366_10346061
1897 Ga0097621_100000616
1898 Ga0097621_100067560
1899 Ga0097621_100130845
1900 Ga0097621_100451891
1901 Ga0075370_10051098
1902 Ga0075370_10405111
1903 Ga0068871_100016286
1904 Ga0068871_100031874
1905 Ga0068871_100045370
1906 Ga0068871_100116665
1907 Ga0075428_100009524
1908 Ga0075428_100093645
1909 Ga0075428_100319812
1910 Ga0075428_100697545
1911 Ga0075428_100914195
1912 Ga0075430_100053356
1913 Ga0075430_100077845
1914 Ga0075431_100004032
1915 Ga0075431_100025139
1916 Ga0075431_100312229
1917 Ga0075433_10000876
1918 Ga0075433_10061884
1919 Ga0075433_10156830
1920 Ga0075433_10327623
1921 Ga0075433_10464983
1922 Ga0075433_10975308
1923 Ga0075434_100003784
1924 Ga0075434_100026789
1925 Ga0075434_100056876
1926 Ga0075434_100103418
1927 Ga0075434_100237368
1928 Ga0075434_100326636
1929 Ga0075434_100453414
1930 Ga0075434_100465532
1931 Ga0075429_100178387
1932 Ga0075429_100207320
1933 Ga0068865_100001101
1934 Ga0068865_100039979
1935 Ga0068865_100053184
1936 Ga0068865_100448001
1937 Ga0075436_100027016
1938 Ga0075436_100131444
1939 Ga0075436_100254770
1940 Ga0075436_100272646
1941 Ga0097620_100002296
1942 Ga0097620_100038394
1943 Ga0097620_100043182
1944 Ga0097620_100451932
1945 Ga0075435_100020401
1946 Ga0075435_100024050
1947 Ga0075435_100032996
1948 Ga0075435_100041844
1949 Ga0075435_100063268
1950 Ga0075435_100114060
1951 Ga0075435_100117179
1952 Ga0099795_10000155
1953 Ga0105251_10037175
1954 Ga0105251_10051478
1955 Ga0105244_10061434
1956 Ga0105250_10026850
1957 Ga0105250_10137392
1958 Ga0105250_10327236
1959 Ga0105240_10011690
1960 Ga0105240_10031786
1961 Ga0105240_11715710
1962 Ga0111539_10003401
1963 Ga0111539_10035433
1964 Ga0111539_10042647
1965 Ga0111539_10171638
1966 Ga0111539_10174268
1967 Ga0111539_10391019
1968 Ga0111539_11144462
1969 Ga0111539_12097479
1970 Ga0105245_10002367
1971 Ga0105245_10056051
1972 Ga0105245_10157650
1973 Ga0105245_10601755
1974 Ga0105247_10001141
1975 Ga0105247_10007741
1976 Ga0105247_10008319
1977 Ga0105247_10011047
1978 Ga0105247_10018808
1979 Ga0105247_10028441
1980 Ga0105247_10775489
1981 Ga0114129_10018611
1982 Ga0114129_10058921
1983 Ga0114129_10141666
1984 Ga0114129_10207555
1985 Ga0114129_10679670
1986 Ga0105243_10000417
1987 Ga0105243_10002317
1988 Ga0105243_10015545
1989 Ga0105241_10000456
1990 Ga0105241_10003767
1991 Ga0105241_10072284
1992 Ga0105241_10205607
1993 Ga0105241_10344256
1994 Ga0105242_10000990
1995 Ga0105242_10002247
1996 Ga0105242_10137941
1997 Ga0105242_10329538
1998 Ga0105242_10600087
1999 Ga0105242_10816779
2000 Ga0105248_10000293
2001 Ga0105248_10013733
2002 Ga0105248_10047103
2003 Ga0105248_10064060
2004 Ga0105248_10067752
2005 Ga0105248_10083940
2006 Ga0105248_10089844
2007 Ga0105248_10198164
2008 Ga0105248_10955660
2009 Ga0105237_10000712
2010 Ga0105237_10024092
2011 Ga0105237_10338448
2012 Ga0105238_10008146
2013 Ga0105238_10088824
2014 Ga0105238_10757331
2015 Ga0105249_10001033
2016 Ga0105249_10025232
2017 Ga0105249_10049172
2018 Ga0105249_10137387
2019 Ga0099796_10000545
2020 Ga0105239_10024373
2021 Ga0105239_10121234
2022 Ga0105239_10135993
2023 Ga0105239_10402983
2024 Ga0105246_10000118
2025 Ga0105246_10001800
2026 Ga0105246_10030840
2027 Ga0105246_10237213
2028 Ga0105246_10466612
2029 Ga0157344_1000799
2030 Ga0157346_1002141
2031 Ga0157335_1002311
2032 Ga0157341_1006083
2033 Ga0157313_1001600
2034 Ga0157316_1003972
2035 Ga0157338_1011623
2036 Ga0157373_10027665
2037 Ga0157373_10619101
2038 Ga0157371_10005561
2039 Ga0157371_10164975
2040 Ga0157370_10014874
2041 Ga0157369_10034660
2042 Ga0157369_10524924
2043 Ga0157374_10004169
2044 Ga0157374_10067658
