F494590
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1529 | 632 | 1526 | 67 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10012518|Ga0157373_100125185 |
| Length | 81 |
| Sequence | MFVSGIEREIRRTAMATGTVKWFNAEKGFGFIAPDDKSADVFVHFSAIAAAGFKTLEEGQKVEFGVTQGPKGLQAADVKPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 2 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 3 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 130 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300019162 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 170 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 176 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 177 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 178 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 270 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 271 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 275 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 276 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 277 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 278 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 279 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 280 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 281 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 282 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 283 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 284 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 285 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 288 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 289 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 290 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 291 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 292 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 293 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 294 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 295 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 296 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 297 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 298 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 299 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 300 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 301 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 302 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 303 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 304 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 305 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 306 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 307 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 308 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 309 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 310 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 311 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 313 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 314 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 317 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 318 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 320 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 323 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 324 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 325 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 326 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 327 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 328 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 329 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 330 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 333 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 334 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 335 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 336 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 337 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 338 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 339 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 340 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 341 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 342 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 343 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 344 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 345 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 346 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 347 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 348 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 349 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 350 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 351 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 352 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 353 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 354 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 355 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 356 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 357 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 358 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 359 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 360 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 361 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 362 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 363 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 364 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 365 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 366 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 367 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 368 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 369 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 370 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 371 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 372 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 373 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 374 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 375 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 376 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 377 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 378 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 379 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 380 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 381 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 382 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 383 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 384 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 385 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 386 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 387 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 388 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 389 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 390 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 391 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 392 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 393 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 394 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 395 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 396 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 397 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 398 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 399 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 400 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 401 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 402 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 403 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 404 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 405 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 406 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 407 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 408 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 409 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 410 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 411 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 475 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 476 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 477 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 478 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 479 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 480 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 481 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 482 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 483 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 484 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 485 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 486 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 487 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 488 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 489 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 490 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 491 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 492 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 493 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 494 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 495 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 496 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 497 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 498 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 499 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 527 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 528 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 539 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 541 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 544 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 546 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 547 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 548 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 549 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 550 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 551 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 552 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 553 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 554 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 555 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 556 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 557 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 558 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 559 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 560 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 561 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 562 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 563 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 564 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 565 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 566 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 567 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 568 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 569 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 570 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 571 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 572 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 573 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 574 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 575 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 576 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 577 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 582 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 583 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 584 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 585 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 586 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 587 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 588 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 589 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 590 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 591 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 592 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 593 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 594 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 595 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 596 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 597 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 598 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 599 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 600 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 601 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 602 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 603 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 604 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 605 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 606 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 607 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 608 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 609 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 610 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 611 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 612 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 613 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 614 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 615 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 616 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 617 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 618 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 619 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 620 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 621 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 622 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 623 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 624 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 625 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 626 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 627 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 628 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 629 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 630 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 631 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 632 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.59 |
| Metatranscriptomes | 6.21 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.31 |
| Nodule | 0 |
| Rhizoplane | 6.08 |
| Rhizosphere | 80.77 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 4.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010643 | 3300001979 | Bacteria | 3532 |
| 2 | JGI24740J21852_10017462 | 3300001979 | Bacteria | 2566 |
| 3 | JGI24740J21852_10028179 | 3300001979 | Bacteria | 1859 |
| 4 | JGI24739J22299_10209495 | 3300001989 | Bacteria | 571 |
| 5 | JGI24743J22301_10038481 | 3300001991 | Bacteria | 956 |
| 6 | JGI24735J21928_10099626 | 3300002067 | Bacteria | 834 |
| 7 | JGI24735J21928_10164583 | 3300002067 | Bacteria | 641 |
| 8 | JGI25162J39368_1005662 | 3300002737 | Bacteria | 2369 |
| 9 | JGI25164J39214_1000246 | 3300002772 | Bacteria | 41190 |
| 10 | JGI25152J39213_1000114 | 3300002773 | Bacteria | 56359 |
| 11 | Ga0006763J43179_105502 | 3300002870 | Bacteria | 639 |
| 12 | Ga0006762J43184_102431 | 3300002872 | Bacteria | 653 |
| 13 | JGI25159J45721_1011959 | 3300002987 | Bacteria | 2096 |
| 14 | JGI25151J46595_10000172 | 3300003187 | Bacteria | 83323 |
| 15 | JGI25406J46586_10192963 | 3300003203 | Bacteria | 594 |
| 16 | JGI25165J46597_1000005 | 3300003214 | Bacteria | 623702 |
| 17 | Ga0006777J48905_1010972 | 3300003308 | Bacteria | 521 |
| 18 | JGI25160J50197_1028800 | 3300003354 | Bacteria | 1483 |
| 19 | Ga0006562J51391_1002147 | 3300003578 | Bacteria | 510 |
| 20 | Ga0007429J51699_1026596 | 3300003579 | Bacteria | 504 |
| 21 | Ga0032354_1019578 | 3300003693 | Bacteria | 523 |
| 22 | Ga0006780_1011188 | 3300003735 | Bacteria | 520 |
| 23 | Ga0055539_1000019 | 3300003752 | Bacteria | 341727 |
| 24 | Ga0055533_1000023 | 3300003756 | Bacteria | 341727 |
| 25 | Ga0055525_1000321 | 3300003759 | Bacteria | 37412 |
| 26 | Ga0055542_1004061 | 3300003762 | Bacteria | 3694 |
| 27 | Ga0055540_1000087 | 3300003792 | Bacteria | 102273 |
| 28 | Ga0055540_1001311 | 3300003792 | Bacteria | 15007 |
| 29 | Ga0055541_1003090 | 3300003841 | Bacteria | 3193 |
| 30 | Ga0058858_1338063 | 3300004785 | Bacteria | 571 |
| 31 | Ga0058863_11610772 | 3300004799 | Bacteria | 533 |
| 32 | Ga0065714_10009230 | 3300005288 | Bacteria | 2388 |
| 33 | Ga0065714_10044791 | 3300005288 | Bacteria | 649 |
| 34 | Ga0065714_10066919 | 3300005288 | Bacteria | 6089 |
| 35 | Ga0065714_10117391 | 3300005288 | Bacteria | 1386 |
| 36 | Ga0065714_10139660 | 3300005288 | Bacteria | 1179 |
| 37 | Ga0065714_10445983 | 3300005288 | Bacteria | 557 |
| 38 | Ga0065704_10481833 | 3300005289 | Bacteria | 681 |
| 39 | Ga0065712_10014795 | 3300005290 | Bacteria | 2065 |
| 40 | Ga0065707_10158208 | 3300005295 | Bacteria | 1588 |
| 41 | Ga0065707_10159123 | 3300005295 | Bacteria | 1580 |
| 42 | Ga0065707_10196937 | 3300005295 | Bacteria | 1330 |
| 43 | Ga0070658_10013125 | 3300005327 | Bacteria | 6648 |
| 44 | Ga0070658_11162531 | 3300005327 | Bacteria | 671 |
| 45 | Ga0070676_10012564 | 3300005328 | Bacteria | 4628 |
| 46 | Ga0070683_100268548 | 3300005329 | Bacteria | 1622 |
| 47 | Ga0070690_100124921 | 3300005330 | Bacteria | 1731 |
| 48 | Ga0070690_100556928 | 3300005330 | Bacteria | 865 |
| 49 | Ga0070670_100025937 | 3300005331 | Bacteria | 5043 |
| 50 | Ga0070670_100104770 | 3300005331 | Bacteria | 2437 |
| 51 | Ga0070670_101980494 | 3300005331 | Bacteria | 537 |
| 52 | Ga0070677_10032889 | 3300005333 | Bacteria | 1993 |
| 53 | Ga0070677_10099294 | 3300005333 | Bacteria | 1280 |
| 54 | Ga0070677_10229723 | 3300005333 | Bacteria | 911 |
| 55 | Ga0070666_10011384 | 3300005335 | Bacteria | 5580 |
| 56 | Ga0070666_10017527 | 3300005335 | Bacteria | 4591 |
| 57 | Ga0070666_10059753 | 3300005335 | Bacteria | 2579 |
| 58 | Ga0070666_10140399 | 3300005335 | Bacteria | 1683 |
| 59 | Ga0070682_100033294 | 3300005337 | Bacteria | 3130 |
| 60 | Ga0070682_101989610 | 3300005337 | Bacteria | 511 |
| 61 | Ga0068868_100241567 | 3300005338 | Bacteria | 1517 |
| 62 | Ga0068868_100568222 | 3300005338 | Bacteria | 1001 |
| 63 | Ga0068868_100653341 | 3300005338 | Bacteria | 937 |
| 64 | Ga0068868_101084725 | 3300005338 | Bacteria | 736 |
| 65 | Ga0070660_100475194 | 3300005339 | Bacteria | 1038 |
| 66 | Ga0070660_100666483 | 3300005339 | Bacteria | 872 |
| 67 | Ga0070689_100018881 | 3300005340 | Bacteria | 5090 |
| 68 | Ga0070687_100538201 | 3300005343 | Bacteria | 793 |
| 69 | Ga0070687_100595329 | 3300005343 | Bacteria | 759 |
| 70 | Ga0070661_100020491 | 3300005344 | Bacteria | 4716 |
| 71 | Ga0070661_100616808 | 3300005344 | Bacteria | 878 |
| 72 | Ga0070661_101076892 | 3300005344 | Bacteria | 669 |
| 73 | Ga0070661_101421889 | 3300005344 | Bacteria | 584 |
| 74 | Ga0070692_10145822 | 3300005345 | Bacteria | 1344 |
| 75 | Ga0070692_10352415 | 3300005345 | Bacteria | 915 |
| 76 | Ga0070668_100269525 | 3300005347 | Bacteria | 1419 |
| 77 | Ga0070668_100364152 | 3300005347 | Bacteria | 1227 |
| 78 | Ga0070668_100404109 | 3300005347 | Bacteria | 1167 |
| 79 | Ga0070668_101502933 | 3300005347 | Bacteria | 616 |
| 80 | Ga0070669_100010681 | 3300005353 | Bacteria | 6517 |
| 81 | Ga0070669_100250290 | 3300005353 | Bacteria | 1411 |
| 82 | Ga0070675_100012709 | 3300005354 | Bacteria | 6603 |
| 83 | Ga0070675_100590374 | 3300005354 | Bacteria | 1007 |
| 84 | Ga0070671_100050847 | 3300005355 | Bacteria | 3447 |
| 85 | Ga0070671_100103048 | 3300005355 | Bacteria | 2394 |
| 86 | Ga0070671_100122694 | 3300005355 | Bacteria | 2187 |
| 87 | Ga0070671_100134904 | 3300005355 | Bacteria | 2081 |
| 88 | Ga0070674_100210699 | 3300005356 | Bacteria | 1506 |
| 89 | Ga0070674_100249853 | 3300005356 | Bacteria | 1392 |
| 90 | Ga0070674_101439508 | 3300005356 | Bacteria | 618 |
| 91 | Ga0070674_102093834 | 3300005356 | Bacteria | 516 |
| 92 | Ga0070673_100225461 | 3300005364 | Bacteria | 1624 |
| 93 | Ga0070673_100391725 | 3300005364 | Bacteria | 1241 |
| 94 | Ga0070688_100342582 | 3300005365 | Bacteria | 1092 |
| 95 | Ga0070688_100775663 | 3300005365 | Bacteria | 748 |
| 96 | Ga0070659_100000875 | 3300005366 | Bacteria | 22001 |
| 97 | Ga0070659_101029289 | 3300005366 | Bacteria | 724 |
| 98 | Ga0070659_101599918 | 3300005366 | Bacteria | 582 |
| 99 | Ga0070667_100000389 | 3300005367 | Bacteria | 47514 |
| 100 | Ga0070667_100017489 | 3300005367 | Bacteria | 5943 |
| 101 | Ga0070667_100043454 | 3300005367 | Bacteria | 3771 |
| 102 | Ga0070667_100469671 | 3300005367 | Bacteria | 1151 |
| 103 | Ga0070703_10103622 | 3300005406 | Bacteria | 1007 |
| 104 | Ga0070709_10097774 | 3300005434 | Bacteria | 1949 |
| 105 | Ga0070714_100000013 | 3300005435 | Bacteria | 211756 |
| 106 | Ga0070714_100271571 | 3300005435 | Bacteria | 1572 |
| 107 | Ga0070714_100381993 | 3300005435 | Bacteria | 1328 |
| 108 | Ga0070714_100965206 | 3300005435 | Bacteria | 829 |
| 109 | Ga0070714_101282696 | 3300005435 | Bacteria | 715 |
| 110 | Ga0070713_100080137 | 3300005436 | Bacteria | 2783 |
| 111 | Ga0070713_100111996 | 3300005436 | Bacteria | 2381 |
| 112 | Ga0070713_100429384 | 3300005436 | Bacteria | 1238 |
| 113 | Ga0070710_10000239 | 3300005437 | Bacteria | 25832 |
| 114 | Ga0070710_10011945 | 3300005437 | Bacteria | 4303 |
| 115 | Ga0070701_10111753 | 3300005438 | Bacteria | 1527 |
| 116 | Ga0070711_100173666 | 3300005439 | Bacteria | 1644 |
| 117 | Ga0070711_100579065 | 3300005439 | Bacteria | 934 |
| 118 | Ga0070705_100022769 | 3300005440 | Bacteria | 3352 |
| 119 | Ga0070705_100085158 | 3300005440 | Bacteria | 1953 |
| 120 | Ga0070700_100091229 | 3300005441 | Bacteria | 1988 |
| 121 | Ga0070700_100666589 | 3300005441 | Bacteria | 823 |
| 122 | Ga0070700_101169859 | 3300005441 | Bacteria | 641 |
| 123 | Ga0070694_100077987 | 3300005444 | Bacteria | 2296 |
| 124 | Ga0070694_100079260 | 3300005444 | Bacteria | 2279 |
| 125 | Ga0070708_100042829 | 3300005445 | Bacteria | 3976 |
| 126 | Ga0070663_100057826 | 3300005455 | Bacteria | 2783 |
| 127 | Ga0070663_100379680 | 3300005455 | Bacteria | 1151 |
| 128 | Ga0070663_100884156 | 3300005455 | Bacteria | 771 |
| 129 | Ga0070678_100129413 | 3300005456 | Bacteria | 2003 |
| 130 | Ga0070678_100535688 | 3300005456 | Bacteria | 1038 |
| 131 | Ga0070678_100684498 | 3300005456 | Bacteria | 923 |
| 132 | Ga0070678_102259483 | 3300005456 | Bacteria | 516 |
| 133 | Ga0070662_100000056 | 3300005457 | Bacteria | 60234 |
| 134 | Ga0070662_100046036 | 3300005457 | Bacteria | 3133 |
| 135 | Ga0070685_10471413 | 3300005466 | Bacteria | 883 |
| 136 | Ga0070685_10664713 | 3300005466 | Bacteria | 756 |
| 137 | Ga0070706_100042430 | 3300005467 | Bacteria | 4202 |
| 138 | Ga0070706_101377740 | 3300005467 | Bacteria | 646 |
| 139 | Ga0070707_100035742 | 3300005468 | Bacteria | 4740 |
| 140 | Ga0070698_100022827 | 3300005471 | Bacteria | 6541 |
| 141 | Ga0070698_100219092 | 3300005471 | Bacteria | 1837 |
| 142 | Ga0070698_100631589 | 3300005471 | Bacteria | 1012 |
| 143 | Ga0070699_100000003 | 3300005518 | Bacteria | 418047 |
| 144 | Ga0070699_100140681 | 3300005518 | Bacteria | 2131 |
| 145 | Ga0070699_100548826 | 3300005518 | Bacteria | 1052 |
| 146 | Ga0070684_100775852 | 3300005535 | Bacteria | 895 |
| 147 | Ga0070697_100034318 | 3300005536 | Bacteria | 4090 |
| 148 | Ga0070697_101074633 | 3300005536 | Bacteria | 716 |
| 149 | Ga0070697_101468679 | 3300005536 | Bacteria | 609 |
| 150 | Ga0068853_100000855 | 3300005539 | Bacteria | 21216 |
| 151 | Ga0068853_100130580 | 3300005539 | Bacteria | 2248 |
| 152 | Ga0068853_100170103 | 3300005539 | Bacteria | 1971 |
| 153 | Ga0068853_100310977 | 3300005539 | Bacteria | 1458 |
| 154 | Ga0070672_100091740 | 3300005543 | Bacteria | 2451 |
| 155 | Ga0070672_100691159 | 3300005543 | Bacteria | 893 |
| 156 | Ga0070686_100151725 | 3300005544 | Bacteria | 1623 |
| 157 | Ga0070686_101457893 | 3300005544 | Bacteria | 576 |
| 158 | Ga0070695_100251135 | 3300005545 | Bacteria | 1287 |
| 159 | Ga0070696_100085329 | 3300005546 | Bacteria | 2241 |
| 160 | Ga0070693_100559664 | 3300005547 | Bacteria | 820 |
| 161 | Ga0070665_100066631 | 3300005548 | Bacteria | 3612 |
| 162 | Ga0070665_100133640 | 3300005548 | Bacteria | 2483 |
| 163 | Ga0070665_100412670 | 3300005548 | Bacteria | 1359 |
| 164 | Ga0070665_100857691 | 3300005548 | Bacteria | 921 |
| 165 | Ga0070665_101083284 | 3300005548 | Bacteria | 813 |
| 166 | Ga0070665_101788677 | 3300005548 | Bacteria | 621 |
| 167 | Ga0070704_100108545 | 3300005549 | Bacteria | 2107 |
| 168 | Ga0070704_101485449 | 3300005549 | Bacteria | 623 |
| 169 | Ga0068855_100379719 | 3300005563 | Bacteria | 1552 |
| 170 | Ga0068855_101528274 | 3300005563 | Bacteria | 685 |
| 171 | Ga0070664_100344297 | 3300005564 | Bacteria | 1355 |
| 172 | Ga0070664_100948579 | 3300005564 | Bacteria | 807 |
| 173 | Ga0068857_100036171 | 3300005577 | Bacteria | 4375 |
| 174 | Ga0068857_100218798 | 3300005577 | Bacteria | 1739 |
| 175 | Ga0068857_100290934 | 3300005577 | Bacteria | 1504 |
| 176 | Ga0068857_101698459 | 3300005577 | Bacteria | 617 |
| 177 | Ga0068857_102242880 | 3300005577 | Bacteria | 536 |
| 178 | Ga0068854_100153819 | 3300005578 | Bacteria | 1776 |
| 179 | Ga0068854_101530256 | 3300005578 | Bacteria | 606 |
| 180 | Ga0068856_100044137 | 3300005614 | Bacteria | 4386 |
| 181 | Ga0068856_100254399 | 3300005614 | Bacteria | 1771 |
| 182 | Ga0068856_102651461 | 3300005614 | Bacteria | 507 |
| 183 | Ga0070702_100011033 | 3300005615 | Bacteria | 4482 |
| 184 | Ga0070702_100217602 | 3300005615 | Bacteria | 1275 |
| 185 | Ga0068852_100028415 | 3300005616 | Bacteria | 4577 |
| 186 | Ga0068852_100039832 | 3300005616 | Bacteria | 3959 |
| 187 | Ga0068852_100723340 | 3300005616 | Bacteria | 1006 |
| 188 | Ga0068859_100043630 | 3300005617 | Bacteria | 4507 |
| 189 | Ga0068859_100110205 | 3300005617 | Bacteria | 2814 |
| 190 | Ga0068859_100113932 | 3300005617 | Bacteria | 2768 |
| 191 | Ga0068859_102561908 | 3300005617 | Bacteria | 561 |
| 192 | Ga0068864_100067443 | 3300005618 | Bacteria | 3107 |
| 193 | Ga0068864_100069350 | 3300005618 | Bacteria | 3065 |
| 194 | Ga0068864_101680423 | 3300005618 | Bacteria | 639 |
| 195 | Ga0068866_10618551 | 3300005718 | Bacteria | 733 |
| 196 | Ga0068861_100069899 | 3300005719 | Bacteria | 2717 |
| 197 | Ga0068861_100480381 | 3300005719 | Bacteria | 1119 |
| 198 | Ga0068861_102703278 | 3300005719 | Bacteria | 501 |
| 199 | Ga0068851_10000003 | 3300005834 | Bacteria | 293018 |
| 200 | Ga0068851_10216563 | 3300005834 | Bacteria | 1074 |
| 201 | Ga0068851_10559338 | 3300005834 | Bacteria | 692 |
| 202 | Ga0068851_10648484 | 3300005834 | Bacteria | 646 |
| 203 | Ga0068863_100017921 | 3300005841 | Bacteria | 6777 |