2045 Ga0157374_10068417
2046 Ga0157374_10775036
2047 Ga0157378_10000643
2048 Ga0157378_10047383
2049 Ga0157378_10075985
2050 Ga0157378_10369456
2051 Ga0163162_10003401
2052 Ga0163162_10009748
2053 Ga0163162_10009782
2054 Ga0163162_10181804
2055 Ga0163162_10206364
2056 Ga0163162_10285414
2057 Ga0163162_10622692
2058 Ga0163162_10661123
2059 Ga0163162_11180439
2060 Ga0157372_10001248
2061 Ga0157372_10014509
2062 Ga0157372_10116252
2063 Ga0157372_10405850
2064 Ga0157375_10002635
2065 Ga0157375_10039024
2066 Ga0157375_10063052
2067 Ga0157375_10124184
2068 Ga0157375_10419068
2069 Ga0157375_10461012
2070 Ga0163163_10005028
2071 Ga0163163_10005155
2072 Ga0163163_10047249
2073 Ga0163163_10096909
2074 Ga0163163_10176164
2075 Ga0163163_10196977
2076 Ga0163163_10227523
2077 Ga0163163_10471930
2078 Ga0157380_10001138
2079 Ga0157380_10001301
2080 Ga0157380_10449421
2081 Ga0157380_10492797
2082 Ga0157380_10554899
2083 Ga0157377_10000982
2084 Ga0157377_10001682
2085 Ga0157377_10024270
2086 Ga0157377_10117432
2087 Ga0157377_10321503
2088 Ga0157379_10000275
2089 Ga0157379_10000933
2090 Ga0157379_10010341
2091 Ga0157379_10018203
2092 Ga0157379_10097828
2093 Ga0157379_10162654
2094 Ga0157379_10173780
2095 Ga0157376_10001069
2096 Ga0157376_10001767
2097 Ga0157376_10033668
2098 Ga0157376_10067815
2099 Ga0157376_10225758
2100 Ga0157376_10714668
2101 Ga0157376_10910733
2102 Ga0163161_10044631
2103 Ga0163161_10115761
2104 Ga0163161_10138728
2105 Ga0228598_1003451
2106 Ga0209677_100646
2107 Ga0207666_1000149
2108 Ga0207673_1000068
2109 Ga0209758_1016560
2110 Ga0207697_10012080
2111 Ga0207697_10012377
2112 Ga0207697_10028933
2113 Ga0207697_10167940
2114 Ga0207656_10063337
2115 Ga0207653_10003139
2116 Ga0207682_10000695
2117 Ga0207692_10087236
2118 Ga0207642_10000453
2119 Ga0207710_10011822
2120 Ga0207710_10027741
2121 Ga0207710_10044901
2122 Ga0207710_10048741
2123 Ga0207710_10314770
2124 Ga0207688_10000764
2125 Ga0207688_10008788
2126 Ga0207688_10064883
2127 Ga0207680_10044492
2128 Ga0207680_10056057
2129 Ga0207680_10137513
2130 Ga0207680_10240928
2131 Ga0207680_10431973
2132 Ga0207647_10001565
2133 Ga0207647_10022486
2134 Ga0207647_10030550
2135 Ga0207685_10008128
2136 Ga0207685_10055588
2137 Ga0207699_10029787
2138 Ga0207699_10052606
2139 Ga0207699_10304265
2140 Ga0207645_10019429
2141 Ga0207645_10035619
2142 Ga0207645_10131127
2143 Ga0207645_10197517
2144 Ga0207643_10000523
2145 Ga0207643_10013330
2146 Ga0207643_10103051
2147 Ga0207705_10396043
2148 Ga0207684_10167323
2149 Ga0207654_10001610
2150 Ga0207654_10053975
2151 Ga0207654_10123326
2152 Ga0207654_10165849
2153 Ga0207707_10001147
2154 Ga0207707_10051812
2155 Ga0207707_10338101
2156 Ga0207695_10136425
2157 Ga0207671_10130803
2158 Ga0207693_10000703
2159 Ga0207693_10003911
2160 Ga0207693_10010627
2161 Ga0207693_10041415
2162 Ga0207663_10001248
2163 Ga0207663_10160475
2164 Ga0207663_10185141
2165 Ga0207663_10292068
2166 Ga0207660_10028108
2167 Ga0207660_10102335
2168 Ga0207660_10590809
2169 Ga0207662_10002213
2170 Ga0207662_10020777
2171 Ga0207662_10083908
2172 Ga0207662_10097343
2173 Ga0207662_10128515
2174 Ga0207657_10000304
2175 Ga0207657_10056806
2176 Ga0207657_10076719
2177 Ga0207657_10243994
2178 Ga0207657_10349052
2179 Ga0207649_10000142
2180 Ga0207649_10002403
2181 Ga0207649_10085151
2182 Ga0207649_10271214
2183 Ga0207649_10274574
2184 Ga0207652_10002021
2185 Ga0207652_10043155
2186 Ga0207652_10092880
2187 Ga0207646_10168325
2188 Ga0207681_10020796
2189 Ga0207681_10044828
2190 Ga0207681_10090654
2191 Ga0207681_10100954
2192 Ga0207694_10009066
2193 Ga0207694_10166927
2194 Ga0207694_10517013
2195 Ga0207650_10002366
2196 Ga0207650_10069957
2197 Ga0207650_10095801
2198 Ga0207650_10156525
2199 Ga0207659_10000078
2200 Ga0207687_10001882
2201 Ga0207687_10002377
2202 Ga0207700_10048631
2203 Ga0207700_10103473
2204 Ga0207700_10456861
2205 Ga0207664_10232042
2206 Ga0207664_10259026
2207 Ga0207644_10001431
2208 Ga0207644_10026921
2209 Ga0207644_10668146
2210 Ga0207690_10002633
2211 Ga0207690_10003254
2212 Ga0207690_10233063
2213 Ga0207690_10345735
2214 Ga0207706_10000263
2215 Ga0207706_10120424
2216 Ga0207706_10134940
2217 Ga0207706_10235601
2218 Ga0207686_10003396
2219 Ga0207686_10027400
2220 Ga0207686_10310464
2221 Ga0207709_10004092
2222 Ga0207709_10009025
2223 Ga0207709_10036935
2224 Ga0207709_10437622
2225 Ga0207670_10003694
2226 Ga0207670_10004344
2227 Ga0207670_10147585
2228 Ga0207670_10217252
2229 Ga0207669_10001025
2230 Ga0207669_10001156
2231 Ga0207669_10138591
2232 Ga0207669_10263326
2233 Ga0207669_10335748
2234 Ga0207704_10085875
2235 Ga0207704_10274213
2236 Ga0207704_10397170
2237 Ga0207665_10000219
2238 Ga0207665_10001692
2239 Ga0207665_10010841
2240 Ga0207665_10041611
2241 Ga0207691_10002753
2242 Ga0207691_10008131
2243 Ga0207691_10064975
2244 Ga0207691_10159568
2245 Ga0207711_10008692
2246 Ga0207711_10037167
2247 Ga0207711_10040516
2248 Ga0207711_10089107
2249 Ga0207711_10567174
2250 Ga0207689_10001399
2251 Ga0207689_10010207
2252 Ga0207689_10013204
2253 Ga0207689_10073515
2254 Ga0207689_10076767
2255 Ga0207689_10236575
2256 Ga0207689_10668585
2257 Ga0207661_10001264
2258 Ga0207661_10027285
2259 Ga0207679_10000064
2260 Ga0207679_10043430
2261 Ga0207679_10458704
2262 Ga0207667_10106805
2263 Ga0207667_10173810
2264 Ga0207651_10000420
2265 Ga0207651_10000820
2266 Ga0207651_10197490
2267 Ga0207651_10984408
2268 Ga0207712_10001661
2269 Ga0207712_10013354
2270 Ga0207712_10150750
2271 Ga0207712_10685475
2272 Ga0207668_10000965
2273 Ga0207668_10025031
2274 Ga0207668_10047738
2275 Ga0207668_10102696
2276 Ga0207668_10257439
2277 Ga0207668_10542324
2278 Ga0207640_10001755
2279 Ga0207640_10039179
2280 Ga0207640_10819529
2281 Ga0207658_10037471
2282 Ga0207677_10023844
2283 Ga0207677_10088811
2284 Ga0207677_10457550
2285 Ga0207703_10005045
2286 Ga0207703_10008946
2287 Ga0207703_10044466
2288 Ga0207703_10152745
2289 Ga0207703_10240532
2290 Ga0207703_10283672
2291 Ga0207639_10019760
2292 Ga0207639_10051164
2293 Ga0207639_10265540
2294 Ga0207639_10823749
2295 Ga0207678_10000209
2296 Ga0207678_10010183
2297 Ga0207678_10021975
2298 Ga0207678_10034530
2299 Ga0207678_10039287
2300 Ga0207678_10056658
2301 Ga0207678_10087331
2302 Ga0207678_10120747
2303 Ga0207678_10751888
2304 Ga0207708_10000953
2305 Ga0207708_10002721
2306 Ga0207708_10020852
2307 Ga0207708_10193379
2308 Ga0207702_10003767
2309 Ga0207702_10007071
2310 Ga0207702_10044708
2311 Ga0207641_10007322
2312 Ga0207641_10034057
2313 Ga0207641_10200868
2314 Ga0207641_10235182
2315 Ga0207641_10802363
2316 Ga0207648_10013547
2317 Ga0207648_10024588
2318 Ga0207648_10082742
2319 Ga0207648_10248865
2320 Ga0207676_10000079
2321 Ga0207676_10023198
2322 Ga0207676_10081013
2323 Ga0207676_10304493
2324 Ga0207676_10530292
2325 Ga0207676_10720567
2326 Ga0207674_10000719
2327 Ga0207674_10013028
2328 Ga0207674_10049956
2329 Ga0207674_10303652
2330 Ga0207674_10401253
2331 Ga0207675_100001925
2332 Ga0207675_100030016
2333 Ga0207675_100030051
2334 Ga0207675_100043624
2335 Ga0207675_100095437
2336 Ga0207675_100140676
2337 Ga0207675_100314621
2338 Ga0207683_10000037
2339 Ga0207683_10038116
2340 Ga0207683_10038529
2341 Ga0207683_10794664
2342 Ga0207698_10725543
2343 Ga0209984_1025295
2344 Ga0210000_1010455
2345 Ga0209179_1000126