| 204 | Ga0068863_100025461 | 3300005841 | Bacteria | 5642 |
| 205 | Ga0068863_100152319 | 3300005841 | Bacteria | 2213 |
| 206 | Ga0068863_100205252 | 3300005841 | Bacteria | 1896 |
| 207 | Ga0068863_101419364 | 3300005841 | Bacteria | 702 |
| 208 | Ga0068858_100000114 | 3300005842 | Bacteria | 84795 |
| 209 | Ga0068858_100469635 | 3300005842 | Bacteria | 1213 |
| 210 | Ga0068858_101395160 | 3300005842 | Bacteria | 690 |
| 211 | Ga0068860_100001136 | 3300005843 | Bacteria | 29265 |
| 212 | Ga0068860_100236589 | 3300005843 | Bacteria | 1776 |
| 213 | Ga0068860_100575934 | 3300005843 | Bacteria | 1130 |
| 214 | Ga0068862_100003322 | 3300005844 | Bacteria | 13891 |
| 215 | Ga0068862_100630733 | 3300005844 | Bacteria | 1032 |
| 216 | Ga0068862_101847700 | 3300005844 | Bacteria | 614 |
| 217 | Ga0081455_10011679 | 3300005937 | Bacteria | 8809 |
| 218 | Ga0081455_10161957 | 3300005937 | Bacteria | 1713 |
| 219 | Ga0081540_1040223 | 3300005983 | Bacteria | 2439 |
| 220 | Ga0081539_10004731 | 3300005985 | Bacteria | 14724 |
| 221 | Ga0081539_10032362 | 3300005985 | Bacteria | 3204 |
| 222 | Ga0081539_10074027 | 3300005985 | Bacteria | 1815 |
| 223 | Ga0081539_10085308 | 3300005985 | Bacteria | 1648 |
| 224 | Ga0070717_10104109 | 3300006028 | Bacteria | 2413 |
| 225 | Ga0070717_10130641 | 3300006028 | Bacteria | 2159 |
| 226 | Ga0070717_10175246 | 3300006028 | Bacteria | 1867 |
| 227 | Ga0070717_10186462 | 3300006028 | Bacteria | 1811 |
| 228 | Ga0070717_11097531 | 3300006028 | Bacteria | 725 |
| 229 | Ga0070717_11140921 | 3300006028 | Bacteria | 710 |
| 230 | Ga0075365_10256026 | 3300006038 | Bacteria | 1230 |
| 231 | Ga0075365_10672555 | 3300006038 | Bacteria | 731 |
| 232 | Ga0075365_10952790 | 3300006038 | Bacteria | 605 |
| 233 | Ga0075365_11004403 | 3300006038 | Bacteria | 588 |
| 234 | Ga0075365_11099734 | 3300006038 | Bacteria | 560 |
| 235 | Ga0075363_100199466 | 3300006048 | Bacteria | 1143 |
| 236 | Ga0075363_100601948 | 3300006048 | Bacteria | 659 |
| 237 | Ga0075363_100819783 | 3300006048 | Bacteria | 567 |
| 238 | Ga0075363_101040550 | 3300006048 | Bacteria | 506 |
| 239 | Ga0075364_10003345 | 3300006051 | Bacteria | 9094 |
| 240 | Ga0075364_10141997 | 3300006051 | Bacteria | 1616 |
| 241 | Ga0075364_10355480 | 3300006051 | Bacteria | 999 |
| 242 | Ga0075364_10493027 | 3300006051 | Bacteria | 837 |
| 243 | Ga0075364_10847603 | 3300006051 | Bacteria | 623 |
| 244 | Ga0075364_11028838 | 3300006051 | Bacteria | 560 |
| 245 | Ga0075364_11215528 | 3300006051 | Bacteria | 511 |
| 246 | Ga0075432_10001110 | 3300006058 | Bacteria | 8616 |
| 247 | Ga0075432_10001540 | 3300006058 | Bacteria | 7564 |
| 248 | Ga0070715_11083242 | 3300006163 | Bacteria | 504 |
| 249 | Ga0070716_100012511 | 3300006173 | Bacteria | 4303 |
| 250 | Ga0070716_100590170 | 3300006173 | Bacteria | 834 |
| 251 | Ga0070716_101506368 | 3300006173 | Bacteria | 550 |
| 252 | Ga0070712_100142880 | 3300006175 | Bacteria | 1829 |
| 253 | Ga0070712_102053512 | 3300006175 | Bacteria | 500 |
| 254 | Ga0075362_10256512 | 3300006177 | Bacteria | 861 |
| 255 | Ga0075362_10304136 | 3300006177 | Bacteria | 792 |
| 256 | Ga0075362_10562911 | 3300006177 | Bacteria | 587 |
| 257 | Ga0075367_10106945 | 3300006178 | Bacteria | 1714 |
| 258 | Ga0075367_10377506 | 3300006178 | Bacteria | 895 |
| 259 | Ga0075369_10059148 | 3300006186 | Bacteria | 1669 |
| 260 | Ga0075366_10326752 | 3300006195 | Bacteria | 940 |
| 261 | Ga0097621_100018661 | 3300006237 | Bacteria | 5305 |
| 262 | Ga0097621_102313961 | 3300006237 | Bacteria | 514 |
| 263 | Ga0075370_10018219 | 3300006353 | Bacteria | 3807 |
| 264 | Ga0075370_10129004 | 3300006353 | Bacteria | 1475 |
| 265 | Ga0075370_10227378 | 3300006353 | Bacteria | 1103 |
| 266 | Ga0075370_10290289 | 3300006353 | Bacteria | 972 |
| 267 | Ga0075370_10436324 | 3300006353 | Bacteria | 787 |
| 268 | Ga0068871_100292952 | 3300006358 | Bacteria | 1427 |
| 269 | Ga0068871_102229816 | 3300006358 | Bacteria | 522 |
| 270 | Ga0075428_100995376 | 3300006844 | Bacteria | 888 |
| 271 | Ga0075431_100055591 | 3300006847 | Bacteria | 4083 |
| 272 | Ga0075431_100133936 | 3300006847 | Bacteria | 2554 |
| 273 | Ga0075431_101864641 | 3300006847 | Bacteria | 557 |
| 274 | Ga0075433_10006838 | 3300006852 | Bacteria | 9037 |
| 275 | Ga0075433_10056663 | 3300006852 | Bacteria | 3424 |
| 276 | Ga0075433_10188363 | 3300006852 | Bacteria | 1835 |
| 277 | Ga0075434_100067699 | 3300006871 | Bacteria | 3557 |
| 278 | Ga0075434_100134546 | 3300006871 | Bacteria | 2492 |
| 279 | Ga0068865_100385951 | 3300006881 | Bacteria | 1144 |
| 280 | Ga0068865_100513179 | 3300006881 | Bacteria | 1001 |
| 281 | Ga0075436_100254738 | 3300006914 | Bacteria | 1251 |
| 282 | Ga0097620_100043629 | 3300006931 | Bacteria | 4507 |
| 283 | Ga0097620_100110207 | 3300006931 | Bacteria | 2814 |
| 284 | Ga0097620_100113924 | 3300006931 | Bacteria | 2768 |
| 285 | Ga0097620_102560380 | 3300006931 | Bacteria | 561 |
| 286 | Ga0075435_100052021 | 3300007076 | Bacteria | 3300 |
| 287 | Ga0099794_10280778 | 3300007265 | Bacteria | 861 |
| 288 | Ga0099795_10003109 | 3300007788 | Bacteria | 4061 |
| 289 | Ga0105251_10298728 | 3300009011 | Bacteria | 730 |
| 290 | Ga0105251_10506754 | 3300009011 | Bacteria | 564 |
| 291 | Ga0105244_10383444 | 3300009036 | Bacteria | 647 |
| 292 | Ga0105250_10321285 | 3300009092 | Bacteria | 673 |
| 293 | Ga0105240_10001674 | 3300009093 | Bacteria | 37626 |
| 294 | Ga0105240_10075070 | 3300009093 | Bacteria | 4171 |
| 295 | Ga0105240_10083169 | 3300009093 | Bacteria | 3929 |
| 296 | Ga0105240_10343760 | 3300009093 | Bacteria | 1694 |
| 297 | Ga0105240_10547016 | 3300009093 | Bacteria | 1281 |
| 298 | Ga0105245_10123391 | 3300009098 | Bacteria | 2422 |
| 299 | Ga0105245_10163980 | 3300009098 | Bacteria | 2111 |
| 300 | Ga0105245_10193143 | 3300009098 | Bacteria | 1951 |
| 301 | Ga0105245_10194690 | 3300009098 | Bacteria | 1944 |
| 302 | Ga0105245_10458861 | 3300009098 | Bacteria | 1284 |
| 303 | Ga0105245_10914994 | 3300009098 | Bacteria | 919 |
| 304 | Ga0105247_10160865 | 3300009101 | Bacteria | 1486 |
| 305 | Ga0105247_11816051 | 3300009101 | Bacteria | 508 |
| 306 | Ga0114129_10352904 | 3300009147 | Bacteria | 1948 |
| 307 | Ga0114129_11642911 | 3300009147 | Bacteria | 785 |
| 308 | Ga0105243_10127253 | 3300009148 | Bacteria | 2157 |
| 309 | Ga0105243_10327527 | 3300009148 | Bacteria | 1398 |
| 310 | Ga0105243_10589302 | 3300009148 | Bacteria | 1069 |
| 311 | Ga0105243_10867679 | 3300009148 | Bacteria | 895 |
| 312 | Ga0105243_11021698 | 3300009148 | Bacteria | 831 |
| 313 | Ga0105241_10099103 | 3300009174 | Bacteria | 2314 |
| 314 | Ga0105241_10238058 | 3300009174 | Bacteria | 1537 |
| 315 | Ga0105242_10028632 | 3300009176 | Bacteria | 4437 |
| 316 | Ga0105242_10110705 | 3300009176 | Bacteria | 2340 |
| 317 | Ga0105242_10165046 | 3300009176 | Bacteria | 1942 |
| 318 | Ga0105248_10015196 | 3300009177 | Bacteria | 8484 |
| 319 | Ga0105248_10172691 | 3300009177 | Bacteria | 2436 |
| 320 | Ga0105248_10315207 | 3300009177 | Bacteria | 1762 |
| 321 | Ga0105237_10197968 | 3300009545 | Bacteria | 2009 |
| 322 | Ga0105237_10283994 | 3300009545 | Bacteria | 1658 |
| 323 | Ga0105237_10937803 | 3300009545 | Bacteria | 873 |
| 324 | Ga0105237_12154879 | 3300009545 | Bacteria | 567 |
| 325 | Ga0105238_10123243 | 3300009551 | Bacteria | 2571 |
| 326 | Ga0105238_11724987 | 3300009551 | Bacteria | 657 |
| 327 | Ga0105238_11914525 | 3300009551 | Bacteria | 626 |
| 328 | Ga0105238_11942143 | 3300009551 | Bacteria | 622 |
| 329 | Ga0105238_12036507 | 3300009551 | Bacteria | 608 |
| 330 | Ga0105238_13063567 | 3300009551 | Bacteria | 501 |
| 331 | Ga0105249_10057208 | 3300009553 | Bacteria | 3572 |
| 332 | Ga0105249_11542253 | 3300009553 | Bacteria | 737 |
| 333 | Ga0099796_10078087 | 3300010159 | Bacteria | 1209 |
| 334 | Ga0105239_10123750 | 3300010375 | Bacteria | 2873 |
| 335 | Ga0105239_10261619 | 3300010375 | Bacteria | 1944 |
| 336 | Ga0105239_10285489 | 3300010375 | Bacteria | 1858 |
| 337 | Ga0105239_10901767 | 3300010375 | Bacteria | 1015 |
| 338 | Ga0105239_11306118 | 3300010375 | Bacteria | 837 |
| 339 | Ga0105239_12235461 | 3300010375 | Bacteria | 636 |
| 340 | Ga0105246_10002237 | 3300011119 | Bacteria | 11676 |
| 341 | Ga0105246_10021144 | 3300011119 | Bacteria | 4183 |
| 342 | Ga0105246_10062191 | 3300011119 | Bacteria | 2600 |
| 343 | Ga0105246_10086326 | 3300011119 | Bacteria | 2249 |
| 344 | Ga0105246_10159254 | 3300011119 | Bacteria | 1718 |
| 345 | Ga0105246_10324169 | 3300011119 | Bacteria | 1253 |
| 346 | Ga0105246_10691200 | 3300011119 | Bacteria | 893 |
| 347 | Ga0105246_11031499 | 3300011119 | Bacteria | 747 |
| 348 | Ga0105246_11418456 | 3300011119 | Bacteria | 649 |
| 349 | Ga0157373_10012518 | 3300013100 | Bacteria | 6235 |
| 350 | Ga0157373_10182921 | 3300013100 | Bacteria | 1476 |
| 351 | Ga0157373_10424749 | 3300013100 | Bacteria | 954 |
| 352 | Ga0157373_10680666 | 3300013100 | Bacteria | 753 |
| 353 | Ga0157371_10005274 | 3300013102 | Bacteria | 10949 |
| 354 | Ga0157371_10230458 | 3300013102 | Bacteria | 1331 |
| 355 | Ga0157371_10375366 | 3300013102 | Bacteria | 1038 |
| 356 | Ga0157371_10528770 | 3300013102 | Bacteria | 873 |
| 357 | Ga0157371_10705786 | 3300013102 | Bacteria | 755 |
| 358 | Ga0157371_10747911 | 3300013102 | Bacteria | 734 |
| 359 | Ga0157370_10001466 | 3300013104 | Bacteria | 29160 |
| 360 | Ga0157370_10153691 | 3300013104 | Bacteria | 2141 |
| 361 | Ga0157370_10539497 | 3300013104 | Bacteria | 1070 |
| 362 | Ga0157370_10774986 | 3300013104 | Bacteria | 873 |
| 363 | Ga0157370_11440189 | 3300013104 | Bacteria | 620 |
| 364 | Ga0157370_11895228 | 3300013104 | Bacteria | 535 |
| 365 | Ga0157369_10039429 | 3300013105 | Bacteria | 5162 |
| 366 | Ga0157369_10166239 | 3300013105 | Bacteria | 2327 |
| 367 | Ga0157369_10783074 | 3300013105 | Bacteria | 980 |
| 368 | Ga0157369_10784953 | 3300013105 | Bacteria | 979 |
| 369 | Ga0157369_11496108 | 3300013105 | Bacteria | 687 |
| 370 | Ga0157369_11793463 | 3300013105 | Bacteria | 623 |
| 371 | Ga0157374_10000337 | 3300013296 | Bacteria | 43353 |
| 372 | Ga0157374_10263709 | 3300013296 | Bacteria | 1697 |
| 373 | Ga0157378_10015607 | 3300013297 | Bacteria | 6652 |
| 374 | Ga0157378_10070642 | 3300013297 | Bacteria | 3135 |
| 375 | Ga0157378_10208506 | 3300013297 | Bacteria | 1852 |
| 376 | Ga0157378_11447242 | 3300013297 | Bacteria | 731 |
| 377 | Ga0163162_10324336 | 3300013306 | Bacteria | 1672 |
| 378 | Ga0163162_10533590 | 3300013306 | Bacteria | 1302 |
| 379 | Ga0163162_10792386 | 3300013306 | Bacteria | 1065 |
| 380 | Ga0157372_10873466 | 3300013307 | Bacteria | 1044 |
| 381 | Ga0157372_10876808 | 3300013307 | Bacteria | 1042 |
| 382 | Ga0157372_11093042 | 3300013307 | Bacteria | 923 |
| 383 | Ga0157372_11193779 | 3300013307 | Bacteria | 879 |
| 384 | Ga0157372_12214052 | 3300013307 | Bacteria | 631 |
| 385 | Ga0157372_13081839 | 3300013307 | Bacteria | 532 |
| 386 | Ga0157375_10024616 | 3300013308 | Bacteria | 5575 |
| 387 | Ga0157375_10636782 | 3300013308 | Bacteria | 1223 |
| 388 | Ga0157375_12396421 | 3300013308 | Bacteria | 630 |
| 389 | Ga0163163_10021218 | 3300014325 | Bacteria | 6125 |
| 390 | Ga0163163_10061827 | 3300014325 | Bacteria | 3710 |
| 391 | Ga0163163_10384717 | 3300014325 | Bacteria | 1461 |
| 392 | Ga0163163_10833465 | 3300014325 | Bacteria | 986 |
| 393 | Ga0163163_12071330 | 3300014325 | Bacteria | 629 |
| 394 | Ga0163163_12829085 | 3300014325 | Bacteria | 541 |
| 395 | Ga0163163_12913425 | 3300014325 | Bacteria | 534 |
| 396 | Ga0157380_10695307 | 3300014326 | Bacteria | 1021 |
| 397 | Ga0157380_11907696 | 3300014326 | Bacteria | 655 |
| 398 | Ga0157380_11951655 | 3300014326 | Bacteria | 648 |
| 399 | Ga0157380_12187982 | 3300014326 | Bacteria | 617 |
| 400 | Ga0182008_10011168 | 3300014497 | Bacteria | 4789 |
| 401 | Ga0182008_10133121 | 3300014497 | Bacteria | 1241 |
| 402 | Ga0182008_10731959 | 3300014497 | Bacteria | 568 |
| 403 | Ga0157377_11611487 | 3300014745 | Bacteria | 520 |
| 404 | Ga0157379_10060551 | 3300014968 | Bacteria | 3385 |
| 405 | Ga0157379_10667602 | 3300014968 | Bacteria | 974 |
| 406 | Ga0157379_10756072 | 3300014968 | Bacteria | 915 |
| 407 | Ga0157379_12674977 | 3300014968 | Bacteria | 500 |
| 408 | Ga0157376_10014760 | 3300014969 | Bacteria | 5876 |
| 409 | Ga0157376_10340710 | 3300014969 | Bacteria | 1432 |
| 410 | Ga0157376_10774504 | 3300014969 | Bacteria | 970 |
| 411 | Ga0157376_13090627 | 3300014969 | Bacteria | 504 |
| 412 | Ga0163161_10246130 | 3300017792 | Bacteria | 1392 |
| 413 | Ga0184597_116904 | 3300019162 | Bacteria | 515 |
| 414 | Ga0184595_117929 | 3300019166 | Bacteria | 558 |
| 415 | Ga0184599_135484 | 3300019188 | Bacteria | 668 |
| 416 | Ga0197907_11039717 | 3300020069 | Bacteria | 2238 |
| 417 | Ga0197907_11415606 | 3300020069 | Bacteria | 825 |
| 418 | Ga0206356_11762204 | 3300020070 | Bacteria | 710 |
| 419 | Ga0206355_1509001 | 3300020076 | Bacteria | 644 |
| 420 | Ga0206352_10996824 | 3300020078 | Bacteria | 684 |
| 421 | Ga0206350_10969978 | 3300020080 | Bacteria | 593 |
| 422 | Ga0206350_11360594 | 3300020080 | Bacteria | 852 |
| 423 | Ga0206354_11072124 | 3300020081 | Bacteria | 597 |
| 424 | Ga0206354_11207445 | 3300020081 | Bacteria | 955 |
| 425 | Ga0206354_11286028 | 3300020081 | Bacteria | 552 |
| 426 | Ga0206353_10573202 | 3300020082 | Bacteria | 558 |
| 427 | Ga0206353_11713086 | 3300020082 | Bacteria | 727 |
| 428 | Ga0154015_1239549 | 3300020610 | Bacteria | 933 |
| 429 | Ga0213872_10068875 | 3300021361 | Bacteria | 1596 |
| 430 | Ga0213876_10044095 | 3300021384 | Bacteria | 2357 |
| 431 | Ga0213876_10209239 | 3300021384 | Bacteria | 1037 |
| 432 | Ga0213876_10606923 | 3300021384 | Bacteria | 582 |
| 433 | Ga0213875_10240368 | 3300021388 | Bacteria | 853 |
| 434 | Ga0224712_10565085 | 3300022467 | Bacteria | 553 |
| 435 | Ga0209566_100031 | 3300025225 | Bacteria | 341555 |
| 436 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 437 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 438 | Ga0209563_100205 | 3300025230 | Bacteria | 31421 |
| 439 | Ga0207427_100024 | 3300025231 | Bacteria | 438403 |
| 440 | Ga0209437_100467 | 3300025233 | Bacteria | 31685 |
| 441 | Ga0207425_1000100 | 3300025245 | Bacteria | 83378 |
| 442 | Ga0207425_1005944 | 3300025245 | Bacteria | 3407 |
| 443 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 444 | Ga0209148_1000702 | 3300025254 | Bacteria | 27035 |
| 445 | Ga0209148_1002471 | 3300025254 | Bacteria | 6310 |
| 446 | Ga0209759_1028627 | 3300025256 | Bacteria | 1130 |
| 447 | Ga0209129_1000028 | 3300025258 | Bacteria | 405451 |
| 448 | Ga0209129_1000191 | 3300025258 | Bacteria | 83378 |
| 449 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 450 | Ga0209565_1084707 | 3300025263 | Bacteria | 518 |
| 451 | Ga0209455_1003427 | 3300025272 | Bacteria | 5616 |
| 452 | Ga0209673_1019086 | 3300025273 | Bacteria | 2473 |
| 453 | Ga0209130_1000358 | 3300025284 | Bacteria | 52094 |
| 454 | Ga0209025_1000112 | 3300025294 | Bacteria | 218958 |
| 455 | Ga0209025_1000427 | 3300025294 | Bacteria | 83378 |
| 456 | Ga0209758_1000352 | 3300025297 | Bacteria | 83378 |
| 457 | Ga0207426_1001302 | 3300025302 | Bacteria | 21458 |
| 458 | Ga0209051_1000014 | 3300025303 | Bacteria | 552732 |
| 459 | Ga0209051_1000546 | 3300025303 | Bacteria | 45996 |
| 460 | Ga0209051_1001222 | 3300025303 | Bacteria | 23105 |
| 461 | Ga0209051_1001430 | 3300025303 | Bacteria | 20445 |
| 462 | Ga0209051_1029296 | 3300025303 | Bacteria | 2156 |
| 463 | Ga0209051_1089221 | 3300025303 | Bacteria | 863 |
| 464 | Ga0209051_1091111 | 3300025303 | Unclassified | 848 |
| 465 | Ga0207697_10011855 | 3300025315 | Bacteria | 3674 |
| 466 | Ga0207697_10016522 | 3300025315 | Bacteria | 3039 |
| 467 | Ga0207697_10057166 | 3300025315 | Bacteria | 1619 |
| 468 | Ga0207697_10474123 | 3300025315 | Bacteria | 554 |
| 469 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 470 | Ga0207656_10259561 | 3300025321 | Bacteria | 853 |
| 471 | Ga0207655_1003093 | 3300025728 | Bacteria | 12648 |
| 472 | Ga0207655_1004839 | 3300025728 | Bacteria | 9359 |
| 473 | Ga0207655_1005444 | 3300025728 | Bacteria | 8650 |
| 474 | Ga0207713_1055246 | 3300025735 | Bacteria | 1551 |
| 475 | Ga0207653_10009297 | 3300025885 | Bacteria | 3060 |
| 476 | Ga0207682_10008648 | 3300025893 | Bacteria | 4024 |
| 477 | Ga0207692_10016869 | 3300025898 | Bacteria | 3245 |
| 478 | Ga0207692_10458843 | 3300025898 | Bacteria | 803 |
| 479 | Ga0207642_10444589 | 3300025899 | Bacteria | 784 |
| 480 | Ga0207710_10004760 | 3300025900 | Bacteria | 5886 |
| 481 | Ga0207710_10065858 | 3300025900 | Bacteria | 1652 |
| 482 | Ga0207710_10067040 | 3300025900 | Bacteria | 1639 |
| 483 | Ga0207688_10007435 | 3300025901 | Bacteria | 5958 |
| 484 | Ga0207688_10363148 | 3300025901 | Bacteria | 894 |
| 485 | Ga0207680_10006719 | 3300025903 | Bacteria | 5580 |
| 486 | Ga0207680_10006982 | 3300025903 | Bacteria | 5479 |
| 487 | Ga0207647_10015036 | 3300025904 | Bacteria | 5319 |
| 488 | Ga0207647_10075384 | 3300025904 | Bacteria | 2030 |
| 489 | Ga0207685_10840279 | 3300025905 | Bacteria | 508 |
| 490 | Ga0207699_10167321 | 3300025906 | Bacteria | 1468 |
| 491 | Ga0207645_10017244 | 3300025907 | Bacteria | 4770 |
| 492 | Ga0207643_10126509 | 3300025908 | Bacteria | 1518 |
| 493 | Ga0207643_11031773 | 3300025908 | Bacteria | 531 |
| 494 | Ga0207705_10037465 | 3300025909 | Bacteria | 3470 |
| 495 | Ga0207705_10140911 | 3300025909 | Bacteria | 1800 |
| 496 | Ga0207705_11014991 | 3300025909 | Bacteria | 641 |
| 497 | Ga0207684_10015324 | 3300025910 | Bacteria | 6600 |
| 498 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 499 | Ga0207654_10486723 | 3300025911 | Bacteria | 870 |
| 500 | Ga0207707_10008724 | 3300025912 | Bacteria | 8796 |
| 501 | Ga0207695_10002367 | 3300025913 | Bacteria | 28011 |
| 502 | Ga0207695_10007138 | 3300025913 | Bacteria | 14297 |
| 503 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 504 | Ga0207671_10049308 | 3300025914 | Bacteria | 3117 |
| 505 | Ga0207671_10063749 | 3300025914 | Bacteria | 2739 |
| 506 | Ga0207671_10891702 | 3300025914 | Bacteria | 703 |
| 507 | Ga0207693_10018369 | 3300025915 | Bacteria | 5569 |
| 508 | Ga0207693_10246628 | 3300025915 | Bacteria | 1402 |
| 509 | Ga0207663_11423790 | 3300025916 | Bacteria | 558 |
| 510 | Ga0207660_10650228 | 3300025917 | Bacteria | 859 |
| 511 | Ga0207660_11521208 | 3300025917 | Bacteria | 540 |
| 512 | Ga0207662_10387285 | 3300025918 | Bacteria | 945 |
| 513 | Ga0207662_10461371 | 3300025918 | Bacteria | 870 |
| 514 | Ga0207657_10016812 | 3300025919 | Bacteria | 7043 |
| 515 | Ga0207657_10157641 | 3300025919 | Bacteria | 1845 |
| 516 | Ga0207657_10683727 | 3300025919 | Bacteria | 798 |
| 517 | Ga0207649_10366280 | 3300025920 | Bacteria | 1071 |
| 518 | Ga0207649_10476235 | 3300025920 | Bacteria | 946 |
| 519 | Ga0207649_11539091 | 3300025920 | Bacteria | 526 |
| 520 | Ga0207652_10454185 | 3300025921 | Bacteria | 1155 |
| 521 | Ga0207646_10008173 | 3300025922 | Bacteria | 10519 |
| 522 | Ga0207681_10199759 | 3300025923 | Bacteria | 1535 |
| 523 | Ga0207681_10938174 | 3300025923 | Bacteria | 725 |
| 524 | Ga0207694_10000656 | 3300025924 | Bacteria | 31213 |
| 525 | Ga0207694_10297320 | 3300025924 | Bacteria | 1329 |
| 526 | Ga0207694_11874675 | 3300025924 | Bacteria | 503 |
| 527 | Ga0207650_10011784 | 3300025925 | Bacteria | 6028 |
| 528 | Ga0207650_10305848 | 3300025925 | Bacteria | 1299 |
| 529 | Ga0207650_10512872 | 3300025925 | Bacteria | 1003 |
| 530 | Ga0207659_10368084 | 3300025926 | Bacteria | 1196 |
| 531 | Ga0207659_11812915 | 3300025926 | Bacteria | 518 |
| 532 | Ga0207687_10058985 | 3300025927 | Bacteria | 2702 |
| 533 | Ga0207687_10060554 | 3300025927 | Bacteria | 2671 |
| 534 | Ga0207687_10083104 | 3300025927 | Bacteria | 2318 |
| 535 | Ga0207687_10093319 | 3300025927 | Bacteria | 2200 |
| 536 | Ga0207687_10169610 | 3300025927 | Bacteria | 1682 |
| 537 | Ga0207700_10420644 | 3300025928 | Bacteria | 1174 |
| 538 | Ga0207700_10497764 | 3300025928 | Bacteria | 1078 |
| 539 | Ga0207700_10558393 | 3300025928 | Bacteria | 1017 |
| 540 | Ga0207700_10789354 | 3300025928 | Bacteria | 849 |
| 541 | Ga0207700_11927573 | 3300025928 | Bacteria | 517 |
| 542 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 543 | Ga0207664_10829357 | 3300025929 | Bacteria | 831 |
| 544 | Ga0207664_10923512 | 3300025929 | Bacteria | 783 |
| 545 | Ga0207664_10951558 | 3300025929 | Bacteria | 770 |
| 546 | Ga0207664_11617916 | 3300025929 | Bacteria | 570 |
| 547 | Ga0207644_10020676 | 3300025931 | Bacteria | 4479 |
| 548 | Ga0207644_10036195 | 3300025931 | Bacteria | 3464 |
| 549 | Ga0207644_10166907 | 3300025931 | Bacteria | 1716 |
| 550 | Ga0207644_10461593 | 3300025931 | Bacteria | 1044 |
| 551 | Ga0207690_10008330 | 3300025932 | Bacteria | 6152 |
| 552 | Ga0207690_10730812 | 3300025932 | Bacteria | 815 |
| 553 | Ga0207706_10003017 | 3300025933 | Bacteria | 16230 |
| 554 | Ga0207706_10095189 | 3300025933 | Bacteria | 2619 |
| 555 | Ga0207686_10222629 | 3300025934 | Bacteria | 1363 |
| 556 | Ga0207686_10483549 | 3300025934 | Bacteria | 958 |
| 557 | Ga0207686_10757720 | 3300025934 | Bacteria | 775 |
| 558 | Ga0207709_10061998 | 3300025935 | Bacteria | 2339 |
| 559 | Ga0207709_10080992 | 3300025935 | Bacteria | 2092 |
| 560 | Ga0207709_10096170 | 3300025935 | Bacteria | 1947 |
| 561 | Ga0207709_10384000 | 3300025935 | Bacteria | 1069 |
| 562 | Ga0207709_10674695 | 3300025935 | Bacteria | 825 |
| 563 | Ga0207709_11240436 | 3300025935 | Bacteria | 615 |
| 564 | Ga0207669_10026766 | 3300025937 | Bacteria | 3144 |
| 565 | Ga0207669_10131285 | 3300025937 | Bacteria | 1722 |
| 566 | Ga0207704_10930672 | 3300025938 | Bacteria | 732 |
| 567 | Ga0207665_10011709 | 3300025939 | Bacteria | 5764 |
| 568 | Ga0207665_10312578 | 3300025939 | Bacteria | 1177 |
| 569 | Ga0207665_11498929 | 3300025939 | Bacteria | 536 |
| 570 | Ga0207691_10000527 | 3300025940 | Bacteria | 38169 |
| 571 | Ga0207691_10611640 | 3300025940 | Bacteria | 922 |
| 572 | Ga0207691_10691711 | 3300025940 | Bacteria | 860 |
| 573 | Ga0207711_10000675 | 3300025941 | Bacteria | 33918 |
| 574 | Ga0207711_10001556 | 3300025941 | Bacteria | 21223 |
| 575 | Ga0207711_10097111 | 3300025941 | Bacteria | 2601 |
| 576 | Ga0207711_10479988 | 3300025941 | Bacteria | 1158 |
| 577 | Ga0207711_11212416 | 3300025941 | Bacteria | 696 |
| 578 | Ga0207689_10017267 | 3300025942 | Bacteria | 6108 |
| 579 | Ga0207689_11760193 | 3300025942 | Bacteria | 512 |
| 580 | Ga0207661_10365898 | 3300025944 | Bacteria | 1303 |
| 581 | Ga0207661_10645584 | 3300025944 | Bacteria | 973 |
| 582 | Ga0207661_11038622 | 3300025944 | Bacteria | 755 |
| 583 | Ga0207679_10346660 | 3300025945 | Bacteria | 1293 |
| 584 | Ga0207679_11036036 | 3300025945 | Bacteria | 752 |
| 585 | Ga0207667_10001125 | 3300025949 | Bacteria | 33757 |
| 586 | Ga0207667_10017539 | 3300025949 | Bacteria | 8052 |
| 587 | Ga0207667_10119327 | 3300025949 | Bacteria | 2718 |
| 588 | Ga0207667_10504307 | 3300025949 | Bacteria | 1227 |
| 589 | Ga0207651_10010498 | 3300025960 | Bacteria | 5137 |
| 590 | Ga0207651_11678228 | 3300025960 | Bacteria | 572 |
| 591 | Ga0207651_11903572 | 3300025960 | Bacteria | 535 |
| 592 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 593 | Ga0207712_10049885 | 3300025961 | Bacteria | 2920 |
| 594 | Ga0207712_11555212 | 3300025961 | Bacteria | 593 |
| 595 | Ga0207668_10106841 | 3300025972 | Bacteria | 2092 |
| 596 | Ga0207668_11058869 | 3300025972 | Bacteria | 726 |
| 597 | Ga0207640_10075142 | 3300025981 | Bacteria | 2289 |
| 598 | Ga0207640_10413879 | 3300025981 | Bacteria | 1101 |
| 599 | Ga0207640_10569844 | 3300025981 | Bacteria | 954 |
| 600 | Ga0207640_11605549 | 3300025981 | Bacteria | 586 |
| 601 | Ga0207658_10003656 | 3300025986 | Bacteria | 10853 |
| 602 | Ga0207658_10031533 | 3300025986 | Bacteria | 3765 |
| 603 | Ga0207658_10049393 | 3300025986 | Bacteria | 3091 |
| 604 | Ga0207658_10712074 | 3300025986 | Bacteria | 908 |
| 605 | Ga0207677_10528205 | 3300026023 | Bacteria | 1025 |
| 606 | Ga0207677_10904139 | 3300026023 | Bacteria | 796 |
| 607 | Ga0207703_10000315 | 3300026035 | Bacteria | 52633 |
| 608 | Ga0207703_10000676 | 3300026035 | Bacteria | 33962 |
| 609 | Ga0207703_10289518 | 3300026035 | Bacteria | 1490 |
| 610 | Ga0207639_10010682 | 3300026041 | Bacteria | 6359 |
| 611 | Ga0207639_10099007 | 3300026041 | Bacteria | 2351 |
| 612 | Ga0207639_10314078 | 3300026041 | Bacteria | 1389 |
| 613 | Ga0207639_11408325 | 3300026041 | Bacteria | 654 |
| 614 | Ga0207678_10154354 | 3300026067 | Bacteria | 1960 |
| 615 | Ga0207678_10172176 | 3300026067 | Bacteria | 1849 |
| 616 | Ga0207678_10280149 | 3300026067 | Bacteria | 1431 |
| 617 | Ga0207678_10489965 | 3300026067 | Bacteria | 1071 |
| 618 | Ga0207678_11432650 | 3300026067 | Bacteria | 610 |
| 619 | Ga0207708_10019564 | 3300026075 | Bacteria | 5105 |
| 620 | Ga0207708_11472027 | 3300026075 | Bacteria | 598 |
| 621 | Ga0207702_10023823 | 3300026078 | Bacteria | 5078 |
| 622 | Ga0207702_10643676 | 3300026078 | Bacteria | 1042 |
| 623 | Ga0207702_11000642 | 3300026078 | Bacteria | 829 |
| 624 | Ga0207702_11161400 | 3300026078 | Bacteria | 766 |
| 625 | Ga0207641_10013108 | 3300026088 | Bacteria | 6798 |
| 626 | Ga0207641_10034952 | 3300026088 | Bacteria | 4183 |
| 627 | Ga0207641_10088299 | 3300026088 | Bacteria | 2707 |
| 628 | Ga0207641_10282525 | 3300026088 | Bacteria | 1562 |
| 629 | Ga0207641_11879757 | 3300026088 | Bacteria | 600 |
| 630 | Ga0207676_10102976 | 3300026095 | Bacteria | 2371 |
| 631 | Ga0207676_10131422 | 3300026095 | Bacteria | 2129 |
| 632 | Ga0207676_10233598 | 3300026095 | Bacteria | 1645 |
| 633 | Ga0207674_10429108 | 3300026116 | Bacteria | 1277 |
| 634 | Ga0207675_100011376 | 3300026118 | Bacteria | 8328 |
| 635 | Ga0207675_100441613 | 3300026118 | Bacteria | 1288 |
| 636 | Ga0207683_10001988 | 3300026121 | Bacteria | 18100 |
| 637 | Ga0207683_10005105 | 3300026121 | Bacteria | 11266 |
| 638 | Ga0207683_11135942 | 3300026121 | Bacteria | 724 |
| 639 | Ga0207698_10001558 | 3300026142 | Bacteria | 13362 |
| 640 | Ga0207698_10280821 | 3300026142 | Bacteria | 1540 |
| 641 | Ga0207698_10284038 | 3300026142 | Bacteria | 1532 |
| 642 | Ga0207698_10731855 | 3300026142 | Bacteria | 986 |
| 643 | Ga0207698_11400398 | 3300026142 | Bacteria | 714 |
| 644 | Ga0209371_1046461 | 3300027312 | Bacteria | 853 |
| 645 | Ga0209179_1002471 | 3300027512 | Bacteria | 2504 |
| 646 | Ga0209974_10202245 | 3300027876 | Bacteria | 734 |
| 647 | Ga0209974_10416211 | 3300027876 | Bacteria | 529 |
| 648 | Ga0207428_10001932 | 3300027907 | Bacteria | 21004 |
| 649 | Ga0207428_10205041 | 3300027907 | Bacteria | 1483 |
| 650 | Ga0207428_10225265 | 3300027907 | Bacteria | 1404 |
| 651 | Ga0265356_1028495 | 3300028017 | Unclassified | 606 |
| 652 | Ga0268266_10020090 | 3300028379 | Bacteria | 5693 |
| 653 | Ga0268266_10306426 | 3300028379 | Bacteria | 1483 |
| 654 | Ga0268266_10483999 | 3300028379 | Bacteria | 1180 |
| 655 | Ga0268266_10742643 | 3300028379 | Bacteria | 947 |
| 656 | Ga0268265_10026539 | 3300028380 | Bacteria | 4122 |
| 657 | Ga0268264_10005182 | 3300028381 | Bacteria | 11039 |
| 658 | Ga0268264_11066015 | 3300028381 | Bacteria | 816 |
| 659 | Ga0268264_11545577 | 3300028381 | Bacteria | 674 |
| 660 | Ga0307517_10572196 | 3300028786 | Bacteria | 561 |