2346 Ga0210002_1000055
2347 Ga0209971_1002180
2348 Ga0209966_1003905
2349 Ga0209966_1047260
2350 Ga0209998_10001005
2351 Ga0209998_10012476
2352 Ga0209974_10003776
2353 Ga0209974_10006247
2354 Ga0207428_10000216
2355 Ga0207428_10000947
2356 Ga0207428_10029008
2357 Ga0207428_10034068
2358 Ga0207428_10209350
2359 Ga0268266_10002460
2360 Ga0268266_10004625
2361 Ga0268266_10028531
2362 Ga0268266_10159548
2363 Ga0268266_10222290
2364 Ga0268266_10426394
2365 Ga0268266_10865929
2366 Ga0268265_10001593
2367 Ga0268265_10033810
2368 Ga0268265_10078341
2369 Ga0268265_10170919
2370 Ga0268265_10220075
2371 Ga0268265_10251496
2372 Ga0268265_10424725
2373 Ga0268264_10002487
2374 Ga0268264_10071239
2375 Ga0268264_10279821
2376 Ga0268264_10769378
2377 Ga0307515_10458819
2378 Ga0265338_10016356
2379 Ga0265760_10103908
2380 Ga0265330_10078554
2381 Ga0265332_10001833
2382 Ga0265332_10078189
2383 Ga0265325_10000104
2384 Ga0265325_10108939
2385 Ga0265325_10139555
2386 Ga0265325_10151187
2387 Ga0265329_10084020
2388 Ga0265340_10000912
2389 Ga0265340_10023714
2390 Ga0265340_10035724
2391 Ga0265340_10066991
2392 Ga0265339_10001873
2393 Ga0265339_10040092
2394 Ga0265339_10394257
2395 Ga0265327_10038056
2396 Ga0265316_10173377
2397 Ga0265313_10042774
2398 Ga0316575_10027893
2399 Ga0316575_10068149
2400 Ga0265314_10009907
2401 Ga0265314_10104897
2402 Ga0265314_10237494
2403 Ga0265342_10000011
2404 Ga0265342_10004591
2405 Ga0265342_10043958
2406 Ga0316576_10009892
2407 Ga0307413_10438084
2408 Ga0307410_10653654
2409 Ga0307416_101000481
2410 Ga0307411_11102927
2411 Ga0307415_100759077
2412 Ga0316583_10060620
2413 Ga0307510_10000998
2414 Ga0307510_10070845
2415 Ga0373948_0024827
2416 Ga0373950_0001326
2417 Ga0373950_0032256
2418 Ga0373958_0001110
2419 Ga0373958_0024100
2420 Ga0373959_0037895
2421 Ga0373938_0011760
2422 Ga0373926_0038931
2423 Ga0373928_0000621
2424 Ga0373929_0035100
2425 Ga0373929_0043985
2426 Ga0373934_0026332
2427 Ga0373934_0156211
2428 Ga0373940_0020800
2429 Ga0373940_0082408
2430 Ga0373944_0004381
2431 Ga0373944_0051511
2432 Ga0373949_0054052
2433 Ga0373951_0025972
2434 Ga0373951_0088153
2435 Ga0373952_0001248
2436 Ga0373952_0001666
2437 Ga0373923_0095776
2438 Ga0373932_0003010
2439 Ga0373936_0027457
2440 Ga0373936_0092131
2441 Ga0373936_0226977
2442 Ga0373939_0001456
2443 Ga0373939_0002110
2444 Ga0373939_0182499
2445 Ga0373941_0000073
2446 Ga0373945_0003925
2447 Ga0373945_0032058
2448 Ga0373945_0070449
2449 Ga0373945_0138105
2450 Ga0373954_0011780
2451 Ga0373954_0019118
2452 Ga0373954_0047850
2453 Ga0373956_0142368
2454 Ga0373956_0267467
2455 Ga0373960_0007900
2456 Ga0373960_0047852
2457 Ga0373960_0097727
2458 Ga0373960_0206990
2459 Ga0373943_0147418
2460 Ga0373946_0011386
2461 Ga0373946_0058208
2462 Ga0373946_0100684
2463 Ga0373946_0161101
2464 Ga0373955_0000596
2465 Ga0373955_0008707
2466 Ga0373955_0286793
2467 Ga0373955_0349460
2468 Ga0373942_0004460
2469 Ga0373942_0031940
2470 Ga0373961_0002214
2471 Ga0373961_0002508
2472 Ga0373961_0028782
2473 Ga0373962_0011700
2474 Ga0373962_0038433
2475 Ga0373962_0127147
2476 Ga0373924_0133752
2477 Ga0373931_0007352
2478 Ga0373931_0041535
2479 Ga0373931_0094083
2480 Ga0373931_0136999
2481 Ga0373931_0163090
2482 Ga0373931_0188535
2483 Ga0373931_0402821
2484 Ga0373935_0023521
2485 Ga0373935_0035954
2486 Ga0373935_0088837
2487 Ga0373935_0179385
2488 Ga0373935_0219916
2489 Ga0373935_0224761
2490 Ga0373935_0287333
2491 Ga0373935_0361731
2492 Ga0373927_0041206
2493 Ga0373933_0050540
2494 Ga0373947_0001465
2495 Ga0373947_0054777
2496 Ga0373947_0070451
2497 Ga0373937_0003886
2498 Ga0373937_0098200
2499 Ga0373937_0420970