| 661 | Ga0307515_10235852 | 3300028794 | Bacteria | 1611 |
| 662 | Ga0307515_10377329 | 3300028794 | Bacteria | 1052 |
| 663 | Ga0265338_10832195 | 3300028800 | Bacteria | 631 |
| 664 | Ga0268256_1052414 | 3300030500 | Bacteria | 853 |
| 665 | Ga0307512_10470834 | 3300030522 | Bacteria | 500 |
| 666 | Ga0316176_1002176 | 3300030732 | Bacteria | 502 |
| 667 | Ga0316178_1092568 | 3300030735 | Bacteria | 1260 |
| 668 | Ga0316180_1140247 | 3300030736 | Bacteria | 698 |
| 669 | Ga0316183_1164821 | 3300030742 | Bacteria | 821 |
| 670 | Ga0316181_1000529 | 3300030744 | Bacteria | 891 |
| 671 | Ga0316182_1131057 | 3300030745 | Bacteria | 652 |
| 672 | Ga0265762_1010635 | 3300030760 | Bacteria | 1644 |
| 673 | Ga0265762_1154113 | 3300030760 | Bacteria | 549 |
| 674 | Ga0265766_1023954 | 3300030863 | Bacteria | 517 |
| 675 | Ga0265328_10060565 | 3300031239 | Bacteria | 1389 |
| 676 | Ga0265325_10211851 | 3300031241 | Bacteria | 890 |
| 677 | Ga0265339_10054864 | 3300031249 | Bacteria | 2163 |
| 678 | Ga0265331_10000393 | 3300031250 | Bacteria | 45046 |
| 679 | Ga0265327_10001930 | 3300031251 | Bacteria | 23961 |
| 680 | Ga0265327_10007612 | 3300031251 | Bacteria | 8308 |
| 681 | Ga0265327_10012338 | 3300031251 | Bacteria | 5776 |
| 682 | Ga0265327_10358605 | 3300031251 | Bacteria | 636 |
| 683 | Ga0265316_10078353 | 3300031344 | Bacteria | 2537 |
| 684 | Ga0307513_10017299 | 3300031456 | Bacteria | 8648 |
| 685 | Ga0307513_10075355 | 3300031456 | Bacteria | 3504 |
| 686 | Ga0307513_10362823 | 3300031456 | Bacteria | 1193 |
| 687 | Ga0307513_10385307 | 3300031456 | Bacteria | 1140 |
| 688 | Ga0307509_10493699 | 3300031507 | Bacteria | 910 |
| 689 | Ga0307408_100004096 | 3300031548 | Bacteria | 9944 |
| 690 | Ga0307408_100027283 | 3300031548 | Bacteria | 3933 |
| 691 | Ga0307408_100029844 | 3300031548 | Bacteria | 3781 |
| 692 | Ga0307408_100037161 | 3300031548 | Bacteria | 3428 |
| 693 | Ga0307408_100037908 | 3300031548 | Bacteria | 3398 |
| 694 | Ga0307408_100056630 | 3300031548 | Bacteria | 2843 |
| 695 | Ga0307408_100089677 | 3300031548 | Bacteria | 2318 |
| 696 | Ga0307408_100124786 | 3300031548 | Bacteria | 2000 |
| 697 | Ga0307408_100149275 | 3300031548 | Bacteria | 1843 |
| 698 | Ga0307408_100388887 | 3300031548 | Bacteria | 1194 |
| 699 | Ga0307408_100408750 | 3300031548 | Bacteria | 1167 |
| 700 | Ga0307408_100486561 | 3300031548 | Bacteria | 1077 |
| 701 | Ga0307408_102391130 | 3300031548 | Bacteria | 513 |
| 702 | Ga0307508_10234030 | 3300031616 | Bacteria | 1435 |
| 703 | Ga0307514_10538232 | 3300031649 | Bacteria | 543 |
| 704 | Ga0316576_10866716 | 3300031727 | Bacteria | 648 |
| 705 | Ga0307405_10001824 | 3300031731 | Bacteria | 9131 |
| 706 | Ga0307405_10049986 | 3300031731 | Bacteria | 2587 |
| 707 | Ga0307405_10058059 | 3300031731 | Bacteria | 2433 |
| 708 | Ga0307405_10061947 | 3300031731 | Bacteria | 2367 |
| 709 | Ga0307405_10208555 | 3300031731 | Bacteria | 1424 |
| 710 | Ga0307405_10247616 | 3300031731 | Bacteria | 1324 |
| 711 | Ga0307405_10290980 | 3300031731 | Bacteria | 1234 |
| 712 | Ga0307405_10357635 | 3300031731 | Bacteria | 1128 |
| 713 | Ga0307405_10445243 | 3300031731 | Bacteria | 1025 |
| 714 | Ga0307405_10470966 | 3300031731 | Bacteria | 1000 |
| 715 | Ga0307405_10602688 | 3300031731 | Bacteria | 896 |
| 716 | Ga0307405_10707280 | 3300031731 | Bacteria | 835 |
| 717 | Ga0307405_11418389 | 3300031731 | Bacteria | 608 |
| 718 | Ga0307405_11570928 | 3300031731 | Bacteria | 580 |
| 719 | Ga0307413_10007146 | 3300031824 | Bacteria | 5158 |
| 720 | Ga0307413_10012044 | 3300031824 | Bacteria | 4287 |
| 721 | Ga0307413_10043973 | 3300031824 | Bacteria | 2636 |
| 722 | Ga0307413_10050698 | 3300031824 | Bacteria | 2496 |
| 723 | Ga0307413_10117255 | 3300031824 | Bacteria | 1795 |
| 724 | Ga0307413_10135921 | 3300031824 | Bacteria | 1690 |
| 725 | Ga0307413_10261513 | 3300031824 | Bacteria | 1290 |
| 726 | Ga0307413_10421462 | 3300031824 | Bacteria | 1051 |
| 727 | Ga0307413_10586556 | 3300031824 | Bacteria | 910 |
| 728 | Ga0307413_10956618 | 3300031824 | Bacteria | 731 |
| 729 | Ga0307413_10973471 | 3300031824 | Bacteria | 725 |
| 730 | Ga0307413_11294872 | 3300031824 | Bacteria | 637 |
| 731 | Ga0307413_11320218 | 3300031824 | Bacteria | 632 |
| 732 | Ga0307518_10064062 | 3300031838 | Bacteria | 2668 |
| 733 | Ga0307410_10004562 | 3300031852 | Bacteria | 7180 |
| 734 | Ga0307410_10006834 | 3300031852 | Bacteria | 6197 |
| 735 | Ga0307410_10021301 | 3300031852 | Bacteria | 3984 |
| 736 | Ga0307410_10025907 | 3300031852 | Bacteria | 3685 |
| 737 | Ga0307410_10032973 | 3300031852 | Bacteria | 3340 |
| 738 | Ga0307410_10184774 | 3300031852 | Bacteria | 1581 |
| 739 | Ga0307410_10239035 | 3300031852 | Bacteria | 1406 |
| 740 | Ga0307410_10832107 | 3300031852 | Bacteria | 787 |
| 741 | Ga0307410_11065894 | 3300031852 | Bacteria | 699 |
| 742 | Ga0307410_11355210 | 3300031852 | Bacteria | 623 |
| 743 | Ga0307410_11660228 | 3300031852 | Bacteria | 565 |
| 744 | Ga0307410_11666567 | 3300031852 | Bacteria | 564 |
| 745 | Ga0307406_10011101 | 3300031901 | Bacteria | 5103 |
| 746 | Ga0307406_10021863 | 3300031901 | Bacteria | 3790 |
| 747 | Ga0307406_10092243 | 3300031901 | Bacteria | 2042 |
| 748 | Ga0307406_10095491 | 3300031901 | Bacteria | 2012 |
| 749 | Ga0307406_10146643 | 3300031901 | Bacteria | 1678 |
| 750 | Ga0307406_10149054 | 3300031901 | Bacteria | 1666 |
| 751 | Ga0307406_10342988 | 3300031901 | Bacteria | 1164 |
| 752 | Ga0307406_10498923 | 3300031901 | Bacteria | 986 |
| 753 | Ga0307406_11253740 | 3300031901 | Bacteria | 645 |
| 754 | Ga0307407_10016800 | 3300031903 | Bacteria | 3652 |
| 755 | Ga0307407_10023952 | 3300031903 | Bacteria | 3193 |
| 756 | Ga0307407_10063249 | 3300031903 | Bacteria | 2170 |
| 757 | Ga0307407_10098440 | 3300031903 | Bacteria | 1809 |
| 758 | Ga0307407_10170372 | 3300031903 | Bacteria | 1433 |
| 759 | Ga0307407_10181446 | 3300031903 | Bacteria | 1395 |
| 760 | Ga0307407_10188886 | 3300031903 | Bacteria | 1371 |
| 761 | Ga0307407_11623756 | 3300031903 | Bacteria | 513 |
| 762 | Ga0307412_10001098 | 3300031911 | Bacteria | 15508 |
| 763 | Ga0307412_10028533 | 3300031911 | Bacteria | 3492 |
| 764 | Ga0307412_10040148 | 3300031911 | Bacteria | 3027 |
| 765 | Ga0307412_10054535 | 3300031911 | Bacteria | 2654 |
| 766 | Ga0307412_10064294 | 3300031911 | Bacteria | 2478 |
| 767 | Ga0307412_10075565 | 3300031911 | Bacteria | 2311 |
| 768 | Ga0307412_10101590 | 3300031911 | Bacteria | 2035 |
| 769 | Ga0307412_10109144 | 3300031911 | Bacteria | 1972 |
| 770 | Ga0307412_10267823 | 3300031911 | Bacteria | 1335 |
| 771 | Ga0307412_10327764 | 3300031911 | Bacteria | 1221 |
| 772 | Ga0307412_10374615 | 3300031911 | Bacteria | 1150 |
| 773 | Ga0307412_10384432 | 3300031911 | Bacteria | 1137 |
| 774 | Ga0307412_10508614 | 3300031911 | Bacteria | 1004 |
| 775 | Ga0307412_10551346 | 3300031911 | Bacteria | 968 |
| 776 | Ga0307412_10734830 | 3300031911 | Bacteria | 850 |
| 777 | Ga0307412_10866759 | 3300031911 | Bacteria | 789 |
| 778 | Ga0307412_10870528 | 3300031911 | Bacteria | 787 |
| 779 | Ga0307412_11367813 | 3300031911 | Bacteria | 639 |
| 780 | Ga0307409_100017036 | 3300031995 | Bacteria | 4829 |
| 781 | Ga0307409_100034644 | 3300031995 | Bacteria | 3690 |
| 782 | Ga0307409_100043092 | 3300031995 | Bacteria | 3385 |
| 783 | Ga0307409_100047789 | 3300031995 | Bacteria | 3251 |
| 784 | Ga0307409_100055044 | 3300031995 | Bacteria | 3069 |
| 785 | Ga0307409_100063933 | 3300031995 | Bacteria | 2888 |
| 786 | Ga0307409_100095980 | 3300031995 | Bacteria | 2444 |
| 787 | Ga0307409_100197086 | 3300031995 | Bacteria | 1798 |
| 788 | Ga0307409_100210360 | 3300031995 | Bacteria | 1747 |
| 789 | Ga0307409_100360534 | 3300031995 | Bacteria | 1375 |
| 790 | Ga0307409_100505904 | 3300031995 | Bacteria | 1177 |
| 791 | Ga0307409_100540907 | 3300031995 | Bacteria | 1142 |
| 792 | Ga0307409_100733313 | 3300031995 | Bacteria | 990 |
| 793 | Ga0307409_100927340 | 3300031995 | Bacteria | 886 |
| 794 | Ga0307409_101373263 | 3300031995 | Bacteria | 732 |
| 795 | Ga0307409_101510148 | 3300031995 | Bacteria | 699 |
| 796 | Ga0307409_102947937 | 3300031995 | Bacteria | 502 |
| 797 | Ga0307416_100014730 | 3300032002 | Bacteria | 5373 |
| 798 | Ga0307416_100072215 | 3300032002 | Bacteria | 2871 |
| 799 | Ga0307416_100077052 | 3300032002 | Bacteria | 2798 |
| 800 | Ga0307416_100094749 | 3300032002 | Bacteria | 2575 |
| 801 | Ga0307416_100096528 | 3300032002 | Bacteria | 2556 |
| 802 | Ga0307416_100120934 | 3300032002 | Bacteria | 2333 |
| 803 | Ga0307416_100213681 | 3300032002 | Bacteria | 1842 |
| 804 | Ga0307416_100231574 | 3300032002 | Bacteria | 1781 |
| 805 | Ga0307416_100244194 | 3300032002 | Bacteria | 1742 |
| 806 | Ga0307416_100275746 | 3300032002 | Bacteria | 1654 |
| 807 | Ga0307416_100280500 | 3300032002 | Bacteria | 1642 |
| 808 | Ga0307416_100288524 | 3300032002 | Bacteria | 1623 |
| 809 | Ga0307416_100326581 | 3300032002 | Bacteria | 1539 |
| 810 | Ga0307416_100352939 | 3300032002 | Bacteria | 1489 |
| 811 | Ga0307416_100430466 | 3300032002 | Bacteria | 1366 |
| 812 | Ga0307416_100602041 | 3300032002 | Bacteria | 1179 |
| 813 | Ga0307416_102168302 | 3300032002 | Bacteria | 657 |
| 814 | Ga0307416_103143038 | 3300032002 | Bacteria | 552 |
| 815 | Ga0307414_10049175 | 3300032004 | Bacteria | 2914 |
| 816 | Ga0307414_10148169 | 3300032004 | Bacteria | 1847 |
| 817 | Ga0307414_10191870 | 3300032004 | Bacteria | 1654 |
| 818 | Ga0307414_10201130 | 3300032004 | Bacteria | 1620 |
| 819 | Ga0307414_10260111 | 3300032004 | Bacteria | 1448 |
| 820 | Ga0307414_10312710 | 3300032004 | Bacteria | 1334 |
| 821 | Ga0307414_10333565 | 3300032004 | Bacteria | 1296 |
| 822 | Ga0307414_11132362 | 3300032004 | Bacteria | 723 |
| 823 | Ga0307414_11796089 | 3300032004 | Bacteria | 572 |
| 824 | Ga0307411_10029428 | 3300032005 | Bacteria | 3353 |
| 825 | Ga0307411_10086652 | 3300032005 | Bacteria | 2173 |
| 826 | Ga0307411_10274877 | 3300032005 | Bacteria | 1338 |
| 827 | Ga0307411_10531447 | 3300032005 | Bacteria | 1000 |
| 828 | Ga0307411_10550441 | 3300032005 | Bacteria | 984 |
| 829 | Ga0307411_10652831 | 3300032005 | Bacteria | 911 |
| 830 | Ga0307411_11107021 | 3300032005 | Bacteria | 714 |
| 831 | Ga0307411_11854232 | 3300032005 | Bacteria | 560 |
| 832 | Ga0307411_12144187 | 3300032005 | Bacteria | 523 |
| 833 | Ga0307415_100015143 | 3300032126 | Bacteria | 4557 |
| 834 | Ga0307415_100060105 | 3300032126 | Bacteria | 2625 |
| 835 | Ga0307415_100158387 | 3300032126 | Bacteria | 1752 |
| 836 | Ga0307415_100200892 | 3300032126 | Bacteria | 1582 |
| 837 | Ga0307415_100340209 | 3300032126 | Bacteria | 1259 |
| 838 | Ga0307415_100500845 | 3300032126 | Bacteria | 1062 |
| 839 | Ga0307415_100502025 | 3300032126 | Bacteria | 1061 |
| 840 | Ga0307415_100865120 | 3300032126 | Bacteria | 830 |
| 841 | Ga0316593_10099211 | 3300032168 | Bacteria | 1032 |
| 842 | Ga0307507_10062721 | 3300033179 | Bacteria | 3448 |
| 843 | Ga0307510_10032524 | 3300033180 | Bacteria | 5875 |
| 844 | Ga0307510_10116554 | 3300033180 | Bacteria | 2392 |
| 845 | Ga0316592_1068630 | 3300033524 | Bacteria | 800 |
| 846 | Ga0316596_1072203 | 3300033541 | Bacteria | 925 |
| 847 | Ga0316596_1081265 | 3300033541 | Bacteria | 871 |
| 848 | Ga0316596_1228058 | 3300033541 | Bacteria | 522 |
| 849 | Ga0373930_0059307 | 3300034816 | Bacteria | 851 |
| 850 | Ga0373958_0159944 | 3300034819 | Bacteria | 569 |
| 851 | Ga0373951_0001434 | 3300035091 | Bacteria | 6254 |
| 852 | Ga0373951_0005165 | 3300035091 | Bacteria | 3050 |
| 853 | Ga0373923_0593976 | 3300035111 | Bacteria | 545 |
| 854 | Ga0373932_0233220 | 3300035112 | Bacteria | 666 |
| 855 | Ga0373941_0219279 | 3300035115 | Bacteria | 730 |
| 856 | Ga0373945_0209981 | 3300035116 | Bacteria | 811 |
| 857 | Ga0373956_0173050 | 3300035119 | Bacteria | 1019 |
| 858 | Ga0373957_0037179 | 3300035120 | Bacteria | 1818 |
| 859 | Ga0373955_0097921 | 3300035172 | Bacteria | 1680 |
| 860 | Ga0373962_0099230 | 3300035242 | Bacteria | 906 |
| 861 | Ga0373931_0092338 | 3300035691 | Bacteria | 1688 |
| 862 | Ga0373935_0776355 | 3300035692 | Bacteria | 707 |
| 863 | Ga0373947_0593340 | 3300035725 | Bacteria | 755 |
| 864 | Ga0373937_0240356 | 3300036401 | Bacteria | 1706 |
| 865 | Ga0373925_0128972 | 3300037068 | Bacteria | 1970 |
| 866 | Ga0395899_0002071 | 3300037312 | Bacteria | 16485 |
| 867 | Ga0395899_0012150 | 3300037312 | Bacteria | 6595 |
| 868 | Ga0395899_0042478 | 3300037312 | Bacteria | 3394 |
| 869 | Ga0395899_0044343 | 3300037312 | Bacteria | 3314 |
| 870 | Ga0395899_0122284 | 3300037312 | Bacteria | 1863 |
| 871 | Ga0395899_1002677 | 3300037312 | Bacteria | 503 |
| 872 | Ga0395900_0002047 | 3300037418 | Bacteria | 22659 |
| 873 | Ga0395900_0007771 | 3300037418 | Bacteria | 11061 |
| 874 | Ga0395900_0063331 | 3300037418 | Bacteria | 3801 |
| 875 | Ga0395900_0091319 | 3300037418 | Bacteria | 3129 |
| 876 | Ga0395900_0119281 | 3300037418 | Bacteria | 2708 |
| 877 | Ga0395900_0162275 | 3300037418 | Bacteria | 2279 |
| 878 | Ga0395900_0276018 | 3300037418 | Bacteria | 1674 |
| 879 | Ga0395900_0472686 | 3300037418 | Bacteria | 1207 |
| 880 | Ga0395900_1119541 | 3300037418 | Bacteria | 704 |
| 881 | Ga0395898_0010620 | 3300037466 | Bacteria | 9618 |
| 882 | Ga0395898_0024316 | 3300037466 | Bacteria | 6109 |
| 883 | Ga0395898_0039323 | 3300037466 | Bacteria | 4682 |
| 884 | Ga0395898_0053014 | 3300037466 | Bacteria | 3961 |
| 885 | Ga0395898_0060072 | 3300037466 | Bacteria | 3695 |
| 886 | Ga0395898_0069594 | 3300037466 | Bacteria | 3404 |
| 887 | Ga0395898_0107768 | 3300037466 | Bacteria | 2672 |
| 888 | Ga0395898_0185881 | 3300037466 | Bacteria | 1985 |
| 889 | Ga0395898_0197932 | 3300037466 | Bacteria | 1919 |
| 890 | Ga0395905_0011108 | 3300037471 | Bacteria | 8711 |
| 891 | Ga0395905_0550049 | 3300037471 | Bacteria | 1055 |
| 892 | Ga0395905_0553332 | 3300037471 | Bacteria | 1052 |
| 893 | Ga0395905_0708485 | 3300037471 | Bacteria | 909 |
| 894 | Ga0395905_0924892 | 3300037471 | Bacteria | 775 |
| 895 | Ga0395905_1781441 | 3300037471 | Bacteria | 521 |
| 896 | Ga0395901_0018181 | 3300038443 | Bacteria | 7175 |
| 897 | Ga0395901_0062464 | 3300038443 | Bacteria | 3876 |
| 898 | Ga0395901_0063679 | 3300038443 | Bacteria | 3838 |
| 899 | Ga0395901_0065762 | 3300038443 | Bacteria | 3776 |
| 900 | Ga0395901_0067956 | 3300038443 | Bacteria | 3712 |
| 901 | Ga0395901_0118943 | 3300038443 | Bacteria | 2776 |
| 902 | Ga0395901_0361299 | 3300038443 | Bacteria | 1497 |
| 903 | Ga0395901_1092670 | 3300038443 | Bacteria | 768 |
| 904 | Ga0395901_1257550 | 3300038443 | Bacteria | 703 |
| 905 | Ga0242420_148478 | 3300038996 | Bacteria | 525 |
| 906 | Ga0436365_0091043 | 3300039437 | Bacteria | 944 |
| 907 | Ga0436365_0779361 | 3300039437 | Bacteria | 6745 |
| 908 | Ga0436365_1937032 | 3300039437 | Bacteria | 712 |
| 909 | Ga0436360_0899858 | 3300039438 | Bacteria | 1149 |
| 910 | Ga0436360_1315227 | 3300039438 | Bacteria | 1151 |
| 911 | Ga0436361_0605533 | 3300039447 | Bacteria | 604 |
| 912 | Ga0436363_0309976 | 3300039450 | Bacteria | 1329 |
| 913 | Ga0436362_0126685 | 3300039453 | Bacteria | 3092 |
| 914 | Ga0436362_0225406 | 3300039453 | Bacteria | 625 |
| 915 | Ga0439436_0000426 | 3300041404 | Bacteria | 10626 |
| 916 | Ga0439436_0002918 | 3300041404 | Bacteria | 5184 |
| 917 | Ga0439436_0037321 | 3300041404 | Bacteria | 1399 |
| 918 | Ga0439438_001015 | 3300041405 | Bacteria | 12523 |
| 919 | Ga0439438_041334 | 3300041405 | Bacteria | 1196 |
| 920 | Ga0439438_081595 | 3300041405 | Bacteria | 793 |
| 921 | Ga0439439_0000182 | 3300041406 | Bacteria | 9522 |
| 922 | Ga0439439_0115147 | 3300041406 | Bacteria | 747 |
| 923 | Ga0439461_0016623 | 3300041410 | Bacteria | 1422 |
| 924 | Ga0439461_0053203 | 3300041410 | Bacteria | 903 |
| 925 | Ga0439461_0112112 | 3300041410 | Bacteria | 674 |
| 926 | Ga0439466_0001588 | 3300041411 | Bacteria | 8883 |
| 927 | Ga0439466_0118738 | 3300041411 | Bacteria | 817 |
| 928 | Ga0439466_0245538 | 3300041411 | Bacteria | 542 |
| 929 | Ga0439465_0019982 | 3300041413 | Bacteria | 2095 |
| 930 | Ga0439465_0060523 | 3300041413 | Bacteria | 1254 |
| 931 | Ga0439465_0268007 | 3300041413 | Bacteria | 634 |
| 932 | Ga0451787_429570 | 3300041441 | Bacteria | 828 |
| 933 | Ga0451787_454270 | 3300041441 | Bacteria | 542 |
| 934 | Ga0451789_0449262 | 3300041443 | Bacteria | 773 |
| 935 | Ga0451789_0954465 | 3300041443 | Bacteria | 2050 |
| 936 | Ga0451790_29369 | 3300041444 | Bacteria | 871 |
| 937 | Ga0451791_0333509 | 3300041451 | Bacteria | 803 |
| 938 | Ga0451791_0425394 | 3300041451 | Bacteria | 1094 |
| 939 | Ga0451791_0746838 | 3300041451 | Bacteria | 1098 |
| 940 | Ga0451791_1365422 | 3300041451 | Bacteria | 1025 |
| 941 | Ga0451791_1684038 | 3300041451 | Bacteria | 1021 |
| 942 | Ga0451793_0107442 | 3300041452 | Bacteria | 862 |
| 943 | Ga0451793_0375343 | 3300041452 | Bacteria | 618 |
| 944 | Ga0451793_0394566 | 3300041452 | Bacteria | 1431 |
| 945 | Ga0451797_0414603 | 3300041453 | Bacteria | 902 |
| 946 | Ga0451797_0578603 | 3300041453 | Bacteria | 567 |
| 947 | Ga0451797_0820372 | 3300041453 | Bacteria | 976 |
| 948 | Ga0451795_0000828 | 3300041456 | Bacteria | 1745 |
| 949 | Ga0451800_0128843 | 3300041459 | Bacteria | 865 |
| 950 | Ga0451800_0298232 | 3300041459 | Bacteria | 892 |
| 951 | Ga0451800_0575305 | 3300041459 | Bacteria | 956 |
| 952 | Ga0451802_0089278 | 3300041460 | Bacteria | 1522 |
| 953 | Ga0451802_0278509 | 3300041460 | Bacteria | 568 |
| 954 | Ga0451802_0708891 | 3300041460 | Bacteria | 502 |
| 955 | Ga0451806_674951 | 3300041462 | Bacteria | 929 |
| 956 | Ga0451807_0181775 | 3300041486 | Bacteria | 656 |
| 957 | Ga0451807_1758962 | 3300041486 | Bacteria | 868 |
| 958 | Ga0451807_2590362 | 3300041486 | Bacteria | 818 |
| 959 | Ga0451833_1376670 | 3300041491 | Bacteria | 836 |
| 960 | Ga0451837_1258306 | 3300041494 | Bacteria | 520 |
| 961 | Ga0451837_1568330 | 3300041494 | Bacteria | 591 |
| 962 | Ga0451839_1351262 | 3300041496 | Bacteria | 813 |
| 963 | Ga0451839_1586779 | 3300041496 | Bacteria | 595 |
| 964 | Ga0451841_0147103 | 3300041498 | Bacteria | 626 |
| 965 | Ga0451847_0602894 | 3300041503 | Bacteria | 550 |
| 966 | Ga0451849_0833272 | 3300041505 | Bacteria | 656 |
| 967 | Ga0451851_0537676 | 3300041507 | Bacteria | 631 |
| 968 | Ga0451843_1119515 | 3300041509 | Bacteria | 939 |
| 969 | Ga0451855_0050733 | 3300041511 | Bacteria | 704 |
| 970 | Ga0451853_0358524 | 3300041512 | Bacteria | 629 |
| 971 | Ga0451853_2739900 | 3300041512 | Bacteria | 567 |
| 972 | Ga0439431_0046537 | 3300041997 | Bacteria | 1116 |
| 973 | Ga0439433_0000242 | 3300041999 | Bacteria | 9104 |
| 974 | Ga0439433_0000467 | 3300041999 | Bacteria | 7466 |
| 975 | Ga0439433_0016129 | 3300041999 | Bacteria | 1652 |
| 976 | Ga0439433_0061981 | 3300041999 | Bacteria | 893 |
| 977 | Ga0439442_000016 | 3300042002 | Bacteria | 46336 |
| 978 | Ga0439442_000282 | 3300042002 | Bacteria | 12486 |
| 979 | Ga0439442_001917 | 3300042002 | Bacteria | 4083 |
| 980 | Ga0439442_005349 | 3300042002 | Bacteria | 2569 |
| 981 | Ga0439442_007158 | 3300042002 | Bacteria | 2242 |
| 982 | Ga0439448_0127540 | 3300042005 | Bacteria | 875 |
| 983 | Ga0439432_010951 | 3300042006 | Bacteria | 3129 |
| 984 | Ga0439432_022430 | 3300042006 | Bacteria | 2085 |
| 985 | Ga0439449_0000230 | 3300042007 | Bacteria | 20108 |
| 986 | Ga0439449_0001930 | 3300042007 | Bacteria | 8140 |
| 987 | Ga0439449_0016620 | 3300042007 | Bacteria | 2764 |
| 988 | Ga0439449_0084853 | 3300042007 | Bacteria | 1168 |
| 989 | Ga0439449_0108314 | 3300042007 | Bacteria | 1028 |
| 990 | Ga0439449_0197236 | 3300042007 | Bacteria | 753 |
| 991 | Ga0439449_0398914 | 3300042007 | Bacteria | 522 |
| 992 | Ga0439452_001317 | 3300042010 | Bacteria | 10421 |
| 993 | Ga0439452_045896 | 3300042010 | Bacteria | 1015 |
| 994 | Ga0439452_064252 | 3300042010 | Bacteria | 817 |
| 995 | Ga0439456_108413 | 3300042013 | Bacteria | 632 |
| 996 | Ga0439457_000356 | 3300042014 | Bacteria | 12742 |
| 997 | Ga0439457_006669 | 3300042014 | Bacteria | 2809 |
| 998 | Ga0439457_027578 | 3300042014 | Bacteria | 1257 |
| 999 | Ga0439462_0003349 | 3300042015 | Bacteria | 3838 |
| 1000 | Ga0439462_0012078 | 3300042015 | Bacteria | 2204 |
| 1001 | Ga0439462_0013073 | 3300042015 | Bacteria | 2126 |
| 1002 | Ga0439462_0077392 | 3300042015 | Bacteria | 907 |
| 1003 | Ga0450911_008837 | 3300042115 | Bacteria | 1424 |
| 1004 | Ga0450911_016469 | 3300042115 | Bacteria | 976 |
| 1005 | Ga0450911_017875 | 3300042115 | Bacteria | 932 |
| 1006 | Ga0450919_000012 | 3300042121 | Bacteria | 14953 |
| 1007 | Ga0450919_001784 | 3300042121 | Bacteria | 2806 |
| 1008 | Ga0450920_007814 | 3300042122 | Bacteria | 1942 |
| 1009 | Ga0450920_126027 | 3300042122 | Bacteria | 538 |
| 1010 | Ga0450922_024543 | 3300042124 | Bacteria | 635 |
| 1011 | Ga0450894_073519 | 3300042131 | Bacteria | 526 |
| 1012 | Ga0450906_014699 | 3300042145 | Bacteria | 1432 |
| 1013 | Ga0450907_000308 | 3300042146 | Bacteria | 16371 |
| 1014 | Ga0450907_001905 | 3300042146 | Bacteria | 4235 |
| 1015 | Ga0450910_045591 | 3300042147 | Bacteria | 716 |
| 1016 | Ga0439446_0006482 | 3300042156 | Bacteria | 3053 |
| 1017 | Ga0439446_0315801 | 3300042156 | Bacteria | 551 |
| 1018 | Ga0439458_0184367 | 3300042157 | Bacteria | 567 |
| 1019 | Ga0450908_001115 | 3300042184 | Bacteria | 5219 |
| 1020 | Ga0450908_004272 | 3300042184 | Bacteria | 2759 |
| 1021 | Ga0450909_001836 | 3300042185 | Bacteria | 2988 |
| 1022 | Ga0450909_020841 | 3300042185 | Bacteria | 978 |
| 1023 | Ga0450909_038462 | 3300042185 | Bacteria | 734 |
| 1024 | Ga0439434_0000231 | 3300042435 | Bacteria | 15604 |
| 1025 | Ga0439434_0012022 | 3300042435 | Bacteria | 2558 |
| 1026 | Ga0450918_004338 | 3300042531 | Bacteria | 2590 |
| 1027 | Ga0450918_004412 | 3300042531 | Bacteria | 2563 |
| 1028 | Ga0451577_0014128 | 3300042876 | Bacteria | 7447 |
| 1029 | Ga0451577_0050819 | 3300042876 | Bacteria | 3700 |
| 1030 | Ga0451577_0128561 | 3300042876 | Bacteria | 2272 |
| 1031 | Ga0466969_0162001 | 3300044656 | Bacteria | 1028 |
| 1032 | Ga0466969_0505183 | 3300044656 | Bacteria | 552 |
| 1033 | Ga0466972_0112550 | 3300044658 | Bacteria | 1286 |
| 1034 | Ga0466972_0230080 | 3300044658 | Bacteria | 867 |
| 1035 | Ga0466972_0393401 | 3300044658 | Bacteria | 649 |
| 1036 | Ga0453683_0048494 | 3300044673 | Bacteria | 2664 |
| 1037 | Ga0453683_0129992 | 3300044673 | Bacteria | 1586 |
| 1038 | Ga0453683_0147082 | 3300044673 | Bacteria | 1488 |
| 1039 | Ga0453683_1115461 | 3300044673 | Bacteria | 526 |
| 1040 | Ga0466965_0051221 | 3300044683 | Bacteria | 2048 |
| 1041 | Ga0466966_0007964 | 3300044684 | Bacteria | 7022 |
| 1042 | Ga0466966_0770770 | 3300044684 | Bacteria | 580 |
| 1043 | Ga0466966_0854820 | 3300044684 | Bacteria | 548 |
| 1044 | Ga0466966_0998319 | 3300044684 | Bacteria | 505 |
| 1045 | Ga0466961_0006228 | 3300044693 | Bacteria | 7581 |
| 1046 | Ga0466961_0032065 | 3300044693 | Bacteria | 3377 |
| 1047 | Ga0466961_0039290 | 3300044693 | Bacteria | 3034 |
| 1048 | Ga0466961_0048204 | 3300044693 | Bacteria | 2723 |
| 1049 | Ga0466961_0338980 | 3300044693 | Bacteria | 916 |
| 1050 | Ga0466963_0119372 | 3300044694 | Bacteria | 1814 |
| 1051 | Ga0466963_0579048 | 3300044694 | Bacteria | 793 |
| 1052 | Ga0466963_0919926 | 3300044694 | Bacteria | 616 |
| 1053 | Ga0453684_0012179 | 3300044712 | Bacteria | 14260 |
| 1054 | Ga0466971_0190511 | 3300044719 | Bacteria | 966 |
| 1055 | Ga0466968_0010303 | 3300044735 | Bacteria | 3621 |
| 1056 | Ga0466968_0216792 | 3300044735 | Bacteria | 900 |
| 1057 | Ga0466968_0742086 | 3300044735 | Bacteria | 503 |
| 1058 | Ga0466970_0000055 | 3300044765 | Bacteria | 43678 |
| 1059 | Ga0466970_0002327 | 3300044765 | Bacteria | 9186 |
| 1060 | Ga0466970_0009014 | 3300044765 | Bacteria | 5033 |
| 1061 | Ga0466970_0086594 | 3300044765 | Bacteria | 1698 |
| 1062 | Ga0466970_0086932 | 3300044765 | Bacteria | 1695 |
| 1063 | Ga0466970_0247452 | 3300044765 | Bacteria | 998 |
| 1064 | Ga0466970_0823343 | 3300044765 | Bacteria | 544 |
| 1065 | Ga0466970_0872377 | 3300044765 | Bacteria | 529 |
| 1066 | Ga0466957_0025992 | 3300044842 | Bacteria | 3472 |
| 1067 | Ga0466957_0118149 | 3300044842 | Bacteria | 1688 |
| 1068 | Ga0466957_1299102 | 3300044842 | Bacteria | 528 |
| 1069 | Ga0466960_0102179 | 3300044901 | Bacteria | 1478 |
| 1070 | Ga0466960_0151059 | 3300044901 | Bacteria | 1241 |
| 1071 | Ga0466960_0345090 | 3300044901 | Bacteria | 848 |
| 1072 | Ga0466960_0446825 | 3300044901 | Bacteria | 751 |
| 1073 | Ga0466959_0001374 | 3300045049 | Bacteria | 14858 |
| 1074 | Ga0466959_0004730 | 3300045049 | Bacteria | 9168 |
| 1075 | Ga0466959_0660839 | 3300045049 | Bacteria | 701 |
| 1076 | Ga0466959_1026321 | 3300045049 | Bacteria | 549 |
| 1077 | Ga0451576_0001029 | 3300045051 | Bacteria | 51466 |
| 1078 | Ga0451576_0068343 | 3300045051 | Bacteria | 3697 |
| 1079 | Ga0451576_0214471 | 3300045051 | Bacteria | 2010 |
| 1080 | Ga0451576_0455613 | 3300045051 | Bacteria | 1343 |
| 1081 | Ga0466967_0911577 | 3300045976 | Bacteria | 874 |
| 1082 | Ga0466967_1221047 | 3300045976 | Bacteria | 749 |
| 1083 | Ga0466967_1284178 | 3300045976 | Bacteria | 729 |
| 1084 | Ga0466967_2571254 | 3300045976 | Bacteria | 504 |
| 1085 | Ga0495592_0077419 | 3300046454 | Bacteria | 2411 |
| 1086 | Ga0495590_0000299 | 3300046457 | Bacteria | 26210 |
| 1087 | Ga0495591_014573 | 3300046458 | Bacteria | 2819 |
| 1088 | Ga0495629_0051856 | 3300046459 | Bacteria | 2871 |
| 1089 | Ga0495629_0286927 | 3300046459 | Bacteria | 1129 |
| 1090 | Ga0495629_0521741 | 3300046459 | Bacteria | 799 |
| 1091 | Ga0495638_0215485 | 3300046460 | Bacteria | 1076 |
| 1092 | Ga0495638_0275826 | 3300046460 | Bacteria | 916 |
| 1093 | Ga0495653_0030310 | 3300046463 | Bacteria | 4310 |
| 1094 | Ga0495653_0076958 | 3300046463 | Bacteria | 2479 |
| 1095 | Ga0495650_0000474 | 3300046471 | Bacteria | 61656 |
| 1096 | Ga0495580_0008811 | 3300046472 | Bacteria | 7986 |
| 1097 | Ga0495580_0352475 | 3300046472 | Bacteria | 997 |
| 1098 | Ga0495580_0414220 | 3300046472 | Bacteria | 907 |
| 1099 | Ga0495582_0213070 | 3300046473 | Bacteria | 1104 |
| 1100 | Ga0495639_0002597 | 3300046475 | Bacteria | 7861 |
| 1101 | Ga0495662_0032943 | 3300046476 | Bacteria | 2503 |
| 1102 | Ga0495664_0012743 | 3300046477 | Bacteria | 4762 |
| 1103 | Ga0495585_0283120 | 3300046492 | Bacteria | 819 |
| 1104 | Ga0495594_0071733 | 3300046499 | Bacteria | 1926 |
| 1105 | Ga0495594_0864155 | 3300046499 | Bacteria | 509 |
| 1106 | Ga0495583_0150527 | 3300046506 | Bacteria | 965 |
| 1107 | Ga0495583_0208673 | 3300046506 | Bacteria | 792 |
| 1108 | Ga0495606_0359042 | 3300046507 | Bacteria | 771 |
| 1109 | Ga0495606_0579260 | 3300046507 | Bacteria | 554 |
| 1110 | Ga0495618_0085855 | 3300046514 | Bacteria | 2012 |
| 1111 | Ga0495628_0929415 | 3300046516 | Bacteria | 602 |
| 1112 | Ga0495630_0363768 | 3300046517 | Bacteria | 1108 |
| 1113 | Ga0495631_0064693 | 3300046518 | Bacteria | 1583 |
| 1114 | Ga0495632_0165084 | 3300046519 | Bacteria | 1019 |
| 1115 | Ga0495648_0336888 | 3300046524 | Bacteria | 694 |
| 1116 | Ga0495666_0508700 | 3300046526 | Bacteria | 538 |
| 1117 | Ga0495654_0033163 | 3300046530 | Bacteria | 2614 |
| 1118 | Ga0495654_0314740 | 3300046530 | Bacteria | 636 |
| 1119 | Ga0495654_0339648 | 3300046530 | Bacteria | 606 |
| 1120 | Ga0495665_0001291 | 3300046531 | Bacteria | 13376 |