2500 Ga0373937_1137856
2501 Ga0316582_0311503
2502 Ga0316584_0013488
2503 Ga0373925_0276660
2504 Ga0373925_0402494
2505 Ga0373925_0475603
2506 Ga0373925_0744496
2507 Ga0395899_0013207
2508 Ga0395899_0072948
2509 Ga0395899_0181356
2510 Ga0395900_0003303
2511 Ga0395900_0005284
2512 Ga0395900_0018616
2513 Ga0395900_0083563
2514 Ga0395900_0242349
2515 Ga0395900_0279491
2516 Ga0395900_1154503
2517 Ga0395898_0007949
2518 Ga0395898_0013960
2519 Ga0395898_0051498
2520 Ga0395898_0097387
2521 Ga0395898_0132734
2522 Ga0395905_0002720
2523 Ga0395905_0023923
2524 Ga0395905_0224049
2525 Ga0395905_0538647
2526 Ga0395905_0930992
2527 Ga0436364_1400093
2528 Ga0395901_0011535
2529 Ga0395901_0032978
2530 Ga0395901_0126562
2531 Ga0395901_0173159
2532 Ga0395901_0173764
2533 Ga0242420_001294
2534 Ga0436365_0222599
2535 Ga0436361_0008631
2536 Ga0436361_0134221
2537 Ga0436361_0134613
2538 Ga0436363_0373741
2539 Ga0439465_0100894
2540 Ga0439450_032555
2541 Ga0439463_005398
2542 Ga0439464_0008117
2543 Ga0451577_0057746
2544 Ga0451577_0320187
2545 Ga0453684_0083097
2546 Ga0466968_0269607
2547 Ga0451576_0056877
2548 Ga0466967_0970447
2549 Ga0495617_045430
2550 Ga0495592_0019655
2551 Ga0495592_0069788
2552 Ga0495592_0070753
2553 Ga0495603_0007479
2554 Ga0495603_0033777
2555 Ga0495603_0037649
2556 Ga0495603_0056689
2557 Ga0495603_0057399
2558 Ga0495603_0182940
2559 Ga0495603_0273410
2560 Ga0495590_0251140
2561 Ga0495629_0001773
2562 Ga0495629_0003853
2563 Ga0495629_0013360
2564 Ga0495629_0036202
2565 Ga0495629_0086389
2566 Ga0495629_0121691
2567 Ga0495638_0010149
2568 Ga0495638_0040049
2569 Ga0495638_0070326
2570 Ga0495638_0152367
2571 Ga0495641_0011539
2572 Ga0495641_0013912
2573 Ga0495641_0017570
2574 Ga0495641_0067695
2575 Ga0495651_0000921
2576 Ga0495651_0067157
2577 Ga0495651_0084924
2578 Ga0495653_0005157
2579 Ga0495653_0288821
2580 Ga0495580_0000835
2581 Ga0495580_0028360
2582 Ga0495580_0084572
2583 Ga0495580_0407193
2584 Ga0495582_0007761
2585 Ga0495582_0051422
2586 Ga0495582_0069273
2587 Ga0495582_0334637
2588 Ga0495639_0012808
2589 Ga0495639_0026424
2590 Ga0495639_0032725
2591 Ga0495639_0048671
2592 Ga0495662_0009375
2593 Ga0495662_0129337
2594 Ga0495664_0031811
2595 Ga0495584_0021018
2596 Ga0495584_0187363
2597 Ga0495584_0222717
2598 Ga0495585_0011751
2599 Ga0495585_0048246
2600 Ga0495594_0020228
2601 Ga0495594_0035972
2602 Ga0495594_0138431
2603 Ga0495594_0242279
2604 Ga0495594_0277211
2605 Ga0495607_0020287
2606 Ga0495608_0021603
2607 Ga0495610_0087255
2608 Ga0495616_0133607
2609 Ga0495618_0062799
2610 Ga0495618_0175740
2611 Ga0495620_0106144
2612 Ga0495620_0199018
2613 Ga0495628_0014081
2614 Ga0495630_0014066
2615 Ga0495630_0025494
2616 Ga0495630_0179847
2617 Ga0495632_0078302
2618 Ga0495632_0111294
2619 Ga0495632_0406252
2620 Ga0495644_0003443
2621 Ga0495644_0134612
2622 Ga0495648_0167164
2623 Ga0495648_0285712
2624 Ga0495663_0094872
2625 Ga0495666_0010494
2626 Ga0495666_0036764
2627 Ga0495666_0116339
2628 Ga0495652_0010378
2629 Ga0495652_0116472
2630 Ga0495652_0222660
2631 Ga0495652_0469597
2632 Ga0495665_0016582
2633 Ga0495665_0075432
2634 Ga0495665_0145503
2635 Ga0495665_0228019
2636 Ga0495640_0082760
2637 Ga0495640_0087133
2638 Ga0495640_0311774
2639 Ga0495586_0077699
2640 Ga0495586_0381647
2641 Ga0495587_0001768
2642 Ga0495587_0130519
2643 Ga0495598_0001247
2644 Ga0495598_0088230
2645 Ga0495621_0106772
2646 Ga0495645_0127864
2647 Ga0495645_0135379
2648 Ga0495645_0218645
2649 Ga0495622_0000576
2650 Ga0495622_0016818
2651 Ga0495622_0144157
2652 Ga0495633_0015379
2653 Ga0495633_0050252
2654 Ga0495667_0003339
2655 Ga0495667_0003637
2656 Ga0495667_0534727
2657 Ga0495656_0035741
2658 Ga0495656_0161462
2659 Ga0495668_0126421
2660 Ga0495634_0050997
2661 Ga0495634_0115116
2662 Ga0495634_0297486
2663 Ga0495611_0052551
2664 Ga0495611_0176422
2665 Ga0495611_0202767
2666 Ga0495625_0177779
2667 Ga0495625_0503512
2668 Ga0495635_0010530
2669 Ga0495635_0029945
2670 Ga0495635_0033322
2671 Ga0495635_0037535
2672 Ga0495635_0105746
2673 Ga0495659_0003402
2674 Ga0495659_0050049
2675 Ga0495661_0076857
2676 Ga0495661_0169881
2677 Ga0495588_0013011
2678 Ga0495588_0086347
2679 Ga0495588_0121709
2680 Ga0495588_0159101
2681 Ga0495657_0039832
2682 Ga0495599_0002940
2683 Ga0495599_0042206
2684 Ga0495623_0029465
2685 Ga0495646_0014858
2686 Ga0495646_0165214
2687 Ga0495647_0001850
2688 Ga0495647_0036932
2689 Ga0495647_0101203
2690 Ga0495658_0000874
2691 Ga0495658_0014876
2692 Ga0495658_0065055
2693 Ga0495658_0168145
2694 Ga0495658_0175442
2695 Ga0495658_0284388
2696 Ga0495613_0001504
2697 Ga0495613_0020707
2698 Ga0495613_0032939
2699 Ga0495613_0185829
2700 Ga0495624_0035314
2701 Ga0495624_0123376
2702 Ga0495624_0364417
2703 Ga0495670_0003793
2704 Ga0495670_0010427
2705 Ga0495670_0013237
2706 Ga0495671_0110284
2707 Ga0495649_0155117
2708 Ga0495649_0277895
2709 Ga0495589_0029954
2710 Ga0495589_0060396
2711 Ga0495589_0086457
2712 Ga0495600_0012176
2713 Ga0495600_0092106
2714 Ga0495600_0094688
2715 Ga0495600_0225776
2716 Ga0495600_0598294
2717 Ga0495581_0007632
2718 Ga0495581_0022957
2719 Ga0495581_0028023
2720 Ga0495581_0392897
2721 Ga0495604_0217693
2722 Ga0495636_0026545
2723 Ga0495636_0204644
2724 Ga0495674_0062320
2725 Ga0495674_0073520
2726 Ga0495674_0140303
2727 Ga0495674_0301131
2728 Ga0495676_0030696
2729 Ga0495676_0038359
2730 Ga0495676_0043807
2731 Ga0495676_0092609
2732 Ga0495676_0261048
2733 Ga0495680_0047510
2734 Ga0495680_0071429
2735 Ga0495680_0076614
2736 Ga0495680_0082709
2737 Ga0495680_0112322
2738 Ga0495683_0114933
2739 Ga0495687_001479
2740 Ga0495675_0206297
2741 Ga0495677_0038434
2742 Ga0495677_0168394
2743 Ga0495685_096831
2744 Ga0495673_0108827
2745 Ga0495684_0002658
2746 Ga0495684_0101159
2747 Ga0495684_0334461
2748 Ga0495686_0298381
2749 Ga0495593_0002967
2750 Ga0495593_0033479
2751 Ga0495593_0139249
2752 Ga0495602_0000618
2753 Ga0495602_0009515
2754 Ga0495602_0118855
2755 Ga0495614_0154867
2756 Ga0495626_0037215
2757 Ga0496100_0001418
2758 Ga0496100_0018933
2759 Ga0496100_0027178
2760 Ga0496100_0058013
2761 Ga0496100_0116480
2762 Ga0496100_0167121
2763 Ga0496100_0459083
2764 Ga0496101_0007889
2765 Ga0496101_0023336
2766 Ga0496101_0024749
2767 Ga0496101_0220075
2768 Ga0496101_0545065
2769 Ga0496102_0005977
2770 Ga0496102_0027192
2771 Ga0496102_0052345
2772 Ga0496102_0071148
2773 Ga0496102_0161964
2774 Ga0496102_0172508
2775 Ga0496102_0182708
2776 Ga0496102_0192167
2777 Ga0496102_0375422
2778 Ga0496102_0434974
2779 Ga0496102_0545390
2780 Ga0496102_0686753
2781 Ga0496103_0001402
2782 Ga0496103_0031407
2783 Ga0496103_0047272
2784 Ga0496103_0052786
2785 Ga0496103_0119580
2786 Ga0496103_0490539
2787 Ga0496104_0000196
2788 Ga0496104_0004505
2789 Ga0496104_0023771
2790 Ga0496104_0041962
2791 Ga0496104_0066033
2792 Ga0496104_0096220
2793 Ga0496104_0263190
2794 Ga0496104_0367667
2795 Ga0496104_0406672
2796 Ga0496104_1472259
2797 Ga0496105_0002714
2798 Ga0496105_0002806
2799 Ga0496105_0023768
2800 Ga0496105_0146095
2801 Ga0496105_0466777
2802 Ga0496106_0048565
2803 Ga0496106_0049066
2804 Ga0496106_0050298
2805 Ga0496106_0074338
2806 Ga0496106_0094473
2807 Ga0496106_0142856
2808 Ga0496107_0001255
2809 Ga0496107_0002765
2810 Ga0496107_0010054
2811 Ga0496107_0015989
2812 Ga0496107_0019262
2813 Ga0496107_0037460