| 1121 | Ga0495665_0021883 | 3300046531 | Bacteria | 3438 |
| 1122 | Ga0495665_0236591 | 3300046531 | Bacteria | 942 |
| 1123 | Ga0495640_0144418 | 3300046533 | Bacteria | 1532 |
| 1124 | Ga0495586_0024557 | 3300046535 | Bacteria | 3223 |
| 1125 | Ga0495586_0040492 | 3300046535 | Bacteria | 2507 |
| 1126 | Ga0495587_0005826 | 3300046536 | Bacteria | 8026 |
| 1127 | Ga0495645_0014732 | 3300046543 | Bacteria | 5553 |
| 1128 | Ga0495645_0032859 | 3300046543 | Bacteria | 3785 |
| 1129 | Ga0495622_0409393 | 3300046557 | Bacteria | 584 |
| 1130 | Ga0495633_0160556 | 3300046558 | Bacteria | 1037 |
| 1131 | Ga0495667_0029880 | 3300046559 | Bacteria | 3665 |
| 1132 | Ga0495667_0038040 | 3300046559 | Bacteria | 3205 |
| 1133 | Ga0495667_0874373 | 3300046559 | Bacteria | 552 |
| 1134 | Ga0495656_0004079 | 3300046615 | Bacteria | 4974 |
| 1135 | Ga0495656_0152222 | 3300046615 | Bacteria | 1118 |
| 1136 | Ga0495668_0814608 | 3300046616 | Bacteria | 517 |
| 1137 | Ga0495634_0122562 | 3300046642 | Bacteria | 1664 |
| 1138 | Ga0495611_0358968 | 3300046648 | Bacteria | 668 |
| 1139 | Ga0495625_0618425 | 3300046660 | Bacteria | 648 |
| 1140 | Ga0495635_0096007 | 3300046663 | Bacteria | 2026 |
| 1141 | Ga0495635_0156730 | 3300046663 | Bacteria | 1550 |
| 1142 | Ga0495659_0149392 | 3300046664 | Bacteria | 937 |
| 1143 | Ga0495588_0001739 | 3300046674 | Bacteria | 9272 |
| 1144 | Ga0495588_0022049 | 3300046674 | Bacteria | 3145 |
| 1145 | Ga0495588_0049220 | 3300046674 | Bacteria | 2167 |
| 1146 | Ga0495588_0117980 | 3300046674 | Bacteria | 1398 |
| 1147 | Ga0495588_0259755 | 3300046674 | Bacteria | 915 |
| 1148 | Ga0495657_0691121 | 3300046675 | Bacteria | 587 |
| 1149 | Ga0495670_0001877 | 3300046691 | Bacteria | 10337 |
| 1150 | Ga0495670_0775590 | 3300046691 | Bacteria | 523 |
| 1151 | Ga0495671_0326119 | 3300046692 | Bacteria | 737 |
| 1152 | Ga0495649_0031008 | 3300046694 | Bacteria | 2949 |
| 1153 | Ga0495600_0015732 | 3300046809 | Bacteria | 4789 |
| 1154 | Ga0495660_0235900 | 3300046810 | Bacteria | 855 |
| 1155 | Ga0495581_0001511 | 3300047315 | Bacteria | 12955 |
| 1156 | Ga0495581_0012051 | 3300047315 | Bacteria | 5003 |
| 1157 | Ga0495581_0017028 | 3300047315 | Bacteria | 4223 |
| 1158 | Ga0495604_0758318 | 3300047317 | Bacteria | 613 |
| 1159 | Ga0495636_0006129 | 3300047318 | Bacteria | 4724 |
| 1160 | Ga0495674_0236146 | 3300047319 | Bacteria | 1508 |
| 1161 | Ga0495672_0019264 | 3300047320 | Bacteria | 4506 |
| 1162 | Ga0495672_0370373 | 3300047320 | Bacteria | 661 |
| 1163 | Ga0495676_0221974 | 3300047321 | Bacteria | 1302 |
| 1164 | Ga0495680_0150219 | 3300047322 | Bacteria | 1699 |
| 1165 | Ga0495680_0944236 | 3300047322 | Bacteria | 554 |
| 1166 | Ga0495675_0079559 | 3300047444 | Bacteria | 2064 |
| 1167 | Ga0495677_0390075 | 3300047445 | Bacteria | 551 |
| 1168 | Ga0495677_0458341 | 3300047445 | Bacteria | 505 |
| 1169 | Ga0495679_006855 | 3300047446 | Bacteria | 4838 |
| 1170 | Ga0495685_005367 | 3300047447 | Bacteria | 4183 |
| 1171 | Ga0495685_199418 | 3300047447 | Bacteria | 642 |
| 1172 | Ga0495684_0537386 | 3300047471 | Bacteria | 798 |
| 1173 | Ga0495686_0010064 | 3300047472 | Bacteria | 6755 |
| 1174 | Ga0495686_0077884 | 3300047472 | Bacteria | 2030 |
| 1175 | Ga0495593_0071938 | 3300047673 | Bacteria | 1796 |
| 1176 | Ga0495593_0150797 | 3300047673 | Bacteria | 1176 |
| 1177 | Ga0495615_0194990 | 3300048090 | Bacteria | 623 |
| 1178 | Ga0496100_0000039 | 3300048903 | Bacteria | 93702 |
| 1179 | Ga0496100_0078944 | 3300048903 | Bacteria | 2216 |
| 1180 | Ga0496100_0444386 | 3300048903 | Unclassified | 993 |
| 1181 | Ga0496100_1369110 | 3300048903 | Bacteria | 558 |
| 1182 | Ga0496100_1393389 | 3300048903 | Bacteria | 553 |
| 1183 | Ga0496101_0000043 | 3300048904 | Bacteria | 161643 |
| 1184 | Ga0496101_0004549 | 3300048904 | Bacteria | 8757 |
| 1185 | Ga0496102_0014569 | 3300048905 | Bacteria | 6833 |
| 1186 | Ga0496102_0027486 | 3300048905 | Bacteria | 5081 |
| 1187 | Ga0496102_0049022 | 3300048905 | Bacteria | 3841 |
| 1188 | Ga0496102_0108166 | 3300048905 | Bacteria | 2589 |
| 1189 | Ga0496102_0479472 | 3300048905 | Bacteria | 1165 |
| 1190 | Ga0496102_0486219 | 3300048905 | Bacteria | 1156 |
| 1191 | Ga0496103_0001202 | 3300048906 | Bacteria | 17776 |
| 1192 | Ga0496103_0060214 | 3300048906 | Bacteria | 2359 |
| 1193 | Ga0496103_0339941 | 3300048906 | Bacteria | 965 |
| 1194 | Ga0496103_0700312 | 3300048906 | Bacteria | 642 |
| 1195 | Ga0496103_0768880 | 3300048906 | Bacteria | 608 |
| 1196 | Ga0496104_0457445 | 3300048907 | Bacteria | 1188 |
| 1197 | Ga0496104_1086940 | 3300048907 | Bacteria | 703 |
| 1198 | Ga0496104_1684992 | 3300048907 | Bacteria | 536 |
| 1199 | Ga0496105_0353105 | 3300048908 | Bacteria | 1174 |
| 1200 | Ga0496105_0500816 | 3300048908 | Bacteria | 953 |
| 1201 | Ga0496105_0833650 | 3300048908 | Bacteria | 699 |
| 1202 | Ga0496106_0001390 | 3300048909 | Bacteria | 18159 |
| 1203 | Ga0496106_0073299 | 3300048909 | Bacteria | 2619 |
| 1204 | Ga0496106_1117427 | 3300048909 | Bacteria | 617 |
| 1205 | Ga0496107_0000922 | 3300048910 | Bacteria | 17326 |
| 1206 | Ga0496107_0120432 | 3300048910 | Bacteria | 1933 |
| 1207 | Ga0496107_0212317 | 3300048910 | Bacteria | 1439 |
| 1208 | Ga0496108_0001472 | 3300048911 | Bacteria | 18588 |
| 1209 | Ga0496108_0100844 | 3300048911 | Bacteria | 2462 |
| 1210 | Ga0496108_0551025 | 3300048911 | Bacteria | 1006 |
| 1211 | Ga0496108_0601335 | 3300048911 | Bacteria | 958 |
| 1212 | Ga0496109_0000145 | 3300048912 | Bacteria | 70505 |
| 1213 | Ga0496109_0057047 | 3300048912 | Bacteria | 3563 |
| 1214 | Ga0496109_0057729 | 3300048912 | Bacteria | 3544 |
| 1215 | Ga0496109_0099545 | 3300048912 | Bacteria | 2696 |
| 1216 | Ga0496109_0116031 | 3300048912 | Bacteria | 2491 |
| 1217 | Ga0496109_0126816 | 3300048912 | Bacteria | 2380 |
| 1218 | Ga0496109_0703843 | 3300048912 | Bacteria | 948 |
| 1219 | Ga0496109_0888766 | 3300048912 | Bacteria | 829 |
| 1220 | Ga0496110_0014371 | 3300048913 | Bacteria | 6571 |
| 1221 | Ga0496110_0100279 | 3300048913 | Bacteria | 2595 |
| 1222 | Ga0496110_0120747 | 3300048913 | Bacteria | 2360 |
| 1223 | Ga0496110_0702154 | 3300048913 | Bacteria | 913 |
| 1224 | Ga0496111_0087480 | 3300048914 | Bacteria | 2280 |
| 1225 | Ga0496111_0091624 | 3300048914 | Bacteria | 2228 |
| 1226 | Ga0496111_1110920 | 3300048914 | Bacteria | 563 |
| 1227 | Ga0496112_0033971 | 3300048915 | Bacteria | 4961 |
| 1228 | Ga0496112_0049201 | 3300048915 | Bacteria | 4132 |
| 1229 | Ga0496112_0078841 | 3300048915 | Bacteria | 3257 |
| 1230 | Ga0496112_0216149 | 3300048915 | Bacteria | 1873 |
| 1231 | Ga0496112_0391314 | 3300048915 | Bacteria | 1330 |
| 1232 | Ga0496112_0703160 | 3300048915 | Bacteria | 938 |
| 1233 | Ga0496113_0107912 | 3300048916 | Bacteria | 2164 |
| 1234 | Ga0496113_0660892 | 3300048916 | Bacteria | 835 |
| 1235 | Ga0496113_1091396 | 3300048916 | Bacteria | 626 |
| 1236 | Ga0496114_0000219 | 3300048917 | Bacteria | 41685 |
| 1237 | Ga0496114_0014191 | 3300048917 | Bacteria | 6392 |
| 1238 | Ga0496114_0092010 | 3300048917 | Bacteria | 2576 |
| 1239 | Ga0496114_1363013 | 3300048917 | Bacteria | 596 |
| 1240 | Ga0496114_1718828 | 3300048917 | Bacteria | 515 |
| 1241 | Ga0496115_0014990 | 3300048918 | Bacteria | 5875 |
| 1242 | Ga0496115_0179927 | 3300048918 | Bacteria | 1748 |
| 1243 | Ga0496115_0735458 | 3300048918 | Bacteria | 773 |
| 1244 | Ga0496116_0134410 | 3300048919 | Bacteria | 1403 |
| 1245 | Ga0496117_0069536 | 3300048920 | Bacteria | 2370 |
| 1246 | Ga0496117_0093402 | 3300048920 | Bacteria | 1929 |
| 1247 | Ga0496117_0129596 | 3300048920 | Bacteria | 1531 |
| 1248 | Ga0496117_0547361 | 3300048920 | Bacteria | 552 |
| 1249 | Ga0496118_0095230 | 3300048921 | Bacteria | 2033 |
| 1250 | Ga0496118_0140520 | 3300048921 | Bacteria | 1531 |
| 1251 | Ga0496118_0322667 | 3300048921 | Bacteria | 837 |
| 1252 | Ga0496119_0002652 | 3300048922 | Bacteria | 19382 |
| 1253 | Ga0496119_0010789 | 3300048922 | Bacteria | 7649 |
| 1254 | Ga0496119_0112425 | 3300048922 | Bacteria | 1509 |
| 1255 | Ga0496120_0006209 | 3300048923 | Bacteria | 9234 |
| 1256 | Ga0496120_0018797 | 3300048923 | Bacteria | 4440 |
| 1257 | Ga0496120_0075819 | 3300048923 | Bacteria | 1835 |
| 1258 | Ga0496120_0315952 | 3300048923 | Bacteria | 711 |
| 1259 | Ga0496120_0404508 | 3300048923 | Bacteria | 602 |
| 1260 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 1261 | Ga0496121_0404428 | 3300048924 | Bacteria | 893 |
| 1262 | Ga0496122_0001790 | 3300048925 | Bacteria | 32891 |
| 1263 | Ga0496123_0005125 | 3300048926 | Bacteria | 13374 |
| 1264 | Ga0496123_0010252 | 3300048926 | Bacteria | 8313 |
| 1265 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 1266 | Ga0496124_0091025 | 3300048927 | Bacteria | 2486 |
| 1267 | Ga0496124_0102040 | 3300048927 | Bacteria | 2322 |
| 1268 | Ga0496124_0375015 | 3300048927 | Bacteria | 997 |
| 1269 | Ga0496124_0856058 | 3300048927 | Bacteria | 556 |
| 1270 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 1271 | Ga0496125_0076977 | 3300048928 | Bacteria | 2574 |
| 1272 | Ga0496125_0081127 | 3300048928 | Bacteria | 2479 |
| 1273 | Ga0496125_0156864 | 3300048928 | Bacteria | 1553 |
| 1274 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 1275 | Ga0496126_1067892 | 3300048929 | Bacteria | 602 |
| 1276 | Ga0501306_004106 | 3300049127 | Bacteria | 1612 |
| 1277 | Ga0501306_063417 | 3300049127 | Bacteria | 612 |
| 1278 | Ga0501308_058468 | 3300049128 | Bacteria | 578 |
| 1279 | Ga0501309_044547 | 3300049129 | Bacteria | 685 |
| 1280 | Ga0501343_028807 | 3300049132 | Bacteria | 509 |
| 1281 | Ga0501304_044837 | 3300049160 | Bacteria | 502 |
| 1282 | Ga0501305_016403 | 3300049161 | Bacteria | 1056 |
| 1283 | Ga0501311_066454 | 3300049527 | Bacteria | 591 |
| 1284 | Ga0501312_000972 | 3300049528 | Bacteria | 2634 |
| 1285 | Ga0501312_066216 | 3300049528 | Bacteria | 633 |
| 1286 | Ga0501313_049590 | 3300049529 | Bacteria | 578 |
| 1287 | Ga0501313_064311 | 3300049529 | Bacteria | 524 |
| 1288 | Ga0501314_016286 | 3300049530 | Bacteria | 741 |
| 1289 | Ga0501316_058754 | 3300049532 | Bacteria | 566 |
| 1290 | Ga0501316_066726 | 3300049532 | Bacteria | 539 |
| 1291 | Ga0501316_074888 | 3300049532 | Bacteria | 517 |
| 1292 | Ga0501317_007238 | 3300049533 | Bacteria | 1246 |
| 1293 | Ga0501317_008434 | 3300049533 | Bacteria | 1187 |
| 1294 | Ga0501318_004887 | 3300049534 | Bacteria | 1306 |
| 1295 | Ga0501320_001640 | 3300049536 | Bacteria | 1681 |
| 1296 | Ga0501320_024448 | 3300049536 | Bacteria | 720 |
| 1297 | Ga0501321_001128 | 3300049537 | Bacteria | 2034 |
| 1298 | Ga0501321_029022 | 3300049537 | Bacteria | 730 |
| 1299 | Ga0501322_027409 | 3300049538 | Bacteria | 526 |
| 1300 | Ga0501323_050716 | 3300049539 | Bacteria | 629 |
| 1301 | Ga0501324_001209 | 3300049540 | Bacteria | 1673 |
| 1302 | Ga0501324_027992 | 3300049540 | Bacteria | 604 |
| 1303 | Ga0501325_000289 | 3300049541 | Bacteria | 2184 |
| 1304 | Ga0501325_008895 | 3300049541 | Bacteria | 881 |
| 1305 | Ga0501330_010028 | 3300049546 | Bacteria | 668 |
| 1306 | Ga0501330_017478 | 3300049546 | Bacteria | 557 |
| 1307 | Ga0501335_014234 | 3300049551 | Bacteria | 802 |
| 1308 | Ga0501031_0000119 | 3300049568 | Bacteria | 43003 |
| 1309 | Ga0501031_0021571 | 3300049568 | Bacteria | 4199 |
| 1310 | Ga0501031_0054027 | 3300049568 | Bacteria | 2617 |
| 1311 | Ga0501032_0000052 | 3300049569 | Bacteria | 101001 |
| 1312 | Ga0501032_0000405 | 3300049569 | Bacteria | 35578 |
| 1313 | Ga0501032_0002093 | 3300049569 | Bacteria | 15734 |
| 1314 | Ga0501032_0006637 | 3300049569 | Bacteria | 8493 |
| 1315 | Ga0501032_0241970 | 3300049569 | Bacteria | 1172 |
| 1316 | Ga0501032_0280523 | 3300049569 | Bacteria | 1079 |
| 1317 | Ga0501032_0322733 | 3300049569 | Bacteria | 996 |
| 1318 | Ga0501032_1042480 | 3300049569 | Bacteria | 513 |
| 1319 | Ga0501033_0000868 | 3300049570 | Bacteria | 27644 |
| 1320 | Ga0501033_0186116 | 3300049570 | Bacteria | 1487 |
| 1321 | Ga0501034_0020741 | 3300049571 | Bacteria | 6708 |
| 1322 | Ga0501034_0023518 | 3300049571 | Bacteria | 6278 |
| 1323 | Ga0501034_0208155 | 3300049571 | Bacteria | 1912 |
| 1324 | Ga0501034_0211536 | 3300049571 | Bacteria | 1894 |
| 1325 | Ga0501034_0404494 | 3300049571 | Bacteria | 1287 |
| 1326 | Ga0501034_0405593 | 3300049571 | Bacteria | 1285 |
| 1327 | Ga0501034_0568947 | 3300049571 | Bacteria | 1041 |
| 1328 | Ga0501034_0590054 | 3300049571 | Bacteria | 1017 |
| 1329 | Ga0501034_1014454 | 3300049571 | Bacteria | 713 |
| 1330 | Ga0501036_0000061 | 3300049572 | Bacteria | 71856 |
| 1331 | Ga0501036_0087103 | 3300049572 | Bacteria | 2640 |
| 1332 | Ga0501036_0225369 | 3300049572 | Bacteria | 1573 |
| 1333 | Ga0501036_0468844 | 3300049572 | Bacteria | 1049 |
| 1334 | Ga0501037_0000046 | 3300049573 | Bacteria | 116524 |
| 1335 | Ga0501037_0001587 | 3300049573 | Bacteria | 16527 |
| 1336 | Ga0501037_0026512 | 3300049573 | Bacteria | 4284 |
| 1337 | Ga0501037_0036548 | 3300049573 | Bacteria | 3620 |
| 1338 | Ga0501037_0119965 | 3300049573 | Bacteria | 1891 |
| 1339 | Ga0501038_0000068 | 3300049574 | Bacteria | 84886 |
| 1340 | Ga0501038_0019942 | 3300049574 | Bacteria | 6035 |
| 1341 | Ga0501038_0038300 | 3300049574 | Bacteria | 4200 |
| 1342 | Ga0501038_0181392 | 3300049574 | Bacteria | 1698 |
| 1343 | Ga0501038_0331478 | 3300049574 | Bacteria | 1188 |
| 1344 | Ga0501038_0800196 | 3300049574 | Bacteria | 700 |
| 1345 | Ga0501039_0002827 | 3300049575 | Bacteria | 12975 |
| 1346 | Ga0501039_0063921 | 3300049575 | Bacteria | 2851 |
| 1347 | Ga0501039_0187739 | 3300049575 | Bacteria | 1625 |
| 1348 | Ga0501039_0502362 | 3300049575 | Bacteria | 952 |
| 1349 | Ga0501040_0047863 | 3300049576 | Bacteria | 2921 |
| 1350 | Ga0501040_0579034 | 3300049576 | Bacteria | 811 |
| 1351 | Ga0501041_0220280 | 3300049577 | Bacteria | 1191 |
| 1352 | Ga0501042_0624172 | 3300049578 | Bacteria | 784 |
| 1353 | Ga0501043_0000340 | 3300049579 | Bacteria | 42317 |
| 1354 | Ga0501043_0001210 | 3300049579 | Bacteria | 22716 |
| 1355 | Ga0501043_0007110 | 3300049579 | Bacteria | 8906 |
| 1356 | Ga0501043_0050924 | 3300049579 | Bacteria | 3255 |
| 1357 | Ga0501043_0082717 | 3300049579 | Bacteria | 2523 |
| 1358 | Ga0501043_0270763 | 3300049579 | Bacteria | 1304 |
| 1359 | Ga0501043_0877704 | 3300049579 | Bacteria | 644 |
| 1360 | Ga0501046_0000102 | 3300049580 | Bacteria | 89938 |
| 1361 | Ga0501047_0000460 | 3300049581 | Bacteria | 44894 |
| 1362 | Ga0501047_0011318 | 3300049581 | Bacteria | 8447 |
| 1363 | Ga0501047_0079667 | 3300049581 | Bacteria | 3149 |
| 1364 | Ga0501047_0095046 | 3300049581 | Bacteria | 2859 |
| 1365 | Ga0501048_0000006 | 3300049582 | Bacteria | 93252 |
| 1366 | Ga0501048_0944520 | 3300049582 | Bacteria | 620 |
| 1367 | Ga0501067_0416975 | 3300049583 | Bacteria | 749 |
| 1368 | Ga0501068_0008598 | 3300049584 | Bacteria | 5689 |
| 1369 | Ga0501069_0005251 | 3300049585 | Bacteria | 6725 |
| 1370 | Ga0501070_0000139 | 3300049586 | Bacteria | 65962 |
| 1371 | Ga0501070_0033551 | 3300049586 | Bacteria | 4296 |
| 1372 | Ga0501070_0097689 | 3300049586 | Bacteria | 2429 |
| 1373 | Ga0501070_0970605 | 3300049586 | Bacteria | 660 |
| 1374 | Ga0501070_1371719 | 3300049586 | Bacteria | 538 |
| 1375 | Ga0501071_0863419 | 3300049587 | Bacteria | 698 |
| 1376 | Ga0501072_0269920 | 3300049588 | Bacteria | 1354 |
| 1377 | Ga0501073_0038923 | 3300049589 | Bacteria | 3371 |
| 1378 | Ga0501073_0912721 | 3300049589 | Bacteria | 605 |
| 1379 | Ga0501073_1288810 | 3300049589 | Bacteria | 501 |
| 1380 | Ga0501074_0001182 | 3300049590 | Bacteria | 17129 |
| 1381 | Ga0501075_0035573 | 3300049591 | Bacteria | 3715 |
| 1382 | Ga0501075_1035878 | 3300049591 | Bacteria | 623 |
| 1383 | Ga0501076_1152484 | 3300049592 | Bacteria | 638 |
| 1384 | Ga0501202_182283 | 3300049652 | Bacteria | 567 |
| 1385 | Ga0501214_055591 | 3300049659 | Bacteria | 613 |
| 1386 | Ga0501227_211086 | 3300049665 | Bacteria | 551 |
| 1387 | Ga0501250_106589 | 3300049680 | Bacteria | 505 |
| 1388 | Ga0501261_019768 | 3300049690 | Bacteria | 959 |
| 1389 | Ga0501245_107218 | 3300049708 | Bacteria | 573 |
| 1390 | Ga0501079_0475247 | 3300049741 | Bacteria | 982 |
| 1391 | Ga0501079_0890292 | 3300049741 | Bacteria | 701 |
| 1392 | Ga0501080_0003170 | 3300049742 | Bacteria | 14496 |
| 1393 | Ga0501080_0240270 | 3300049742 | Bacteria | 1653 |
| 1394 | Ga0501080_0655899 | 3300049742 | Bacteria | 928 |
| 1395 | Ga0501081_0407581 | 3300049743 | Bacteria | 1007 |
| 1396 | Ga0501081_0708927 | 3300049743 | Bacteria | 756 |
| 1397 | Ga0501083_0010568 | 3300049744 | Bacteria | 6498 |
| 1398 | Ga0501083_0735121 | 3300049744 | Bacteria | 642 |
| 1399 | Ga0501268_061854 | 3300049765 | Bacteria | 743 |
| 1400 | Ga0501270_150251 | 3300049767 | Bacteria | 530 |
| 1401 | Ga0501273_084087 | 3300049770 | Bacteria | 533 |
| 1402 | Ga0501279_031763 | 3300049775 | Bacteria | 785 |
| 1403 | Ga0501279_082399 | 3300049775 | Bacteria | 557 |
| 1404 | Ga0501035_0005470 | 3300049822 | Bacteria | 12001 |
| 1405 | Ga0501035_0157529 | 3300049822 | Bacteria | 1967 |
| 1406 | Ga0501035_0455701 | 3300049822 | Bacteria | 1058 |
| 1407 | Ga0501035_0946228 | 3300049822 | Bacteria | 680 |
| 1408 | Ga0501044_0000137 | 3300049823 | Bacteria | 89352 |
| 1409 | Ga0501044_0032073 | 3300049823 | Bacteria | 5524 |
| 1410 | Ga0501044_0074896 | 3300049823 | Bacteria | 3438 |
| 1411 | Ga0501044_0238050 | 3300049823 | Bacteria | 1765 |
| 1412 | Ga0501044_0404331 | 3300049823 | Bacteria | 1277 |
| 1413 | Ga0501044_0476207 | 3300049823 | Bacteria | 1152 |
| 1414 | Ga0501044_1001269 | 3300049823 | Bacteria | 707 |
| 1415 | Ga0501044_1466551 | 3300049823 | Bacteria | 547 |
| 1416 | Ga0501045_0190180 | 3300049824 | Bacteria | 1530 |
| 1417 | Ga0501045_0413511 | 3300049824 | Bacteria | 1003 |
| 1418 | Ga0501212_104866 | 3300049851 | Bacteria | 534 |
| 1419 | Ga0501212_122104 | 3300049851 | Bacteria | 506 |
| 1420 | nmdc:mga03683_244489_c1 | 3300050489 | Bacteria | 832 |
| 1421 | nmdc:mga03683_259401_c1 | 3300050489 | Bacteria | 809 |
| 1422 | nmdc:mga03683_503106_c1 | 3300050489 | Bacteria | 587 |
| 1423 | nmdc:mga03683_92485_c1 | 3300050489 | Bacteria | 1320 |
| 1424 | nmdc:mga03n38_750373_c1 | 3300050490 | Bacteria | 565 |
| 1425 | nmdc:mga00v17_10944_c1 | 3300050491 | Bacteria | 4971 |
| 1426 | nmdc:mga00v17_196814_c1 | 3300050491 | Bacteria | 1302 |
| 1427 | nmdc:mga00v17_2871_c1 | 3300050491 | Bacteria | 8825 |
| 1428 | nmdc:mga00v17_544486_c1 | 3300050491 | Bacteria | 751 |
| 1429 | nmdc:mga00v17_701709_c1 | 3300050491 | Bacteria | 649 |
| 1430 | nmdc:mga0yw44_76203_c1 | 3300050492 | Bacteria | 2093 |
| 1431 | nmdc:mga0yw44_799152_c1 | 3300050492 | Bacteria | 641 |
| 1432 | nmdc:mga0yw44_926157_c1 | 3300050492 | Bacteria | 591 |
| 1433 | nmdc:mga0k408_336534_c1 | 3300050493 | Bacteria | 900 |
| 1434 | nmdc:mga06z11_690680_c1 | 3300050494 | Bacteria | 621 |
| 1435 | nmdc:mga04h51_284871_c1 | 3300050495 | Bacteria | 670 |
| 1436 | nmdc:mga07m45_132281_c2 | 3300050496 | Bacteria | 1143 |
| 1437 | nmdc:mga07m45_202524_c1 | 3300050496 | Bacteria | 1155 |
| 1438 | nmdc:mga07m45_289094_c1 | 3300050496 | Bacteria | 953 |
| 1439 | nmdc:mga07m45_43749_c1 | 3300050496 | Bacteria | 2511 |
| 1440 | nmdc:mga07m45_608452_c1 | 3300050496 | Bacteria | 631 |
| 1441 | nmdc:mga07m45_625951_c1 | 3300050496 | Bacteria | 621 |
| 1442 | nmdc:mga07m45_709601_c1 | 3300050496 | Bacteria | 578 |
| 1443 | nmdc:mga07m45_788412_c1 | 3300050496 | Bacteria | 545 |
| 1444 | nmdc:mga05p37_1862486_c1 | 3300050507 | Bacteria | 577 |
| 1445 | nmdc:mga06r32_211219_c1 | 3300050510 | Bacteria | 1928 |
| 1446 | nmdc:mga06r32_41763_c2 | 3300050510 | Bacteria | 2844 |
| 1447 | nmdc:mga0n895_65601_c1 | 3300050512 | Bacteria | 3594 |
| 1448 | nmdc:mga0n895_82086_c1 | 3300050512 | Bacteria | 3213 |
| 1449 | nmdc:mga0rr50_1547388_c1 | 3300050513 | Bacteria | 560 |
| 1450 | nmdc:mga0rr50_739426_c1 | 3300050513 | Bacteria | 840 |
| 1451 | nmdc:mga0rr50_97288_c1 | 3300050513 | Bacteria | 2304 |
| 1452 | nmdc:mga0a205_16343_c1 | 3300050515 | Bacteria | 6950 |
| 1453 | nmdc:mga0a205_36939_c1 | 3300050515 | Bacteria | 4696 |
| 1454 | nmdc:mga0a205_62517_c1 | 3300050515 | Bacteria | 3597 |
| 1455 | nmdc:mga0sz30_35896_c1 | 3300050516 | Bacteria | 2071 |
| 1456 | nmdc:mga0sz30_89013_c1 | 3300050516 | Bacteria | 1342 |
| 1457 | Ga0495601_0072154 | 3300053077 | Bacteria | 2205 |
| 1458 | Ga0495655_0262770 | 3300053083 | Bacteria | 583 |
| 1459 | Ga0495595_0022145 | 3300053084 | Bacteria | 2786 |
| 1460 | Ga0495619_0389739 | 3300053085 | Bacteria | 962 |
| 1461 | Ga0495619_1080713 | 3300053085 | Bacteria | 534 |
| 1462 | Ga0500578_0006193 | 3300053086 | Bacteria | 8032 |
| 1463 | Ga0500643_113661 | 3300053087 | Bacteria | 730 |
| 1464 | Ga0500644_0142328 | 3300053088 | Bacteria | 954 |
| 1465 | Ga0500583_0498343 | 3300053092 | Bacteria | 572 |
| 1466 | Ga0500651_0001759 | 3300053093 | Bacteria | 11078 |
| 1467 | Ga0500651_0104729 | 3300053093 | Bacteria | 1732 |
| 1468 | Ga0500651_0571555 | 3300053093 | Bacteria | 616 |
| 1469 | Ga0500641_0004090 | 3300053096 | Bacteria | 5150 |
| 1470 | Ga0500650_0058819 | 3300053098 | Bacteria | 1793 |
| 1471 | Ga0500650_0111097 | 3300053098 | Bacteria | 1279 |
| 1472 | Ga0500569_293315 | 3300053109 | Bacteria | 548 |
| 1473 | Ga0500628_174259 | 3300053129 | Bacteria | 612 |
| 1474 | Ga0500655_094324 | 3300053133 | Bacteria | 623 |
| 1475 | Ga0500655_132263 | 3300053133 | Bacteria | 533 |
| 1476 | Ga0500658_0006898 | 3300053134 | Bacteria | 4204 |
| 1477 | Ga0500559_0251206 | 3300053136 | Bacteria | 833 |
| 1478 | Ga0500564_198001 | 3300053138 | Bacteria | 827 |
| 1479 | Ga0500568_0065623 | 3300053139 | Bacteria | 1397 |
| 1480 | Ga0500568_0100324 | 3300053139 | Bacteria | 1086 |
| 1481 | Ga0500577_0228244 | 3300053142 | Bacteria | 807 |
| 1482 | Ga0500588_0039510 | 3300053146 | Bacteria | 1413 |
| 1483 | Ga0500588_0296993 | 3300053146 | Bacteria | 611 |
| 1484 | Ga0500590_004888 | 3300053148 | Bacteria | 6397 |
| 1485 | Ga0500604_0066940 | 3300053151 | Bacteria | 1139 |
| 1486 | Ga0500616_0000779 | 3300053153 | Bacteria | 36584 |
| 1487 | Ga0500620_000231 | 3300053155 | Bacteria | 11121 |
| 1488 | Ga0500622_0170332 | 3300053156 | Bacteria | 1014 |
| 1489 | Ga0500611_061588 | 3300053727 | Bacteria | 891 |
| 1490 | Ga0500645_065092 | 3300053730 | Unclassified | 1051 |
| 1491 | Ga0500609_001519 | 3300053731 | Bacteria | 3396 |
| 1492 | Ga0501084_0009305 | 3300054114 | Bacteria | 8132 |
| 1493 | Ga0501084_0680769 | 3300054114 | Bacteria | 868 |
| 1494 | Ga0590075_020432 | 3300059424 | Bacteria | 1648 |
| 1495 | Ga0587084_003200 | 3300059477 | Bacteria | 1780 |
| 1496 | Ga0587066_132392 | 3300059490 | Bacteria | 601 |
| 1497 | Ga0587070_064990 | 3300059491 | Bacteria | 764 |
| 1498 | Ga0587070_125303 | 3300059491 | Bacteria | 619 |
| 1499 | Ga0587077_033689 | 3300059493 | Bacteria | 991 |
| 1500 | Ga0587086_008561 | 3300059507 | Bacteria | 1198 |
| 1501 | Ga0587089_066535 | 3300059509 | Bacteria | 605 |
| 1502 | Ga0587090_000394 | 3300059510 | Bacteria | 3530 |
| 1503 | Ga0587090_110903 | 3300059510 | Bacteria | 585 |
| 1504 | Ga0587092_005257 | 3300059512 | Bacteria | 1588 |
| 1505 | Ga0587094_080005 | 3300059513 | Bacteria | 603 |
| 1506 | Ga0587095_021505 | 3300059514 | Bacteria | 622 |
| 1507 | Ga0587106_090973 | 3300059605 | Bacteria | 609 |
| 1508 | Ga0587101_001978 | 3300059623 | Bacteria | 1877 |
| 1509 | Ga0587101_005211 | 3300059623 | Bacteria | 1432 |
| 1510 | Ga0587115_070811 | 3300059626 | Bacteria | 602 |
| 1511 | Ga0587127_019179 | 3300059629 | Bacteria | 595 |
| 1512 | Ga0587128_000257 | 3300059630 | Bacteria | 3449 |
| 1513 | Ga0587128_130216 | 3300059630 | Bacteria | 556 |
| 1514 | Ga0587069_052982 | 3300059642 | Bacteria | 727 |
| 1515 | Ga0587072_001880 | 3300059643 | Bacteria | 2712 |
| 1516 | Ga0587079_209177 | 3300059647 | Bacteria | 536 |
| 1517 | Ga0587100_028874 | 3300059648 | Bacteria | 579 |
| 1518 | Ga0587114_075769 | 3300059655 | Bacteria | 617 |
| 1519 | Ga0587119_079381 | 3300059658 | Bacteria | 533 |
| 1520 | Ga0587124_000909 | 3300059660 | Bacteria | 1796 |
| 1521 | Ga0587111_0036985 | 3300060346 | Bacteria | 1024 |
| 1522 | Ga0587111_0141062 | 3300060346 | Bacteria | 639 |
| 1523 | Ga0501082_0293975 | 3300060353 | Bacteria | 1414 |
| 1524 | Ga0501082_1884698 | 3300060353 | Bacteria | 521 |
| 1525 | Ga0466962_0298012 | 3300061719 | Bacteria | 797 |
| 1526 | Ga0530510_0999317 | 3300061734 | Bacteria | 640 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221575 | 2643885133 | 63 |
| 2 | iso_pu_bacteria | 2643221616 | 2644097548 | 63 |
| 3 | iso_pu_bacteria | 2884763398 | 2884767173 | 63 |
| 4 | 3300014968 | Ga0157379_12674977 | Ga0157379_126749772 | 65 |
| 5 | 3300005617 | Ga0068859_102561908 | Ga0068859_1025619081 | 66 |
| 6 | 3300006931 | Ga0097620_102560380 | Ga0097620_1025603801 | 66 |
| 7 | 3300013307 | Ga0157372_11193779 | Ga0157372_111937791 | 66 |
| 8 | 3300014497 | Ga0182008_10011168 | Ga0182008_100111683 | 66 |
| 9 | 3300025912 | Ga0207707_10008724 | Ga0207707_100087242 | 66 |
| 10 | 3300025921 | Ga0207652_10454185 | Ga0207652_104541851 | 66 |
| 11 | 3300025928 | Ga0207700_11927573 | Ga0207700_119275731 | 66 |
| 12 | 3300028017 | Ga0265356_1028495 | Ga0265356_10284951 | 66 |
| 13 | 3300028800 | Ga0265338_10832195 | Ga0265338_108321951 | 66 |
| 14 | 3300030760 | Ga0265762_1010635 | Ga0265762_10106352 | 66 |
| 15 | 3300031249 | Ga0265339_10054864 | Ga0265339_100548641 | 66 |
| 16 | 3300031731 | Ga0307405_11570928 | Ga0307405_115709282 | 66 |
| 17 | 3300039438 | Ga0436360_0899858 | Ga0436360_0899858_148_351 | 66 |
| 18 | 3300039438 | Ga0436360_1315227 | Ga0436360_1315227_434_637 | 66 |
| 19 | 3300039447 | Ga0436361_0605533 | Ga0436361_0605533_318_521 | 66 |
| 20 | 3300039453 | Ga0436362_0225406 | Ga0436362_0225406_143_346 | 66 |
| 21 | 3300049568 | Ga0501031_0021571 | Ga0501031_0021571_26_229 | 66 |
| 22 | 3300049568 | Ga0501031_0054027 | Ga0501031_0054027_622_825 | 66 |
| 23 | 3300049569 | Ga0501032_0322733 | Ga0501032_0322733_223_426 | 66 |
| 24 | 3300049570 | Ga0501033_0186116 | Ga0501033_0186116_1242_1445 | 66 |
| 25 | 3300049571 | Ga0501034_0023518 | Ga0501034_0023518_899_1102 | 66 |
| 26 | 3300049571 | Ga0501034_0404494 | Ga0501034_0404494_1059_1262 | 66 |
| 27 | 3300049572 | Ga0501036_0225369 | Ga0501036_0225369_749_952 | 66 |
| 28 | 3300049573 | Ga0501037_0026512 | Ga0501037_0026512_3765_3968 | 66 |
| 29 | 3300049574 | Ga0501038_0181392 | Ga0501038_0181392_669_872 | 66 |
| 30 | 3300049574 | Ga0501038_0800196 | Ga0501038_0800196_26_229 | 66 |
| 31 | 3300049575 | Ga0501039_0502362 | Ga0501039_0502362_332_535 | 66 |
| 32 | 3300049579 | Ga0501043_0270763 | Ga0501043_0270763_752_955 | 66 |
| 33 | 3300049581 | Ga0501047_0095046 | Ga0501047_0095046_1802_2005 | 66 |
| 34 | 3300049586 | Ga0501070_0097689 | Ga0501070_0097689_1525_1728 | 66 |
| 35 | 3300049822 | Ga0501035_0157529 | Ga0501035_0157529_1261_1464 | 66 |
| 36 | 3300049823 | Ga0501044_0404331 | Ga0501044_0404331_27_230 | 66 |
| 37 | 3300049823 | Ga0501044_1001269 | Ga0501044_1001269_478_681 | 66 |
| 38 | 3300001979 | JGI24740J21852_10010643 | JGI24740J21852_100106433 | 67 |
| 39 | 3300001979 | JGI24740J21852_10017462 | JGI24740J21852_100174622 | 67 |
| 40 | 3300001979 | JGI24740J21852_10028179 | JGI24740J21852_100281793 | 67 |
| 41 | 3300001989 | JGI24739J22299_10209495 | JGI24739J22299_102094951 | 67 |