2814 Ga0496107_0041642
2815 Ga0496107_0441785
2816 Ga0496107_0548652
2817 Ga0496108_0002196
2818 Ga0496108_0010961
2819 Ga0496108_0013177
2820 Ga0496108_0041626
2821 Ga0496108_0173597
2822 Ga0496108_0177570
2823 Ga0496108_0191409
2824 Ga0496108_0251862
2825 Ga0496109_0001302
2826 Ga0496109_0010523
2827 Ga0496109_0018777
2828 Ga0496109_0043056
2829 Ga0496109_0068663
2830 Ga0496109_0307001
2831 Ga0496109_0547109
2832 Ga0496110_0043581
2833 Ga0496110_0065153
2834 Ga0496110_0072015
2835 Ga0496110_0170325
2836 Ga0496110_0231374
2837 Ga0496110_0276644
2838 Ga0496110_0426971
2839 Ga0496110_0449951
2840 Ga0496111_0002435
2841 Ga0496111_0008814
2842 Ga0496111_0024822
2843 Ga0496111_0064305
2844 Ga0496111_0226974
2845 Ga0496111_0333231
2846 Ga0496112_0004880
2847 Ga0496112_0005955
2848 Ga0496112_0046232
2849 Ga0496112_0055656
2850 Ga0496112_0075751
2851 Ga0496112_0076321
2852 Ga0496112_0092714
2853 Ga0496112_0133256
2854 Ga0496112_0393785
2855 Ga0496112_1236967
2856 Ga0496113_0000394
2857 Ga0496113_0002343
2858 Ga0496113_0027510
2859 Ga0496113_0031970
2860 Ga0496113_0064283
2861 Ga0496113_0351528
2862 Ga0496114_0004563
2863 Ga0496114_0011722
2864 Ga0496114_0018298
2865 Ga0496114_0035965
2866 Ga0496114_0081983
2867 Ga0496114_0126945
2868 Ga0496114_0678046
2869 Ga0496114_0787267
2870 Ga0496114_1064643
2871 Ga0496115_0004440
2872 Ga0496115_0005793
2873 Ga0496115_0015657
2874 Ga0496115_0187663
2875 Ga0496115_0214545
2876 Ga0496115_0267824
2877 Ga0496115_0396035
2878 Ga0496115_0484603
2879 Ga0496116_0182617
2880 Ga0496118_0021970
2881 Ga0496119_0046748
2882 Ga0496121_0065288
2883 Ga0496121_0150220
2884 Ga0496121_0201088
2885 Ga0496121_0261538
2886 Ga0496121_0484065
2887 Ga0496121_0521610
2888 Ga0496122_0010630
2889 Ga0496123_0000699
2890 Ga0496124_0150105
2891 Ga0496124_0190898
2892 Ga0496125_0109970
2893 Ga0496126_0007417
2894 Ga0496126_0402706
2895 Ga0496126_0534638
2896 Ga0501032_0065356
2897 Ga0501034_0065644
2898 Ga0501038_0103883
2899 Ga0501040_0024567
2900 Ga0501041_0096977
2901 Ga0501041_0629797
2902 Ga0501043_0077627
2903 Ga0501047_0004728
2904 Ga0501048_0485860
2905 Ga0501067_0163228
2906 Ga0501068_0223224
2907 Ga0501068_0375953
2908 Ga0501070_0025239
2909 Ga0501070_0186440
2910 Ga0501071_0591937
2911 Ga0501071_0658462
2912 Ga0501072_0135586
2913 Ga0501073_0001633
2914 Ga0501074_0547975
2915 Ga0501075_0030457
2916 Ga0501075_0062556
2917 Ga0501076_0109343
2918 Ga0501077_0014892
2919 Ga0501079_0010682
2920 Ga0501080_0163363
2921 Ga0501080_0253719
2922 Ga0501081_0008617
2923 Ga0501083_0093812
2924 Ga0501083_0095920
2925 Ga0501083_0112649
2926 Ga0501083_0126768
2927 Ga0501035_0224155
2928 Ga0501044_0006753
2929 Ga0501044_0037948
2930 Ga0501044_0346930
2931 Ga0501044_0365650
2932 Ga0501045_0701279
2933 nmdc:mga03683_67278_c1
2934 nmdc:mga03n38_473825_c1
2935 nmdc:mga03n38_57888_c1
2936 nmdc:mga03n38_900_c1
2937 nmdc:mga00v17_216763_c1
2938 nmdc:mga0yw44_149487_c1
2939 nmdc:mga0yw44_20390_c1
2940 nmdc:mga0yw44_2168_c1
2941 nmdc:mga0yw44_239384_c1
2942 nmdc:mga0k408_110847_c1
2943 nmdc:mga0k408_148432_c1
2944 nmdc:mga0k408_216802_c1
2945 nmdc:mga0k408_459212_c1
2946 nmdc:mga0k408_493957_c1
2947 nmdc:mga06z11_385242_c1
2948 nmdc:mga04h51_35073_c1
2949 nmdc:mga04h51_57703_c1
2950 nmdc:mga07m45_83242_c1
2951 nmdc:mga05p37_129848_c1
2952 nmdc:mga05p37_4032_c1
2953 nmdc:mga05p37_465051_c1
2954 nmdc:mga05p37_595196_c1
2955 nmdc:mga05p37_92337_c1
2956 nmdc:mga09592_143025_c1
2957 nmdc:mga09592_4710_c1
2958 nmdc:mga0qj67_150443_c1
2959 nmdc:mga0qj67_552735_c1
2960 nmdc:mga0qj67_646987_c1
2961 nmdc:mga0qj67_768_c1
2962 nmdc:mga06r32_117900_c1
2963 nmdc:mga06r32_427368_c1
2964 nmdc:mga08y16_13725_c1
2965 nmdc:mga08y16_1880010_c1
2966 nmdc:mga08y16_2116_c1
2967 nmdc:mga08y16_321381_c1
2968 nmdc:mga08y16_342219_c1
2969 nmdc:mga08y16_67671_c1
2970 nmdc:mga08y16_77404_c1
2971 nmdc:mga0n895_125016_c1
2972 nmdc:mga0n895_167480_c1
2973 nmdc:mga0n895_211894_c1
2974 nmdc:mga0n895_226459_c1
2975 nmdc:mga0n895_408739_c1
2976 nmdc:mga0rr50_1039_c1
2977 nmdc:mga0rr50_19830_c1
2978 nmdc:mga0rr50_379266_c1
2979 nmdc:mga0rr50_42391_c1
2980 nmdc:mga0rr50_85712_c1
2981 nmdc:mga0rr50_989646_c1
2982 nmdc:mga08x19_114924_c1
2983 nmdc:mga08x19_157864_c1
2984 nmdc:mga08x19_38172_c1
2985 nmdc:mga08x19_50158_c1
2986 nmdc:mga0a205_12523_c1
2987 nmdc:mga0a205_153815_c1
2988 nmdc:mga0a205_293311_c1
2989 nmdc:mga0a205_719_c1
2990 nmdc:mga0sz30_16211_c1
2991 Ga0495601_0040671
2992 Ga0495601_0224068
2993 Ga0495601_0321479
2994 Ga0495612_0000795
2995 Ga0495612_0001561
2996 Ga0495612_0045685
2997 Ga0495612_0088008
2998 Ga0495655_0048895
2999 Ga0495595_0001780
3000 Ga0495595_0009392
3001 Ga0495595_0108490
3002 Ga0495595_0231695
3003 Ga0495595_0247532
3004 Ga0495619_0001605
3005 Ga0495619_0002808
3006 Ga0495619_0010084
3007 Ga0495619_0016499
3008 Ga0495619_0017496
3009 Ga0495619_0027239
3010 Ga0500643_068097
3011 Ga0500644_0002004
3012 Ga0500646_0031443
3013 Ga0500583_0085791
3014 Ga0500583_0102302
3015 Ga0500566_0175753
3016 Ga0500566_0332379
3017 Ga0500641_0002828
3018 Ga0500650_0242138
3019 Ga0500555_093027
3020 Ga0500593_000274
3021 Ga0500595_000002
3022 Ga0500595_001169
3023 Ga0500595_008303
3024 Ga0500652_019791
3025 Ga0500652_094295
3026 Ga0500655_011673
3027 Ga0500658_0438589
3028 Ga0500577_0065741
3029 Ga0500616_0000002
3030 Ga0500616_0169368
3031 Ga0500645_000410
3032 Ga0501084_0119599
3033 Ga0501082_0009855
3034 Ga0501082_0057803
3035 Ga0501082_0359557
3036 2643756579
3037 2723845924
3038 2765465450
3039 2770197687
3040 2774868500
3041 2776271712
3042 2776279775
3043 2828305786
3044 2839995691
3045 2840769965
3046 2842872802
3047 2874609423
3048 2876813191
3049 2879110355
3050 2882460511
3051 2894654623
3052 2904581592
3053 2919122826
3054 2922392233
3055 3003672326
3056 8006990550
3057 8006996307
3058 8056695786

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

44

224

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.9282 1 190
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.9277 3 192
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.892 3 192
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8919 1 190
8e0m-assembly1.cif.gz_B homotrimeric variant of tctrp9, bgl15 0.364 41 182
ID Description Score Start End Superfamily
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9234 10 180 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.901 10 180 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8816 10 180 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.861 10 180 1.10.1760.20
af_Q2FVK0_1_153_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3647 62 183 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A1E3H611-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9734 2 194 GO:0005886
GO:0008654
GO:0043772
AF-A0A6N8T7P6-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9717 2 193 GO:0005886
GO:0008654
GO:0043772
AF-A0A6B8KE78-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9707 2 193 GO:0005886
GO:0008654
GO:0043772
AF-A0A530APE1-F1-model_v4 Glycerol-3-phosphate 1-O-acyltransferase PlsY (EC 2.3.1.15) 0.9693 1 165 GO:0004366
GO:0005886
GO:0008654
GO:0043772
AF-A0A3C0ME81-F1-model_v4 Acyl-phosphate glycerol 3-phosphate acyltransferase 0.9688 2 180 GO:0005886
GO:0008654
GO:0043772

Map