| 42 | 3300001991 | JGI24743J22301_10038481 | JGI24743J22301_100384814 | 67 |
| 43 | 3300002067 | JGI24735J21928_10099626 | JGI24735J21928_100996261 | 67 |
| 44 | 3300002067 | JGI24735J21928_10164583 | JGI24735J21928_101645831 | 67 |
| 45 | 3300002737 | JGI25162J39368_1005662 | JGI25162J39368_10056622 | 67 |
| 46 | 3300002772 | JGI25164J39214_1000246 | JGI25164J39214_100024620 | 67 |
| 47 | 3300002773 | JGI25152J39213_1000114 | JGI25152J39213_100011429 | 67 |
| 48 | 3300002870 | Ga0006763J43179_105502 | Ga0006763J43179_1055022 | 67 |
| 49 | 3300002872 | Ga0006762J43184_102431 | Ga0006762J43184_1024312 | 67 |
| 50 | 3300002987 | JGI25159J45721_1011959 | JGI25159J45721_10119591 | 67 |
| 51 | 3300003187 | JGI25151J46595_10000172 | JGI25151J46595_1000017296 | 67 |
| 52 | 3300003203 | JGI25406J46586_10192963 | JGI25406J46586_101929632 | 67 |
| 53 | 3300003214 | JGI25165J46597_1000005 | JGI25165J46597_1000005247 | 67 |
| 54 | 3300003308 | Ga0006777J48905_1010972 | Ga0006777J48905_10109721 | 67 |
| 55 | 3300003354 | JGI25160J50197_1028800 | JGI25160J50197_10288002 | 67 |
| 56 | 3300003578 | Ga0006562J51391_1002147 | Ga0006562J51391_10021471 | 67 |
| 57 | 3300003579 | Ga0007429J51699_1026596 | Ga0007429J51699_10265962 | 67 |
| 58 | 3300003693 | Ga0032354_1019578 | Ga0032354_10195781 | 67 |
| 59 | 3300003735 | Ga0006780_1011188 | Ga0006780_10111881 | 67 |
| 60 | 3300003752 | Ga0055539_1000019 | Ga0055539_1000019262 | 67 |
| 61 | 3300003756 | Ga0055533_1000023 | Ga0055533_100002363 | 67 |
| 62 | 3300003759 | Ga0055525_1000321 | Ga0055525_100032125 | 67 |
| 63 | 3300003762 | Ga0055542_1004061 | Ga0055542_10040612 | 67 |
| 64 | 3300003792 | Ga0055540_1000087 | Ga0055540_10000876 | 67 |
| 65 | 3300003792 | Ga0055540_1001311 | Ga0055540_100131110 | 67 |
| 66 | 3300003841 | Ga0055541_1003090 | Ga0055541_10030902 | 67 |
| 67 | 3300004785 | Ga0058858_1338063 | Ga0058858_13380631 | 67 |
| 68 | 3300004799 | Ga0058863_11610772 | Ga0058863_116107721 | 67 |
| 69 | 3300005288 | Ga0065714_10009230 | Ga0065714_100092304 | 67 |
| 70 | 3300005288 | Ga0065714_10044791 | Ga0065714_100447912 | 67 |
| 71 | 3300005288 | Ga0065714_10066919 | Ga0065714_100669195 | 67 |
| 72 | 3300005288 | Ga0065714_10117391 | Ga0065714_101173912 | 67 |
| 73 | 3300005288 | Ga0065714_10139660 | Ga0065714_101396602 | 67 |
| 74 | 3300005288 | Ga0065714_10445983 | Ga0065714_104459831 | 67 |
| 75 | 3300005289 | Ga0065704_10481833 | Ga0065704_104818332 | 67 |
| 76 | 3300005290 | Ga0065712_10014795 | Ga0065712_100147952 | 67 |
| 77 | 3300005295 | Ga0065707_10158208 | Ga0065707_101582081 | 67 |
| 78 | 3300005295 | Ga0065707_10159123 | Ga0065707_101591232 | 67 |
| 79 | 3300005295 | Ga0065707_10196937 | Ga0065707_101969373 | 67 |
| 80 | 3300005327 | Ga0070658_10013125 | Ga0070658_100131255 | 67 |
| 81 | 3300005327 | Ga0070658_11162531 | Ga0070658_111625311 | 67 |
| 82 | 3300005328 | Ga0070676_10012564 | Ga0070676_100125642 | 67 |
| 83 | 3300005329 | Ga0070683_100268548 | Ga0070683_1002685482 | 67 |
| 84 | 3300005330 | Ga0070690_100124921 | Ga0070690_1001249212 | 67 |
| 85 | 3300005330 | Ga0070690_100556928 | Ga0070690_1005569281 | 67 |
| 86 | 3300005331 | Ga0070670_100025937 | Ga0070670_1000259373 | 67 |
| 87 | 3300005331 | Ga0070670_100104770 | Ga0070670_1001047701 | 67 |
| 88 | 3300005331 | Ga0070670_101980494 | Ga0070670_1019804941 | 67 |
| 89 | 3300005333 | Ga0070677_10032889 | Ga0070677_100328892 | 67 |
| 90 | 3300005333 | Ga0070677_10099294 | Ga0070677_100992941 | 67 |
| 91 | 3300005333 | Ga0070677_10229723 | Ga0070677_102297232 | 67 |
| 92 | 3300005335 | Ga0070666_10011384 | Ga0070666_100113842 | 67 |
| 93 | 3300005335 | Ga0070666_10017527 | Ga0070666_100175272 | 67 |
| 94 | 3300005335 | Ga0070666_10059753 | Ga0070666_100597532 | 67 |
| 95 | 3300005335 | Ga0070666_10140399 | Ga0070666_101403993 | 67 |
| 96 | 3300005337 | Ga0070682_100033294 | Ga0070682_1000332941 | 67 |
| 97 | 3300005337 | Ga0070682_101989610 | Ga0070682_1019896101 | 67 |
| 98 | 3300005338 | Ga0068868_100241567 | Ga0068868_1002415673 | 67 |
| 99 | 3300005338 | Ga0068868_100568222 | Ga0068868_1005682222 | 67 |
| 100 | 3300005338 | Ga0068868_100653341 | Ga0068868_1006533412 | 67 |
| 101 | 3300005338 | Ga0068868_101084725 | Ga0068868_1010847252 | 67 |
| 102 | 3300005339 | Ga0070660_100475194 | Ga0070660_1004751941 | 67 |
| 103 | 3300005339 | Ga0070660_100666483 | Ga0070660_1006664831 | 67 |
| 104 | 3300005340 | Ga0070689_100018881 | Ga0070689_1000188818 | 67 |
| 105 | 3300005343 | Ga0070687_100538201 | Ga0070687_1005382012 | 67 |
| 106 | 3300005343 | Ga0070687_100595329 | Ga0070687_1005953291 | 67 |
| 107 | 3300005344 | Ga0070661_100020491 | Ga0070661_1000204913 | 67 |
| 108 | 3300005344 | Ga0070661_100616808 | Ga0070661_1006168081 | 67 |
| 109 | 3300005344 | Ga0070661_101076892 | Ga0070661_1010768921 | 67 |
| 110 | 3300005344 | Ga0070661_101421889 | Ga0070661_1014218892 | 67 |
| 111 | 3300005345 | Ga0070692_10145822 | Ga0070692_101458221 | 67 |
| 112 | 3300005345 | Ga0070692_10352415 | Ga0070692_103524152 | 67 |
| 113 | 3300005347 | Ga0070668_100269525 | Ga0070668_1002695253 | 67 |
| 114 | 3300005347 | Ga0070668_100364152 | Ga0070668_1003641522 | 67 |
| 115 | 3300005347 | Ga0070668_100404109 | Ga0070668_1004041091 | 67 |
| 116 | 3300005347 | Ga0070668_101502933 | Ga0070668_1015029331 | 67 |
| 117 | 3300005353 | Ga0070669_100010681 | Ga0070669_1000106813 | 67 |
| 118 | 3300005353 | Ga0070669_100250290 | Ga0070669_1002502902 | 67 |
| 119 | 3300005354 | Ga0070675_100012709 | Ga0070675_1000127093 | 67 |
| 120 | 3300005354 | Ga0070675_100590374 | Ga0070675_1005903742 | 67 |
| 121 | 3300005355 | Ga0070671_100050847 | Ga0070671_1000508472 | 67 |
| 122 | 3300005355 | Ga0070671_100103048 | Ga0070671_1001030484 | 67 |
| 123 | 3300005355 | Ga0070671_100122694 | Ga0070671_1001226941 | 67 |
| 124 | 3300005355 | Ga0070671_100134904 | Ga0070671_1001349043 | 67 |
| 125 | 3300005356 | Ga0070674_100210699 | Ga0070674_1002106992 | 67 |
| 126 | 3300005356 | Ga0070674_100249853 | Ga0070674_1002498532 | 67 |
| 127 | 3300005356 | Ga0070674_101439508 | Ga0070674_1014395081 | 67 |
| 128 | 3300005356 | Ga0070674_102093834 | Ga0070674_1020938341 | 67 |
| 129 | 3300005364 | Ga0070673_100225461 | Ga0070673_1002254613 | 67 |
| 130 | 3300005364 | Ga0070673_100391725 | Ga0070673_1003917252 | 67 |
| 131 | 3300005365 | Ga0070688_100342582 | Ga0070688_1003425822 | 67 |
| 132 | 3300005365 | Ga0070688_100775663 | Ga0070688_1007756631 | 67 |
| 133 | 3300005366 | Ga0070659_100000875 | Ga0070659_1000008755 | 67 |
| 134 | 3300005366 | Ga0070659_101029289 | Ga0070659_1010292892 | 67 |
| 135 | 3300005366 | Ga0070659_101599918 | Ga0070659_1015999181 | 67 |
| 136 | 3300005367 | Ga0070667_100000389 | Ga0070667_10000038923 | 67 |
| 137 | 3300005367 | Ga0070667_100017489 | Ga0070667_1000174895 | 67 |
| 138 | 3300005367 | Ga0070667_100043454 | Ga0070667_1000434544 | 67 |
| 139 | 3300005367 | Ga0070667_100469671 | Ga0070667_1004696712 | 67 |
| 140 | 3300005406 | Ga0070703_10103622 | Ga0070703_101036222 | 67 |
| 141 | 3300005434 | Ga0070709_10097774 | Ga0070709_100977742 | 67 |
| 142 | 3300005435 | Ga0070714_100000013 | Ga0070714_1000000134 | 67 |
| 143 | 3300005435 | Ga0070714_100271571 | Ga0070714_1002715713 | 67 |
| 144 | 3300005435 | Ga0070714_100381993 | Ga0070714_1003819932 | 67 |
| 145 | 3300005435 | Ga0070714_100965206 | Ga0070714_1009652061 | 67 |
| 146 | 3300005435 | Ga0070714_101282696 | Ga0070714_1012826962 | 67 |
| 147 | 3300005436 | Ga0070713_100080137 | Ga0070713_1000801375 | 67 |
| 148 | 3300005436 | Ga0070713_100111996 | Ga0070713_1001119962 | 67 |
| 149 | 3300005436 | Ga0070713_100429384 | Ga0070713_1004293842 | 67 |
| 150 | 3300005437 | Ga0070710_10000239 | Ga0070710_1000023922 | 67 |
| 151 | 3300005437 | Ga0070710_10011945 | Ga0070710_100119451 | 67 |
| 152 | 3300005438 | Ga0070701_10111753 | Ga0070701_101117532 | 67 |
| 153 | 3300005439 | Ga0070711_100173666 | Ga0070711_1001736663 | 67 |
| 154 | 3300005439 | Ga0070711_100579065 | Ga0070711_1005790652 | 67 |
| 155 | 3300005440 | Ga0070705_100022769 | Ga0070705_1000227696 | 67 |
| 156 | 3300005440 | Ga0070705_100085158 | Ga0070705_1000851583 | 67 |
| 157 | 3300005441 | Ga0070700_100091229 | Ga0070700_1000912293 | 67 |
| 158 | 3300005441 | Ga0070700_100666589 | Ga0070700_1006665891 | 67 |
| 159 | 3300005441 | Ga0070700_101169859 | Ga0070700_1011698592 | 67 |
| 160 | 3300005444 | Ga0070694_100077987 | Ga0070694_1000779873 | 67 |
| 161 | 3300005444 | Ga0070694_100079260 | Ga0070694_1000792602 | 67 |
| 162 | 3300005445 | Ga0070708_100042829 | Ga0070708_1000428292 | 67 |
| 163 | 3300005455 | Ga0070663_100057826 | Ga0070663_1000578262 | 67 |
| 164 | 3300005455 | Ga0070663_100379680 | Ga0070663_1003796801 | 67 |
| 165 | 3300005455 | Ga0070663_100884156 | Ga0070663_1008841562 | 67 |
| 166 | 3300005456 | Ga0070678_100129413 | Ga0070678_1001294133 | 67 |
| 167 | 3300005456 | Ga0070678_100535688 | Ga0070678_1005356881 | 67 |
| 168 | 3300005456 | Ga0070678_100684498 | Ga0070678_1006844982 | 67 |
| 169 | 3300005456 | Ga0070678_102259483 | Ga0070678_1022594832 | 67 |
| 170 | 3300005457 | Ga0070662_100000056 | Ga0070662_10000005617 | 67 |
| 171 | 3300005457 | Ga0070662_100046036 | Ga0070662_1000460364 | 67 |
| 172 | 3300005466 | Ga0070685_10471413 | Ga0070685_104714132 | 67 |
| 173 | 3300005466 | Ga0070685_10664713 | Ga0070685_106647131 | 67 |
| 174 | 3300005467 | Ga0070706_100042430 | Ga0070706_1000424303 | 67 |
| 175 | 3300005467 | Ga0070706_101377740 | Ga0070706_1013777401 | 67 |
| 176 | 3300005468 | Ga0070707_100035742 | Ga0070707_1000357427 | 67 |
| 177 | 3300005471 | Ga0070698_100022827 | Ga0070698_1000228277 | 67 |
| 178 | 3300005471 | Ga0070698_100219092 | Ga0070698_1002190922 | 67 |
| 179 | 3300005471 | Ga0070698_100631589 | Ga0070698_1006315891 | 67 |
| 180 | 3300005518 | Ga0070699_100000003 | Ga0070699_100000003115 | 67 |
| 181 | 3300005518 | Ga0070699_100140681 | Ga0070699_1001406814 | 67 |
| 182 | 3300005518 | Ga0070699_100548826 | Ga0070699_1005488262 | 67 |
| 183 | 3300005535 | Ga0070684_100775852 | Ga0070684_1007758522 | 67 |
| 184 | 3300005536 | Ga0070697_100034318 | Ga0070697_1000343183 | 67 |
| 185 | 3300005536 | Ga0070697_101074633 | Ga0070697_1010746331 | 67 |
| 186 | 3300005536 | Ga0070697_101468679 | Ga0070697_1014686792 | 67 |
| 187 | 3300005539 | Ga0068853_100000855 | Ga0068853_10000085511 | 67 |
| 188 | 3300005539 | Ga0068853_100130580 | Ga0068853_1001305801 | 67 |
| 189 | 3300005539 | Ga0068853_100170103 | Ga0068853_1001701032 | 67 |
| 190 | 3300005539 | Ga0068853_100310977 | Ga0068853_1003109772 | 67 |
| 191 | 3300005543 | Ga0070672_100091740 | Ga0070672_1000917402 | 67 |
| 192 | 3300005543 | Ga0070672_100691159 | Ga0070672_1006911592 | 67 |
| 193 | 3300005544 | Ga0070686_100151725 | Ga0070686_1001517252 | 67 |
| 194 | 3300005544 | Ga0070686_101457893 | Ga0070686_1014578931 | 67 |
| 195 | 3300005545 | Ga0070695_100251135 | Ga0070695_1002511352 | 67 |
| 196 | 3300005546 | Ga0070696_100085329 | Ga0070696_1000853293 | 67 |
| 197 | 3300005547 | Ga0070693_100559664 | Ga0070693_1005596642 | 67 |
| 198 | 3300005548 | Ga0070665_100066631 | Ga0070665_1000666315 | 67 |
| 199 | 3300005548 | Ga0070665_100133640 | Ga0070665_1001336402 | 67 |
| 200 | 3300005548 | Ga0070665_100412670 | Ga0070665_1004126702 | 67 |
| 201 | 3300005548 | Ga0070665_100857691 | Ga0070665_1008576911 | 67 |
| 202 | 3300005548 | Ga0070665_101083284 | Ga0070665_1010832842 | 67 |
| 203 | 3300005548 | Ga0070665_101788677 | Ga0070665_1017886771 | 67 |
| 204 | 3300005549 | Ga0070704_100108545 | Ga0070704_1001085452 | 67 |
| 205 | 3300005549 | Ga0070704_101485449 | Ga0070704_1014854491 | 67 |
| 206 | 3300005563 | Ga0068855_100379719 | Ga0068855_1003797192 | 67 |
| 207 | 3300005563 | Ga0068855_101528274 | Ga0068855_1015282742 | 67 |
| 208 | 3300005564 | Ga0070664_100344297 | Ga0070664_1003442972 | 67 |
| 209 | 3300005564 | Ga0070664_100948579 | Ga0070664_1009485791 | 67 |
| 210 | 3300005577 | Ga0068857_100036171 | Ga0068857_1000361714 | 67 |
| 211 | 3300005577 | Ga0068857_100218798 | Ga0068857_1002187982 | 67 |
| 212 | 3300005577 | Ga0068857_100290934 | Ga0068857_1002909342 | 67 |
| 213 | 3300005577 | Ga0068857_101698459 | Ga0068857_1016984591 | 67 |
| 214 | 3300005577 | Ga0068857_102242880 | Ga0068857_1022428801 | 67 |
| 215 | 3300005578 | Ga0068854_100153819 | Ga0068854_1001538192 | 67 |
| 216 | 3300005578 | Ga0068854_101530256 | Ga0068854_1015302561 | 67 |
| 217 | 3300005614 | Ga0068856_100044137 | Ga0068856_1000441371 | 67 |
| 218 | 3300005614 | Ga0068856_100254399 | Ga0068856_1002543992 | 67 |
| 219 | 3300005614 | Ga0068856_102651461 | Ga0068856_1026514612 | 67 |
| 220 | 3300005615 | Ga0070702_100011033 | Ga0070702_1000110333 | 67 |
| 221 | 3300005615 | Ga0070702_100217602 | Ga0070702_1002176022 | 67 |
| 222 | 3300005616 | Ga0068852_100028415 | Ga0068852_1000284154 | 67 |
| 223 | 3300005616 | Ga0068852_100039832 | Ga0068852_1000398324 | 67 |
| 224 | 3300005616 | Ga0068852_100723340 | Ga0068852_1007233402 | 67 |
| 225 | 3300005617 | Ga0068859_100043630 | Ga0068859_1000436303 | 67 |
| 226 | 3300005617 | Ga0068859_100110205 | Ga0068859_1001102053 | 67 |
| 227 | 3300005617 | Ga0068859_100113932 | Ga0068859_1001139326 | 67 |
| 228 | 3300005618 | Ga0068864_100067443 | Ga0068864_1000674433 | 67 |
| 229 | 3300005618 | Ga0068864_100069350 | Ga0068864_1000693503 | 67 |
| 230 | 3300005618 | Ga0068864_101680423 | Ga0068864_1016804231 | 67 |
| 231 | 3300005718 | Ga0068866_10618551 | Ga0068866_106185511 | 67 |
| 232 | 3300005719 | Ga0068861_100069899 | Ga0068861_1000698994 | 67 |
| 233 | 3300005719 | Ga0068861_100480381 | Ga0068861_1004803812 | 67 |
| 234 | 3300005719 | Ga0068861_102703278 | Ga0068861_1027032781 | 67 |
| 235 | 3300005834 | Ga0068851_10000003 | Ga0068851_10000003139 | 67 |
| 236 | 3300005834 | Ga0068851_10216563 | Ga0068851_102165632 | 67 |
| 237 | 3300005834 | Ga0068851_10559338 | Ga0068851_105593381 | 67 |
| 238 | 3300005834 | Ga0068851_10648484 | Ga0068851_106484842 | 67 |
| 239 | 3300005841 | Ga0068863_100017921 | Ga0068863_1000179217 | 67 |
| 240 | 3300005841 | Ga0068863_100025461 | Ga0068863_1000254616 | 67 |
| 241 | 3300005841 | Ga0068863_100152319 | Ga0068863_1001523193 | 67 |
| 242 | 3300005841 | Ga0068863_100205252 | Ga0068863_1002052522 | 67 |
| 243 | 3300005841 | Ga0068863_101419364 | Ga0068863_1014193643 | 67 |
| 244 | 3300005842 | Ga0068858_100000114 | Ga0068858_10000011426 | 67 |
| 245 | 3300005842 | Ga0068858_100469635 | Ga0068858_1004696351 | 67 |
| 246 | 3300005842 | Ga0068858_101395160 | Ga0068858_1013951602 | 67 |
| 247 | 3300005843 | Ga0068860_100001136 | Ga0068860_10000113631 | 67 |
| 248 | 3300005843 | Ga0068860_100236589 | Ga0068860_1002365894 | 67 |
| 249 | 3300005843 | Ga0068860_100575934 | Ga0068860_1005759342 | 67 |
| 250 | 3300005844 | Ga0068862_100003322 | Ga0068862_10000332216 | 67 |
| 251 | 3300005844 | Ga0068862_100630733 | Ga0068862_1006307332 | 67 |
| 252 | 3300005844 | Ga0068862_101847700 | Ga0068862_1018477002 | 67 |
| 253 | 3300005937 | Ga0081455_10011679 | Ga0081455_100116797 | 67 |
| 254 | 3300005937 | Ga0081455_10161957 | Ga0081455_101619573 | 67 |
| 255 | 3300005983 | Ga0081540_1040223 | Ga0081540_10402233 | 67 |
| 256 | 3300005985 | Ga0081539_10004731 | Ga0081539_1000473112 | 67 |
| 257 | 3300005985 | Ga0081539_10032362 | Ga0081539_100323624 | 67 |
| 258 | 3300005985 | Ga0081539_10074027 | Ga0081539_100740273 | 67 |
| 259 | 3300005985 | Ga0081539_10085308 | Ga0081539_100853084 | 67 |
| 260 | 3300006028 | Ga0070717_10104109 | Ga0070717_101041093 | 67 |
| 261 | 3300006028 | Ga0070717_10130641 | Ga0070717_101306414 | 67 |
| 262 | 3300006028 | Ga0070717_10175246 | Ga0070717_101752463 | 67 |
| 263 | 3300006028 | Ga0070717_10186462 | Ga0070717_101864622 | 67 |
| 264 | 3300006028 | Ga0070717_11097531 | Ga0070717_110975311 | 67 |
| 265 | 3300006028 | Ga0070717_11140921 | Ga0070717_111409213 | 67 |
| 266 | 3300006038 | Ga0075365_10256026 | Ga0075365_102560261 | 67 |
| 267 | 3300006038 | Ga0075365_10672555 | Ga0075365_106725552 | 67 |
| 268 | 3300006038 | Ga0075365_10952790 | Ga0075365_109527901 | 67 |
| 269 | 3300006038 | Ga0075365_11004403 | Ga0075365_110044032 | 67 |
| 270 | 3300006038 | Ga0075365_11099734 | Ga0075365_110997341 | 67 |
| 271 | 3300006048 | Ga0075363_100199466 | Ga0075363_1001994663 | 67 |
| 272 | 3300006048 | Ga0075363_100601948 | Ga0075363_1006019482 | 67 |
| 273 | 3300006048 | Ga0075363_100819783 | Ga0075363_1008197831 | 67 |
| 274 | 3300006048 | Ga0075363_101040550 | Ga0075363_1010405501 | 67 |
| 275 | 3300006051 | Ga0075364_10003345 | Ga0075364_100033458 | 67 |
| 276 | 3300006051 | Ga0075364_10141997 | Ga0075364_101419972 | 67 |
| 277 | 3300006051 | Ga0075364_10355480 | Ga0075364_103554802 | 67 |
| 278 | 3300006051 | Ga0075364_10493027 | Ga0075364_104930272 | 67 |
| 279 | 3300006051 | Ga0075364_10847603 | Ga0075364_108476031 | 67 |
| 280 | 3300006051 | Ga0075364_11028838 | Ga0075364_110288381 | 67 |
| 281 | 3300006051 | Ga0075364_11215528 | Ga0075364_112155282 | 67 |
| 282 | 3300006058 | Ga0075432_10001110 | Ga0075432_100011107 | 67 |
| 283 | 3300006058 | Ga0075432_10001540 | Ga0075432_100015406 | 67 |
| 284 | 3300006163 | Ga0070715_11083242 | Ga0070715_110832421 | 67 |
| 285 | 3300006173 | Ga0070716_100012511 | Ga0070716_1000125116 | 67 |
| 286 | 3300006173 | Ga0070716_100590170 | Ga0070716_1005901702 | 67 |
| 287 | 3300006173 | Ga0070716_101506368 | Ga0070716_1015063682 | 67 |
| 288 | 3300006175 | Ga0070712_100142880 | Ga0070712_1001428802 | 67 |
| 289 | 3300006175 | Ga0070712_102053512 | Ga0070712_1020535122 | 67 |
| 290 | 3300006177 | Ga0075362_10256512 | Ga0075362_102565121 | 67 |
| 291 | 3300006177 | Ga0075362_10304136 | Ga0075362_103041362 | 67 |
| 292 | 3300006177 | Ga0075362_10562911 | Ga0075362_105629111 | 67 |
| 293 | 3300006178 | Ga0075367_10106945 | Ga0075367_101069453 | 67 |
| 294 | 3300006178 | Ga0075367_10377506 | Ga0075367_103775062 | 67 |
| 295 | 3300006186 | Ga0075369_10059148 | Ga0075369_100591482 | 67 |
| 296 | 3300006195 | Ga0075366_10326752 | Ga0075366_103267521 | 67 |
| 297 | 3300006237 | Ga0097621_100018661 | Ga0097621_1000186618 | 67 |
| 298 | 3300006237 | Ga0097621_102313961 | Ga0097621_1023139612 | 67 |
| 299 | 3300006353 | Ga0075370_10018219 | Ga0075370_100182194 | 67 |
| 300 | 3300006353 | Ga0075370_10129004 | Ga0075370_101290043 | 67 |
| 301 | 3300006353 | Ga0075370_10227378 | Ga0075370_102273782 | 67 |
| 302 | 3300006353 | Ga0075370_10290289 | Ga0075370_102902891 | 67 |
| 303 | 3300006353 | Ga0075370_10436324 | Ga0075370_104363242 | 67 |
| 304 | 3300006358 | Ga0068871_100292952 | Ga0068871_1002929523 | 67 |
| 305 | 3300006358 | Ga0068871_102229816 | Ga0068871_1022298161 | 67 |
| 306 | 3300006844 | Ga0075428_100995376 | Ga0075428_1009953761 | 67 |
| 307 | 3300006847 | Ga0075431_100055591 | Ga0075431_1000555912 | 67 |
| 308 | 3300006847 | Ga0075431_100133936 | Ga0075431_1001339362 | 67 |
| 309 | 3300006847 | Ga0075431_101864641 | Ga0075431_1018646412 | 67 |
| 310 | 3300006852 | Ga0075433_10006838 | Ga0075433_100068383 | 67 |
| 311 | 3300006852 | Ga0075433_10056663 | Ga0075433_100566632 | 67 |
| 312 | 3300006852 | Ga0075433_10188363 | Ga0075433_101883633 | 67 |
| 313 | 3300006871 | Ga0075434_100067699 | Ga0075434_1000676993 | 67 |
| 314 | 3300006871 | Ga0075434_100134546 | Ga0075434_1001345463 | 67 |
| 315 | 3300006881 | Ga0068865_100385951 | Ga0068865_1003859514 | 67 |
| 316 | 3300006881 | Ga0068865_100513179 | Ga0068865_1005131794 | 67 |
| 317 | 3300006914 | Ga0075436_100254738 | Ga0075436_1002547384 | 67 |
| 318 | 3300006931 | Ga0097620_100043629 | Ga0097620_1000436293 | 67 |
| 319 | 3300006931 | Ga0097620_100110207 | Ga0097620_1001102073 | 67 |
| 320 | 3300006931 | Ga0097620_100113924 | Ga0097620_1001139246 | 67 |
| 321 | 3300007076 | Ga0075435_100052021 | Ga0075435_1000520212 | 67 |
| 322 | 3300007265 | Ga0099794_10280778 | Ga0099794_102807783 | 67 |
| 323 | 3300007788 | Ga0099795_10003109 | Ga0099795_100031093 | 67 |
| 324 | 3300009011 | Ga0105251_10298728 | Ga0105251_102987281 | 67 |
| 325 | 3300009011 | Ga0105251_10506754 | Ga0105251_105067542 | 67 |
| 326 | 3300009036 | Ga0105244_10383444 | Ga0105244_103834442 | 67 |
| 327 | 3300009092 | Ga0105250_10321285 | Ga0105250_103212851 | 67 |
| 328 | 3300009093 | Ga0105240_10001674 | Ga0105240_1000167412 | 67 |
| 329 | 3300009093 | Ga0105240_10075070 | Ga0105240_100750702 | 67 |
| 330 | 3300009093 | Ga0105240_10083169 | Ga0105240_100831692 | 67 |
| 331 | 3300009093 | Ga0105240_10343760 | Ga0105240_103437603 | 67 |
| 332 | 3300009093 | Ga0105240_10547016 | Ga0105240_105470162 | 67 |
| 333 | 3300009098 | Ga0105245_10123391 | Ga0105245_101233912 | 67 |
| 334 | 3300009098 | Ga0105245_10163980 | Ga0105245_101639802 | 67 |
| 335 | 3300009098 | Ga0105245_10193143 | Ga0105245_101931431 | 67 |
| 336 | 3300009098 | Ga0105245_10194690 | Ga0105245_101946904 | 67 |
| 337 | 3300009098 | Ga0105245_10458861 | Ga0105245_104588611 | 67 |
| 338 | 3300009098 | Ga0105245_10914994 | Ga0105245_109149943 | 67 |
| 339 | 3300009101 | Ga0105247_10160865 | Ga0105247_101608652 | 67 |
| 340 | 3300009101 | Ga0105247_11816051 | Ga0105247_118160511 | 67 |
| 341 | 3300009147 | Ga0114129_10352904 | Ga0114129_103529045 | 67 |
| 342 | 3300009147 | Ga0114129_11642911 | Ga0114129_116429111 | 67 |
| 343 | 3300009148 | Ga0105243_10127253 | Ga0105243_101272533 | 67 |
| 344 | 3300009148 | Ga0105243_10327527 | Ga0105243_103275271 | 67 |
| 345 | 3300009148 | Ga0105243_10589302 | Ga0105243_105893022 | 67 |
| 346 | 3300009148 | Ga0105243_10867679 | Ga0105243_108676791 | 67 |
| 347 | 3300009148 | Ga0105243_11021698 | Ga0105243_110216982 | 67 |
| 348 | 3300009174 | Ga0105241_10099103 | Ga0105241_100991033 | 67 |
| 349 | 3300009174 | Ga0105241_10238058 | Ga0105241_102380582 | 67 |
| 350 | 3300009176 | Ga0105242_10028632 | Ga0105242_100286324 | 67 |
| 351 | 3300009176 | Ga0105242_10110705 | Ga0105242_101107052 | 67 |
| 352 | 3300009176 | Ga0105242_10165046 | Ga0105242_101650463 | 67 |
| 353 | 3300009177 | Ga0105248_10015196 | Ga0105248_100151964 | 67 |
| 354 | 3300009177 | Ga0105248_10172691 | Ga0105248_101726913 | 67 |
| 355 | 3300009177 | Ga0105248_10315207 | Ga0105248_103152072 | 67 |
| 356 | 3300009545 | Ga0105237_10197968 | Ga0105237_101979683 | 67 |
| 357 | 3300009545 | Ga0105237_10283994 | Ga0105237_102839941 | 67 |
| 358 | 3300009545 | Ga0105237_10937803 | Ga0105237_109378031 | 67 |
| 359 | 3300009545 | Ga0105237_12154879 | Ga0105237_121548791 | 67 |
| 360 | 3300009551 | Ga0105238_10123243 | Ga0105238_101232433 | 67 |
| 361 | 3300009551 | Ga0105238_11724987 | Ga0105238_117249872 | 67 |
| 362 | 3300009551 | Ga0105238_11914525 | Ga0105238_119145252 | 67 |
| 363 | 3300009551 | Ga0105238_11942143 | Ga0105238_119421431 | 67 |
| 364 | 3300009551 | Ga0105238_12036507 | Ga0105238_120365071 | 67 |
| 365 | 3300009551 | Ga0105238_13063567 | Ga0105238_130635671 | 67 |
| 366 | 3300009553 | Ga0105249_10057208 | Ga0105249_100572083 | 67 |
| 367 | 3300009553 | Ga0105249_11542253 | Ga0105249_115422532 | 67 |
| 368 | 3300010159 | Ga0099796_10078087 | Ga0099796_100780873 | 67 |
| 369 | 3300010375 | Ga0105239_10123750 | Ga0105239_101237502 | 67 |
| 370 | 3300010375 | Ga0105239_10261619 | Ga0105239_102616191 | 67 |
| 371 | 3300010375 | Ga0105239_10285489 | Ga0105239_102854891 | 67 |
| 372 | 3300010375 | Ga0105239_10901767 | Ga0105239_109017672 | 67 |
| 373 | 3300010375 | Ga0105239_11306118 | Ga0105239_113061182 | 67 |
| 374 | 3300010375 | Ga0105239_12235461 | Ga0105239_122354611 | 67 |
| 375 | 3300011119 | Ga0105246_10002237 | Ga0105246_100022378 | 67 |
| 376 | 3300011119 | Ga0105246_10021144 | Ga0105246_100211441 | 67 |
| 377 | 3300011119 | Ga0105246_10062191 | Ga0105246_100621912 | 67 |
| 378 | 3300011119 | Ga0105246_10086326 | Ga0105246_100863263 | 67 |
| 379 | 3300011119 | Ga0105246_10159254 | Ga0105246_101592542 | 67 |
| 380 | 3300011119 | Ga0105246_10324169 | Ga0105246_103241692 | 67 |
| 381 | 3300011119 | Ga0105246_10691200 | Ga0105246_106912001 | 67 |
| 382 | 3300011119 | Ga0105246_11031499 | Ga0105246_110314992 | 67 |
| 383 | 3300011119 | Ga0105246_11418456 | Ga0105246_114184561 | 67 |
| 384 | 3300013100 | Ga0157373_10012518 | Ga0157373_100125185 | 67 |
| 385 | 3300013100 | Ga0157373_10182921 | Ga0157373_101829211 | 67 |
| 386 | 3300013100 | Ga0157373_10424749 | Ga0157373_104247491 | 67 |
| 387 | 3300013100 | Ga0157373_10680666 | Ga0157373_106806662 | 67 |
| 388 | 3300013102 | Ga0157371_10005274 | Ga0157371_100052748 | 67 |
| 389 | 3300013102 | Ga0157371_10230458 | Ga0157371_102304583 | 67 |
| 390 | 3300013102 | Ga0157371_10375366 | Ga0157371_103753663 | 67 |
| 391 | 3300013102 | Ga0157371_10528770 | Ga0157371_105287702 | 67 |
| 392 | 3300013102 | Ga0157371_10705786 | Ga0157371_107057862 | 67 |
| 393 | 3300013102 | Ga0157371_10747911 | Ga0157371_107479111 | 67 |
| 394 | 3300013104 | Ga0157370_10001466 | Ga0157370_1000146625 | 67 |
| 395 | 3300013104 | Ga0157370_10153691 | Ga0157370_101536912 | 67 |
| 396 | 3300013104 | Ga0157370_10539497 | Ga0157370_105394972 | 67 |
| 397 | 3300013104 | Ga0157370_10774986 | Ga0157370_107749862 | 67 |
| 398 | 3300013104 | Ga0157370_11440189 | Ga0157370_114401891 | 67 |
| 399 | 3300013104 | Ga0157370_11895228 | Ga0157370_118952281 | 67 |
| 400 | 3300013105 | Ga0157369_10039429 | Ga0157369_100394294 | 67 |
| 401 | 3300013105 | Ga0157369_10166239 | Ga0157369_101662392 | 67 |
| 402 | 3300013105 | Ga0157369_10783074 | Ga0157369_107830741 | 67 |
| 403 | 3300013105 | Ga0157369_10784953 | Ga0157369_107849532 | 67 |
| 404 | 3300013105 | Ga0157369_11496108 | Ga0157369_114961081 | 67 |
| 405 | 3300013105 | Ga0157369_11793463 | Ga0157369_117934632 | 67 |
| 406 | 3300013296 | Ga0157374_10000337 | Ga0157374_100003379 | 67 |
| 407 | 3300013296 | Ga0157374_10263709 | Ga0157374_102637092 | 67 |
| 408 | 3300013297 | Ga0157378_10015607 | Ga0157378_100156072 | 67 |
| 409 | 3300013297 | Ga0157378_10070642 | Ga0157378_100706424 | 67 |
| 410 | 3300013297 | Ga0157378_10208506 | Ga0157378_102085062 | 67 |
| 411 | 3300013297 | Ga0157378_11447242 | Ga0157378_114472422 | 67 |
| 412 | 3300013306 | Ga0163162_10324336 | Ga0163162_103243362 | 67 |
| 413 | 3300013306 | Ga0163162_10533590 | Ga0163162_105335902 | 67 |
| 414 | 3300013306 | Ga0163162_10792386 | Ga0163162_107923861 | 67 |
| 415 | 3300013307 | Ga0157372_10873466 | Ga0157372_108734662 | 67 |
| 416 | 3300013307 | Ga0157372_10876808 | Ga0157372_108768083 | 67 |
| 417 | 3300013307 | Ga0157372_11093042 | Ga0157372_110930422 | 67 |
| 418 | 3300013307 | Ga0157372_12214052 | Ga0157372_122140522 | 67 |
| 419 | 3300013307 | Ga0157372_13081839 | Ga0157372_130818391 | 67 |
| 420 | 3300013308 | Ga0157375_10024616 | Ga0157375_100246163 | 67 |
| 421 | 3300013308 | Ga0157375_10636782 | Ga0157375_106367821 | 67 |
| 422 | 3300013308 | Ga0157375_12396421 | Ga0157375_123964211 | 67 |
| 423 | 3300014325 | Ga0163163_10021218 | Ga0163163_100212182 | 67 |
| 424 | 3300014325 | Ga0163163_10061827 | Ga0163163_100618274 | 67 |
| 425 | 3300014325 | Ga0163163_10384717 | Ga0163163_103847171 | 67 |
| 426 | 3300014325 | Ga0163163_10833465 | Ga0163163_108334651 | 67 |
| 427 | 3300014325 | Ga0163163_12071330 | Ga0163163_120713301 | 67 |
| 428 | 3300014325 | Ga0163163_12829085 | Ga0163163_128290851 | 67 |
| 429 | 3300014325 | Ga0163163_12913425 | Ga0163163_129134251 | 67 |
| 430 | 3300014326 | Ga0157380_10695307 | Ga0157380_106953072 | 67 |
| 431 | 3300014326 | Ga0157380_11907696 | Ga0157380_119076961 | 67 |
| 432 | 3300014326 | Ga0157380_11951655 | Ga0157380_119516552 | 67 |
| 433 | 3300014326 | Ga0157380_12187982 | Ga0157380_121879821 | 67 |
| 434 | 3300014497 | Ga0182008_10133121 | Ga0182008_101331212 | 67 |
| 435 | 3300014497 | Ga0182008_10731959 | Ga0182008_107319591 | 67 |
| 436 | 3300014745 | Ga0157377_11611487 | Ga0157377_116114871 | 67 |
| 437 | 3300014968 | Ga0157379_10060551 | Ga0157379_100605511 | 67 |
| 438 | 3300014968 | Ga0157379_10667602 | Ga0157379_106676021 | 67 |
| 439 | 3300014968 | Ga0157379_10756072 | Ga0157379_107560722 | 67 |
| 440 | 3300014969 | Ga0157376_10014760 | Ga0157376_100147601 | 67 |
| 441 | 3300014969 | Ga0157376_10340710 | Ga0157376_103407102 | 67 |
| 442 | 3300014969 | Ga0157376_10774504 | Ga0157376_107745042 | 67 |
| 443 | 3300014969 | Ga0157376_13090627 | Ga0157376_130906271 | 67 |
| 444 | 3300017792 | Ga0163161_10246130 | Ga0163161_102461301 | 67 |
| 445 | 3300019162 | Ga0184597_116904 | Ga0184597_1169042 | 67 |
| 446 | 3300019166 | Ga0184595_117929 | Ga0184595_1179291 | 67 |
| 447 | 3300019188 | Ga0184599_135484 | Ga0184599_1354842 | 67 |
| 448 | 3300020069 | Ga0197907_11039717 | Ga0197907_110397172 | 67 |
| 449 | 3300020069 | Ga0197907_11415606 | Ga0197907_114156062 | 67 |
| 450 | 3300020070 | Ga0206356_11762204 | Ga0206356_117622042 | 67 |
| 451 | 3300020076 | Ga0206355_1509001 | Ga0206355_15090012 | 67 |
| 452 | 3300020078 | Ga0206352_10996824 | Ga0206352_109968242 | 67 |
| 453 | 3300020080 | Ga0206350_10969978 | Ga0206350_109699782 | 67 |
| 454 | 3300020080 | Ga0206350_11360594 | Ga0206350_113605941 | 67 |
| 455 | 3300020081 | Ga0206354_11072124 | Ga0206354_110721242 | 67 |
| 456 | 3300020081 | Ga0206354_11207445 | Ga0206354_112074452 | 67 |
| 457 | 3300020081 | Ga0206354_11286028 | Ga0206354_112860281 | 67 |
| 458 | 3300020082 | Ga0206353_10573202 | Ga0206353_105732022 | 67 |
| 459 | 3300020082 | Ga0206353_11713086 | Ga0206353_117130862 | 67 |
| 460 | 3300020610 | Ga0154015_1239549 | Ga0154015_12395492 | 67 |
| 461 | 3300021361 | Ga0213872_10068875 | Ga0213872_100688753 | 67 |
| 462 | 3300021384 | Ga0213876_10044095 | Ga0213876_100440952 | 67 |
| 463 | 3300021384 | Ga0213876_10209239 | Ga0213876_102092392 | 67 |
| 464 | 3300021384 | Ga0213876_10606923 | Ga0213876_106069231 | 67 |
| 465 | 3300021388 | Ga0213875_10240368 | Ga0213875_102403682 | 67 |
| 466 | 3300022467 | Ga0224712_10565085 | Ga0224712_105650851 | 67 |
| 467 | 3300025225 | Ga0209566_100031 | Ga0209566_10003163 | 67 |
| 468 | 3300025226 | Ga0209674_100001 | Ga0209674_1000012088 | 67 |
| 469 | 3300025230 | Ga0209563_100001 | Ga0209563_1000012088 | 67 |
| 470 | 3300025230 | Ga0209563_100205 | Ga0209563_10020523 | 67 |
| 471 | 3300025231 | Ga0207427_100024 | Ga0207427_100024361 | 67 |
| 472 | 3300025233 | Ga0209437_100467 | Ga0209437_10046721 | 67 |
| 473 | 3300025245 | Ga0207425_1000100 | Ga0207425_10001005 | 67 |
| 474 | 3300025245 | Ga0207425_1005944 | Ga0207425_10059442 | 67 |
| 475 | 3300025253 | Ga0209677_100001 | Ga0209677_1000012088 | 67 |
| 476 | 3300025254 | Ga0209148_1000702 | Ga0209148_100070221 | 67 |
| 477 | 3300025254 | Ga0209148_1002471 | Ga0209148_10024713 | 67 |
| 478 | 3300025256 | Ga0209759_1028627 | Ga0209759_10286272 | 67 |
| 479 | 3300025258 | Ga0209129_1000028 | Ga0209129_1000028181 | 67 |
| 480 | 3300025258 | Ga0209129_1000191 | Ga0209129_10001915 | 67 |
| 481 | 3300025261 | Ga0209233_1000001 | Ga0209233_1000001403 | 67 |
| 482 | 3300025263 | Ga0209565_1084707 | Ga0209565_10847071 | 67 |
| 483 | 3300025272 | Ga0209455_1003427 | Ga0209455_10034273 | 67 |
| 484 | 3300025273 | Ga0209673_1019086 | Ga0209673_10190862 | 67 |
| 485 | 3300025284 | Ga0209130_1000358 | Ga0209130_100035836 | 67 |
| 486 | 3300025294 | Ga0209025_1000112 | Ga0209025_100011289 | 67 |
| 487 | 3300025294 | Ga0209025_1000427 | Ga0209025_10004275 | 67 |
| 488 | 3300025297 | Ga0209758_1000352 | Ga0209758_100035288 | 67 |
| 489 | 3300025302 | Ga0207426_1001302 | Ga0207426_10013026 | 67 |
| 490 | 3300025303 | Ga0209051_1000014 | Ga0209051_100001460 | 67 |
| 491 | 3300025303 | Ga0209051_1000546 | Ga0209051_100054629 | 67 |
| 492 | 3300025303 | Ga0209051_1001222 | Ga0209051_10012225 | 67 |
| 493 | 3300025303 | Ga0209051_1001430 | Ga0209051_10014304 | 67 |
| 494 | 3300025303 | Ga0209051_1029296 | Ga0209051_10292962 | 67 |
| 495 | 3300025303 | Ga0209051_1089221 | Ga0209051_10892212 | 67 |
| 496 | 3300025303 | Ga0209051_1091111 | Ga0209051_10911111 | 67 |
| 497 | 3300025315 | Ga0207697_10011855 | Ga0207697_100118552 | 67 |
| 498 | 3300025315 | Ga0207697_10016522 | Ga0207697_100165222 | 67 |
| 499 | 3300025315 | Ga0207697_10057166 | Ga0207697_100571661 | 67 |
| 500 | 3300025315 | Ga0207697_10474123 | Ga0207697_104741231 | 67 |
| 501 | 3300025321 | Ga0207656_10000002 | Ga0207656_1000000298 | 67 |
| 502 | 3300025321 | Ga0207656_10259561 | Ga0207656_102595611 | 67 |
| 503 | 3300025728 | Ga0207655_1003093 | Ga0207655_10030932 | 67 |
| 504 | 3300025728 | Ga0207655_1004839 | Ga0207655_10048391 | 67 |
| 505 | 3300025728 | Ga0207655_1005444 | Ga0207655_10054443 | 67 |
| 506 | 3300025735 | Ga0207713_1055246 | Ga0207713_10552461 | 67 |
| 507 | 3300025885 | Ga0207653_10009297 | Ga0207653_100092973 | 67 |
| 508 | 3300025893 | Ga0207682_10008648 | Ga0207682_100086484 | 67 |
| 509 | 3300025898 | Ga0207692_10016869 | Ga0207692_100168692 | 67 |
| 510 | 3300025898 | Ga0207692_10458843 | Ga0207692_104588431 | 67 |
| 511 | 3300025899 | Ga0207642_10444589 | Ga0207642_104445891 | 67 |
| 512 | 3300025900 | Ga0207710_10004760 | Ga0207710_100047609 | 67 |
| 513 | 3300025900 | Ga0207710_10065858 | Ga0207710_100658582 | 67 |
| 514 | 3300025900 | Ga0207710_10067040 | Ga0207710_100670402 | 67 |
| 515 | 3300025901 | Ga0207688_10007435 | Ga0207688_100074353 | 67 |
| 516 | 3300025901 | Ga0207688_10363148 | Ga0207688_103631481 | 67 |
| 517 | 3300025903 | Ga0207680_10006719 | Ga0207680_100067195 | 67 |
| 518 | 3300025903 | Ga0207680_10006982 | Ga0207680_100069822 | 67 |
| 519 | 3300025904 | Ga0207647_10015036 | Ga0207647_100150362 | 67 |
| 520 | 3300025904 | Ga0207647_10075384 | Ga0207647_100753841 | 67 |
| 521 | 3300025905 | Ga0207685_10840279 | Ga0207685_108402791 | 67 |
| 522 | 3300025906 | Ga0207699_10167321 | Ga0207699_101673213 | 67 |
| 523 | 3300025907 | Ga0207645_10017244 | Ga0207645_100172444 | 67 |
| 524 | 3300025908 | Ga0207643_10126509 | Ga0207643_101265092 | 67 |
| 525 | 3300025908 | Ga0207643_11031773 | Ga0207643_110317731 | 67 |
| 526 | 3300025909 | Ga0207705_10037465 | Ga0207705_100374653 | 67 |
| 527 | 3300025909 | Ga0207705_10140911 | Ga0207705_101409112 | 67 |
| 528 | 3300025909 | Ga0207705_11014991 | Ga0207705_110149911 | 67 |
| 529 | 3300025910 | Ga0207684_10015324 | Ga0207684_100153247 | 67 |
| 530 | 3300025911 | Ga0207654_10000001 | Ga0207654_100000011757 | 67 |
| 531 | 3300025911 | Ga0207654_10486723 | Ga0207654_104867232 | 67 |
| 532 | 3300025913 | Ga0207695_10002367 | Ga0207695_1000236728 | 67 |
| 533 | 3300025913 | Ga0207695_10007138 | Ga0207695_100071385 | 67 |
| 534 | 3300025914 | Ga0207671_10000002 | Ga0207671_10000002392 | 67 |
| 535 | 3300025914 | Ga0207671_10049308 | Ga0207671_100493083 | 67 |
| 536 | 3300025914 | Ga0207671_10063749 | Ga0207671_100637491 | 67 |
| 537 | 3300025914 | Ga0207671_10891702 | Ga0207671_108917021 | 67 |
| 538 | 3300025915 | Ga0207693_10018369 | Ga0207693_100183693 | 67 |
| 539 | 3300025915 | Ga0207693_10246628 | Ga0207693_102466283 | 67 |
| 540 | 3300025916 | Ga0207663_11423790 | Ga0207663_114237901 | 67 |
| 541 | 3300025917 | Ga0207660_10650228 | Ga0207660_106502281 | 67 |
| 542 | 3300025917 | Ga0207660_11521208 | Ga0207660_115212081 | 67 |
| 543 | 3300025918 | Ga0207662_10387285 | Ga0207662_103872852 | 67 |
| 544 | 3300025918 | Ga0207662_10461371 | Ga0207662_104613713 | 67 |
| 545 | 3300025919 | Ga0207657_10016812 | Ga0207657_100168122 | 67 |
| 546 | 3300025919 | Ga0207657_10157641 | Ga0207657_101576413 | 67 |
| 547 | 3300025919 | Ga0207657_10683727 | Ga0207657_106837271 | 67 |
| 548 | 3300025920 | Ga0207649_10366280 | Ga0207649_103662802 | 67 |
| 549 | 3300025920 | Ga0207649_10476235 | Ga0207649_104762352 | 67 |
| 550 | 3300025920 | Ga0207649_11539091 | Ga0207649_115390911 | 67 |
| 551 | 3300025922 | Ga0207646_10008173 | Ga0207646_1000817318 | 67 |
| 552 | 3300025923 | Ga0207681_10199759 | Ga0207681_101997593 | 67 |
| 553 | 3300025923 | Ga0207681_10938174 | Ga0207681_109381741 | 67 |
| 554 | 3300025924 | Ga0207694_10000656 | Ga0207694_1000065628 | 67 |
| 555 | 3300025924 | Ga0207694_10297320 | Ga0207694_102973203 | 67 |
| 556 | 3300025924 | Ga0207694_11874675 | Ga0207694_118746751 | 67 |
| 557 | 3300025925 | Ga0207650_10011784 | Ga0207650_100117843 | 67 |
| 558 | 3300025925 | Ga0207650_10305848 | Ga0207650_103058482 | 67 |
| 559 | 3300025925 | Ga0207650_10512872 | Ga0207650_105128722 | 67 |
| 560 | 3300025926 | Ga0207659_10368084 | Ga0207659_103680842 | 67 |
| 561 | 3300025926 | Ga0207659_11812915 | Ga0207659_118129151 | 67 |
| 562 | 3300025927 | Ga0207687_10058985 | Ga0207687_100589854 | 67 |
| 563 | 3300025927 | Ga0207687_10060554 | Ga0207687_100605542 | 67 |
| 564 | 3300025927 | Ga0207687_10083104 | Ga0207687_100831043 | 67 |
| 565 | 3300025927 | Ga0207687_10093319 | Ga0207687_100933193 | 67 |
| 566 | 3300025927 | Ga0207687_10169610 | Ga0207687_101696101 | 67 |
| 567 | 3300025928 | Ga0207700_10420644 | Ga0207700_104206441 | 67 |
| 568 | 3300025928 | Ga0207700_10497764 | Ga0207700_104977641 | 67 |
| 569 | 3300025928 | Ga0207700_10558393 | Ga0207700_105583932 | 67 |
| 570 | 3300025928 | Ga0207700_10789354 | Ga0207700_107893541 | 67 |
| 571 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001510 | 67 |
| 572 | 3300025929 | Ga0207664_10829357 | Ga0207664_108293572 | 67 |
| 573 | 3300025929 | Ga0207664_10923512 | Ga0207664_109235121 | 67 |
| 574 | 3300025929 | Ga0207664_10951558 | Ga0207664_109515582 | 67 |
| 575 | 3300025929 | Ga0207664_11617916 | Ga0207664_116179161 | 67 |
| 576 | 3300025931 | Ga0207644_10020676 | Ga0207644_100206762 | 67 |
| 577 | 3300025931 | Ga0207644_10036195 | Ga0207644_100361954 | 67 |
| 578 | 3300025931 | Ga0207644_10166907 | Ga0207644_101669073 | 67 |
| 579 | 3300025931 | Ga0207644_10461593 | Ga0207644_104615931 | 67 |
| 580 | 3300025932 | Ga0207690_10008330 | Ga0207690_100083305 | 67 |
| 581 | 3300025932 | Ga0207690_10730812 | Ga0207690_107308121 | 67 |
| 582 | 3300025933 | Ga0207706_10003017 | Ga0207706_1000301716 | 67 |
| 583 | 3300025933 | Ga0207706_10095189 | Ga0207706_100951892 | 67 |
| 584 | 3300025934 | Ga0207686_10222629 | Ga0207686_102226291 | 67 |
| 585 | 3300025934 | Ga0207686_10483549 | Ga0207686_104835492 | 67 |
| 586 | 3300025934 | Ga0207686_10757720 | Ga0207686_107577201 | 67 |
| 587 | 3300025935 | Ga0207709_10061998 | Ga0207709_100619983 | 67 |
| 588 | 3300025935 | Ga0207709_10080992 | Ga0207709_100809922 | 67 |
| 589 | 3300025935 | Ga0207709_10096170 | Ga0207709_100961702 | 67 |
| 590 | 3300025935 | Ga0207709_10384000 | Ga0207709_103840002 | 67 |
| 591 | 3300025935 | Ga0207709_10674695 | Ga0207709_106746951 | 67 |
| 592 | 3300025935 | Ga0207709_11240436 | Ga0207709_112404361 | 67 |
| 593 | 3300025937 | Ga0207669_10026766 | Ga0207669_100267665 | 67 |
| 594 | 3300025937 | Ga0207669_10131285 | Ga0207669_101312852 | 67 |
| 595 | 3300025938 | Ga0207704_10930672 | Ga0207704_109306721 | 67 |
| 596 | 3300025939 | Ga0207665_10011709 | Ga0207665_100117096 | 67 |
| 597 | 3300025939 | Ga0207665_10312578 | Ga0207665_103125783 | 67 |
| 598 | 3300025939 | Ga0207665_11498929 | Ga0207665_114989291 | 67 |
| 599 | 3300025940 | Ga0207691_10000527 | Ga0207691_1000052718 | 67 |
| 600 | 3300025940 | Ga0207691_10611640 | Ga0207691_106116401 | 67 |
| 601 | 3300025940 | Ga0207691_10691711 | Ga0207691_106917111 | 67 |
| 602 | 3300025941 | Ga0207711_10000675 | Ga0207711_100006756 | 67 |
| 603 | 3300025941 | Ga0207711_10001556 | Ga0207711_1000155619 | 67 |
| 604 | 3300025941 | Ga0207711_10097111 | Ga0207711_100971114 | 67 |
| 605 | 3300025941 | Ga0207711_10479988 | Ga0207711_104799882 | 67 |
| 606 | 3300025941 | Ga0207711_11212416 | Ga0207711_112124161 | 67 |
| 607 | 3300025942 | Ga0207689_10017267 | Ga0207689_100172673 | 67 |
| 608 | 3300025942 | Ga0207689_11760193 | Ga0207689_117601931 | 67 |
| 609 | 3300025944 | Ga0207661_10365898 | Ga0207661_103658982 | 67 |
| 610 | 3300025944 | Ga0207661_10645584 | Ga0207661_106455841 | 67 |
| 611 | 3300025944 | Ga0207661_11038622 | Ga0207661_110386222 | 67 |
| 612 | 3300025945 | Ga0207679_10346660 | Ga0207679_103466601 | 67 |
| 613 | 3300025945 | Ga0207679_11036036 | Ga0207679_110360362 | 67 |
| 614 | 3300025949 | Ga0207667_10001125 | Ga0207667_100011254 | 67 |
| 615 | 3300025949 | Ga0207667_10017539 | Ga0207667_100175393 | 67 |
| 616 | 3300025949 | Ga0207667_10119327 | Ga0207667_101193273 | 67 |
| 617 | 3300025949 | Ga0207667_10504307 | Ga0207667_105043072 | 67 |
| 618 | 3300025960 | Ga0207651_10010498 | Ga0207651_100104982 | 67 |
| 619 | 3300025960 | Ga0207651_11678228 | Ga0207651_116782281 | 67 |
| 620 | 3300025960 | Ga0207651_11903572 | Ga0207651_119035721 | 67 |
| 621 | 3300025961 | Ga0207712_10000002 | Ga0207712_100000025 | 67 |
| 622 | 3300025961 | Ga0207712_10049885 | Ga0207712_100498854 | 67 |
| 623 | 3300025961 | Ga0207712_11555212 | Ga0207712_115552121 | 67 |
| 624 | 3300025972 | Ga0207668_10106841 | Ga0207668_101068412 | 67 |
| 625 | 3300025972 | Ga0207668_11058869 | Ga0207668_110588691 | 67 |
| 626 | 3300025981 | Ga0207640_10075142 | Ga0207640_100751422 | 67 |
| 627 | 3300025981 | Ga0207640_10413879 | Ga0207640_104138792 | 67 |
| 628 | 3300025981 | Ga0207640_10569844 | Ga0207640_105698442 | 67 |
| 629 | 3300025981 | Ga0207640_11605549 | Ga0207640_116055491 | 67 |
| 630 | 3300025986 | Ga0207658_10003656 | Ga0207658_1000365611 | 67 |
| 631 | 3300025986 | Ga0207658_10031533 | Ga0207658_100315335 | 67 |
| 632 | 3300025986 | Ga0207658_10049393 | Ga0207658_100493931 | 67 |
| 633 | 3300025986 | Ga0207658_10712074 | Ga0207658_107120741 | 67 |
| 634 | 3300026023 | Ga0207677_10528205 | Ga0207677_105282052 | 67 |
| 635 | 3300026023 | Ga0207677_10904139 | Ga0207677_109041392 | 67 |
| 636 | 3300026035 | Ga0207703_10000315 | Ga0207703_1000031537 | 67 |
| 637 | 3300026035 | Ga0207703_10000676 | Ga0207703_1000067629 | 67 |
| 638 | 3300026035 | Ga0207703_10289518 | Ga0207703_102895182 | 67 |
| 639 | 3300026041 | Ga0207639_10010682 | Ga0207639_100106825 | 67 |
| 640 | 3300026041 | Ga0207639_10099007 | Ga0207639_100990072 | 67 |
| 641 | 3300026041 | Ga0207639_10314078 | Ga0207639_103140782 | 67 |
| 642 | 3300026041 | Ga0207639_11408325 | Ga0207639_114083251 | 67 |
| 643 | 3300026067 | Ga0207678_10154354 | Ga0207678_101543541 | 67 |
| 644 | 3300026067 | Ga0207678_10172176 | Ga0207678_101721762 | 67 |
| 645 | 3300026067 | Ga0207678_10280149 | Ga0207678_102801492 | 67 |
| 646 | 3300026067 | Ga0207678_10489965 | Ga0207678_104899652 | 67 |
| 647 | 3300026067 | Ga0207678_11432650 | Ga0207678_114326502 | 67 |
| 648 | 3300026075 | Ga0207708_10019564 | Ga0207708_100195642 | 67 |
| 649 | 3300026075 | Ga0207708_11472027 | Ga0207708_114720271 | 67 |
| 650 | 3300026078 | Ga0207702_10023823 | Ga0207702_100238232 | 67 |
| 651 | 3300026078 | Ga0207702_10643676 | Ga0207702_106436762 | 67 |
| 652 | 3300026078 | Ga0207702_11000642 | Ga0207702_110006421 | 67 |
| 653 | 3300026078 | Ga0207702_11161400 | Ga0207702_111614001 | 67 |
| 654 | 3300026088 | Ga0207641_10013108 | Ga0207641_100131087 | 67 |
| 655 | 3300026088 | Ga0207641_10034952 | Ga0207641_100349524 | 67 |
| 656 | 3300026088 | Ga0207641_10088299 | Ga0207641_100882993 | 67 |
| 657 | 3300026088 | Ga0207641_10282525 | Ga0207641_102825251 | 67 |
| 658 | 3300026088 | Ga0207641_11879757 | Ga0207641_118797571 | 67 |
| 659 | 3300026095 | Ga0207676_10102976 | Ga0207676_101029763 | 67 |
| 660 | 3300026095 | Ga0207676_10131422 | Ga0207676_101314221 | 67 |
| 661 | 3300026095 | Ga0207676_10233598 | Ga0207676_102335983 | 67 |
| 662 | 3300026116 | Ga0207674_10429108 | Ga0207674_104291082 | 67 |
| 663 | 3300026118 | Ga0207675_100011376 | Ga0207675_1000113764 | 67 |
| 664 | 3300026118 | Ga0207675_100441613 | Ga0207675_1004416131 | 67 |
| 665 | 3300026121 | Ga0207683_10001988 | Ga0207683_100019882 | 67 |
| 666 | 3300026121 | Ga0207683_10005105 | Ga0207683_100051053 | 67 |
| 667 | 3300026121 | Ga0207683_11135942 | Ga0207683_111359423 | 67 |
| 668 | 3300026142 | Ga0207698_10001558 | Ga0207698_1000155814 | 67 |
| 669 | 3300026142 | Ga0207698_10280821 | Ga0207698_102808212 | 67 |
| 670 | 3300026142 | Ga0207698_10284038 | Ga0207698_102840382 | 67 |
| 671 | 3300026142 | Ga0207698_10731855 | Ga0207698_107318552 | 67 |
| 672 | 3300026142 | Ga0207698_11400398 | Ga0207698_114003981 | 67 |
| 673 | 3300027312 | Ga0209371_1046461 | Ga0209371_10464611 | 67 |
| 674 | 3300027512 | Ga0209179_1002471 | Ga0209179_10024717 | 67 |
| 675 | 3300027876 | Ga0209974_10202245 | Ga0209974_102022452 | 67 |
| 676 | 3300027876 | Ga0209974_10416211 | Ga0209974_104162112 | 67 |
| 677 | 3300027907 | Ga0207428_10001932 | Ga0207428_1000193216 | 67 |
| 678 | 3300027907 | Ga0207428_10205041 | Ga0207428_102050412 | 67 |
| 679 | 3300027907 | Ga0207428_10225265 | Ga0207428_102252652 | 67 |
| 680 | 3300028379 | Ga0268266_10020090 | Ga0268266_100200905 | 67 |
| 681 | 3300028379 | Ga0268266_10306426 | Ga0268266_103064262 | 67 |
| 682 | 3300028379 | Ga0268266_10483999 | Ga0268266_104839991 | 67 |
| 683 | 3300028379 | Ga0268266_10742643 | Ga0268266_107426432 | 67 |
| 684 | 3300028380 | Ga0268265_10026539 | Ga0268265_100265396 | 67 |
| 685 | 3300028381 | Ga0268264_10005182 | Ga0268264_100051826 | 67 |
| 686 | 3300028381 | Ga0268264_11066015 | Ga0268264_110660151 | 67 |
| 687 | 3300028381 | Ga0268264_11545577 | Ga0268264_115455771 | 67 |
| 688 | 3300028786 | Ga0307517_10572196 | Ga0307517_105721961 | 67 |
| 689 | 3300028794 | Ga0307515_10235852 | Ga0307515_102358522 | 67 |
| 690 | 3300028794 | Ga0307515_10377329 | Ga0307515_103773291 | 67 |
| 691 | 3300030500 | Ga0268256_1052414 | Ga0268256_10524142 | 67 |
| 692 | 3300030522 | Ga0307512_10470834 | Ga0307512_104708341 | 67 |
| 693 | 3300030732 | Ga0316176_1002176 | Ga0316176_10021762 | 67 |
| 694 | 3300030735 | Ga0316178_1092568 | Ga0316178_10925681 | 67 |
| 695 | 3300030736 | Ga0316180_1140247 | Ga0316180_11402471 | 67 |
| 696 | 3300030742 | Ga0316183_1164821 | Ga0316183_11648211 | 67 |
| 697 | 3300030744 | Ga0316181_1000529 | Ga0316181_10005291 | 67 |
| 698 | 3300030745 | Ga0316182_1131057 | Ga0316182_11310572 | 67 |
| 699 | 3300030760 | Ga0265762_1154113 | Ga0265762_11541132 | 67 |
| 700 | 3300030863 | Ga0265766_1023954 | Ga0265766_10239541 | 67 |
| 701 | 3300031239 | Ga0265328_10060565 | Ga0265328_100605653 | 67 |
| 702 | 3300031241 | Ga0265325_10211851 | Ga0265325_102118511 | 67 |
| 703 | 3300031250 | Ga0265331_10000393 | Ga0265331_1000039318 | 67 |
| 704 | 3300031251 | Ga0265327_10001930 | Ga0265327_1000193013 | 67 |
| 705 | 3300031251 | Ga0265327_10007612 | Ga0265327_100076126 | 67 |
| 706 | 3300031251 | Ga0265327_10012338 | Ga0265327_100123382 | 67 |
| 707 | 3300031251 | Ga0265327_10358605 | Ga0265327_103586052 | 67 |
| 708 | 3300031344 | Ga0265316_10078353 | Ga0265316_100783534 | 67 |
| 709 | 3300031456 | Ga0307513_10017299 | Ga0307513_100172996 | 67 |
| 710 | 3300031456 | Ga0307513_10075355 | Ga0307513_100753554 | 67 |
| 711 | 3300031456 | Ga0307513_10362823 | Ga0307513_103628231 | 67 |
| 712 | 3300031456 | Ga0307513_10385307 | Ga0307513_103853072 | 67 |
| 713 | 3300031507 | Ga0307509_10493699 | Ga0307509_104936991 | 67 |
| 714 | 3300031548 | Ga0307408_100004096 | Ga0307408_1000040968 | 67 |
| 715 | 3300031548 | Ga0307408_100027283 | Ga0307408_1000272834 | 67 |
| 716 | 3300031548 | Ga0307408_100029844 | Ga0307408_1000298442 | 67 |
| 717 | 3300031548 | Ga0307408_100037161 | Ga0307408_1000371613 | 67 |
| 718 | 3300031548 | Ga0307408_100037908 | Ga0307408_1000379082 | 67 |
| 719 | 3300031548 | Ga0307408_100056630 | Ga0307408_1000566302 | 67 |
| 720 | 3300031548 | Ga0307408_100089677 | Ga0307408_1000896774 | 67 |
| 721 | 3300031548 | Ga0307408_100124786 | Ga0307408_1001247863 | 67 |
| 722 | 3300031548 | Ga0307408_100149275 | Ga0307408_1001492752 | 67 |
| 723 | 3300031548 | Ga0307408_100388887 | Ga0307408_1003888873 | 67 |
| 724 | 3300031548 | Ga0307408_100408750 | Ga0307408_1004087504 | 67 |
| 725 | 3300031548 | Ga0307408_100486561 | Ga0307408_1004865612 | 67 |
| 726 | 3300031548 | Ga0307408_102391130 | Ga0307408_1023911302 | 67 |
| 727 | 3300031616 | Ga0307508_10234030 | Ga0307508_102340301 | 67 |
| 728 | 3300031649 | Ga0307514_10538232 | Ga0307514_105382321 | 67 |
| 729 | 3300031727 | Ga0316576_10866716 | Ga0316576_108667161 | 67 |
| 730 | 3300031731 | Ga0307405_10001824 | Ga0307405_100018247 | 67 |
| 731 | 3300031731 | Ga0307405_10049986 | Ga0307405_100499864 | 67 |
| 732 | 3300031731 | Ga0307405_10058059 | Ga0307405_100580592 | 67 |
| 733 | 3300031731 | Ga0307405_10061947 | Ga0307405_100619474 | 67 |
| 734 | 3300031731 | Ga0307405_10208555 | Ga0307405_102085552 | 67 |
| 735 | 3300031731 | Ga0307405_10247616 | Ga0307405_102476162 | 67 |
| 736 | 3300031731 | Ga0307405_10290980 | Ga0307405_102909802 | 67 |
| 737 | 3300031731 | Ga0307405_10357635 | Ga0307405_103576352 | 67 |
| 738 | 3300031731 | Ga0307405_10445243 | Ga0307405_104452432 | 67 |
| 739 | 3300031731 | Ga0307405_10470966 | Ga0307405_104709662 | 67 |
| 740 | 3300031731 | Ga0307405_10602688 | Ga0307405_106026882 | 67 |
| 741 | 3300031731 | Ga0307405_10707280 | Ga0307405_107072802 | 67 |
| 742 | 3300031731 | Ga0307405_11418389 | Ga0307405_114183891 | 67 |
| 743 | 3300031824 | Ga0307413_10007146 | Ga0307413_100071464 | 67 |
| 744 | 3300031824 | Ga0307413_10012044 | Ga0307413_100120443 | 67 |
| 745 | 3300031824 | Ga0307413_10043973 | Ga0307413_100439732 | 67 |
| 746 | 3300031824 | Ga0307413_10050698 | Ga0307413_100506983 | 67 |
| 747 | 3300031824 | Ga0307413_10117255 | Ga0307413_101172551 | 67 |
| 748 | 3300031824 | Ga0307413_10135921 | Ga0307413_101359212 | 67 |
| 749 | 3300031824 | Ga0307413_10261513 | Ga0307413_102615132 | 67 |
| 750 | 3300031824 | Ga0307413_10421462 | Ga0307413_104214622 | 67 |
| 751 | 3300031824 | Ga0307413_10586556 | Ga0307413_105865561 | 67 |
| 752 | 3300031824 | Ga0307413_10956618 | Ga0307413_109566182 | 67 |
| 753 | 3300031824 | Ga0307413_10973471 | Ga0307413_109734712 | 67 |
| 754 | 3300031824 | Ga0307413_11294872 | Ga0307413_112948722 | 67 |
| 755 | 3300031824 | Ga0307413_11320218 | Ga0307413_113202182 | 67 |
| 756 | 3300031838 | Ga0307518_10064062 | Ga0307518_100640623 | 67 |
| 757 | 3300031852 | Ga0307410_10004562 | Ga0307410_100045627 | 67 |
| 758 | 3300031852 | Ga0307410_10006834 | Ga0307410_100068342 | 67 |
| 759 | 3300031852 | Ga0307410_10021301 | Ga0307410_100213012 | 67 |
| 760 | 3300031852 | Ga0307410_10025907 | Ga0307410_100259072 | 67 |
| 761 | 3300031852 | Ga0307410_10032973 | Ga0307410_100329732 | 67 |
| 762 | 3300031852 | Ga0307410_10184774 | Ga0307410_101847742 | 67 |
| 763 | 3300031852 | Ga0307410_10239035 | Ga0307410_102390352 | 67 |
| 764 | 3300031852 | Ga0307410_10832107 | Ga0307410_108321073 | 67 |
| 765 | 3300031852 | Ga0307410_11065894 | Ga0307410_110658941 | 67 |
| 766 | 3300031852 | Ga0307410_11355210 | Ga0307410_113552101 | 67 |
| 767 | 3300031852 | Ga0307410_11660228 | Ga0307410_116602282 | 67 |
| 768 | 3300031852 | Ga0307410_11666567 | Ga0307410_116665671 | 67 |
| 769 | 3300031901 | Ga0307406_10011101 | Ga0307406_100111016 | 67 |
| 770 | 3300031901 | Ga0307406_10021863 | Ga0307406_100218635 | 67 |
| 771 | 3300031901 | Ga0307406_10092243 | Ga0307406_100922432 | 67 |
| 772 | 3300031901 | Ga0307406_10095491 | Ga0307406_100954912 | 67 |
| 773 | 3300031901 | Ga0307406_10146643 | Ga0307406_101466431 | 67 |
| 774 | 3300031901 | Ga0307406_10149054 | Ga0307406_101490541 | 67 |
| 775 | 3300031901 | Ga0307406_10342988 | Ga0307406_103429882 | 67 |
| 776 | 3300031901 | Ga0307406_10498923 | Ga0307406_104989231 | 67 |
| 777 | 3300031901 | Ga0307406_11253740 | Ga0307406_112537401 | 67 |
| 778 | 3300031903 | Ga0307407_10016800 | Ga0307407_100168002 | 67 |
| 779 | 3300031903 | Ga0307407_10023952 | Ga0307407_100239523 | 67 |
| 780 | 3300031903 | Ga0307407_10063249 | Ga0307407_100632492 | 67 |
| 781 | 3300031903 | Ga0307407_10098440 | Ga0307407_100984401 | 67 |
| 782 | 3300031903 | Ga0307407_10170372 | Ga0307407_101703721 | 67 |
| 783 | 3300031903 | Ga0307407_10181446 | Ga0307407_101814462 | 67 |
| 784 | 3300031903 | Ga0307407_10188886 | Ga0307407_101888861 | 67 |
| 785 | 3300031903 | Ga0307407_11623756 | Ga0307407_116237561 | 67 |
| 786 | 3300031911 | Ga0307412_10001098 | Ga0307412_1000109813 | 67 |
| 787 | 3300031911 | Ga0307412_10028533 | Ga0307412_100285331 | 67 |
| 788 | 3300031911 | Ga0307412_10040148 | Ga0307412_100401482 | 67 |
| 789 | 3300031911 | Ga0307412_10054535 | Ga0307412_100545353 | 67 |
| 790 | 3300031911 | Ga0307412_10064294 | Ga0307412_100642942 | 67 |
| 791 | 3300031911 | Ga0307412_10075565 | Ga0307412_100755652 | 67 |
| 792 | 3300031911 | Ga0307412_10101590 | Ga0307412_101015902 | 67 |
| 793 | 3300031911 | Ga0307412_10109144 | Ga0307412_101091442 | 67 |
| 794 | 3300031911 | Ga0307412_10267823 | Ga0307412_102678232 | 67 |
| 795 | 3300031911 | Ga0307412_10327764 | Ga0307412_103277641 | 67 |
| 796 | 3300031911 | Ga0307412_10374615 | Ga0307412_103746151 | 67 |
| 797 | 3300031911 | Ga0307412_10384432 | Ga0307412_103844322 | 67 |
| 798 | 3300031911 | Ga0307412_10508614 | Ga0307412_105086141 | 67 |
| 799 | 3300031911 | Ga0307412_10551346 | Ga0307412_105513461 | 67 |
| 800 | 3300031911 | Ga0307412_10734830 | Ga0307412_107348301 | 67 |
| 801 | 3300031911 | Ga0307412_10866759 | Ga0307412_108667592 | 67 |
| 802 | 3300031911 | Ga0307412_10870528 | Ga0307412_108705282 | 67 |
| 803 | 3300031911 | Ga0307412_11367813 | Ga0307412_113678131 | 67 |
| 804 | 3300031995 | Ga0307409_100017036 | Ga0307409_1000170363 | 67 |
| 805 | 3300031995 | Ga0307409_100034644 | Ga0307409_1000346441 | 67 |
| 806 | 3300031995 | Ga0307409_100043092 | Ga0307409_1000430925 | 67 |
| 807 | 3300031995 | Ga0307409_100047789 | Ga0307409_1000477894 | 67 |
| 808 | 3300031995 | Ga0307409_100055044 | Ga0307409_1000550442 | 67 |
| 809 | 3300031995 | Ga0307409_100063933 | Ga0307409_1000639332 | 67 |
| 810 | 3300031995 | Ga0307409_100095980 | Ga0307409_1000959801 | 67 |
| 811 | 3300031995 | Ga0307409_100197086 | Ga0307409_1001970862 | 67 |
| 812 | 3300031995 | Ga0307409_100210360 | Ga0307409_1002103601 | 67 |
| 813 | 3300031995 | Ga0307409_100360534 | Ga0307409_1003605341 | 67 |
| 814 | 3300031995 | Ga0307409_100505904 | Ga0307409_1005059041 | 67 |
| 815 | 3300031995 | Ga0307409_100540907 | Ga0307409_1005409072 | 67 |
| 816 | 3300031995 | Ga0307409_100733313 | Ga0307409_1007333132 | 67 |
| 817 | 3300031995 | Ga0307409_100927340 | Ga0307409_1009273402 | 67 |
| 818 | 3300031995 | Ga0307409_101373263 | Ga0307409_1013732631 | 67 |
| 819 | 3300031995 | Ga0307409_101510148 | Ga0307409_1015101481 | 67 |
| 820 | 3300031995 | Ga0307409_102947937 | Ga0307409_1029479372 | 67 |
| 821 | 3300032002 | Ga0307416_100014730 | Ga0307416_1000147303 | 67 |
| 822 | 3300032002 | Ga0307416_100072215 | Ga0307416_1000722152 | 67 |
| 823 | 3300032002 | Ga0307416_100077052 | Ga0307416_1000770524 | 67 |
| 824 | 3300032002 | Ga0307416_100094749 | Ga0307416_1000947494 | 67 |
| 825 | 3300032002 | Ga0307416_100096528 | Ga0307416_1000965284 | 67 |
| 826 | 3300032002 | Ga0307416_100120934 | Ga0307416_1001209343 | 67 |
| 827 | 3300032002 | Ga0307416_100213681 | Ga0307416_1002136811 | 67 |
| 828 | 3300032002 | Ga0307416_100231574 | Ga0307416_1002315742 | 67 |
| 829 | 3300032002 | Ga0307416_100244194 | Ga0307416_1002441942 | 67 |
| 830 | 3300032002 | Ga0307416_100275746 | Ga0307416_1002757461 | 67 |
| 831 | 3300032002 | Ga0307416_100280500 | Ga0307416_1002805002 | 67 |
| 832 | 3300032002 | Ga0307416_100288524 | Ga0307416_1002885242 | 67 |
| 833 | 3300032002 | Ga0307416_100326581 | Ga0307416_1003265812 | 67 |
| 834 | 3300032002 | Ga0307416_100352939 | Ga0307416_1003529391 | 67 |
| 835 | 3300032002 | Ga0307416_100430466 | Ga0307416_1004304662 | 67 |
| 836 | 3300032002 | Ga0307416_100602041 | Ga0307416_1006020412 | 67 |
| 837 | 3300032002 | Ga0307416_102168302 | Ga0307416_1021683021 | 67 |
| 838 | 3300032002 | Ga0307416_103143038 | Ga0307416_1031430381 | 67 |
| 839 | 3300032004 | Ga0307414_10049175 | Ga0307414_100491755 | 67 |
| 840 | 3300032004 | Ga0307414_10148169 | Ga0307414_101481691 | 67 |
| 841 | 3300032004 | Ga0307414_10191870 | Ga0307414_101918701 | 67 |
| 842 | 3300032004 | Ga0307414_10201130 | Ga0307414_102011301 | 67 |
| 843 | 3300032004 | Ga0307414_10260111 | Ga0307414_102601112 | 67 |
| 844 | 3300032004 | Ga0307414_10312710 | Ga0307414_103127102 | 67 |
| 845 | 3300032004 | Ga0307414_10333565 | Ga0307414_103335651 | 67 |
| 846 | 3300032004 | Ga0307414_11132362 | Ga0307414_111323621 | 67 |
| 847 | 3300032004 | Ga0307414_11796089 | Ga0307414_117960891 | 67 |
| 848 | 3300032005 | Ga0307411_10029428 | Ga0307411_100294284 | 67 |
| 849 | 3300032005 | Ga0307411_10086652 | Ga0307411_100866521 | 67 |
| 850 | 3300032005 | Ga0307411_10274877 | Ga0307411_102748772 | 67 |
| 851 | 3300032005 | Ga0307411_10531447 | Ga0307411_105314472 | 67 |
| 852 | 3300032005 | Ga0307411_10550441 | Ga0307411_105504412 | 67 |
| 853 | 3300032005 | Ga0307411_10652831 | Ga0307411_106528311 | 67 |
| 854 | 3300032005 | Ga0307411_11107021 | Ga0307411_111070211 | 67 |
| 855 | 3300032005 | Ga0307411_11854232 | Ga0307411_118542322 | 67 |
| 856 | 3300032005 | Ga0307411_12144187 | Ga0307411_121441871 | 67 |
| 857 | 3300032126 | Ga0307415_100015143 | Ga0307415_1000151436 | 67 |
| 858 | 3300032126 | Ga0307415_100060105 | Ga0307415_1000601055 | 67 |
| 859 | 3300032126 | Ga0307415_100158387 | Ga0307415_1001583871 | 67 |
| 860 | 3300032126 | Ga0307415_100200892 | Ga0307415_1002008923 | 67 |
| 861 | 3300032126 | Ga0307415_100340209 | Ga0307415_1003402092 | 67 |
| 862 | 3300032126 | Ga0307415_100500845 | Ga0307415_1005008452 | 67 |
| 863 | 3300032126 | Ga0307415_100502025 | Ga0307415_1005020252 | 67 |
| 864 | 3300032126 | Ga0307415_100865120 | Ga0307415_1008651202 | 67 |
| 865 | 3300032168 | Ga0316593_10099211 | Ga0316593_100992113 | 67 |
| 866 | 3300033179 | Ga0307507_10062721 | Ga0307507_100627214 | 67 |
| 867 | 3300033180 | Ga0307510_10032524 | Ga0307510_100325245 | 67 |
| 868 | 3300033180 | Ga0307510_10116554 | Ga0307510_101165543 | 67 |
| 869 | 3300033524 | Ga0316592_1068630 | Ga0316592_10686302 | 67 |
| 870 | 3300033541 | Ga0316596_1072203 | Ga0316596_10722032 | 67 |
| 871 | 3300033541 | Ga0316596_1081265 | Ga0316596_10812652 | 67 |
| 872 | 3300033541 | Ga0316596_1228058 | Ga0316596_12280582 | 67 |
| 873 | 3300034816 | Ga0373930_0059307 | Ga0373930_0059307_230_433 | 67 |
| 874 | 3300034819 | Ga0373958_0159944 | Ga0373958_0159944_124_327 | 67 |
| 875 | 3300035091 | Ga0373951_0001434 | Ga0373951_0001434_316_519 | 67 |
| 876 | 3300035091 | Ga0373951_0005165 | Ga0373951_0005165_1010_1213 | 67 |
| 877 | 3300035111 | Ga0373923_0593976 | Ga0373923_0593976_101_307 | 67 |
| 878 | 3300035112 | Ga0373932_0233220 | Ga0373932_0233220_340_543 | 67 |
| 879 | 3300035115 | Ga0373941_0219279 | Ga0373941_0219279_274_477 | 67 |
| 880 | 3300035116 | Ga0373945_0209981 | Ga0373945_0209981_550_756 | 67 |
| 881 | 3300035119 | Ga0373956_0173050 | Ga0373956_0173050_329_535 | 67 |
| 882 | 3300035120 | Ga0373957_0037179 | Ga0373957_0037179_1098_1304 | 67 |
| 883 | 3300035172 | Ga0373955_0097921 | Ga0373955_0097921_324_530 | 67 |
| 884 | 3300035242 | Ga0373962_0099230 | Ga0373962_0099230_341_544 | 67 |
| 885 | 3300035691 | Ga0373931_0092338 | Ga0373931_0092338_706_909 | 67 |
| 886 | 3300035692 | Ga0373935_0776355 | Ga0373935_0776355_329_535 | 67 |
| 887 | 3300035725 | Ga0373947_0593340 | Ga0373947_0593340_361_567 | 67 |
| 888 | 3300036401 | Ga0373937_0240356 | Ga0373937_0240356_619_825 | 67 |
| 889 | 3300037068 | Ga0373925_0128972 | Ga0373925_0128972_994_1200 | 67 |
| 890 | 3300037312 | Ga0395899_0002071 | Ga0395899_0002071_15438_15641 | 67 |
| 891 | 3300037312 | Ga0395899_0012150 | Ga0395899_0012150_4816_5019 | 67 |
| 892 | 3300037312 | Ga0395899_0042478 | Ga0395899_0042478_1273_1476 | 67 |
| 893 | 3300037312 | Ga0395899_0044343 | Ga0395899_0044343_749_952 | 67 |
| 894 | 3300037312 | Ga0395899_0122284 | Ga0395899_0122284_1170_1373 | 67 |
| 895 | 3300037312 | Ga0395899_1002677 | Ga0395899_1002677_251_454 | 67 |
| 896 | 3300037418 | Ga0395900_0002047 | Ga0395900_0002047_7136_7363 | 67 |
| 897 | 3300037418 | Ga0395900_0007771 | Ga0395900_0007771_5817_6020 | 67 |
| 898 | 3300037418 | Ga0395900_0063331 | Ga0395900_0063331_973_1176 | 67 |
| 899 | 3300037418 | Ga0395900_0091319 | Ga0395900_0091319_1498_1701 | 67 |
| 900 | 3300037418 | Ga0395900_0119281 | Ga0395900_0119281_2361_2564 | 67 |
| 901 | 3300037418 | Ga0395900_0162275 | Ga0395900_0162275_1661_1864 | 67 |
| 902 | 3300037418 | Ga0395900_0276018 | Ga0395900_0276018_1263_1466 | 67 |
| 903 | 3300037418 | Ga0395900_0472686 | Ga0395900_0472686_414_617 | 67 |
| 904 | 3300037418 | Ga0395900_1119541 | Ga0395900_1119541_29_232 | 67 |
| 905 | 3300037466 | Ga0395898_0010620 | Ga0395898_0010620_2296_2499 | 67 |
| 906 | 3300037466 | Ga0395898_0024316 | Ga0395898_0024316_1755_1958 | 67 |
| 907 | 3300037466 | Ga0395898_0039323 | Ga0395898_0039323_2903_3130 | 67 |
| 908 | 3300037466 | Ga0395898_0053014 | Ga0395898_0053014_168_371 | 67 |
| 909 | 3300037466 | Ga0395898_0060072 | Ga0395898_0060072_228_431 | 67 |
| 910 | 3300037466 | Ga0395898_0069594 | Ga0395898_0069594_2653_2856 | 67 |
| 911 | 3300037466 | Ga0395898_0107768 | Ga0395898_0107768_1376_1579 | 67 |
| 912 | 3300037466 | Ga0395898_0185881 | Ga0395898_0185881_570_773 | 67 |
| 913 | 3300037466 | Ga0395898_0197932 | Ga0395898_0197932_501_704 | 67 |
| 914 | 3300037471 | Ga0395905_0011108 | Ga0395905_0011108_1157_1360 | 67 |
| 915 | 3300037471 | Ga0395905_0550049 | Ga0395905_0550049_490_693 | 67 |
| 916 | 3300037471 | Ga0395905_0553332 | Ga0395905_0553332_822_1025 | 67 |
| 917 | 3300037471 | Ga0395905_0708485 | Ga0395905_0708485_228_431 | 67 |
| 918 | 3300037471 | Ga0395905_0924892 | Ga0395905_0924892_496_699 | 67 |
| 919 | 3300037471 | Ga0395905_1781441 | Ga0395905_1781441_271_483 | 67 |
| 920 | 3300038443 | Ga0395901_0018181 | Ga0395901_0018181_6410_6613 | 67 |
| 921 | 3300038443 | Ga0395901_0062464 | Ga0395901_0062464_2880_3083 | 67 |
| 922 | 3300038443 | Ga0395901_0063679 | Ga0395901_0063679_676_903 | 67 |
| 923 | 3300038443 | Ga0395901_0065762 | Ga0395901_0065762_2161_2364 | 67 |
| 924 | 3300038443 | Ga0395901_0067956 | Ga0395901_0067956_2056_2259 | 67 |
| 925 | 3300038443 | Ga0395901_0118943 | Ga0395901_0118943_1386_1589 | 67 |
| 926 | 3300038443 | Ga0395901_0361299 | Ga0395901_0361299_143_346 | 67 |
| 927 | 3300038443 | Ga0395901_1092670 | Ga0395901_1092670_102_305 | 67 |
| 928 | 3300038443 | Ga0395901_1257550 | Ga0395901_1257550_359_562 | 67 |
| 929 | 3300038996 | Ga0242420_148478 | Ga0242420_148478_224_427 | 67 |
| 930 | 3300039437 | Ga0436365_0091043 | Ga0436365_0091043_407_610 | 67 |
| 931 | 3300039437 | Ga0436365_0779361 | Ga0436365_0779361_2052_2258 | 67 |
| 932 | 3300039437 | Ga0436365_1937032 | Ga0436365_1937032_299_505 | 67 |
| 933 | 3300039450 | Ga0436363_0309976 | Ga0436363_0309976_933_1139 | 67 |
| 934 | 3300039453 | Ga0436362_0126685 | Ga0436362_0126685_2625_2831 | 67 |
| 935 | 3300041404 | Ga0439436_0000426 | Ga0439436_0000426_1615_1818 | 67 |
| 936 | 3300041404 | Ga0439436_0002918 | Ga0439436_0002918_4341_4559 | 67 |
| 937 | 3300041404 | Ga0439436_0037321 | Ga0439436_0037321_1030_1233 | 67 |
| 938 | 3300041405 | Ga0439438_001015 | Ga0439438_001015_2416_2634 | 67 |
| 939 | 3300041405 | Ga0439438_041334 | Ga0439438_041334_769_972 | 67 |
| 940 | 3300041405 | Ga0439438_081595 | Ga0439438_081595_40_243 | 67 |
| 941 | 3300041406 | Ga0439439_0000182 | Ga0439439_0000182_6079_6297 | 67 |
| 942 | 3300041406 | Ga0439439_0115147 | Ga0439439_0115147_362_565 | 67 |
| 943 | 3300041410 | Ga0439461_0016623 | Ga0439461_0016623_329_547 | 67 |
| 944 | 3300041410 | Ga0439461_0053203 | Ga0439461_0053203_267_470 | 67 |
| 945 | 3300041410 | Ga0439461_0112112 | Ga0439461_0112112_225_428 | 67 |
| 946 | 3300041411 | Ga0439466_0001588 | Ga0439466_0001588_1903_2121 | 67 |
| 947 | 3300041411 | Ga0439466_0118738 | Ga0439466_0118738_112_315 | 67 |
| 948 | 3300041411 | Ga0439466_0245538 | Ga0439466_0245538_255_458 | 67 |
| 949 | 3300041413 | Ga0439465_0019982 | Ga0439465_0019982_1589_1792 | 67 |
| 950 | 3300041413 | Ga0439465_0060523 | Ga0439465_0060523_125_343 | 67 |
| 951 | 3300041413 | Ga0439465_0268007 | Ga0439465_0268007_344_556 | 67 |
| 952 | 3300041441 | Ga0451787_429570 | Ga0451787_429570_263_466 | 67 |
| 953 | 3300041441 | Ga0451787_454270 | Ga0451787_454270_233_436 | 67 |
| 954 | 3300041443 | Ga0451789_0449262 | Ga0451789_0449262_286_489 | 67 |
| 955 | 3300041443 | Ga0451789_0954465 | Ga0451789_0954465_1223_1426 | 67 |
| 956 | 3300041444 | Ga0451790_29369 | Ga0451790_29369_551_754 | 67 |
| 957 | 3300041451 | Ga0451791_0333509 | Ga0451791_0333509_213_419 | 67 |
| 958 | 3300041451 | Ga0451791_0425394 | Ga0451791_0425394_748_951 | 67 |
| 959 | 3300041451 | Ga0451791_0746838 | Ga0451791_0746838_354_557 | 67 |
| 960 | 3300041451 | Ga0451791_1365422 | Ga0451791_1365422_284_487 | 67 |
| 961 | 3300041451 | Ga0451791_1684038 | Ga0451791_1684038_77_280 | 67 |
| 962 | 3300041452 | Ga0451793_0107442 | Ga0451793_0107442_571_774 | 67 |
| 963 | 3300041452 | Ga0451793_0375343 | Ga0451793_0375343_262_465 | 67 |
| 964 | 3300041452 | Ga0451793_0394566 | Ga0451793_0394566_603_806 | 67 |
| 965 | 3300041453 | Ga0451797_0414603 | Ga0451797_0414603_359_562 | 67 |
| 966 | 3300041453 | Ga0451797_0578603 | Ga0451797_0578603_158_361 | 67 |
| 967 | 3300041453 | Ga0451797_0820372 | Ga0451797_0820372_705_908 | 67 |
| 968 | 3300041456 | Ga0451795_0000828 | Ga0451795_0000828_435_638 | 67 |
| 969 | 3300041459 | Ga0451800_0128843 | Ga0451800_0128843_123_326 | 67 |
| 970 | 3300041459 | Ga0451800_0298232 | Ga0451800_0298232_162_365 | 67 |
| 971 | 3300041459 | Ga0451800_0575305 | Ga0451800_0575305_434_637 | 67 |
| 972 | 3300041460 | Ga0451802_0089278 | Ga0451802_0089278_941_1144 | 67 |
| 973 | 3300041460 | Ga0451802_0278509 | Ga0451802_0278509_61_264 | 67 |
| 974 | 3300041460 | Ga0451802_0708891 | Ga0451802_0708891_286_489 | 67 |
| 975 | 3300041462 | Ga0451806_674951 | Ga0451806_674951_265_468 | 67 |
| 976 | 3300041486 | Ga0451807_0181775 | Ga0451807_0181775_333_536 | 67 |
| 977 | 3300041486 | Ga0451807_1758962 | Ga0451807_1758962_454_657 | 67 |
| 978 | 3300041486 | Ga0451807_2590362 | Ga0451807_2590362_216_419 | 67 |
| 979 | 3300041491 | Ga0451833_1376670 | Ga0451833_1376670_31_234 | 67 |
| 980 | 3300041494 | Ga0451837_1258306 | Ga0451837_1258306_301_507 | 67 |
| 981 | 3300041494 | Ga0451837_1568330 | Ga0451837_1568330_75_281 | 67 |
| 982 | 3300041496 | Ga0451839_1351262 | Ga0451839_1351262_552_764 | 67 |
| 983 | 3300041496 | Ga0451839_1586779 | Ga0451839_1586779_142_345 | 67 |
| 984 | 3300041498 | Ga0451841_0147103 | Ga0451841_0147103_243_446 | 67 |
| 985 | 3300041503 | Ga0451847_0602894 | Ga0451847_0602894_256_459 | 67 |
| 986 | 3300041505 | Ga0451849_0833272 | Ga0451849_0833272_144_347 | 67 |
| 987 | 3300041507 | Ga0451851_0537676 | Ga0451851_0537676_277_480 | 67 |
| 988 | 3300041509 | Ga0451843_1119515 | Ga0451843_1119515_560_763 | 67 |
| 989 | 3300041511 | Ga0451855_0050733 | Ga0451855_0050733_266_469 | 67 |
| 990 | 3300041512 | Ga0451853_0358524 | Ga0451853_0358524_313_516 | 67 |
| 991 | 3300041512 | Ga0451853_2739900 | Ga0451853_2739900_182_385 | 67 |
| 992 | 3300041997 | Ga0439431_0046537 | Ga0439431_0046537_248_466 | 67 |
| 993 | 3300041999 | Ga0439433_0000242 | Ga0439433_0000242_4122_4340 | 67 |
| 994 | 3300041999 | Ga0439433_0000467 | Ga0439433_0000467_4845_5048 | 67 |
| 995 | 3300041999 | Ga0439433_0016129 | Ga0439433_0016129_1416_1619 | 67 |
| 996 | 3300041999 | Ga0439433_0061981 | Ga0439433_0061981_486_695 | 67 |
| 997 | 3300042002 | Ga0439442_000016 | Ga0439442_000016_15445_15648 | 67 |
| 998 | 3300042002 | Ga0439442_000282 | Ga0439442_000282_4772_4975 | 67 |
| 999 | 3300042002 | Ga0439442_001917 | Ga0439442_001917_1903_2121 | 67 |
| 1000 | 3300042002 | Ga0439442_005349 | Ga0439442_005349_2319_2522 | 67 |
| 1001 | 3300042002 | Ga0439442_007158 | Ga0439442_007158_1888_2091 | 67 |
| 1002 | 3300042005 | Ga0439448_0127540 | Ga0439448_0127540_102_305 | 67 |
| 1003 | 3300042006 | Ga0439432_010951 | Ga0439432_010951_154_372 | 67 |
| 1004 | 3300042006 | Ga0439432_022430 | Ga0439432_022430_1386_1589 | 67 |
| 1005 | 3300042007 | Ga0439449_0000230 | Ga0439449_0000230_8138_8341 | 67 |
| 1006 | 3300042007 | Ga0439449_0001930 | Ga0439449_0001930_2623_2826 | 67 |
| 1007 | 3300042007 | Ga0439449_0016620 | Ga0439449_0016620_1351_1569 | 67 |
| 1008 | 3300042007 | Ga0439449_0084853 | Ga0439449_0084853_133_336 | 67 |
| 1009 | 3300042007 | Ga0439449_0108314 | Ga0439449_0108314_381_584 | 67 |
| 1010 | 3300042007 | Ga0439449_0197236 | Ga0439449_0197236_47_250 | 67 |
| 1011 | 3300042007 | Ga0439449_0398914 | Ga0439449_0398914_144_347 | 67 |
| 1012 | 3300042010 | Ga0439452_001317 | Ga0439452_001317_8623_8841 | 67 |
| 1013 | 3300042010 | Ga0439452_045896 | Ga0439452_045896_780_983 | 67 |
| 1014 | 3300042010 | Ga0439452_064252 | Ga0439452_064252_425_628 | 67 |
| 1015 | 3300042013 | Ga0439456_108413 | Ga0439456_108413_172_381 | 67 |
| 1016 | 3300042014 | Ga0439457_000356 | Ga0439457_000356_8571_8789 | 67 |
| 1017 | 3300042014 | Ga0439457_006669 | Ga0439457_006669_1381_1584 | 67 |
| 1018 | 3300042014 | Ga0439457_027578 | Ga0439457_027578_804_1007 | 67 |
| 1019 | 3300042015 | Ga0439462_0003349 | Ga0439462_0003349_1530_1748 | 67 |
| 1020 | 3300042015 | Ga0439462_0012078 | Ga0439462_0012078_1908_2111 | 67 |
| 1021 | 3300042015 | Ga0439462_0013073 | Ga0439462_0013073_54_257 | 67 |
| 1022 | 3300042015 | Ga0439462_0077392 | Ga0439462_0077392_573_776 | 67 |
| 1023 | 3300042115 | Ga0450911_008837 | Ga0450911_008837_307_510 | 67 |
| 1024 | 3300042115 | Ga0450911_016469 | Ga0450911_016469_590_793 | 67 |
| 1025 | 3300042115 | Ga0450911_017875 | Ga0450911_017875_292_510 | 67 |
| 1026 | 3300042121 | Ga0450919_000012 | Ga0450919_000012_2572_2790 | 67 |
| 1027 | 3300042121 | Ga0450919_001784 | Ga0450919_001784_293_496 | 67 |
| 1028 | 3300042122 | Ga0450920_007814 | Ga0450920_007814_1529_1747 | 67 |
| 1029 | 3300042122 | Ga0450920_126027 | Ga0450920_126027_43_246 | 67 |
| 1030 | 3300042124 | Ga0450922_024543 | Ga0450922_024543_387_605 | 67 |
| 1031 | 3300042131 | Ga0450894_073519 | Ga0450894_073519_12_215 | 67 |
| 1032 | 3300042145 | Ga0450906_014699 | Ga0450906_014699_546_749 | 67 |
| 1033 | 3300042146 | Ga0450907_000308 | Ga0450907_000308_11237_11440 | 67 |
| 1034 | 3300042146 | Ga0450907_001905 | Ga0450907_001905_1529_1747 | 67 |
| 1035 | 3300042147 | Ga0450910_045591 | Ga0450910_045591_241_444 | 67 |
| 1036 | 3300042156 | Ga0439446_0006482 | Ga0439446_0006482_1826_2044 | 67 |
| 1037 | 3300042156 | Ga0439446_0315801 | Ga0439446_0315801_12_215 | 67 |
| 1038 | 3300042157 | Ga0439458_0184367 | Ga0439458_0184367_266_469 | 67 |
| 1039 | 3300042184 | Ga0450908_001115 | Ga0450908_001115_2090_2308 | 67 |
| 1040 | 3300042184 | Ga0450908_004272 | Ga0450908_004272_1571_1774 | 67 |
| 1041 | 3300042185 | Ga0450909_001836 | Ga0450909_001836_1037_1255 | 67 |
| 1042 | 3300042185 | Ga0450909_020841 | Ga0450909_020841_368_571 | 67 |
| 1043 | 3300042185 | Ga0450909_038462 | Ga0450909_038462_302_505 | 67 |
| 1044 | 3300042435 | Ga0439434_0000231 | Ga0439434_0000231_8570_8788 | 67 |
| 1045 | 3300042435 | Ga0439434_0012022 | Ga0439434_0012022_341_544 | 67 |
| 1046 | 3300042531 | Ga0450918_004338 | Ga0450918_004338_1726_1929 | 67 |
| 1047 | 3300042531 | Ga0450918_004412 | Ga0450918_004412_383_601 | 67 |
| 1048 | 3300042876 | Ga0451577_0014128 | Ga0451577_0014128_7139_7342 | 67 |
| 1049 | 3300042876 | Ga0451577_0050819 | Ga0451577_0050819_2291_2494 | 67 |
| 1050 | 3300042876 | Ga0451577_0128561 | Ga0451577_0128561_2009_2212 | 67 |
| 1051 | 3300044656 | Ga0466969_0162001 | Ga0466969_0162001_74_277 | 67 |
| 1052 | 3300044656 | Ga0466969_0505183 | Ga0466969_0505183_28_234 | 67 |
| 1053 | 3300044658 | Ga0466972_0112550 | Ga0466972_0112550_82_285 | 67 |
| 1054 | 3300044658 | Ga0466972_0230080 | Ga0466972_0230080_424_627 | 67 |
| 1055 | 3300044658 | Ga0466972_0393401 | Ga0466972_0393401_387_593 | 67 |
| 1056 | 3300044673 | Ga0453683_0048494 | Ga0453683_0048494_1676_1879 | 67 |
| 1057 | 3300044673 | Ga0453683_0129992 | Ga0453683_0129992_230_433 | 67 |
| 1058 | 3300044673 | Ga0453683_0147082 | Ga0453683_0147082_682_888 | 67 |
| 1059 | 3300044673 | Ga0453683_1115461 | Ga0453683_1115461_305_508 | 67 |
| 1060 | 3300044683 | Ga0466965_0051221 | Ga0466965_0051221_957_1160 | 67 |
| 1061 | 3300044684 | Ga0466966_0007964 | Ga0466966_0007964_3250_3456 | 67 |
| 1062 | 3300044684 | Ga0466966_0770770 | Ga0466966_0770770_10_213 | 67 |
| 1063 | 3300044684 | Ga0466966_0854820 | Ga0466966_0854820_300_503 | 67 |
| 1064 | 3300044684 | Ga0466966_0998319 | Ga0466966_0998319_283_486 | 67 |
| 1065 | 3300044693 | Ga0466961_0006228 | Ga0466961_0006228_7141_7344 | 67 |
| 1066 | 3300044693 | Ga0466961_0032065 | Ga0466961_0032065_861_1064 | 67 |
| 1067 | 3300044693 | Ga0466961_0039290 | Ga0466961_0039290_1930_2136 | 67 |
| 1068 | 3300044693 | Ga0466961_0048204 | Ga0466961_0048204_119_322 | 67 |
| 1069 | 3300044693 | Ga0466961_0338980 | Ga0466961_0338980_462_665 | 67 |
| 1070 | 3300044694 | Ga0466963_0119372 | Ga0466963_0119372_734_937 | 67 |
| 1071 | 3300044694 | Ga0466963_0579048 | Ga0466963_0579048_221_424 | 67 |
| 1072 | 3300044694 | Ga0466963_0919926 | Ga0466963_0919926_215_421 | 67 |
| 1073 | 3300044712 | Ga0453684_0012179 | Ga0453684_0012179_693_896 | 67 |
| 1074 | 3300044719 | Ga0466971_0190511 | Ga0466971_0190511_496_699 | 67 |
| 1075 | 3300044735 | Ga0466968_0010303 | Ga0466968_0010303_2856_3062 | 67 |
| 1076 | 3300044735 | Ga0466968_0216792 | Ga0466968_0216792_320_526 | 67 |
| 1077 | 3300044735 | Ga0466968_0742086 | Ga0466968_0742086_264_467 | 67 |
| 1078 | 3300044765 | Ga0466970_0000055 | Ga0466970_0000055_13561_13764 | 67 |
| 1079 | 3300044765 | Ga0466970_0002327 | Ga0466970_0002327_2664_2870 | 67 |
| 1080 | 3300044765 | Ga0466970_0009014 | Ga0466970_0009014_2608_2811 | 67 |
| 1081 | 3300044765 | Ga0466970_0086594 | Ga0466970_0086594_902_1105 | 67 |
| 1082 | 3300044765 | Ga0466970_0086932 | Ga0466970_0086932_653_859 | 67 |
| 1083 | 3300044765 | Ga0466970_0247452 | Ga0466970_0247452_739_945 | 67 |
| 1084 | 3300044765 | Ga0466970_0823343 | Ga0466970_0823343_30_233 | 67 |
| 1085 | 3300044765 | Ga0466970_0872377 | Ga0466970_0872377_305_508 | 67 |
| 1086 | 3300044842 | Ga0466957_0025992 | Ga0466957_0025992_2639_2845 | 67 |
| 1087 | 3300044842 | Ga0466957_0118149 | Ga0466957_0118149_1233_1436 | 67 |
| 1088 | 3300044842 | Ga0466957_1299102 | Ga0466957_1299102_86_289 | 67 |
| 1089 | 3300044901 | Ga0466960_0102179 | Ga0466960_0102179_1165_1371 | 67 |
| 1090 | 3300044901 | Ga0466960_0151059 | Ga0466960_0151059_462_665 | 67 |
| 1091 | 3300044901 | Ga0466960_0345090 | Ga0466960_0345090_52_255 | 67 |
| 1092 | 3300044901 | Ga0466960_0446825 | Ga0466960_0446825_258_464 | 67 |
| 1093 | 3300045049 | Ga0466959_0001374 | Ga0466959_0001374_2668_2874 | 67 |
| 1094 | 3300045049 | Ga0466959_0004730 | Ga0466959_0004730_3353_3559 | 67 |
| 1095 | 3300045049 | Ga0466959_0660839 | Ga0466959_0660839_99_302 | 67 |
| 1096 | 3300045049 | Ga0466959_1026321 | Ga0466959_1026321_112_315 | 67 |
| 1097 | 3300045051 | Ga0451576_0001029 | Ga0451576_0001029_19896_20102 | 67 |
| 1098 | 3300045051 | Ga0451576_0068343 | Ga0451576_0068343_2665_2868 | 67 |
| 1099 | 3300045051 | Ga0451576_0214471 | Ga0451576_0214471_1433_1636 | 67 |
| 1100 | 3300045051 | Ga0451576_0455613 | Ga0451576_0455613_245_448 | 67 |
| 1101 | 3300045976 | Ga0466967_0911577 | Ga0466967_0911577_128_331 | 67 |
| 1102 | 3300045976 | Ga0466967_1221047 | Ga0466967_1221047_97_300 | 67 |
| 1103 | 3300045976 | Ga0466967_1284178 | Ga0466967_1284178_412_618 | 67 |
| 1104 | 3300045976 | Ga0466967_2571254 | Ga0466967_2571254_102_329 | 67 |
| 1105 | 3300046454 | Ga0495592_0077419 | Ga0495592_0077419_1154_1360 | 67 |
| 1106 | 3300046457 | Ga0495590_0000299 | Ga0495590_0000299_11463_11666 | 67 |
| 1107 | 3300046458 | Ga0495591_014573 | Ga0495591_014573_1830_2075 | 67 |
| 1108 | 3300046459 | Ga0495629_0051856 | Ga0495629_0051856_1082_1285 | 67 |
| 1109 | 3300046459 | Ga0495629_0286927 | Ga0495629_0286927_476_682 | 67 |
| 1110 | 3300046459 | Ga0495629_0521741 | Ga0495629_0521741_534_737 | 67 |
| 1111 | 3300046460 | Ga0495638_0215485 | Ga0495638_0215485_638_850 | 67 |
| 1112 | 3300046460 | Ga0495638_0275826 | Ga0495638_0275826_700_903 | 67 |
| 1113 | 3300046463 | Ga0495653_0030310 | Ga0495653_0030310_3448_3651 | 67 |
| 1114 | 3300046463 | Ga0495653_0076958 | Ga0495653_0076958_2100_2303 | 67 |
| 1115 | 3300046471 | Ga0495650_0000474 | Ga0495650_0000474_45848_46051 | 67 |
| 1116 | 3300046472 | Ga0495580_0008811 | Ga0495580_0008811_230_433 | 67 |
| 1117 | 3300046472 | Ga0495580_0352475 | Ga0495580_0352475_21_224 | 67 |
| 1118 | 3300046472 | Ga0495580_0414220 | Ga0495580_0414220_261_464 | 67 |
| 1119 | 3300046473 | Ga0495582_0213070 | Ga0495582_0213070_50_253 | 67 |
| 1120 | 3300046475 | Ga0495639_0002597 | Ga0495639_0002597_615_818 | 67 |
| 1121 | 3300046476 | Ga0495662_0032943 | Ga0495662_0032943_557_760 | 67 |
| 1122 | 3300046477 | Ga0495664_0012743 | Ga0495664_0012743_1450_1653 | 67 |
| 1123 | 3300046492 | Ga0495585_0283120 | Ga0495585_0283120_530_733 | 67 |
| 1124 | 3300046499 | Ga0495594_0071733 | Ga0495594_0071733_12_215 | 67 |
| 1125 | 3300046499 | Ga0495594_0864155 | Ga0495594_0864155_143_346 | 67 |
| 1126 | 3300046506 | Ga0495583_0150527 | Ga0495583_0150527_118_321 | 67 |
| 1127 | 3300046506 | Ga0495583_0208673 | Ga0495583_0208673_535_738 | 67 |
| 1128 | 3300046507 | Ga0495606_0359042 | Ga0495606_0359042_535_738 | 67 |
| 1129 | 3300046507 | Ga0495606_0579260 | Ga0495606_0579260_142_345 | 67 |
| 1130 | 3300046514 | Ga0495618_0085855 | Ga0495618_0085855_876_1082 | 67 |
| 1131 | 3300046516 | Ga0495628_0929415 | Ga0495628_0929415_329_535 | 67 |
| 1132 | 3300046517 | Ga0495630_0363768 | Ga0495630_0363768_853_1056 | 67 |
| 1133 | 3300046518 | Ga0495631_0064693 | Ga0495631_0064693_561_764 | 67 |
| 1134 | 3300046519 | Ga0495632_0165084 | Ga0495632_0165084_223_426 | 67 |
| 1135 | 3300046524 | Ga0495648_0336888 | Ga0495648_0336888_350_553 | 67 |
| 1136 | 3300046526 | Ga0495666_0508700 | Ga0495666_0508700_261_464 | 67 |
| 1137 | 3300046530 | Ga0495654_0033163 | Ga0495654_0033163_606_851 | 67 |
| 1138 | 3300046530 | Ga0495654_0314740 | Ga0495654_0314740_49_252 | 67 |
| 1139 | 3300046530 | Ga0495654_0339648 | Ga0495654_0339648_239_442 | 67 |
| 1140 | 3300046531 | Ga0495665_0001291 | Ga0495665_0001291_5143_5346 | 67 |
| 1141 | 3300046531 | Ga0495665_0021883 | Ga0495665_0021883_1116_1319 | 67 |
| 1142 | 3300046531 | Ga0495665_0236591 | Ga0495665_0236591_694_897 | 67 |
| 1143 | 3300046533 | Ga0495640_0144418 | Ga0495640_0144418_101_307 | 67 |
| 1144 | 3300046535 | Ga0495586_0024557 | Ga0495586_0024557_419_622 | 67 |
| 1145 | 3300046535 | Ga0495586_0040492 | Ga0495586_0040492_1125_1331 | 67 |
| 1146 | 3300046536 | Ga0495587_0005826 | Ga0495587_0005826_5741_5944 | 67 |
| 1147 | 3300046543 | Ga0495645_0014732 | Ga0495645_0014732_5038_5241 | 67 |
| 1148 | 3300046543 | Ga0495645_0032859 | Ga0495645_0032859_188_391 | 67 |
| 1149 | 3300046557 | Ga0495622_0409393 | Ga0495622_0409393_36_239 | 67 |
| 1150 | 3300046558 | Ga0495633_0160556 | Ga0495633_0160556_689_892 | 67 |
| 1151 | 3300046559 | Ga0495667_0029880 | Ga0495667_0029880_1144_1347 | 67 |
| 1152 | 3300046559 | Ga0495667_0038040 | Ga0495667_0038040_702_908 | 67 |
| 1153 | 3300046559 | Ga0495667_0874373 | Ga0495667_0874373_61_264 | 67 |
| 1154 | 3300046615 | Ga0495656_0004079 | Ga0495656_0004079_4399_4602 | 67 |
| 1155 | 3300046615 | Ga0495656_0152222 | Ga0495656_0152222_868_1074 | 67 |
| 1156 | 3300046616 | Ga0495668_0814608 | Ga0495668_0814608_265_468 | 67 |
| 1157 | 3300046642 | Ga0495634_0122562 | Ga0495634_0122562_1130_1336 | 67 |
| 1158 | 3300046648 | Ga0495611_0358968 | Ga0495611_0358968_408_611 | 67 |
| 1159 | 3300046660 | Ga0495625_0618425 | Ga0495625_0618425_259_471 | 67 |
| 1160 | 3300046663 | Ga0495635_0096007 | Ga0495635_0096007_1139_1345 | 67 |
| 1161 | 3300046663 | Ga0495635_0156730 | Ga0495635_0156730_1132_1335 | 67 |
| 1162 | 3300046664 | Ga0495659_0149392 | Ga0495659_0149392_718_921 | 67 |
| 1163 | 3300046674 | Ga0495588_0001739 | Ga0495588_0001739_6697_6900 | 67 |
| 1164 | 3300046674 | Ga0495588_0022049 | Ga0495588_0022049_1581_1784 | 67 |
| 1165 | 3300046674 | Ga0495588_0049220 | Ga0495588_0049220_373_576 | 67 |
| 1166 | 3300046674 | Ga0495588_0117980 | Ga0495588_0117980_397_600 | 67 |
| 1167 | 3300046674 | Ga0495588_0259755 | Ga0495588_0259755_696_899 | 67 |
| 1168 | 3300046675 | Ga0495657_0691121 | Ga0495657_0691121_283_486 | 67 |
| 1169 | 3300046691 | Ga0495670_0001877 | Ga0495670_0001877_5577_5780 | 67 |
| 1170 | 3300046691 | Ga0495670_0775590 | Ga0495670_0775590_135_338 | 67 |
| 1171 | 3300046692 | Ga0495671_0326119 | Ga0495671_0326119_71_274 | 67 |
| 1172 | 3300046694 | Ga0495649_0031008 | Ga0495649_0031008_1916_2161 | 67 |
| 1173 | 3300046809 | Ga0495600_0015732 | Ga0495600_0015732_4320_4523 | 67 |
| 1174 | 3300046810 | Ga0495660_0235900 | Ga0495660_0235900_86_289 | 67 |
| 1175 | 3300047315 | Ga0495581_0001511 | Ga0495581_0001511_4034_4237 | 67 |
| 1176 | 3300047315 | Ga0495581_0012051 | Ga0495581_0012051_290_493 | 67 |
| 1177 | 3300047315 | Ga0495581_0017028 | Ga0495581_0017028_2912_3115 | 67 |
| 1178 | 3300047317 | Ga0495604_0758318 | Ga0495604_0758318_63_266 | 67 |
| 1179 | 3300047318 | Ga0495636_0006129 | Ga0495636_0006129_1925_2128 | 67 |
| 1180 | 3300047319 | Ga0495674_0236146 | Ga0495674_0236146_1256_1459 | 67 |
| 1181 | 3300047320 | Ga0495672_0019264 | Ga0495672_0019264_4052_4255 | 67 |
| 1182 | 3300047320 | Ga0495672_0370373 | Ga0495672_0370373_245_448 | 67 |
| 1183 | 3300047321 | Ga0495676_0221974 | Ga0495676_0221974_113_316 | 67 |
| 1184 | 3300047322 | Ga0495680_0150219 | Ga0495680_0150219_317_520 | 67 |
| 1185 | 3300047322 | Ga0495680_0944236 | Ga0495680_0944236_329_535 | 67 |
| 1186 | 3300047444 | Ga0495675_0079559 | Ga0495675_0079559_491_694 | 67 |
| 1187 | 3300047445 | Ga0495677_0390075 | Ga0495677_0390075_34_237 | 67 |
| 1188 | 3300047445 | Ga0495677_0458341 | Ga0495677_0458341_194_397 | 67 |
| 1189 | 3300047446 | Ga0495679_006855 | Ga0495679_006855_228_473 | 67 |
| 1190 | 3300047447 | Ga0495685_005367 | Ga0495685_005367_1175_1378 | 67 |
| 1191 | 3300047447 | Ga0495685_199418 | Ga0495685_199418_142_345 | 67 |
| 1192 | 3300047471 | Ga0495684_0537386 | Ga0495684_0537386_198_401 | 67 |
| 1193 | 3300047472 | Ga0495686_0010064 | Ga0495686_0010064_68_271 | 67 |
| 1194 | 3300047472 | Ga0495686_0077884 | Ga0495686_0077884_1107_1319 | 67 |
| 1195 | 3300047673 | Ga0495593_0071938 | Ga0495593_0071938_518_721 | 67 |
| 1196 | 3300047673 | Ga0495593_0150797 | Ga0495593_0150797_170_373 | 67 |
| 1197 | 3300048090 | Ga0495615_0194990 | Ga0495615_0194990_157_360 | 67 |
| 1198 | 3300048903 | Ga0496100_0000039 | Ga0496100_0000039_8650_8853 | 67 |
| 1199 | 3300048903 | Ga0496100_0078944 | Ga0496100_0078944_694_897 | 67 |
| 1200 | 3300048903 | Ga0496100_0444386 | Ga0496100_0444386_111_326 | 67 |
| 1201 | 3300048903 | Ga0496100_1369110 | Ga0496100_1369110_147_350 | 67 |
| 1202 | 3300048903 | Ga0496100_1393389 | Ga0496100_1393389_282_485 | 67 |
| 1203 | 3300048904 | Ga0496101_0000043 | Ga0496101_0000043_130409_130612 | 67 |
| 1204 | 3300048904 | Ga0496101_0004549 | Ga0496101_0004549_3728_3931 | 67 |
| 1205 | 3300048905 | Ga0496102_0014569 | Ga0496102_0014569_677_880 | 67 |
| 1206 | 3300048905 | Ga0496102_0027486 | Ga0496102_0027486_1372_1575 | 67 |
| 1207 | 3300048905 | Ga0496102_0049022 | Ga0496102_0049022_2704_2907 | 67 |
| 1208 | 3300048905 | Ga0496102_0108166 | Ga0496102_0108166_2110_2313 | 67 |
| 1209 | 3300048905 | Ga0496102_0479472 | Ga0496102_0479472_149_352 | 67 |
| 1210 | 3300048905 | Ga0496102_0486219 | Ga0496102_0486219_609_812 | 67 |
| 1211 | 3300048906 | Ga0496103_0001202 | Ga0496103_0001202_13632_13835 | 67 |
| 1212 | 3300048906 | Ga0496103_0060214 | Ga0496103_0060214_429_632 | 67 |
| 1213 | 3300048906 | Ga0496103_0339941 | Ga0496103_0339941_10_213 | 67 |
| 1214 | 3300048906 | Ga0496103_0700312 | Ga0496103_0700312_296_499 | 67 |
| 1215 | 3300048906 | Ga0496103_0768880 | Ga0496103_0768880_118_321 | 67 |
| 1216 | 3300048907 | Ga0496104_0457445 | Ga0496104_0457445_548_751 | 67 |
| 1217 | 3300048907 | Ga0496104_1086940 | Ga0496104_1086940_148_351 | 67 |
| 1218 | 3300048907 | Ga0496104_1684992 | Ga0496104_1684992_182_385 | 67 |
| 1219 | 3300048908 | Ga0496105_0353105 | Ga0496105_0353105_441_644 | 67 |
| 1220 | 3300048908 | Ga0496105_0500816 | Ga0496105_0500816_579_782 | 67 |
| 1221 | 3300048908 | Ga0496105_0833650 | Ga0496105_0833650_65_268 | 67 |
| 1222 | 3300048909 | Ga0496106_0001390 | Ga0496106_0001390_11977_12180 | 67 |
| 1223 | 3300048909 | Ga0496106_0073299 | Ga0496106_0073299_1336_1539 | 67 |
| 1224 | 3300048909 | Ga0496106_1117427 | Ga0496106_1117427_370_573 | 67 |
| 1225 | 3300048910 | Ga0496107_0000922 | Ga0496107_0000922_831_1034 | 67 |
| 1226 | 3300048910 | Ga0496107_0120432 | Ga0496107_0120432_488_691 | 67 |
| 1227 | 3300048910 | Ga0496107_0212317 | Ga0496107_0212317_446_649 | 67 |
| 1228 | 3300048911 | Ga0496108_0001472 | Ga0496108_0001472_13298_13501 | 67 |
| 1229 | 3300048911 | Ga0496108_0100844 | Ga0496108_0100844_687_890 | 67 |
| 1230 | 3300048911 | Ga0496108_0551025 | Ga0496108_0551025_759_962 | 67 |
| 1231 | 3300048911 | Ga0496108_0601335 | Ga0496108_0601335_546_749 | 67 |
| 1232 | 3300048912 | Ga0496109_0000145 | Ga0496109_0000145_31017_31220 | 67 |
| 1233 | 3300048912 | Ga0496109_0057047 | Ga0496109_0057047_1451_1654 | 67 |
| 1234 | 3300048912 | Ga0496109_0057729 | Ga0496109_0057729_1805_2008 | 67 |
| 1235 | 3300048912 | Ga0496109_0099545 | Ga0496109_0099545_507_710 | 67 |
| 1236 | 3300048912 | Ga0496109_0116031 | Ga0496109_0116031_2270_2473 | 67 |
| 1237 | 3300048912 | Ga0496109_0126816 | Ga0496109_0126816_290_493 | 67 |
| 1238 | 3300048912 | Ga0496109_0703843 | Ga0496109_0703843_37_240 | 67 |
| 1239 | 3300048912 | Ga0496109_0888766 | Ga0496109_0888766_469_672 | 67 |
| 1240 | 3300048913 | Ga0496110_0014371 | Ga0496110_0014371_1572_1775 | 67 |
| 1241 | 3300048913 | Ga0496110_0100279 | Ga0496110_0100279_1988_2191 | 67 |
| 1242 | 3300048913 | Ga0496110_0120747 | Ga0496110_0120747_515_718 | 67 |
| 1243 | 3300048913 | Ga0496110_0702154 | Ga0496110_0702154_673_876 | 67 |
| 1244 | 3300048914 | Ga0496111_0087480 | Ga0496111_0087480_1613_1816 | 67 |
| 1245 | 3300048914 | Ga0496111_0091624 | Ga0496111_0091624_99_302 | 67 |
| 1246 | 3300048914 | Ga0496111_1110920 | Ga0496111_1110920_303_506 | 67 |
| 1247 | 3300048915 | Ga0496112_0033971 | Ga0496112_0033971_2672_2875 | 67 |
| 1248 | 3300048915 | Ga0496112_0049201 | Ga0496112_0049201_464_667 | 67 |
| 1249 | 3300048915 | Ga0496112_0078841 | Ga0496112_0078841_2254_2457 | 67 |
| 1250 | 3300048915 | Ga0496112_0216149 | Ga0496112_0216149_1567_1770 | 67 |
| 1251 | 3300048915 | Ga0496112_0391314 | Ga0496112_0391314_968_1171 | 67 |
| 1252 | 3300048915 | Ga0496112_0703160 | Ga0496112_0703160_461_664 | 67 |
| 1253 | 3300048916 | Ga0496113_0107912 | Ga0496113_0107912_1016_1219 | 67 |
| 1254 | 3300048916 | Ga0496113_0660892 | Ga0496113_0660892_11_214 | 67 |
| 1255 | 3300048916 | Ga0496113_1091396 | Ga0496113_1091396_321_524 | 67 |
| 1256 | 3300048917 | Ga0496114_0000219 | Ga0496114_0000219_31026_31229 | 67 |
| 1257 | 3300048917 | Ga0496114_0014191 | Ga0496114_0014191_4938_5141 | 67 |
| 1258 | 3300048917 | Ga0496114_0092010 | Ga0496114_0092010_2140_2343 | 67 |
| 1259 | 3300048917 | Ga0496114_1363013 | Ga0496114_1363013_354_557 | 67 |
| 1260 | 3300048917 | Ga0496114_1718828 | Ga0496114_1718828_267_470 | 67 |
| 1261 | 3300048918 | Ga0496115_0014990 | Ga0496115_0014990_4236_4439 | 67 |
| 1262 | 3300048918 | Ga0496115_0179927 | Ga0496115_0179927_156_359 | 67 |
| 1263 | 3300048918 | Ga0496115_0735458 | Ga0496115_0735458_46_249 | 67 |
| 1264 | 3300048919 | Ga0496116_0134410 | Ga0496116_0134410_814_1017 | 67 |
| 1265 | 3300048920 | Ga0496117_0069536 | Ga0496117_0069536_165_368 | 67 |
| 1266 | 3300048920 | Ga0496117_0093402 | Ga0496117_0093402_933_1136 | 67 |
| 1267 | 3300048920 | Ga0496117_0129596 | Ga0496117_0129596_814_1017 | 67 |
| 1268 | 3300048920 | Ga0496117_0547361 | Ga0496117_0547361_309_512 | 67 |
| 1269 | 3300048921 | Ga0496118_0095230 | Ga0496118_0095230_1734_1937 | 67 |
| 1270 | 3300048921 | Ga0496118_0140520 | Ga0496118_0140520_814_1017 | 67 |
| 1271 | 3300048921 | Ga0496118_0322667 | Ga0496118_0322667_366_569 | 67 |
| 1272 | 3300048922 | Ga0496119_0002652 | Ga0496119_0002652_18665_18868 | 67 |
| 1273 | 3300048922 | Ga0496119_0010789 | Ga0496119_0010789_5345_5548 | 67 |
| 1274 | 3300048922 | Ga0496119_0112425 | Ga0496119_0112425_794_997 | 67 |
| 1275 | 3300048923 | Ga0496120_0006209 | Ga0496120_0006209_7455_7658 | 67 |
| 1276 | 3300048923 | Ga0496120_0018797 | Ga0496120_0018797_2965_3168 | 67 |
| 1277 | 3300048923 | Ga0496120_0075819 | Ga0496120_0075819_1095_1298 | 67 |
| 1278 | 3300048923 | Ga0496120_0315952 | Ga0496120_0315952_370_573 | 67 |
| 1279 | 3300048923 | Ga0496120_0404508 | Ga0496120_0404508_28_231 | 67 |
| 1280 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_31044_31247 | 67 |
| 1281 | 3300048924 | Ga0496121_0404428 | Ga0496121_0404428_53_256 | 67 |
| 1282 | 3300048925 | Ga0496122_0001790 | Ga0496122_0001790_31044_31247 | 67 |
| 1283 | 3300048926 | Ga0496123_0005125 | Ga0496123_0005125_8413_8628 | 67 |
| 1284 | 3300048926 | Ga0496123_0010252 | Ga0496123_0010252_6845_7048 | 67 |
| 1285 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_1463342_1463545 | 67 |
| 1286 | 3300048927 | Ga0496124_0091025 | Ga0496124_0091025_1510_1755 | 67 |
| 1287 | 3300048927 | Ga0496124_0102040 | Ga0496124_0102040_269_472 | 67 |
| 1288 | 3300048927 | Ga0496124_0375015 | Ga0496124_0375015_236_439 | 67 |
| 1289 | 3300048927 | Ga0496124_0856058 | Ga0496124_0856058_298_501 | 67 |
| 1290 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_31044_31247 | 67 |
| 1291 | 3300048928 | Ga0496125_0076977 | Ga0496125_0076977_2361_2564 | 67 |
| 1292 | 3300048928 | Ga0496125_0081127 | Ga0496125_0081127_2058_2261 | 67 |
| 1293 | 3300048928 | Ga0496125_0156864 | Ga0496125_0156864_801_1004 | 67 |
| 1294 | 3300048929 | Ga0496126_0000009 | Ga0496126_0000009_719104_719307 | 67 |
| 1295 | 3300048929 | Ga0496126_1067892 | Ga0496126_1067892_325_528 | 67 |
| 1296 | 3300049127 | Ga0501306_004106 | Ga0501306_004106_589_792 | 67 |
| 1297 | 3300049127 | Ga0501306_063417 | Ga0501306_063417_360_563 | 67 |
| 1298 | 3300049128 | Ga0501308_058468 | Ga0501308_058468_328_531 | 67 |
| 1299 | 3300049129 | Ga0501309_044547 | Ga0501309_044547_327_530 | 67 |
| 1300 | 3300049132 | Ga0501343_028807 | Ga0501343_028807_23_229 | 67 |
| 1301 | 3300049160 | Ga0501304_044837 | Ga0501304_044837_252_455 | 67 |
| 1302 | 3300049161 | Ga0501305_016403 | Ga0501305_016403_674_877 | 67 |
| 1303 | 3300049527 | Ga0501311_066454 | Ga0501311_066454_33_236 | 67 |
| 1304 | 3300049528 | Ga0501312_000972 | Ga0501312_000972_2274_2477 | 67 |
| 1305 | 3300049528 | Ga0501312_066216 | Ga0501312_066216_276_482 | 67 |
| 1306 | 3300049529 | Ga0501313_049590 | Ga0501313_049590_339_542 | 67 |
| 1307 | 3300049529 | Ga0501313_064311 | Ga0501313_064311_276_482 | 67 |
| 1308 | 3300049530 | Ga0501314_016286 | Ga0501314_016286_481_684 | 67 |
| 1309 | 3300049532 | Ga0501316_058754 | Ga0501316_058754_52_255 | 67 |
| 1310 | 3300049532 | Ga0501316_066726 | Ga0501316_066726_53_256 | 67 |
| 1311 | 3300049532 | Ga0501316_074888 | Ga0501316_074888_271_477 | 67 |
| 1312 | 3300049533 | Ga0501317_007238 | Ga0501317_007238_860_1063 | 67 |
| 1313 | 3300049533 | Ga0501317_008434 | Ga0501317_008434_948_1151 | 67 |
| 1314 | 3300049534 | Ga0501318_004887 | Ga0501318_004887_975_1178 | 67 |
| 1315 | 3300049536 | Ga0501320_001640 | Ga0501320_001640_1400_1603 | 67 |
| 1316 | 3300049536 | Ga0501320_024448 | Ga0501320_024448_477_683 | 67 |
| 1317 | 3300049537 | Ga0501321_001128 | Ga0501321_001128_972_1175 | 67 |
| 1318 | 3300049537 | Ga0501321_029022 | Ga0501321_029022_345_548 | 67 |
| 1319 | 3300049538 | Ga0501322_027409 | Ga0501322_027409_50_253 | 67 |
| 1320 | 3300049539 | Ga0501323_050716 | Ga0501323_050716_177_380 | 67 |
| 1321 | 3300049540 | Ga0501324_001209 | Ga0501324_001209_1288_1491 | 67 |
| 1322 | 3300049540 | Ga0501324_027992 | Ga0501324_027992_254_457 | 67 |
| 1323 | 3300049541 | Ga0501325_000289 | Ga0501325_000289_964_1167 | 67 |
| 1324 | 3300049541 | Ga0501325_008895 | Ga0501325_008895_660_863 | 67 |
| 1325 | 3300049546 | Ga0501330_010028 | Ga0501330_010028_91_294 | 67 |
| 1326 | 3300049546 | Ga0501330_017478 | Ga0501330_017478_242_445 | 67 |
| 1327 | 3300049551 | Ga0501335_014234 | Ga0501335_014234_437_640 | 67 |
| 1328 | 3300049568 | Ga0501031_0000119 | Ga0501031_0000119_7055_7258 | 67 |
| 1329 | 3300049569 | Ga0501032_0000052 | Ga0501032_0000052_30232_30435 | 67 |
| 1330 | 3300049569 | Ga0501032_0000405 | Ga0501032_0000405_16213_16416 | 67 |
| 1331 | 3300049569 | Ga0501032_0002093 | Ga0501032_0002093_15447_15650 | 67 |
| 1332 | 3300049569 | Ga0501032_0006637 | Ga0501032_0006637_544_747 | 67 |
| 1333 | 3300049569 | Ga0501032_0241970 | Ga0501032_0241970_576_779 | 67 |
| 1334 | 3300049569 | Ga0501032_0280523 | Ga0501032_0280523_603_815 | 67 |
| 1335 | 3300049569 | Ga0501032_1042480 | Ga0501032_1042480_73_279 | 67 |
| 1336 | 3300049570 | Ga0501033_0000868 | Ga0501033_0000868_1646_1849 | 67 |
| 1337 | 3300049571 | Ga0501034_0020741 | Ga0501034_0020741_1668_1871 | 67 |
| 1338 | 3300049571 | Ga0501034_0208155 | Ga0501034_0208155_1478_1681 | 67 |
| 1339 | 3300049571 | Ga0501034_0211536 | Ga0501034_0211536_831_1034 | 67 |
| 1340 | 3300049571 | Ga0501034_0405593 | Ga0501034_0405593_804_1007 | 67 |
| 1341 | 3300049571 | Ga0501034_0568947 | Ga0501034_0568947_780_983 | 67 |
| 1342 | 3300049571 | Ga0501034_0590054 | Ga0501034_0590054_506_709 | 67 |
| 1343 | 3300049571 | Ga0501034_1014454 | Ga0501034_1014454_404_610 | 67 |
| 1344 | 3300049572 | Ga0501036_0000061 | Ga0501036_0000061_31336_31539 | 67 |
| 1345 | 3300049572 | Ga0501036_0087103 | Ga0501036_0087103_2127_2330 | 67 |
| 1346 | 3300049572 | Ga0501036_0468844 | Ga0501036_0468844_561_764 | 67 |
| 1347 | 3300049573 | Ga0501037_0000046 | Ga0501037_0000046_82420_82623 | 67 |
| 1348 | 3300049573 | Ga0501037_0001587 | Ga0501037_0001587_12158_12361 | 67 |
| 1349 | 3300049573 | Ga0501037_0036548 | Ga0501037_0036548_926_1129 | 67 |
| 1350 | 3300049573 | Ga0501037_0119965 | Ga0501037_0119965_1503_1706 | 67 |
| 1351 | 3300049574 | Ga0501038_0000068 | Ga0501038_0000068_29607_29810 | 67 |
| 1352 | 3300049574 | Ga0501038_0019942 | Ga0501038_0019942_1433_1639 | 67 |
| 1353 | 3300049574 | Ga0501038_0038300 | Ga0501038_0038300_1693_1896 | 67 |
| 1354 | 3300049574 | Ga0501038_0331478 | Ga0501038_0331478_817_1020 | 67 |
| 1355 | 3300049575 | Ga0501039_0002827 | Ga0501039_0002827_5846_6049 | 67 |
| 1356 | 3300049575 | Ga0501039_0063921 | Ga0501039_0063921_1733_1936 | 67 |
| 1357 | 3300049575 | Ga0501039_0187739 | Ga0501039_0187739_1069_1272 | 67 |
| 1358 | 3300049576 | Ga0501040_0047863 | Ga0501040_0047863_303_506 | 67 |
| 1359 | 3300049576 | Ga0501040_0579034 | Ga0501040_0579034_31_237 | 67 |
| 1360 | 3300049577 | Ga0501041_0220280 | Ga0501041_0220280_668_871 | 67 |
| 1361 | 3300049578 | Ga0501042_0624172 | Ga0501042_0624172_123_326 | 67 |
| 1362 | 3300049579 | Ga0501043_0000340 | Ga0501043_0000340_3127_3330 | 67 |
| 1363 | 3300049579 | Ga0501043_0001210 | Ga0501043_0001210_1696_1899 | 67 |
| 1364 | 3300049579 | Ga0501043_0007110 | Ga0501043_0007110_7101_7313 | 67 |
| 1365 | 3300049579 | Ga0501043_0050924 | Ga0501043_0050924_1196_1399 | 67 |
| 1366 | 3300049579 | Ga0501043_0082717 | Ga0501043_0082717_815_1018 | 67 |
| 1367 | 3300049579 | Ga0501043_0877704 | Ga0501043_0877704_14_217 | 67 |
| 1368 | 3300049580 | Ga0501046_0000102 | Ga0501046_0000102_34659_34862 | 67 |
| 1369 | 3300049581 | Ga0501047_0000460 | Ga0501047_0000460_13836_14039 | 67 |
| 1370 | 3300049581 | Ga0501047_0011318 | Ga0501047_0011318_5025_5228 | 67 |
| 1371 | 3300049581 | Ga0501047_0079667 | Ga0501047_0079667_2370_2582 | 67 |
| 1372 | 3300049582 | Ga0501048_0000006 | Ga0501048_0000006_35168_35371 | 67 |
| 1373 | 3300049582 | Ga0501048_0944520 | Ga0501048_0944520_27_230 | 67 |
| 1374 | 3300049583 | Ga0501067_0416975 | Ga0501067_0416975_89_301 | 67 |
| 1375 | 3300049584 | Ga0501068_0008598 | Ga0501068_0008598_5415_5618 | 67 |
| 1376 | 3300049585 | Ga0501069_0005251 | Ga0501069_0005251_3396_3599 | 67 |
| 1377 | 3300049586 | Ga0501070_0000139 | Ga0501070_0000139_33192_33395 | 67 |
| 1378 | 3300049586 | Ga0501070_0033551 | Ga0501070_0033551_972_1175 | 67 |
| 1379 | 3300049586 | Ga0501070_0970605 | Ga0501070_0970605_93_302 | 67 |
| 1380 | 3300049586 | Ga0501070_1371719 | Ga0501070_1371719_23_226 | 67 |
| 1381 | 3300049587 | Ga0501071_0863419 | Ga0501071_0863419_476_679 | 67 |
| 1382 | 3300049588 | Ga0501072_0269920 | Ga0501072_0269920_729_932 | 67 |
| 1383 | 3300049589 | Ga0501073_0038923 | Ga0501073_0038923_1926_2129 | 67 |
| 1384 | 3300049589 | Ga0501073_0912721 | Ga0501073_0912721_21_224 | 67 |
| 1385 | 3300049589 | Ga0501073_1288810 | Ga0501073_1288810_174_377 | 67 |
| 1386 | 3300049590 | Ga0501074_0001182 | Ga0501074_0001182_9983_10186 | 67 |
| 1387 | 3300049591 | Ga0501075_0035573 | Ga0501075_0035573_2859_3065 | 67 |
| 1388 | 3300049591 | Ga0501075_1035878 | Ga0501075_1035878_386_589 | 67 |
| 1389 | 3300049592 | Ga0501076_1152484 | Ga0501076_1152484_354_557 | 67 |
| 1390 | 3300049652 | Ga0501202_182283 | Ga0501202_182283_61_264 | 67 |
| 1391 | 3300049659 | Ga0501214_055591 | Ga0501214_055591_119_325 | 67 |
| 1392 | 3300049665 | Ga0501227_211086 | Ga0501227_211086_170_373 | 67 |
| 1393 | 3300049680 | Ga0501250_106589 | Ga0501250_106589_198_404 | 67 |
| 1394 | 3300049690 | Ga0501261_019768 | Ga0501261_019768_640_843 | 67 |
| 1395 | 3300049708 | Ga0501245_107218 | Ga0501245_107218_221_424 | 67 |
| 1396 | 3300049741 | Ga0501079_0475247 | Ga0501079_0475247_274_477 | 67 |
| 1397 | 3300049741 | Ga0501079_0890292 | Ga0501079_0890292_116_322 | 67 |
| 1398 | 3300049742 | Ga0501080_0003170 | Ga0501080_0003170_8978_9181 | 67 |
| 1399 | 3300049742 | Ga0501080_0240270 | Ga0501080_0240270_476_688 | 67 |
| 1400 | 3300049742 | Ga0501080_0655899 | Ga0501080_0655899_455_658 | 67 |
| 1401 | 3300049743 | Ga0501081_0407581 | Ga0501081_0407581_638_844 | 67 |
| 1402 | 3300049743 | Ga0501081_0708927 | Ga0501081_0708927_59_262 | 67 |
| 1403 | 3300049744 | Ga0501083_0010568 | Ga0501083_0010568_276_479 | 67 |
| 1404 | 3300049744 | Ga0501083_0735121 | Ga0501083_0735121_68_271 | 67 |
| 1405 | 3300049765 | Ga0501268_061854 | Ga0501268_061854_264_467 | 67 |
| 1406 | 3300049767 | Ga0501270_150251 | Ga0501270_150251_222_425 | 67 |
| 1407 | 3300049770 | Ga0501273_084087 | Ga0501273_084087_203_406 | 67 |
| 1408 | 3300049775 | Ga0501279_031763 | Ga0501279_031763_252_455 | 67 |
| 1409 | 3300049775 | Ga0501279_082399 | Ga0501279_082399_180_383 | 67 |
| 1410 | 3300049822 | Ga0501035_0005470 | Ga0501035_0005470_9028_9231 | 67 |
| 1411 | 3300049822 | Ga0501035_0455701 | Ga0501035_0455701_44_256 | 67 |
| 1412 | 3300049822 | Ga0501035_0946228 | Ga0501035_0946228_247_450 | 67 |
| 1413 | 3300049823 | Ga0501044_0000137 | Ga0501044_0000137_32710_32913 | 67 |
| 1414 | 3300049823 | Ga0501044_0032073 | Ga0501044_0032073_2467_2679 | 67 |
| 1415 | 3300049823 | Ga0501044_0074896 | Ga0501044_0074896_1829_2032 | 67 |
| 1416 | 3300049823 | Ga0501044_0238050 | Ga0501044_0238050_361_564 | 67 |
| 1417 | 3300049823 | Ga0501044_0476207 | Ga0501044_0476207_867_1070 | 67 |
| 1418 | 3300049823 | Ga0501044_1466551 | Ga0501044_1466551_89_292 | 67 |
| 1419 | 3300049824 | Ga0501045_0190180 | Ga0501045_0190180_445_648 | 67 |
| 1420 | 3300049824 | Ga0501045_0413511 | Ga0501045_0413511_641_847 | 67 |
| 1421 | 3300049851 | Ga0501212_104866 | Ga0501212_104866_58_261 | 67 |
| 1422 | 3300049851 | Ga0501212_122104 | Ga0501212_122104_33_239 | 67 |
| 1423 | 3300050489 | nmdc:mga03683_244489_c1 | nmdc:mga03683_244489_c1_486_689 | 67 |
| 1424 | 3300050489 | nmdc:mga03683_259401_c1 | nmdc:mga03683_259401_c1_83_286 | 67 |
| 1425 | 3300050489 | nmdc:mga03683_503106_c1 | nmdc:mga03683_503106_c1_325_528 | 67 |
| 1426 | 3300050489 | nmdc:mga03683_92485_c1 | nmdc:mga03683_92485_c1_172_375 | 67 |
| 1427 | 3300050490 | nmdc:mga03n38_750373_c1 | nmdc:mga03n38_750373_c1_61_267 | 67 |
| 1428 | 3300050491 | nmdc:mga00v17_10944_c1 | nmdc:mga00v17_10944_c1_153_356 | 67 |
| 1429 | 3300050491 | nmdc:mga00v17_196814_c1 | nmdc:mga00v17_196814_c1_720_923 | 67 |
| 1430 | 3300050491 | nmdc:mga00v17_2871_c1 | nmdc:mga00v17_2871_c1_2529_2732 | 67 |
| 1431 | 3300050491 | nmdc:mga00v17_544486_c1 | nmdc:mga00v17_544486_c1_440_643 | 67 |
| 1432 | 3300050491 | nmdc:mga00v17_701709_c1 | nmdc:mga00v17_701709_c1_21_224 | 67 |
| 1433 | 3300050492 | nmdc:mga0yw44_76203_c1 | nmdc:mga0yw44_76203_c1_390_593 | 67 |
| 1434 | 3300050492 | nmdc:mga0yw44_799152_c1 | nmdc:mga0yw44_799152_c1_229_432 | 67 |
| 1435 | 3300050492 | nmdc:mga0yw44_926157_c1 | nmdc:mga0yw44_926157_c1_277_480 | 67 |
| 1436 | 3300050493 | nmdc:mga0k408_336534_c1 | nmdc:mga0k408_336534_c1_65_268 | 67 |
| 1437 | 3300050494 | nmdc:mga06z11_690680_c1 | nmdc:mga06z11_690680_c1_396_599 | 67 |
| 1438 | 3300050495 | nmdc:mga04h51_284871_c1 | nmdc:mga04h51_284871_c1_267_470 | 67 |
| 1439 | 3300050496 | nmdc:mga07m45_132281_c2 | nmdc:mga07m45_132281_c2_469_672 | 67 |
| 1440 | 3300050496 | nmdc:mga07m45_202524_c1 | nmdc:mga07m45_202524_c1_124_327 | 67 |
| 1441 | 3300050496 | nmdc:mga07m45_289094_c1 | nmdc:mga07m45_289094_c1_400_603 | 67 |
| 1442 | 3300050496 | nmdc:mga07m45_43749_c1 | nmdc:mga07m45_43749_c1_2159_2362 | 67 |
| 1443 | 3300050496 | nmdc:mga07m45_608452_c1 | nmdc:mga07m45_608452_c1_153_356 | 67 |
| 1444 | 3300050496 | nmdc:mga07m45_625951_c1 | nmdc:mga07m45_625951_c1_230_433 | 67 |
| 1445 | 3300050496 | nmdc:mga07m45_709601_c1 | nmdc:mga07m45_709601_c1_279_485 | 67 |
| 1446 | 3300050496 | nmdc:mga07m45_788412_c1 | nmdc:mga07m45_788412_c1_163_366 | 67 |
| 1447 | 3300050507 | nmdc:mga05p37_1862486_c1 | nmdc:mga05p37_1862486_c1_173_376 | 67 |
| 1448 | 3300050510 | nmdc:mga06r32_211219_c1 | nmdc:mga06r32_211219_c1_902_1105 | 67 |
| 1449 | 3300050510 | nmdc:mga06r32_41763_c2 | nmdc:mga06r32_41763_c2_1591_1797 | 67 |
| 1450 | 3300050512 | nmdc:mga0n895_65601_c1 | nmdc:mga0n895_65601_c1_750_953 | 67 |
| 1451 | 3300050512 | nmdc:mga0n895_82086_c1 | nmdc:mga0n895_82086_c1_1148_1351 | 67 |
| 1452 | 3300050513 | nmdc:mga0rr50_1547388_c1 | nmdc:mga0rr50_1547388_c1_278_481 | 67 |
| 1453 | 3300050513 | nmdc:mga0rr50_739426_c1 | nmdc:mga0rr50_739426_c1_289_492 | 67 |
| 1454 | 3300050513 | nmdc:mga0rr50_97288_c1 | nmdc:mga0rr50_97288_c1_1469_1672 | 67 |
| 1455 | 3300050515 | nmdc:mga0a205_16343_c1 | nmdc:mga0a205_16343_c1_176_379 | 67 |
| 1456 | 3300050515 | nmdc:mga0a205_36939_c1 | nmdc:mga0a205_36939_c1_2895_3098 | 67 |
| 1457 | 3300050515 | nmdc:mga0a205_62517_c1 | nmdc:mga0a205_62517_c1_2230_2433 | 67 |
| 1458 | 3300050516 | nmdc:mga0sz30_35896_c1 | nmdc:mga0sz30_35896_c1_464_667 | 67 |
| 1459 | 3300050516 | nmdc:mga0sz30_89013_c1 | nmdc:mga0sz30_89013_c1_434_637 | 67 |
| 1460 | 3300053077 | Ga0495601_0072154 | Ga0495601_0072154_871_1077 | 67 |
| 1461 | 3300053083 | Ga0495655_0262770 | Ga0495655_0262770_72_275 | 67 |
| 1462 | 3300053084 | Ga0495595_0022145 | Ga0495595_0022145_695_901 | 67 |
| 1463 | 3300053085 | Ga0495619_0389739 | Ga0495619_0389739_701_907 | 67 |
| 1464 | 3300053085 | Ga0495619_1080713 | Ga0495619_1080713_306_509 | 67 |
| 1465 | 3300053086 | Ga0500578_0006193 | Ga0500578_0006193_5987_6199 | 67 |
| 1466 | 3300053087 | Ga0500643_113661 | Ga0500643_113661_310_522 | 67 |
| 1467 | 3300053088 | Ga0500644_0142328 | Ga0500644_0142328_255_467 | 67 |
| 1468 | 3300053092 | Ga0500583_0498343 | Ga0500583_0498343_312_524 | 67 |
| 1469 | 3300053093 | Ga0500651_0001759 | Ga0500651_0001759_5226_5429 | 67 |
| 1470 | 3300053093 | Ga0500651_0104729 | Ga0500651_0104729_1043_1255 | 67 |
| 1471 | 3300053093 | Ga0500651_0571555 | Ga0500651_0571555_304_516 | 67 |
| 1472 | 3300053096 | Ga0500641_0004090 | Ga0500641_0004090_2413_2625 | 67 |
| 1473 | 3300053098 | Ga0500650_0058819 | Ga0500650_0058819_750_962 | 67 |
| 1474 | 3300053098 | Ga0500650_0111097 | Ga0500650_0111097_80_292 | 67 |
| 1475 | 3300053109 | Ga0500569_293315 | Ga0500569_293315_232_444 | 67 |
| 1476 | 3300053129 | Ga0500628_174259 | Ga0500628_174259_253_465 | 67 |
| 1477 | 3300053133 | Ga0500655_094324 | Ga0500655_094324_259_471 | 67 |
| 1478 | 3300053133 | Ga0500655_132263 | Ga0500655_132263_226_438 | 67 |
| 1479 | 3300053134 | Ga0500658_0006898 | Ga0500658_0006898_1642_1854 | 67 |
| 1480 | 3300053136 | Ga0500559_0251206 | Ga0500559_0251206_233_436 | 67 |
| 1481 | 3300053138 | Ga0500564_198001 | Ga0500564_198001_158_361 | 67 |
| 1482 | 3300053139 | Ga0500568_0065623 | Ga0500568_0065623_249_452 | 67 |
| 1483 | 3300053139 | Ga0500568_0100324 | Ga0500568_0100324_94_297 | 67 |
| 1484 | 3300053142 | Ga0500577_0228244 | Ga0500577_0228244_207_419 | 67 |
| 1485 | 3300053146 | Ga0500588_0039510 | Ga0500588_0039510_1013_1216 | 67 |
| 1486 | 3300053146 | Ga0500588_0296993 | Ga0500588_0296993_34_246 | 67 |
| 1487 | 3300053148 | Ga0500590_004888 | Ga0500590_004888_1648_1851 | 67 |
| 1488 | 3300053151 | Ga0500604_0066940 | Ga0500604_0066940_595_807 | 67 |
| 1489 | 3300053153 | Ga0500616_0000779 | Ga0500616_0000779_7672_7884 | 67 |
| 1490 | 3300053155 | Ga0500620_000231 | Ga0500620_000231_4535_4738 | 67 |
| 1491 | 3300053156 | Ga0500622_0170332 | Ga0500622_0170332_419_631 | 67 |
| 1492 | 3300053727 | Ga0500611_061588 | Ga0500611_061588_267_479 | 67 |
| 1493 | 3300053730 | Ga0500645_065092 | Ga0500645_065092_201_413 | 67 |
| 1494 | 3300053731 | Ga0500609_001519 | Ga0500609_001519_445_657 | 67 |
| 1495 | 3300054114 | Ga0501084_0009305 | Ga0501084_0009305_1513_1716 | 67 |
| 1496 | 3300054114 | Ga0501084_0680769 | Ga0501084_0680769_422_628 | 67 |
| 1497 | 3300059424 | Ga0590075_020432 | Ga0590075_020432_295_498 | 67 |
| 1498 | 3300059477 | Ga0587084_003200 | Ga0587084_003200_739_945 | 67 |
| 1499 | 3300059490 | Ga0587066_132392 | Ga0587066_132392_356_559 | 67 |
| 1500 | 3300059491 | Ga0587070_064990 | Ga0587070_064990_162_368 | 67 |
| 1501 | 3300059491 | Ga0587070_125303 | Ga0587070_125303_213_416 | 67 |
| 1502 | 3300059493 | Ga0587077_033689 | Ga0587077_033689_584_790 | 67 |
| 1503 | 3300059507 | Ga0587086_008561 | Ga0587086_008561_15_218 | 67 |
| 1504 | 3300059509 | Ga0587089_066535 | Ga0587089_066535_172_378 | 67 |
| 1505 | 3300059510 | Ga0587090_000394 | Ga0587090_000394_1140_1343 | 67 |
| 1506 | 3300059510 | Ga0587090_110903 | Ga0587090_110903_165_377 | 67 |
| 1507 | 3300059512 | Ga0587092_005257 | Ga0587092_005257_824_1030 | 67 |
| 1508 | 3300059513 | Ga0587094_080005 | Ga0587094_080005_164_370 | 67 |
| 1509 | 3300059514 | Ga0587095_021505 | Ga0587095_021505_103_309 | 67 |
| 1510 | 3300059605 | Ga0587106_090973 | Ga0587106_090973_322_525 | 67 |
| 1511 | 3300059623 | Ga0587101_001978 | Ga0587101_001978_919_1125 | 67 |
| 1512 | 3300059623 | Ga0587101_005211 | Ga0587101_005211_152_355 | 67 |
| 1513 | 3300059626 | Ga0587115_070811 | Ga0587115_070811_360_566 | 67 |
| 1514 | 3300059629 | Ga0587127_019179 | Ga0587127_019179_230_436 | 67 |
| 1515 | 3300059630 | Ga0587128_000257 | Ga0587128_000257_3042_3245 | 67 |
| 1516 | 3300059630 | Ga0587128_130216 | Ga0587128_130216_178_381 | 67 |
| 1517 | 3300059642 | Ga0587069_052982 | Ga0587069_052982_167_373 | 67 |
| 1518 | 3300059643 | Ga0587072_001880 | Ga0587072_001880_988_1191 | 67 |
| 1519 | 3300059647 | Ga0587079_209177 | Ga0587079_209177_282_485 | 67 |
| 1520 | 3300059648 | Ga0587100_028874 | Ga0587100_028874_278_484 | 67 |
| 1521 | 3300059655 | Ga0587114_075769 | Ga0587114_075769_266_469 | 67 |
| 1522 | 3300059658 | Ga0587119_079381 | Ga0587119_079381_103_306 | 67 |
| 1523 | 3300059660 | Ga0587124_000909 | Ga0587124_000909_963_1166 | 67 |
| 1524 | 3300060346 | Ga0587111_0036985 | Ga0587111_0036985_41_259 | 67 |
| 1525 | 3300060346 | Ga0587111_0141062 | Ga0587111_0141062_267_473 | 67 |
| 1526 | 3300060353 | Ga0501082_0293975 | Ga0501082_0293975_627_839 | 67 |
| 1527 | 3300060353 | Ga0501082_1884698 | Ga0501082_1884698_240_443 | 67 |
| 1528 | 3300061719 | Ga0466962_0298012 | Ga0466962_0298012_226_429 | 67 |
| 1529 | 3300061734 | Ga0530510_0999317 | Ga0530510_0999317_88_294 | 67 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mjc-assembly1.cif.gz_A | crystal structure of cspa, the major cold shock protein of escherichia coli | 0.985 | 2 | 67 |
| 3i2z-assembly2.cif.gz_B | structure of cold shock protein e from salmonella typhimurium | 0.9772 | 1 | 67 |
| 8h1i-assembly1.cif.gz_B | crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c | 0.9755 | 2 | 67 |
| 1hza-assembly1.cif.gz_B | bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability | 0.9737 | 1 | 67 |
| 1c9o-assembly1.cif.gz_B | crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp | 0.9662 | 1 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94C69_1_75_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.966 | 2 | 64 | 2.40.50.140 |
| af_P91306_55_138_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9637 | 2 | 64 | 2.40.50.140 |
| af_P92186_48_133_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9627 | 2 | 64 | 2.40.50.140 |
| af_Q9VRN5_36_116_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9586 | 2 | 64 | 2.40.50.140 |
| af_I1LPN7_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9572 | 2 | 64 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M2HNG0-F1-model_v4 | Putative cold shock protein A | 1.012 | 2 | 67 |
GO:0003676
GO:0005737 |
| AF-A0A4Y4G4A9-F1-model_v4 | deleted | 1.01 | 2 | 67 |
|
| AF-A0A849DLQ8-F1-model_v4 | Cold-shock protein | 1.01 | 1 | 67 |
GO:0003676
GO:0005737 |
| AF-A0A7Y7WNA6-F1-model_v4 | Cold-shock protein | 1.009 | 2 | 67 |
GO:0003676
GO:0005829 |
| AF-A0A345CDC2-F1-model_v4 | deleted | 1.009 | 2 | 67 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar