F494590

General Info

Members Datasets Scaffolds Average Seq Length
1529 632 1526 67

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10012518|Ga0157373_100125185
Length 81
Sequence MFVSGIEREIRRTAMATGTVKWFNAEKGFGFIAPDDKSADVFVHFSAIAAAGFKTLEEGQKVEFGVTQGPKGLQAADVKPL

Samples

Sample ID Description Type Environment
1 2643221575 Microbacterium sp. Root61 Isolate Unclassified
2 2643221616 Leifsonia sp. Root227 Isolate Unclassified
3 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
130 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
170 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
176 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
177 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
178 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
270 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
271 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
275 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
276 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
277 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
278 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
279 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
280 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
281 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
282 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
283 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
284 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
285 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
288 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
289 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
290 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
291 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
292 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
293 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
294 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
295 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
296 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
297 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
298 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
299 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
300 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
301 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
302 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
303 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
304 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
305 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
306 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
307 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
308 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
309 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
310 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
311 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
313 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
314 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
317 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
318 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
319 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
320 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
321 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
322 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
323 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
324 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
325 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
326 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
327 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
328 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
329 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
332 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
333 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
334 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
335 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
338 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
339 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
340 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
341 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
342 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
343 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
344 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
345 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
346 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
347 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
348 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
349 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
350 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
351 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
352 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
353 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
354 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
355 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
356 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
357 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
358 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
359 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
360 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
361 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
362 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
363 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
364 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
365 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
366 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
367 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
368 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
369 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
370 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
371 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
372 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
373 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
374 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
375 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
376 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
377 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
378 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
379 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
380 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
381 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
382 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
383 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
384 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
385 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
386 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
387 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
388 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
389 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
390 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
391 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
392 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
393 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
394 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
395 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
396 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
397 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
398 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
399 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
400 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
401 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
402 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
403 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
404 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
405 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
406 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
407 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
408 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
409 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
410 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
411 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
412 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
413 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
414 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
415 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
416 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
417 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
418 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
419 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
420 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
421 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
422 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
423 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
424 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
425 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
426 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
427 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
428 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
429 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
430 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
431 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
432 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
433 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
434 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
435 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
436 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
437 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
438 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
439 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
440 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
441 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
442 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
443 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
444 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
445 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
446 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
447 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
448 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
449 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
450 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
451 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
452 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
453 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
454 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
455 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
456 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
457 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
458 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
459 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
460 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
461 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
462 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
463 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
464 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
465 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
466 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
467 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
468 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
469 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
470 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
471 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
472 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
473 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
474 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
475 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
476 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
477 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
478 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
479 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
480 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
481 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
482 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
483 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
484 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
485 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
486 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
487 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
488 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
489 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
490 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
491 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
492 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
493 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
494 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
495 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
496 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
497 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
498 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
499 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
532 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
533 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
535 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
536 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
537 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
538 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
539 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
540 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
541 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
542 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
543 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
544 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
545 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
546 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
547 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
548 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
549 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
550 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
551 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
552 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
553 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
554 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
555 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
556 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
557 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
558 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
559 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
560 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
562 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
563 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
564 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
565 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
566 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
567 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
568 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
569 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
570 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
571 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
572 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
573 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
574 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
575 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
576 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
577 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
578 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
579 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
580 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
581 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
582 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
583 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
584 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
585 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
586 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
587 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
588 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
589 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
590 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
591 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
592 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
593 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
594 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
595 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
596 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
597 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
598 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
599 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
600 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
601 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
602 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
603 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
604 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
605 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
606 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
607 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
629 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
631 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
632 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.59
Metatranscriptomes 6.21
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 0
Rhizoplane 6.08
Rhizosphere 80.77
Stem 0
Stem Tuber 0.07
Unclassified 4.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010643 3300001979 Bacteria 3532
2 JGI24740J21852_10017462 3300001979 Bacteria 2566
3 JGI24740J21852_10028179 3300001979 Bacteria 1859
4 JGI24739J22299_10209495 3300001989 Bacteria 571
5 JGI24743J22301_10038481 3300001991 Bacteria 956
6 JGI24735J21928_10099626 3300002067 Bacteria 834
7 JGI24735J21928_10164583 3300002067 Bacteria 641
8 JGI25162J39368_1005662 3300002737 Bacteria 2369
9 JGI25164J39214_1000246 3300002772 Bacteria 41190
10 JGI25152J39213_1000114 3300002773 Bacteria 56359
11 Ga0006763J43179_105502 3300002870 Bacteria 639
12 Ga0006762J43184_102431 3300002872 Bacteria 653
13 JGI25159J45721_1011959 3300002987 Bacteria 2096
14 JGI25151J46595_10000172 3300003187 Bacteria 83323
15 JGI25406J46586_10192963 3300003203 Bacteria 594
16 JGI25165J46597_1000005 3300003214 Bacteria 623702
17 Ga0006777J48905_1010972 3300003308 Bacteria 521
18 JGI25160J50197_1028800 3300003354 Bacteria 1483
19 Ga0006562J51391_1002147 3300003578 Bacteria 510
20 Ga0007429J51699_1026596 3300003579 Bacteria 504
21 Ga0032354_1019578 3300003693 Bacteria 523
22 Ga0006780_1011188 3300003735 Bacteria 520
23 Ga0055539_1000019 3300003752 Bacteria 341727
24 Ga0055533_1000023 3300003756 Bacteria 341727
25 Ga0055525_1000321 3300003759 Bacteria 37412
26 Ga0055542_1004061 3300003762 Bacteria 3694
27 Ga0055540_1000087 3300003792 Bacteria 102273
28 Ga0055540_1001311 3300003792 Bacteria 15007
29 Ga0055541_1003090 3300003841 Bacteria 3193
30 Ga0058858_1338063 3300004785 Bacteria 571
31 Ga0058863_11610772 3300004799 Bacteria 533
32 Ga0065714_10009230 3300005288 Bacteria 2388
33 Ga0065714_10044791 3300005288 Bacteria 649
34 Ga0065714_10066919 3300005288 Bacteria 6089
35 Ga0065714_10117391 3300005288 Bacteria 1386
36 Ga0065714_10139660 3300005288 Bacteria 1179
37 Ga0065714_10445983 3300005288 Bacteria 557
38 Ga0065704_10481833 3300005289 Bacteria 681
39 Ga0065712_10014795 3300005290 Bacteria 2065
40 Ga0065707_10158208 3300005295 Bacteria 1588
41 Ga0065707_10159123 3300005295 Bacteria 1580
42 Ga0065707_10196937 3300005295 Bacteria 1330
43 Ga0070658_10013125 3300005327 Bacteria 6648
44 Ga0070658_11162531 3300005327 Bacteria 671
45 Ga0070676_10012564 3300005328 Bacteria 4628
46 Ga0070683_100268548 3300005329 Bacteria 1622
47 Ga0070690_100124921 3300005330 Bacteria 1731
48 Ga0070690_100556928 3300005330 Bacteria 865
49 Ga0070670_100025937 3300005331 Bacteria 5043
50 Ga0070670_100104770 3300005331 Bacteria 2437
51 Ga0070670_101980494 3300005331 Bacteria 537
52 Ga0070677_10032889 3300005333 Bacteria 1993
53 Ga0070677_10099294 3300005333 Bacteria 1280
54 Ga0070677_10229723 3300005333 Bacteria 911
55 Ga0070666_10011384 3300005335 Bacteria 5580
56 Ga0070666_10017527 3300005335 Bacteria 4591
57 Ga0070666_10059753 3300005335 Bacteria 2579
58 Ga0070666_10140399 3300005335 Bacteria 1683
59 Ga0070682_100033294 3300005337 Bacteria 3130
60 Ga0070682_101989610 3300005337 Bacteria 511
61 Ga0068868_100241567 3300005338 Bacteria 1517
62 Ga0068868_100568222 3300005338 Bacteria 1001
63 Ga0068868_100653341 3300005338 Bacteria 937
64 Ga0068868_101084725 3300005338 Bacteria 736
65 Ga0070660_100475194 3300005339 Bacteria 1038
66 Ga0070660_100666483 3300005339 Bacteria 872
67 Ga0070689_100018881 3300005340 Bacteria 5090
68 Ga0070687_100538201 3300005343 Bacteria 793
69 Ga0070687_100595329 3300005343 Bacteria 759
70 Ga0070661_100020491 3300005344 Bacteria 4716
71 Ga0070661_100616808 3300005344 Bacteria 878
72 Ga0070661_101076892 3300005344 Bacteria 669
73 Ga0070661_101421889 3300005344 Bacteria 584
74 Ga0070692_10145822 3300005345 Bacteria 1344
75 Ga0070692_10352415 3300005345 Bacteria 915
76 Ga0070668_100269525 3300005347 Bacteria 1419
77 Ga0070668_100364152 3300005347 Bacteria 1227
78 Ga0070668_100404109 3300005347 Bacteria 1167
79 Ga0070668_101502933 3300005347 Bacteria 616
80 Ga0070669_100010681 3300005353 Bacteria 6517
81 Ga0070669_100250290 3300005353 Bacteria 1411
82 Ga0070675_100012709 3300005354 Bacteria 6603
83 Ga0070675_100590374 3300005354 Bacteria 1007
84 Ga0070671_100050847 3300005355 Bacteria 3447
85 Ga0070671_100103048 3300005355 Bacteria 2394
86 Ga0070671_100122694 3300005355 Bacteria 2187
87 Ga0070671_100134904 3300005355 Bacteria 2081
88 Ga0070674_100210699 3300005356 Bacteria 1506
89 Ga0070674_100249853 3300005356 Bacteria 1392
90 Ga0070674_101439508 3300005356 Bacteria 618
91 Ga0070674_102093834 3300005356 Bacteria 516
92 Ga0070673_100225461 3300005364 Bacteria 1624
93 Ga0070673_100391725 3300005364 Bacteria 1241
94 Ga0070688_100342582 3300005365 Bacteria 1092
95 Ga0070688_100775663 3300005365 Bacteria 748
96 Ga0070659_100000875 3300005366 Bacteria 22001
97 Ga0070659_101029289 3300005366 Bacteria 724
98 Ga0070659_101599918 3300005366 Bacteria 582
99 Ga0070667_100000389 3300005367 Bacteria 47514
100 Ga0070667_100017489 3300005367 Bacteria 5943
101 Ga0070667_100043454 3300005367 Bacteria 3771
102 Ga0070667_100469671 3300005367 Bacteria 1151
103 Ga0070703_10103622 3300005406 Bacteria 1007
104 Ga0070709_10097774 3300005434 Bacteria 1949
105 Ga0070714_100000013 3300005435 Bacteria 211756
106 Ga0070714_100271571 3300005435 Bacteria 1572
107 Ga0070714_100381993 3300005435 Bacteria 1328
108 Ga0070714_100965206 3300005435 Bacteria 829
109 Ga0070714_101282696 3300005435 Bacteria 715
110 Ga0070713_100080137 3300005436 Bacteria 2783
111 Ga0070713_100111996 3300005436 Bacteria 2381
112 Ga0070713_100429384 3300005436 Bacteria 1238
113 Ga0070710_10000239 3300005437 Bacteria 25832
114 Ga0070710_10011945 3300005437 Bacteria 4303
115 Ga0070701_10111753 3300005438 Bacteria 1527
116 Ga0070711_100173666 3300005439 Bacteria 1644
117 Ga0070711_100579065 3300005439 Bacteria 934
118 Ga0070705_100022769 3300005440 Bacteria 3352
119 Ga0070705_100085158 3300005440 Bacteria 1953
120 Ga0070700_100091229 3300005441 Bacteria 1988
121 Ga0070700_100666589 3300005441 Bacteria 823
122 Ga0070700_101169859 3300005441 Bacteria 641
123 Ga0070694_100077987 3300005444 Bacteria 2296
124 Ga0070694_100079260 3300005444 Bacteria 2279
125 Ga0070708_100042829 3300005445 Bacteria 3976
126 Ga0070663_100057826 3300005455 Bacteria 2783
127 Ga0070663_100379680 3300005455 Bacteria 1151
128 Ga0070663_100884156 3300005455 Bacteria 771
129 Ga0070678_100129413 3300005456 Bacteria 2003
130 Ga0070678_100535688 3300005456 Bacteria 1038
131 Ga0070678_100684498 3300005456 Bacteria 923
132 Ga0070678_102259483 3300005456 Bacteria 516
133 Ga0070662_100000056 3300005457 Bacteria 60234
134 Ga0070662_100046036 3300005457 Bacteria 3133
135 Ga0070685_10471413 3300005466 Bacteria 883
136 Ga0070685_10664713 3300005466 Bacteria 756
137 Ga0070706_100042430 3300005467 Bacteria 4202
138 Ga0070706_101377740 3300005467 Bacteria 646
139 Ga0070707_100035742 3300005468 Bacteria 4740
140 Ga0070698_100022827 3300005471 Bacteria 6541
141 Ga0070698_100219092 3300005471 Bacteria 1837
142 Ga0070698_100631589 3300005471 Bacteria 1012
143 Ga0070699_100000003 3300005518 Bacteria 418047
144 Ga0070699_100140681 3300005518 Bacteria 2131
145 Ga0070699_100548826 3300005518 Bacteria 1052
146 Ga0070684_100775852 3300005535 Bacteria 895
147 Ga0070697_100034318 3300005536 Bacteria 4090
148 Ga0070697_101074633 3300005536 Bacteria 716
149 Ga0070697_101468679 3300005536 Bacteria 609
150 Ga0068853_100000855 3300005539 Bacteria 21216
151 Ga0068853_100130580 3300005539 Bacteria 2248
152 Ga0068853_100170103 3300005539 Bacteria 1971
153 Ga0068853_100310977 3300005539 Bacteria 1458
154 Ga0070672_100091740 3300005543 Bacteria 2451
155 Ga0070672_100691159 3300005543 Bacteria 893
156 Ga0070686_100151725 3300005544 Bacteria 1623
157 Ga0070686_101457893 3300005544 Bacteria 576
158 Ga0070695_100251135 3300005545 Bacteria 1287
159 Ga0070696_100085329 3300005546 Bacteria 2241
160 Ga0070693_100559664 3300005547 Bacteria 820
161 Ga0070665_100066631 3300005548 Bacteria 3612
162 Ga0070665_100133640 3300005548 Bacteria 2483
163 Ga0070665_100412670 3300005548 Bacteria 1359
164 Ga0070665_100857691 3300005548 Bacteria 921
165 Ga0070665_101083284 3300005548 Bacteria 813
166 Ga0070665_101788677 3300005548 Bacteria 621
167 Ga0070704_100108545 3300005549 Bacteria 2107
168 Ga0070704_101485449 3300005549 Bacteria 623
169 Ga0068855_100379719 3300005563 Bacteria 1552
170 Ga0068855_101528274 3300005563 Bacteria 685
171 Ga0070664_100344297 3300005564 Bacteria 1355
172 Ga0070664_100948579 3300005564 Bacteria 807
173 Ga0068857_100036171 3300005577 Bacteria 4375
174 Ga0068857_100218798 3300005577 Bacteria 1739
175 Ga0068857_100290934 3300005577 Bacteria 1504
176 Ga0068857_101698459 3300005577 Bacteria 617
177 Ga0068857_102242880 3300005577 Bacteria 536
178 Ga0068854_100153819 3300005578 Bacteria 1776
179 Ga0068854_101530256 3300005578 Bacteria 606
180 Ga0068856_100044137 3300005614 Bacteria 4386
181 Ga0068856_100254399 3300005614 Bacteria 1771
182 Ga0068856_102651461 3300005614 Bacteria 507
183 Ga0070702_100011033 3300005615 Bacteria 4482
184 Ga0070702_100217602 3300005615 Bacteria 1275
185 Ga0068852_100028415 3300005616 Bacteria 4577
186 Ga0068852_100039832 3300005616 Bacteria 3959
187 Ga0068852_100723340 3300005616 Bacteria 1006
188 Ga0068859_100043630 3300005617 Bacteria 4507
189 Ga0068859_100110205 3300005617 Bacteria 2814
190 Ga0068859_100113932 3300005617 Bacteria 2768
191 Ga0068859_102561908 3300005617 Bacteria 561
192 Ga0068864_100067443 3300005618 Bacteria 3107
193 Ga0068864_100069350 3300005618 Bacteria 3065
194 Ga0068864_101680423 3300005618 Bacteria 639
195 Ga0068866_10618551 3300005718 Bacteria 733
196 Ga0068861_100069899 3300005719 Bacteria 2717
197 Ga0068861_100480381 3300005719 Bacteria 1119
198 Ga0068861_102703278 3300005719 Bacteria 501
199 Ga0068851_10000003 3300005834 Bacteria 293018
200 Ga0068851_10216563 3300005834 Bacteria 1074
201 Ga0068851_10559338 3300005834 Bacteria 692
202 Ga0068851_10648484 3300005834 Bacteria 646
203 Ga0068863_100017921 3300005841 Bacteria 6777
204 Ga0068863_100025461 3300005841 Bacteria 5642
205 Ga0068863_100152319 3300005841 Bacteria 2213
206 Ga0068863_100205252 3300005841 Bacteria 1896
207 Ga0068863_101419364 3300005841 Bacteria 702
208 Ga0068858_100000114 3300005842 Bacteria 84795
209 Ga0068858_100469635 3300005842 Bacteria 1213
210 Ga0068858_101395160 3300005842 Bacteria 690
211 Ga0068860_100001136 3300005843 Bacteria 29265
212 Ga0068860_100236589 3300005843 Bacteria 1776
213 Ga0068860_100575934 3300005843 Bacteria 1130
214 Ga0068862_100003322 3300005844 Bacteria 13891
215 Ga0068862_100630733 3300005844 Bacteria 1032
216 Ga0068862_101847700 3300005844 Bacteria 614
217 Ga0081455_10011679 3300005937 Bacteria 8809
218 Ga0081455_10161957 3300005937 Bacteria 1713
219 Ga0081540_1040223 3300005983 Bacteria 2439
220 Ga0081539_10004731 3300005985 Bacteria 14724
221 Ga0081539_10032362 3300005985 Bacteria 3204
222 Ga0081539_10074027 3300005985 Bacteria 1815
223 Ga0081539_10085308 3300005985 Bacteria 1648
224 Ga0070717_10104109 3300006028 Bacteria 2413
225 Ga0070717_10130641 3300006028 Bacteria 2159
226 Ga0070717_10175246 3300006028 Bacteria 1867
227 Ga0070717_10186462 3300006028 Bacteria 1811
228 Ga0070717_11097531 3300006028 Bacteria 725
229 Ga0070717_11140921 3300006028 Bacteria 710
230 Ga0075365_10256026 3300006038 Bacteria 1230
231 Ga0075365_10672555 3300006038 Bacteria 731
232 Ga0075365_10952790 3300006038 Bacteria 605
233 Ga0075365_11004403 3300006038 Bacteria 588
234 Ga0075365_11099734 3300006038 Bacteria 560
235 Ga0075363_100199466 3300006048 Bacteria 1143
236 Ga0075363_100601948 3300006048 Bacteria 659
237 Ga0075363_100819783 3300006048 Bacteria 567
238 Ga0075363_101040550 3300006048 Bacteria 506
239 Ga0075364_10003345 3300006051 Bacteria 9094
240 Ga0075364_10141997 3300006051 Bacteria 1616
241 Ga0075364_10355480 3300006051 Bacteria 999
242 Ga0075364_10493027 3300006051 Bacteria 837
243 Ga0075364_10847603 3300006051 Bacteria 623
244 Ga0075364_11028838 3300006051 Bacteria 560
245 Ga0075364_11215528 3300006051 Bacteria 511
246 Ga0075432_10001110 3300006058 Bacteria 8616
247 Ga0075432_10001540 3300006058 Bacteria 7564
248 Ga0070715_11083242 3300006163 Bacteria 504
249 Ga0070716_100012511 3300006173 Bacteria 4303
250 Ga0070716_100590170 3300006173 Bacteria 834
251 Ga0070716_101506368 3300006173 Bacteria 550
252 Ga0070712_100142880 3300006175 Bacteria 1829
253 Ga0070712_102053512 3300006175 Bacteria 500
254 Ga0075362_10256512 3300006177 Bacteria 861
255 Ga0075362_10304136 3300006177 Bacteria 792
256 Ga0075362_10562911 3300006177 Bacteria 587
257 Ga0075367_10106945 3300006178 Bacteria 1714
258 Ga0075367_10377506 3300006178 Bacteria 895
259 Ga0075369_10059148 3300006186 Bacteria 1669
260 Ga0075366_10326752 3300006195 Bacteria 940
261 Ga0097621_100018661 3300006237 Bacteria 5305
262 Ga0097621_102313961 3300006237 Bacteria 514
263 Ga0075370_10018219 3300006353 Bacteria 3807
264 Ga0075370_10129004 3300006353 Bacteria 1475
265 Ga0075370_10227378 3300006353 Bacteria 1103
266 Ga0075370_10290289 3300006353 Bacteria 972
267 Ga0075370_10436324 3300006353 Bacteria 787
268 Ga0068871_100292952 3300006358 Bacteria 1427
269 Ga0068871_102229816 3300006358 Bacteria 522
270 Ga0075428_100995376 3300006844 Bacteria 888
271 Ga0075431_100055591 3300006847 Bacteria 4083
272 Ga0075431_100133936 3300006847 Bacteria 2554
273 Ga0075431_101864641 3300006847 Bacteria 557
274 Ga0075433_10006838 3300006852 Bacteria 9037
275 Ga0075433_10056663 3300006852 Bacteria 3424
276 Ga0075433_10188363 3300006852 Bacteria 1835
277 Ga0075434_100067699 3300006871 Bacteria 3557
278 Ga0075434_100134546 3300006871 Bacteria 2492
279 Ga0068865_100385951 3300006881 Bacteria 1144
280 Ga0068865_100513179 3300006881 Bacteria 1001
281 Ga0075436_100254738 3300006914 Bacteria 1251
282 Ga0097620_100043629 3300006931 Bacteria 4507
283 Ga0097620_100110207 3300006931 Bacteria 2814
284 Ga0097620_100113924 3300006931 Bacteria 2768
285 Ga0097620_102560380 3300006931 Bacteria 561
286 Ga0075435_100052021 3300007076 Bacteria 3300
287 Ga0099794_10280778 3300007265 Bacteria 861
288 Ga0099795_10003109 3300007788 Bacteria 4061
289 Ga0105251_10298728 3300009011 Bacteria 730
290 Ga0105251_10506754 3300009011 Bacteria 564
291 Ga0105244_10383444 3300009036 Bacteria 647
292 Ga0105250_10321285 3300009092 Bacteria 673
293 Ga0105240_10001674 3300009093 Bacteria 37626
294 Ga0105240_10075070 3300009093 Bacteria 4171
295 Ga0105240_10083169 3300009093 Bacteria 3929
296 Ga0105240_10343760 3300009093 Bacteria 1694
297 Ga0105240_10547016 3300009093 Bacteria 1281
298 Ga0105245_10123391 3300009098 Bacteria 2422
299 Ga0105245_10163980 3300009098 Bacteria 2111
300 Ga0105245_10193143 3300009098 Bacteria 1951
301 Ga0105245_10194690 3300009098 Bacteria 1944
302 Ga0105245_10458861 3300009098 Bacteria 1284
303 Ga0105245_10914994 3300009098 Bacteria 919
304 Ga0105247_10160865 3300009101 Bacteria 1486
305 Ga0105247_11816051 3300009101 Bacteria 508
306 Ga0114129_10352904 3300009147 Bacteria 1948
307 Ga0114129_11642911 3300009147 Bacteria 785
308 Ga0105243_10127253 3300009148 Bacteria 2157
309 Ga0105243_10327527 3300009148 Bacteria 1398
310 Ga0105243_10589302 3300009148 Bacteria 1069
311 Ga0105243_10867679 3300009148 Bacteria 895
312 Ga0105243_11021698 3300009148 Bacteria 831
313 Ga0105241_10099103 3300009174 Bacteria 2314
314 Ga0105241_10238058 3300009174 Bacteria 1537
315 Ga0105242_10028632 3300009176 Bacteria 4437
316 Ga0105242_10110705 3300009176 Bacteria 2340
317 Ga0105242_10165046 3300009176 Bacteria 1942
318 Ga0105248_10015196 3300009177 Bacteria 8484
319 Ga0105248_10172691 3300009177 Bacteria 2436
320 Ga0105248_10315207 3300009177 Bacteria 1762
321 Ga0105237_10197968 3300009545 Bacteria 2009
322 Ga0105237_10283994 3300009545 Bacteria 1658
323 Ga0105237_10937803 3300009545 Bacteria 873
324 Ga0105237_12154879 3300009545 Bacteria 567
325 Ga0105238_10123243 3300009551 Bacteria 2571
326 Ga0105238_11724987 3300009551 Bacteria 657
327 Ga0105238_11914525 3300009551 Bacteria 626
328 Ga0105238_11942143 3300009551 Bacteria 622
329 Ga0105238_12036507 3300009551 Bacteria 608
330 Ga0105238_13063567 3300009551 Bacteria 501
331 Ga0105249_10057208 3300009553 Bacteria 3572
332 Ga0105249_11542253 3300009553 Bacteria 737
333 Ga0099796_10078087 3300010159 Bacteria 1209
334 Ga0105239_10123750 3300010375 Bacteria 2873
335 Ga0105239_10261619 3300010375 Bacteria 1944
336 Ga0105239_10285489 3300010375 Bacteria 1858
337 Ga0105239_10901767 3300010375 Bacteria 1015
338 Ga0105239_11306118 3300010375 Bacteria 837
339 Ga0105239_12235461 3300010375 Bacteria 636
340 Ga0105246_10002237 3300011119 Bacteria 11676
341 Ga0105246_10021144 3300011119 Bacteria 4183
342 Ga0105246_10062191 3300011119 Bacteria 2600
343 Ga0105246_10086326 3300011119 Bacteria 2249
344 Ga0105246_10159254 3300011119 Bacteria 1718
345 Ga0105246_10324169 3300011119 Bacteria 1253
346 Ga0105246_10691200 3300011119 Bacteria 893
347 Ga0105246_11031499 3300011119 Bacteria 747
348 Ga0105246_11418456 3300011119 Bacteria 649
349 Ga0157373_10012518 3300013100 Bacteria 6235
350 Ga0157373_10182921 3300013100 Bacteria 1476
351 Ga0157373_10424749 3300013100 Bacteria 954
352 Ga0157373_10680666 3300013100 Bacteria 753
353 Ga0157371_10005274 3300013102 Bacteria 10949
354 Ga0157371_10230458 3300013102 Bacteria 1331
355 Ga0157371_10375366 3300013102 Bacteria 1038
356 Ga0157371_10528770 3300013102 Bacteria 873
357 Ga0157371_10705786 3300013102 Bacteria 755
358 Ga0157371_10747911 3300013102 Bacteria 734
359 Ga0157370_10001466 3300013104 Bacteria 29160
360 Ga0157370_10153691 3300013104 Bacteria 2141
361 Ga0157370_10539497 3300013104 Bacteria 1070
362 Ga0157370_10774986 3300013104 Bacteria 873
363 Ga0157370_11440189 3300013104 Bacteria 620
364 Ga0157370_11895228 3300013104 Bacteria 535
365 Ga0157369_10039429 3300013105 Bacteria 5162
366 Ga0157369_10166239 3300013105 Bacteria 2327
367 Ga0157369_10783074 3300013105 Bacteria 980
368 Ga0157369_10784953 3300013105 Bacteria 979
369 Ga0157369_11496108 3300013105 Bacteria 687
370 Ga0157369_11793463 3300013105 Bacteria 623
371 Ga0157374_10000337 3300013296 Bacteria 43353
372 Ga0157374_10263709 3300013296 Bacteria 1697
373 Ga0157378_10015607 3300013297 Bacteria 6652
374 Ga0157378_10070642 3300013297 Bacteria 3135
375 Ga0157378_10208506 3300013297 Bacteria 1852
376 Ga0157378_11447242 3300013297 Bacteria 731
377 Ga0163162_10324336 3300013306 Bacteria 1672
378 Ga0163162_10533590 3300013306 Bacteria 1302
379 Ga0163162_10792386 3300013306 Bacteria 1065
380 Ga0157372_10873466 3300013307 Bacteria 1044
381 Ga0157372_10876808 3300013307 Bacteria 1042
382 Ga0157372_11093042 3300013307 Bacteria 923
383 Ga0157372_11193779 3300013307 Bacteria 879
384 Ga0157372_12214052 3300013307 Bacteria 631
385 Ga0157372_13081839 3300013307 Bacteria 532
386 Ga0157375_10024616 3300013308 Bacteria 5575
387 Ga0157375_10636782 3300013308 Bacteria 1223
388 Ga0157375_12396421 3300013308 Bacteria 630
389 Ga0163163_10021218 3300014325 Bacteria 6125
390 Ga0163163_10061827 3300014325 Bacteria 3710
391 Ga0163163_10384717 3300014325 Bacteria 1461
392 Ga0163163_10833465 3300014325 Bacteria 986
393 Ga0163163_12071330 3300014325 Bacteria 629
394 Ga0163163_12829085 3300014325 Bacteria 541
395 Ga0163163_12913425 3300014325 Bacteria 534
396 Ga0157380_10695307 3300014326 Bacteria 1021
397 Ga0157380_11907696 3300014326 Bacteria 655
398 Ga0157380_11951655 3300014326 Bacteria 648
399 Ga0157380_12187982 3300014326 Bacteria 617
400 Ga0182008_10011168 3300014497 Bacteria 4789
401 Ga0182008_10133121 3300014497 Bacteria 1241
402 Ga0182008_10731959 3300014497 Bacteria 568
403 Ga0157377_11611487 3300014745 Bacteria 520
404 Ga0157379_10060551 3300014968 Bacteria 3385
405 Ga0157379_10667602 3300014968 Bacteria 974
406 Ga0157379_10756072 3300014968 Bacteria 915
407 Ga0157379_12674977 3300014968 Bacteria 500
408 Ga0157376_10014760 3300014969 Bacteria 5876
409 Ga0157376_10340710 3300014969 Bacteria 1432
410 Ga0157376_10774504 3300014969 Bacteria 970
411 Ga0157376_13090627 3300014969 Bacteria 504
412 Ga0163161_10246130 3300017792 Bacteria 1392
413 Ga0184597_116904 3300019162 Bacteria 515
414 Ga0184595_117929 3300019166 Bacteria 558
415 Ga0184599_135484 3300019188 Bacteria 668
416 Ga0197907_11039717 3300020069 Bacteria 2238
417 Ga0197907_11415606 3300020069 Bacteria 825
418 Ga0206356_11762204 3300020070 Bacteria 710
419 Ga0206355_1509001 3300020076 Bacteria 644
420 Ga0206352_10996824 3300020078 Bacteria 684
421 Ga0206350_10969978 3300020080 Bacteria 593
422 Ga0206350_11360594 3300020080 Bacteria 852
423 Ga0206354_11072124 3300020081 Bacteria 597
424 Ga0206354_11207445 3300020081 Bacteria 955
425 Ga0206354_11286028 3300020081 Bacteria 552
426 Ga0206353_10573202 3300020082 Bacteria 558
427 Ga0206353_11713086 3300020082 Bacteria 727
428 Ga0154015_1239549 3300020610 Bacteria 933
429 Ga0213872_10068875 3300021361 Bacteria 1596
430 Ga0213876_10044095 3300021384 Bacteria 2357
431 Ga0213876_10209239 3300021384 Bacteria 1037
432 Ga0213876_10606923 3300021384 Bacteria 582
433 Ga0213875_10240368 3300021388 Bacteria 853
434 Ga0224712_10565085 3300022467 Bacteria 553
435 Ga0209566_100031 3300025225 Bacteria 341555
436 Ga0209674_100001 3300025226 Bacteria 4013750
437 Ga0209563_100001 3300025230 Bacteria 4013775
438 Ga0209563_100205 3300025230 Bacteria 31421
439 Ga0207427_100024 3300025231 Bacteria 438403
440 Ga0209437_100467 3300025233 Bacteria 31685
441 Ga0207425_1000100 3300025245 Bacteria 83378
442 Ga0207425_1005944 3300025245 Bacteria 3407
443 Ga0209677_100001 3300025253 Bacteria 4013787
444 Ga0209148_1000702 3300025254 Bacteria 27035
445 Ga0209148_1002471 3300025254 Bacteria 6310
446 Ga0209759_1028627 3300025256 Bacteria 1130
447 Ga0209129_1000028 3300025258 Bacteria 405451
448 Ga0209129_1000191 3300025258 Bacteria 83378
449 Ga0209233_1000001 3300025261 Bacteria 2992747
450 Ga0209565_1084707 3300025263 Bacteria 518
451 Ga0209455_1003427 3300025272 Bacteria 5616
452 Ga0209673_1019086 3300025273 Bacteria 2473
453 Ga0209130_1000358 3300025284 Bacteria 52094
454 Ga0209025_1000112 3300025294 Bacteria 218958
455 Ga0209025_1000427 3300025294 Bacteria 83378
456 Ga0209758_1000352 3300025297 Bacteria 83378
457 Ga0207426_1001302 3300025302 Bacteria 21458
458 Ga0209051_1000014 3300025303 Bacteria 552732
459 Ga0209051_1000546 3300025303 Bacteria 45996
460 Ga0209051_1001222 3300025303 Bacteria 23105
461 Ga0209051_1001430 3300025303 Bacteria 20445
462 Ga0209051_1029296 3300025303 Bacteria 2156
463 Ga0209051_1089221 3300025303 Bacteria 863
464 Ga0209051_1091111 3300025303 Unclassified 848
465 Ga0207697_10011855 3300025315 Bacteria 3674
466 Ga0207697_10016522 3300025315 Bacteria 3039
467 Ga0207697_10057166 3300025315 Bacteria 1619
468 Ga0207697_10474123 3300025315 Bacteria 554
469 Ga0207656_10000002 3300025321 Bacteria 792178
470 Ga0207656_10259561 3300025321 Bacteria 853
471 Ga0207655_1003093 3300025728 Bacteria 12648
472 Ga0207655_1004839 3300025728 Bacteria 9359
473 Ga0207655_1005444 3300025728 Bacteria 8650
474 Ga0207713_1055246 3300025735 Bacteria 1551
475 Ga0207653_10009297 3300025885 Bacteria 3060
476 Ga0207682_10008648 3300025893 Bacteria 4024
477 Ga0207692_10016869 3300025898 Bacteria 3245
478 Ga0207692_10458843 3300025898 Bacteria 803
479 Ga0207642_10444589 3300025899 Bacteria 784
480 Ga0207710_10004760 3300025900 Bacteria 5886
481 Ga0207710_10065858 3300025900 Bacteria 1652
482 Ga0207710_10067040 3300025900 Bacteria 1639
483 Ga0207688_10007435 3300025901 Bacteria 5958
484 Ga0207688_10363148 3300025901 Bacteria 894
485 Ga0207680_10006719 3300025903 Bacteria 5580
486 Ga0207680_10006982 3300025903 Bacteria 5479
487 Ga0207647_10015036 3300025904 Bacteria 5319
488 Ga0207647_10075384 3300025904 Bacteria 2030
489 Ga0207685_10840279 3300025905 Bacteria 508
490 Ga0207699_10167321 3300025906 Bacteria 1468
491 Ga0207645_10017244 3300025907 Bacteria 4770
492 Ga0207643_10126509 3300025908 Bacteria 1518
493 Ga0207643_11031773 3300025908 Bacteria 531
494 Ga0207705_10037465 3300025909 Bacteria 3470
495 Ga0207705_10140911 3300025909 Bacteria 1800
496 Ga0207705_11014991 3300025909 Bacteria 641
497 Ga0207684_10015324 3300025910 Bacteria 6600
498 Ga0207654_10000001 3300025911 Bacteria 1816198
499 Ga0207654_10486723 3300025911 Bacteria 870
500 Ga0207707_10008724 3300025912 Bacteria 8796
501 Ga0207695_10002367 3300025913 Bacteria 28011
502 Ga0207695_10007138 3300025913 Bacteria 14297
503 Ga0207671_10000002 3300025914 Bacteria 1144816
504 Ga0207671_10049308 3300025914 Bacteria 3117
505 Ga0207671_10063749 3300025914 Bacteria 2739
506 Ga0207671_10891702 3300025914 Bacteria 703
507 Ga0207693_10018369 3300025915 Bacteria 5569
508 Ga0207693_10246628 3300025915 Bacteria 1402
509 Ga0207663_11423790 3300025916 Bacteria 558
510 Ga0207660_10650228 3300025917 Bacteria 859
511 Ga0207660_11521208 3300025917 Bacteria 540
512 Ga0207662_10387285 3300025918 Bacteria 945
513 Ga0207662_10461371 3300025918 Bacteria 870
514 Ga0207657_10016812 3300025919 Bacteria 7043
515 Ga0207657_10157641 3300025919 Bacteria 1845
516 Ga0207657_10683727 3300025919 Bacteria 798
517 Ga0207649_10366280 3300025920 Bacteria 1071
518 Ga0207649_10476235 3300025920 Bacteria 946
519 Ga0207649_11539091 3300025920 Bacteria 526
520 Ga0207652_10454185 3300025921 Bacteria 1155
521 Ga0207646_10008173 3300025922 Bacteria 10519
522 Ga0207681_10199759 3300025923 Bacteria 1535
523 Ga0207681_10938174 3300025923 Bacteria 725
524 Ga0207694_10000656 3300025924 Bacteria 31213
525 Ga0207694_10297320 3300025924 Bacteria 1329
526 Ga0207694_11874675 3300025924 Bacteria 503
527 Ga0207650_10011784 3300025925 Bacteria 6028
528 Ga0207650_10305848 3300025925 Bacteria 1299
529 Ga0207650_10512872 3300025925 Bacteria 1003
530 Ga0207659_10368084 3300025926 Bacteria 1196
531 Ga0207659_11812915 3300025926 Bacteria 518
532 Ga0207687_10058985 3300025927 Bacteria 2702
533 Ga0207687_10060554 3300025927 Bacteria 2671
534 Ga0207687_10083104 3300025927 Bacteria 2318
535 Ga0207687_10093319 3300025927 Bacteria 2200
536 Ga0207687_10169610 3300025927 Bacteria 1682
537 Ga0207700_10420644 3300025928 Bacteria 1174
538 Ga0207700_10497764 3300025928 Bacteria 1078
539 Ga0207700_10558393 3300025928 Bacteria 1017
540 Ga0207700_10789354 3300025928 Bacteria 849
541 Ga0207700_11927573 3300025928 Bacteria 517
542 Ga0207664_10000001 3300025929 Bacteria 724213
543 Ga0207664_10829357 3300025929 Bacteria 831
544 Ga0207664_10923512 3300025929 Bacteria 783
545 Ga0207664_10951558 3300025929 Bacteria 770
546 Ga0207664_11617916 3300025929 Bacteria 570
547 Ga0207644_10020676 3300025931 Bacteria 4479
548 Ga0207644_10036195 3300025931 Bacteria 3464
549 Ga0207644_10166907 3300025931 Bacteria 1716
550 Ga0207644_10461593 3300025931 Bacteria 1044
551 Ga0207690_10008330 3300025932 Bacteria 6152
552 Ga0207690_10730812 3300025932 Bacteria 815
553 Ga0207706_10003017 3300025933 Bacteria 16230
554 Ga0207706_10095189 3300025933 Bacteria 2619
555 Ga0207686_10222629 3300025934 Bacteria 1363
556 Ga0207686_10483549 3300025934 Bacteria 958
557 Ga0207686_10757720 3300025934 Bacteria 775
558 Ga0207709_10061998 3300025935 Bacteria 2339
559 Ga0207709_10080992 3300025935 Bacteria 2092
560 Ga0207709_10096170 3300025935 Bacteria 1947
561 Ga0207709_10384000 3300025935 Bacteria 1069
562 Ga0207709_10674695 3300025935 Bacteria 825
563 Ga0207709_11240436 3300025935 Bacteria 615
564 Ga0207669_10026766 3300025937 Bacteria 3144
565 Ga0207669_10131285 3300025937 Bacteria 1722
566 Ga0207704_10930672 3300025938 Bacteria 732
567 Ga0207665_10011709 3300025939 Bacteria 5764
568 Ga0207665_10312578 3300025939 Bacteria 1177
569 Ga0207665_11498929 3300025939 Bacteria 536
570 Ga0207691_10000527 3300025940 Bacteria 38169
571 Ga0207691_10611640 3300025940 Bacteria 922
572 Ga0207691_10691711 3300025940 Bacteria 860
573 Ga0207711_10000675 3300025941 Bacteria 33918
574 Ga0207711_10001556 3300025941 Bacteria 21223
575 Ga0207711_10097111 3300025941 Bacteria 2601
576 Ga0207711_10479988 3300025941 Bacteria 1158
577 Ga0207711_11212416 3300025941 Bacteria 696
578 Ga0207689_10017267 3300025942 Bacteria 6108
579 Ga0207689_11760193 3300025942 Bacteria 512
580 Ga0207661_10365898 3300025944 Bacteria 1303
581 Ga0207661_10645584 3300025944 Bacteria 973
582 Ga0207661_11038622 3300025944 Bacteria 755
583 Ga0207679_10346660 3300025945 Bacteria 1293
584 Ga0207679_11036036 3300025945 Bacteria 752
585 Ga0207667_10001125 3300025949 Bacteria 33757
586 Ga0207667_10017539 3300025949 Bacteria 8052
587 Ga0207667_10119327 3300025949 Bacteria 2718
588 Ga0207667_10504307 3300025949 Bacteria 1227
589 Ga0207651_10010498 3300025960 Bacteria 5137
590 Ga0207651_11678228 3300025960 Bacteria 572
591 Ga0207651_11903572 3300025960 Bacteria 535
592 Ga0207712_10000002 3300025961 Bacteria 706628
593 Ga0207712_10049885 3300025961 Bacteria 2920
594 Ga0207712_11555212 3300025961 Bacteria 593
595 Ga0207668_10106841 3300025972 Bacteria 2092
596 Ga0207668_11058869 3300025972 Bacteria 726
597 Ga0207640_10075142 3300025981 Bacteria 2289
598 Ga0207640_10413879 3300025981 Bacteria 1101
599 Ga0207640_10569844 3300025981 Bacteria 954
600 Ga0207640_11605549 3300025981 Bacteria 586
601 Ga0207658_10003656 3300025986 Bacteria 10853
602 Ga0207658_10031533 3300025986 Bacteria 3765
603 Ga0207658_10049393 3300025986 Bacteria 3091
604 Ga0207658_10712074 3300025986 Bacteria 908
605 Ga0207677_10528205 3300026023 Bacteria 1025
606 Ga0207677_10904139 3300026023 Bacteria 796
607 Ga0207703_10000315 3300026035 Bacteria 52633
608 Ga0207703_10000676 3300026035 Bacteria 33962
609 Ga0207703_10289518 3300026035 Bacteria 1490
610 Ga0207639_10010682 3300026041 Bacteria 6359
611 Ga0207639_10099007 3300026041 Bacteria 2351
612 Ga0207639_10314078 3300026041 Bacteria 1389
613 Ga0207639_11408325 3300026041 Bacteria 654
614 Ga0207678_10154354 3300026067 Bacteria 1960
615 Ga0207678_10172176 3300026067 Bacteria 1849
616 Ga0207678_10280149 3300026067 Bacteria 1431
617 Ga0207678_10489965 3300026067 Bacteria 1071
618 Ga0207678_11432650 3300026067 Bacteria 610
619 Ga0207708_10019564 3300026075 Bacteria 5105
620 Ga0207708_11472027 3300026075 Bacteria 598
621 Ga0207702_10023823 3300026078 Bacteria 5078
622 Ga0207702_10643676 3300026078 Bacteria 1042
623 Ga0207702_11000642 3300026078 Bacteria 829
624 Ga0207702_11161400 3300026078 Bacteria 766
625 Ga0207641_10013108 3300026088 Bacteria 6798
626 Ga0207641_10034952 3300026088 Bacteria 4183
627 Ga0207641_10088299 3300026088 Bacteria 2707
628 Ga0207641_10282525 3300026088 Bacteria 1562
629 Ga0207641_11879757 3300026088 Bacteria 600
630 Ga0207676_10102976 3300026095 Bacteria 2371
631 Ga0207676_10131422 3300026095 Bacteria 2129
632 Ga0207676_10233598 3300026095 Bacteria 1645
633 Ga0207674_10429108 3300026116 Bacteria 1277
634 Ga0207675_100011376 3300026118 Bacteria 8328
635 Ga0207675_100441613 3300026118 Bacteria 1288
636 Ga0207683_10001988 3300026121 Bacteria 18100
637 Ga0207683_10005105 3300026121 Bacteria 11266
638 Ga0207683_11135942 3300026121 Bacteria 724
639 Ga0207698_10001558 3300026142 Bacteria 13362
640 Ga0207698_10280821 3300026142 Bacteria 1540
641 Ga0207698_10284038 3300026142 Bacteria 1532
642 Ga0207698_10731855 3300026142 Bacteria 986
643 Ga0207698_11400398 3300026142 Bacteria 714
644 Ga0209371_1046461 3300027312 Bacteria 853
645 Ga0209179_1002471 3300027512 Bacteria 2504
646 Ga0209974_10202245 3300027876 Bacteria 734
647 Ga0209974_10416211 3300027876 Bacteria 529
648 Ga0207428_10001932 3300027907 Bacteria 21004
649 Ga0207428_10205041 3300027907 Bacteria 1483
650 Ga0207428_10225265 3300027907 Bacteria 1404
651 Ga0265356_1028495 3300028017 Unclassified 606
652 Ga0268266_10020090 3300028379 Bacteria 5693
653 Ga0268266_10306426 3300028379 Bacteria 1483
654 Ga0268266_10483999 3300028379 Bacteria 1180
655 Ga0268266_10742643 3300028379 Bacteria 947
656 Ga0268265_10026539 3300028380 Bacteria 4122
657 Ga0268264_10005182 3300028381 Bacteria 11039
658 Ga0268264_11066015 3300028381 Bacteria 816
659 Ga0268264_11545577 3300028381 Bacteria 674
660 Ga0307517_10572196 3300028786 Bacteria 561
661 Ga0307515_10235852 3300028794 Bacteria 1611
662 Ga0307515_10377329 3300028794 Bacteria 1052
663 Ga0265338_10832195 3300028800 Bacteria 631
664 Ga0268256_1052414 3300030500 Bacteria 853
665 Ga0307512_10470834 3300030522 Bacteria 500
666 Ga0316176_1002176 3300030732 Bacteria 502
667 Ga0316178_1092568 3300030735 Bacteria 1260
668 Ga0316180_1140247 3300030736 Bacteria 698
669 Ga0316183_1164821 3300030742 Bacteria 821
670 Ga0316181_1000529 3300030744 Bacteria 891
671 Ga0316182_1131057 3300030745 Bacteria 652
672 Ga0265762_1010635 3300030760 Bacteria 1644
673 Ga0265762_1154113 3300030760 Bacteria 549
674 Ga0265766_1023954 3300030863 Bacteria 517
675 Ga0265328_10060565 3300031239 Bacteria 1389
676 Ga0265325_10211851 3300031241 Bacteria 890
677 Ga0265339_10054864 3300031249 Bacteria 2163
678 Ga0265331_10000393 3300031250 Bacteria 45046
679 Ga0265327_10001930 3300031251 Bacteria 23961
680 Ga0265327_10007612 3300031251 Bacteria 8308
681 Ga0265327_10012338 3300031251 Bacteria 5776
682 Ga0265327_10358605 3300031251 Bacteria 636
683 Ga0265316_10078353 3300031344 Bacteria 2537
684 Ga0307513_10017299 3300031456 Bacteria 8648
685 Ga0307513_10075355 3300031456 Bacteria 3504
686 Ga0307513_10362823 3300031456 Bacteria 1193
687 Ga0307513_10385307 3300031456 Bacteria 1140
688 Ga0307509_10493699 3300031507 Bacteria 910
689 Ga0307408_100004096 3300031548 Bacteria 9944
690 Ga0307408_100027283 3300031548 Bacteria 3933
691 Ga0307408_100029844 3300031548 Bacteria 3781
692 Ga0307408_100037161 3300031548 Bacteria 3428
693 Ga0307408_100037908 3300031548 Bacteria 3398
694 Ga0307408_100056630 3300031548 Bacteria 2843
695 Ga0307408_100089677 3300031548 Bacteria 2318
696 Ga0307408_100124786 3300031548 Bacteria 2000
697 Ga0307408_100149275 3300031548 Bacteria 1843
698 Ga0307408_100388887 3300031548 Bacteria 1194
699 Ga0307408_100408750 3300031548 Bacteria 1167
700 Ga0307408_100486561 3300031548 Bacteria 1077
701 Ga0307408_102391130 3300031548 Bacteria 513
702 Ga0307508_10234030 3300031616 Bacteria 1435
703 Ga0307514_10538232 3300031649 Bacteria 543
704 Ga0316576_10866716 3300031727 Bacteria 648
705 Ga0307405_10001824 3300031731 Bacteria 9131
706 Ga0307405_10049986 3300031731 Bacteria 2587
707 Ga0307405_10058059 3300031731 Bacteria 2433
708 Ga0307405_10061947 3300031731 Bacteria 2367
709 Ga0307405_10208555 3300031731 Bacteria 1424
710 Ga0307405_10247616 3300031731 Bacteria 1324
711 Ga0307405_10290980 3300031731 Bacteria 1234
712 Ga0307405_10357635 3300031731 Bacteria 1128
713 Ga0307405_10445243 3300031731 Bacteria 1025
714 Ga0307405_10470966 3300031731 Bacteria 1000
715 Ga0307405_10602688 3300031731 Bacteria 896
716 Ga0307405_10707280 3300031731 Bacteria 835
717 Ga0307405_11418389 3300031731 Bacteria 608
718 Ga0307405_11570928 3300031731 Bacteria 580
719 Ga0307413_10007146 3300031824 Bacteria 5158
720 Ga0307413_10012044 3300031824 Bacteria 4287
721 Ga0307413_10043973 3300031824 Bacteria 2636
722 Ga0307413_10050698 3300031824 Bacteria 2496
723 Ga0307413_10117255 3300031824 Bacteria 1795
724 Ga0307413_10135921 3300031824 Bacteria 1690
725 Ga0307413_10261513 3300031824 Bacteria 1290
726 Ga0307413_10421462 3300031824 Bacteria 1051
727 Ga0307413_10586556 3300031824 Bacteria 910
728 Ga0307413_10956618 3300031824 Bacteria 731
729 Ga0307413_10973471 3300031824 Bacteria 725
730 Ga0307413_11294872 3300031824 Bacteria 637
731 Ga0307413_11320218 3300031824 Bacteria 632
732 Ga0307518_10064062 3300031838 Bacteria 2668
733 Ga0307410_10004562 3300031852 Bacteria 7180
734 Ga0307410_10006834 3300031852 Bacteria 6197
735 Ga0307410_10021301 3300031852 Bacteria 3984
736 Ga0307410_10025907 3300031852 Bacteria 3685
737 Ga0307410_10032973 3300031852 Bacteria 3340
738 Ga0307410_10184774 3300031852 Bacteria 1581
739 Ga0307410_10239035 3300031852 Bacteria 1406
740 Ga0307410_10832107 3300031852 Bacteria 787
741 Ga0307410_11065894 3300031852 Bacteria 699
742 Ga0307410_11355210 3300031852 Bacteria 623
743 Ga0307410_11660228 3300031852 Bacteria 565
744 Ga0307410_11666567 3300031852 Bacteria 564
745 Ga0307406_10011101 3300031901 Bacteria 5103
746 Ga0307406_10021863 3300031901 Bacteria 3790
747 Ga0307406_10092243 3300031901 Bacteria 2042
748 Ga0307406_10095491 3300031901 Bacteria 2012
749 Ga0307406_10146643 3300031901 Bacteria 1678
750 Ga0307406_10149054 3300031901 Bacteria 1666
751 Ga0307406_10342988 3300031901 Bacteria 1164
752 Ga0307406_10498923 3300031901 Bacteria 986
753 Ga0307406_11253740 3300031901 Bacteria 645
754 Ga0307407_10016800 3300031903 Bacteria 3652
755 Ga0307407_10023952 3300031903 Bacteria 3193
756 Ga0307407_10063249 3300031903 Bacteria 2170
757 Ga0307407_10098440 3300031903 Bacteria 1809
758 Ga0307407_10170372 3300031903 Bacteria 1433
759 Ga0307407_10181446 3300031903 Bacteria 1395
760 Ga0307407_10188886 3300031903 Bacteria 1371
761 Ga0307407_11623756 3300031903 Bacteria 513
762 Ga0307412_10001098 3300031911 Bacteria 15508
763 Ga0307412_10028533 3300031911 Bacteria 3492
764 Ga0307412_10040148 3300031911 Bacteria 3027
765 Ga0307412_10054535 3300031911 Bacteria 2654
766 Ga0307412_10064294 3300031911 Bacteria 2478
767 Ga0307412_10075565 3300031911 Bacteria 2311
768 Ga0307412_10101590 3300031911 Bacteria 2035
769 Ga0307412_10109144 3300031911 Bacteria 1972
770 Ga0307412_10267823 3300031911 Bacteria 1335
771 Ga0307412_10327764 3300031911 Bacteria 1221
772 Ga0307412_10374615 3300031911 Bacteria 1150
773 Ga0307412_10384432 3300031911 Bacteria 1137
774 Ga0307412_10508614 3300031911 Bacteria 1004
775 Ga0307412_10551346 3300031911 Bacteria 968
776 Ga0307412_10734830 3300031911 Bacteria 850
777 Ga0307412_10866759 3300031911 Bacteria 789
778 Ga0307412_10870528 3300031911 Bacteria 787
779 Ga0307412_11367813 3300031911 Bacteria 639
780 Ga0307409_100017036 3300031995 Bacteria 4829
781 Ga0307409_100034644 3300031995 Bacteria 3690
782 Ga0307409_100043092 3300031995 Bacteria 3385
783 Ga0307409_100047789 3300031995 Bacteria 3251
784 Ga0307409_100055044 3300031995 Bacteria 3069
785 Ga0307409_100063933 3300031995 Bacteria 2888
786 Ga0307409_100095980 3300031995 Bacteria 2444
787 Ga0307409_100197086 3300031995 Bacteria 1798
788 Ga0307409_100210360 3300031995 Bacteria 1747
789 Ga0307409_100360534 3300031995 Bacteria 1375
790 Ga0307409_100505904 3300031995 Bacteria 1177
791 Ga0307409_100540907 3300031995 Bacteria 1142
792 Ga0307409_100733313 3300031995 Bacteria 990
793 Ga0307409_100927340 3300031995 Bacteria 886
794 Ga0307409_101373263 3300031995 Bacteria 732
795 Ga0307409_101510148 3300031995 Bacteria 699
796 Ga0307409_102947937 3300031995 Bacteria 502
797 Ga0307416_100014730 3300032002 Bacteria 5373
798 Ga0307416_100072215 3300032002 Bacteria 2871
799 Ga0307416_100077052 3300032002 Bacteria 2798
800 Ga0307416_100094749 3300032002 Bacteria 2575
801 Ga0307416_100096528 3300032002 Bacteria 2556
802 Ga0307416_100120934 3300032002 Bacteria 2333
803 Ga0307416_100213681 3300032002 Bacteria 1842
804 Ga0307416_100231574 3300032002 Bacteria 1781
805 Ga0307416_100244194 3300032002 Bacteria 1742
806 Ga0307416_100275746 3300032002 Bacteria 1654
807 Ga0307416_100280500 3300032002 Bacteria 1642
808 Ga0307416_100288524 3300032002 Bacteria 1623
809 Ga0307416_100326581 3300032002 Bacteria 1539
810 Ga0307416_100352939 3300032002 Bacteria 1489
811 Ga0307416_100430466 3300032002 Bacteria 1366
812 Ga0307416_100602041 3300032002 Bacteria 1179
813 Ga0307416_102168302 3300032002 Bacteria 657
814 Ga0307416_103143038 3300032002 Bacteria 552
815 Ga0307414_10049175 3300032004 Bacteria 2914
816 Ga0307414_10148169 3300032004 Bacteria 1847
817 Ga0307414_10191870 3300032004 Bacteria 1654
818 Ga0307414_10201130 3300032004 Bacteria 1620
819 Ga0307414_10260111 3300032004 Bacteria 1448
820 Ga0307414_10312710 3300032004 Bacteria 1334
821 Ga0307414_10333565 3300032004 Bacteria 1296
822 Ga0307414_11132362 3300032004 Bacteria 723
823 Ga0307414_11796089 3300032004 Bacteria 572
824 Ga0307411_10029428 3300032005 Bacteria 3353
825 Ga0307411_10086652 3300032005 Bacteria 2173
826 Ga0307411_10274877 3300032005 Bacteria 1338
827 Ga0307411_10531447 3300032005 Bacteria 1000
828 Ga0307411_10550441 3300032005 Bacteria 984
829 Ga0307411_10652831 3300032005 Bacteria 911
830 Ga0307411_11107021 3300032005 Bacteria 714
831 Ga0307411_11854232 3300032005 Bacteria 560
832 Ga0307411_12144187 3300032005 Bacteria 523
833 Ga0307415_100015143 3300032126 Bacteria 4557
834 Ga0307415_100060105 3300032126 Bacteria 2625
835 Ga0307415_100158387 3300032126 Bacteria 1752
836 Ga0307415_100200892 3300032126 Bacteria 1582
837 Ga0307415_100340209 3300032126 Bacteria 1259
838 Ga0307415_100500845 3300032126 Bacteria 1062
839 Ga0307415_100502025 3300032126 Bacteria 1061
840 Ga0307415_100865120 3300032126 Bacteria 830
841 Ga0316593_10099211 3300032168 Bacteria 1032
842 Ga0307507_10062721 3300033179 Bacteria 3448
843 Ga0307510_10032524 3300033180 Bacteria 5875
844 Ga0307510_10116554 3300033180 Bacteria 2392
845 Ga0316592_1068630 3300033524 Bacteria 800
846 Ga0316596_1072203 3300033541 Bacteria 925
847 Ga0316596_1081265 3300033541 Bacteria 871
848 Ga0316596_1228058 3300033541 Bacteria 522
849 Ga0373930_0059307 3300034816 Bacteria 851
850 Ga0373958_0159944 3300034819 Bacteria 569
851 Ga0373951_0001434 3300035091 Bacteria 6254
852 Ga0373951_0005165 3300035091 Bacteria 3050
853 Ga0373923_0593976 3300035111 Bacteria 545
854 Ga0373932_0233220 3300035112 Bacteria 666
855 Ga0373941_0219279 3300035115 Bacteria 730
856 Ga0373945_0209981 3300035116 Bacteria 811
857 Ga0373956_0173050 3300035119 Bacteria 1019
858 Ga0373957_0037179 3300035120 Bacteria 1818
859 Ga0373955_0097921 3300035172 Bacteria 1680
860 Ga0373962_0099230 3300035242 Bacteria 906
861 Ga0373931_0092338 3300035691 Bacteria 1688
862 Ga0373935_0776355 3300035692 Bacteria 707
863 Ga0373947_0593340 3300035725 Bacteria 755
864 Ga0373937_0240356 3300036401 Bacteria 1706
865 Ga0373925_0128972 3300037068 Bacteria 1970
866 Ga0395899_0002071 3300037312 Bacteria 16485
867 Ga0395899_0012150 3300037312 Bacteria 6595
868 Ga0395899_0042478 3300037312 Bacteria 3394
869 Ga0395899_0044343 3300037312 Bacteria 3314
870 Ga0395899_0122284 3300037312 Bacteria 1863
871 Ga0395899_1002677 3300037312 Bacteria 503
872 Ga0395900_0002047 3300037418 Bacteria 22659
873 Ga0395900_0007771 3300037418 Bacteria 11061
874 Ga0395900_0063331 3300037418 Bacteria 3801
875 Ga0395900_0091319 3300037418 Bacteria 3129
876 Ga0395900_0119281 3300037418 Bacteria 2708
877 Ga0395900_0162275 3300037418 Bacteria 2279
878 Ga0395900_0276018 3300037418 Bacteria 1674
879 Ga0395900_0472686 3300037418 Bacteria 1207
880 Ga0395900_1119541 3300037418 Bacteria 704
881 Ga0395898_0010620 3300037466 Bacteria 9618
882 Ga0395898_0024316 3300037466 Bacteria 6109
883 Ga0395898_0039323 3300037466 Bacteria 4682
884 Ga0395898_0053014 3300037466 Bacteria 3961
885 Ga0395898_0060072 3300037466 Bacteria 3695
886 Ga0395898_0069594 3300037466 Bacteria 3404
887 Ga0395898_0107768 3300037466 Bacteria 2672
888 Ga0395898_0185881 3300037466 Bacteria 1985
889 Ga0395898_0197932 3300037466 Bacteria 1919
890 Ga0395905_0011108 3300037471 Bacteria 8711
891 Ga0395905_0550049 3300037471 Bacteria 1055
892 Ga0395905_0553332 3300037471 Bacteria 1052
893 Ga0395905_0708485 3300037471 Bacteria 909
894 Ga0395905_0924892 3300037471 Bacteria 775
895 Ga0395905_1781441 3300037471 Bacteria 521
896 Ga0395901_0018181 3300038443 Bacteria 7175
897 Ga0395901_0062464 3300038443 Bacteria 3876
898 Ga0395901_0063679 3300038443 Bacteria 3838
899 Ga0395901_0065762 3300038443 Bacteria 3776
900 Ga0395901_0067956 3300038443 Bacteria 3712
901 Ga0395901_0118943 3300038443 Bacteria 2776
902 Ga0395901_0361299 3300038443 Bacteria 1497
903 Ga0395901_1092670 3300038443 Bacteria 768
904 Ga0395901_1257550 3300038443 Bacteria 703
905 Ga0242420_148478 3300038996 Bacteria 525
906 Ga0436365_0091043 3300039437 Bacteria 944
907 Ga0436365_0779361 3300039437 Bacteria 6745
908 Ga0436365_1937032 3300039437 Bacteria 712
909 Ga0436360_0899858 3300039438 Bacteria 1149
910 Ga0436360_1315227 3300039438 Bacteria 1151
911 Ga0436361_0605533 3300039447 Bacteria 604
912 Ga0436363_0309976 3300039450 Bacteria 1329
913 Ga0436362_0126685 3300039453 Bacteria 3092
914 Ga0436362_0225406 3300039453 Bacteria 625
915 Ga0439436_0000426 3300041404 Bacteria 10626
916 Ga0439436_0002918 3300041404 Bacteria 5184
917 Ga0439436_0037321 3300041404 Bacteria 1399
918 Ga0439438_001015 3300041405 Bacteria 12523
919 Ga0439438_041334 3300041405 Bacteria 1196
920 Ga0439438_081595 3300041405 Bacteria 793
921 Ga0439439_0000182 3300041406 Bacteria 9522
922 Ga0439439_0115147 3300041406 Bacteria 747
923 Ga0439461_0016623 3300041410 Bacteria 1422
924 Ga0439461_0053203 3300041410 Bacteria 903
925 Ga0439461_0112112 3300041410 Bacteria 674
926 Ga0439466_0001588 3300041411 Bacteria 8883
927 Ga0439466_0118738 3300041411 Bacteria 817
928 Ga0439466_0245538 3300041411 Bacteria 542
929 Ga0439465_0019982 3300041413 Bacteria 2095
930 Ga0439465_0060523 3300041413 Bacteria 1254
931 Ga0439465_0268007 3300041413 Bacteria 634
932 Ga0451787_429570 3300041441 Bacteria 828
933 Ga0451787_454270 3300041441 Bacteria 542
934 Ga0451789_0449262 3300041443 Bacteria 773
935 Ga0451789_0954465 3300041443 Bacteria 2050
936 Ga0451790_29369 3300041444 Bacteria 871
937 Ga0451791_0333509 3300041451 Bacteria 803
938 Ga0451791_0425394 3300041451 Bacteria 1094
939 Ga0451791_0746838 3300041451 Bacteria 1098
940 Ga0451791_1365422 3300041451 Bacteria 1025
941 Ga0451791_1684038 3300041451 Bacteria 1021
942 Ga0451793_0107442 3300041452 Bacteria 862
943 Ga0451793_0375343 3300041452 Bacteria 618
944 Ga0451793_0394566 3300041452 Bacteria 1431
945 Ga0451797_0414603 3300041453 Bacteria 902
946 Ga0451797_0578603 3300041453 Bacteria 567
947 Ga0451797_0820372 3300041453 Bacteria 976
948 Ga0451795_0000828 3300041456 Bacteria 1745
949 Ga0451800_0128843 3300041459 Bacteria 865
950 Ga0451800_0298232 3300041459 Bacteria 892
951 Ga0451800_0575305 3300041459 Bacteria 956
952 Ga0451802_0089278 3300041460 Bacteria 1522
953 Ga0451802_0278509 3300041460 Bacteria 568
954 Ga0451802_0708891 3300041460 Bacteria 502
955 Ga0451806_674951 3300041462 Bacteria 929
956 Ga0451807_0181775 3300041486 Bacteria 656
957 Ga0451807_1758962 3300041486 Bacteria 868
958 Ga0451807_2590362 3300041486 Bacteria 818
959 Ga0451833_1376670 3300041491 Bacteria 836
960 Ga0451837_1258306 3300041494 Bacteria 520
961 Ga0451837_1568330 3300041494 Bacteria 591
962 Ga0451839_1351262 3300041496 Bacteria 813
963 Ga0451839_1586779 3300041496 Bacteria 595
964 Ga0451841_0147103 3300041498 Bacteria 626
965 Ga0451847_0602894 3300041503 Bacteria 550
966 Ga0451849_0833272 3300041505 Bacteria 656
967 Ga0451851_0537676 3300041507 Bacteria 631
968 Ga0451843_1119515 3300041509 Bacteria 939
969 Ga0451855_0050733 3300041511 Bacteria 704
970 Ga0451853_0358524 3300041512 Bacteria 629
971 Ga0451853_2739900 3300041512 Bacteria 567
972 Ga0439431_0046537 3300041997 Bacteria 1116
973 Ga0439433_0000242 3300041999 Bacteria 9104
974 Ga0439433_0000467 3300041999 Bacteria 7466
975 Ga0439433_0016129 3300041999 Bacteria 1652
976 Ga0439433_0061981 3300041999 Bacteria 893
977 Ga0439442_000016 3300042002 Bacteria 46336
978 Ga0439442_000282 3300042002 Bacteria 12486
979 Ga0439442_001917 3300042002 Bacteria 4083
980 Ga0439442_005349 3300042002 Bacteria 2569
981 Ga0439442_007158 3300042002 Bacteria 2242
982 Ga0439448_0127540 3300042005 Bacteria 875
983 Ga0439432_010951 3300042006 Bacteria 3129
984 Ga0439432_022430 3300042006 Bacteria 2085
985 Ga0439449_0000230 3300042007 Bacteria 20108
986 Ga0439449_0001930 3300042007 Bacteria 8140
987 Ga0439449_0016620 3300042007 Bacteria 2764
988 Ga0439449_0084853 3300042007 Bacteria 1168
989 Ga0439449_0108314 3300042007 Bacteria 1028
990 Ga0439449_0197236 3300042007 Bacteria 753
991 Ga0439449_0398914 3300042007 Bacteria 522
992 Ga0439452_001317 3300042010 Bacteria 10421
993 Ga0439452_045896 3300042010 Bacteria 1015
994 Ga0439452_064252 3300042010 Bacteria 817
995 Ga0439456_108413 3300042013 Bacteria 632
996 Ga0439457_000356 3300042014 Bacteria 12742
997 Ga0439457_006669 3300042014 Bacteria 2809
998 Ga0439457_027578 3300042014 Bacteria 1257
999 Ga0439462_0003349 3300042015 Bacteria 3838
1000 Ga0439462_0012078 3300042015 Bacteria 2204
1001 Ga0439462_0013073 3300042015 Bacteria 2126
1002 Ga0439462_0077392 3300042015 Bacteria 907
1003 Ga0450911_008837 3300042115 Bacteria 1424
1004 Ga0450911_016469 3300042115 Bacteria 976
1005 Ga0450911_017875 3300042115 Bacteria 932
1006 Ga0450919_000012 3300042121 Bacteria 14953
1007 Ga0450919_001784 3300042121 Bacteria 2806
1008 Ga0450920_007814 3300042122 Bacteria 1942
1009 Ga0450920_126027 3300042122 Bacteria 538
1010 Ga0450922_024543 3300042124 Bacteria 635
1011 Ga0450894_073519 3300042131 Bacteria 526
1012 Ga0450906_014699 3300042145 Bacteria 1432
1013 Ga0450907_000308 3300042146 Bacteria 16371
1014 Ga0450907_001905 3300042146 Bacteria 4235
1015 Ga0450910_045591 3300042147 Bacteria 716
1016 Ga0439446_0006482 3300042156 Bacteria 3053
1017 Ga0439446_0315801 3300042156 Bacteria 551
1018 Ga0439458_0184367 3300042157 Bacteria 567
1019 Ga0450908_001115 3300042184 Bacteria 5219
1020 Ga0450908_004272 3300042184 Bacteria 2759
1021 Ga0450909_001836 3300042185 Bacteria 2988
1022 Ga0450909_020841 3300042185 Bacteria 978
1023 Ga0450909_038462 3300042185 Bacteria 734
1024 Ga0439434_0000231 3300042435 Bacteria 15604
1025 Ga0439434_0012022 3300042435 Bacteria 2558
1026 Ga0450918_004338 3300042531 Bacteria 2590
1027 Ga0450918_004412 3300042531 Bacteria 2563
1028 Ga0451577_0014128 3300042876 Bacteria 7447
1029 Ga0451577_0050819 3300042876 Bacteria 3700
1030 Ga0451577_0128561 3300042876 Bacteria 2272
1031 Ga0466969_0162001 3300044656 Bacteria 1028
1032 Ga0466969_0505183 3300044656 Bacteria 552
1033 Ga0466972_0112550 3300044658 Bacteria 1286
1034 Ga0466972_0230080 3300044658 Bacteria 867
1035 Ga0466972_0393401 3300044658 Bacteria 649
1036 Ga0453683_0048494 3300044673 Bacteria 2664
1037 Ga0453683_0129992 3300044673 Bacteria 1586
1038 Ga0453683_0147082 3300044673 Bacteria 1488
1039 Ga0453683_1115461 3300044673 Bacteria 526
1040 Ga0466965_0051221 3300044683 Bacteria 2048
1041 Ga0466966_0007964 3300044684 Bacteria 7022
1042 Ga0466966_0770770 3300044684 Bacteria 580
1043 Ga0466966_0854820 3300044684 Bacteria 548
1044 Ga0466966_0998319 3300044684 Bacteria 505
1045 Ga0466961_0006228 3300044693 Bacteria 7581
1046 Ga0466961_0032065 3300044693 Bacteria 3377
1047 Ga0466961_0039290 3300044693 Bacteria 3034
1048 Ga0466961_0048204 3300044693 Bacteria 2723
1049 Ga0466961_0338980 3300044693 Bacteria 916
1050 Ga0466963_0119372 3300044694 Bacteria 1814
1051 Ga0466963_0579048 3300044694 Bacteria 793
1052 Ga0466963_0919926 3300044694 Bacteria 616
1053 Ga0453684_0012179 3300044712 Bacteria 14260
1054 Ga0466971_0190511 3300044719 Bacteria 966
1055 Ga0466968_0010303 3300044735 Bacteria 3621
1056 Ga0466968_0216792 3300044735 Bacteria 900
1057 Ga0466968_0742086 3300044735 Bacteria 503
1058 Ga0466970_0000055 3300044765 Bacteria 43678
1059 Ga0466970_0002327 3300044765 Bacteria 9186
1060 Ga0466970_0009014 3300044765 Bacteria 5033
1061 Ga0466970_0086594 3300044765 Bacteria 1698
1062 Ga0466970_0086932 3300044765 Bacteria 1695
1063 Ga0466970_0247452 3300044765 Bacteria 998
1064 Ga0466970_0823343 3300044765 Bacteria 544
1065 Ga0466970_0872377 3300044765 Bacteria 529
1066 Ga0466957_0025992 3300044842 Bacteria 3472
1067 Ga0466957_0118149 3300044842 Bacteria 1688
1068 Ga0466957_1299102 3300044842 Bacteria 528
1069 Ga0466960_0102179 3300044901 Bacteria 1478
1070 Ga0466960_0151059 3300044901 Bacteria 1241
1071 Ga0466960_0345090 3300044901 Bacteria 848
1072 Ga0466960_0446825 3300044901 Bacteria 751
1073 Ga0466959_0001374 3300045049 Bacteria 14858
1074 Ga0466959_0004730 3300045049 Bacteria 9168
1075 Ga0466959_0660839 3300045049 Bacteria 701
1076 Ga0466959_1026321 3300045049 Bacteria 549
1077 Ga0451576_0001029 3300045051 Bacteria 51466
1078 Ga0451576_0068343 3300045051 Bacteria 3697
1079 Ga0451576_0214471 3300045051 Bacteria 2010
1080 Ga0451576_0455613 3300045051 Bacteria 1343
1081 Ga0466967_0911577 3300045976 Bacteria 874
1082 Ga0466967_1221047 3300045976 Bacteria 749
1083 Ga0466967_1284178 3300045976 Bacteria 729
1084 Ga0466967_2571254 3300045976 Bacteria 504
1085 Ga0495592_0077419 3300046454 Bacteria 2411
1086 Ga0495590_0000299 3300046457 Bacteria 26210
1087 Ga0495591_014573 3300046458 Bacteria 2819
1088 Ga0495629_0051856 3300046459 Bacteria 2871
1089 Ga0495629_0286927 3300046459 Bacteria 1129
1090 Ga0495629_0521741 3300046459 Bacteria 799
1091 Ga0495638_0215485 3300046460 Bacteria 1076
1092 Ga0495638_0275826 3300046460 Bacteria 916
1093 Ga0495653_0030310 3300046463 Bacteria 4310
1094 Ga0495653_0076958 3300046463 Bacteria 2479
1095 Ga0495650_0000474 3300046471 Bacteria 61656
1096 Ga0495580_0008811 3300046472 Bacteria 7986
1097 Ga0495580_0352475 3300046472 Bacteria 997
1098 Ga0495580_0414220 3300046472 Bacteria 907
1099 Ga0495582_0213070 3300046473 Bacteria 1104
1100 Ga0495639_0002597 3300046475 Bacteria 7861
1101 Ga0495662_0032943 3300046476 Bacteria 2503
1102 Ga0495664_0012743 3300046477 Bacteria 4762
1103 Ga0495585_0283120 3300046492 Bacteria 819
1104 Ga0495594_0071733 3300046499 Bacteria 1926
1105 Ga0495594_0864155 3300046499 Bacteria 509
1106 Ga0495583_0150527 3300046506 Bacteria 965
1107 Ga0495583_0208673 3300046506 Bacteria 792
1108 Ga0495606_0359042 3300046507 Bacteria 771
1109 Ga0495606_0579260 3300046507 Bacteria 554
1110 Ga0495618_0085855 3300046514 Bacteria 2012
1111 Ga0495628_0929415 3300046516 Bacteria 602
1112 Ga0495630_0363768 3300046517 Bacteria 1108
1113 Ga0495631_0064693 3300046518 Bacteria 1583
1114 Ga0495632_0165084 3300046519 Bacteria 1019
1115 Ga0495648_0336888 3300046524 Bacteria 694
1116 Ga0495666_0508700 3300046526 Bacteria 538
1117 Ga0495654_0033163 3300046530 Bacteria 2614
1118 Ga0495654_0314740 3300046530 Bacteria 636
1119 Ga0495654_0339648 3300046530 Bacteria 606
1120 Ga0495665_0001291 3300046531 Bacteria 13376
1121 Ga0495665_0021883 3300046531 Bacteria 3438
1122 Ga0495665_0236591 3300046531 Bacteria 942
1123 Ga0495640_0144418 3300046533 Bacteria 1532
1124 Ga0495586_0024557 3300046535 Bacteria 3223
1125 Ga0495586_0040492 3300046535 Bacteria 2507
1126 Ga0495587_0005826 3300046536 Bacteria 8026
1127 Ga0495645_0014732 3300046543 Bacteria 5553
1128 Ga0495645_0032859 3300046543 Bacteria 3785
1129 Ga0495622_0409393 3300046557 Bacteria 584
1130 Ga0495633_0160556 3300046558 Bacteria 1037
1131 Ga0495667_0029880 3300046559 Bacteria 3665
1132 Ga0495667_0038040 3300046559 Bacteria 3205
1133 Ga0495667_0874373 3300046559 Bacteria 552
1134 Ga0495656_0004079 3300046615 Bacteria 4974
1135 Ga0495656_0152222 3300046615 Bacteria 1118
1136 Ga0495668_0814608 3300046616 Bacteria 517
1137 Ga0495634_0122562 3300046642 Bacteria 1664
1138 Ga0495611_0358968 3300046648 Bacteria 668
1139 Ga0495625_0618425 3300046660 Bacteria 648
1140 Ga0495635_0096007 3300046663 Bacteria 2026
1141 Ga0495635_0156730 3300046663 Bacteria 1550
1142 Ga0495659_0149392 3300046664 Bacteria 937
1143 Ga0495588_0001739 3300046674 Bacteria 9272
1144 Ga0495588_0022049 3300046674 Bacteria 3145
1145 Ga0495588_0049220 3300046674 Bacteria 2167
1146 Ga0495588_0117980 3300046674 Bacteria 1398
1147 Ga0495588_0259755 3300046674 Bacteria 915
1148 Ga0495657_0691121 3300046675 Bacteria 587
1149 Ga0495670_0001877 3300046691 Bacteria 10337
1150 Ga0495670_0775590 3300046691 Bacteria 523
1151 Ga0495671_0326119 3300046692 Bacteria 737
1152 Ga0495649_0031008 3300046694 Bacteria 2949
1153 Ga0495600_0015732 3300046809 Bacteria 4789
1154 Ga0495660_0235900 3300046810 Bacteria 855
1155 Ga0495581_0001511 3300047315 Bacteria 12955
1156 Ga0495581_0012051 3300047315 Bacteria 5003
1157 Ga0495581_0017028 3300047315 Bacteria 4223
1158 Ga0495604_0758318 3300047317 Bacteria 613
1159 Ga0495636_0006129 3300047318 Bacteria 4724
1160 Ga0495674_0236146 3300047319 Bacteria 1508
1161 Ga0495672_0019264 3300047320 Bacteria 4506
1162 Ga0495672_0370373 3300047320 Bacteria 661
1163 Ga0495676_0221974 3300047321 Bacteria 1302
1164 Ga0495680_0150219 3300047322 Bacteria 1699
1165 Ga0495680_0944236 3300047322 Bacteria 554
1166 Ga0495675_0079559 3300047444 Bacteria 2064
1167 Ga0495677_0390075 3300047445 Bacteria 551
1168 Ga0495677_0458341 3300047445 Bacteria 505
1169 Ga0495679_006855 3300047446 Bacteria 4838
1170 Ga0495685_005367 3300047447 Bacteria 4183
1171 Ga0495685_199418 3300047447 Bacteria 642
1172 Ga0495684_0537386 3300047471 Bacteria 798
1173 Ga0495686_0010064 3300047472 Bacteria 6755
1174 Ga0495686_0077884 3300047472 Bacteria 2030
1175 Ga0495593_0071938 3300047673 Bacteria 1796
1176 Ga0495593_0150797 3300047673 Bacteria 1176
1177 Ga0495615_0194990 3300048090 Bacteria 623
1178 Ga0496100_0000039 3300048903 Bacteria 93702
1179 Ga0496100_0078944 3300048903 Bacteria 2216
1180 Ga0496100_0444386 3300048903 Unclassified 993
1181 Ga0496100_1369110 3300048903 Bacteria 558
1182 Ga0496100_1393389 3300048903 Bacteria 553
1183 Ga0496101_0000043 3300048904 Bacteria 161643
1184 Ga0496101_0004549 3300048904 Bacteria 8757
1185 Ga0496102_0014569 3300048905 Bacteria 6833
1186 Ga0496102_0027486 3300048905 Bacteria 5081
1187 Ga0496102_0049022 3300048905 Bacteria 3841
1188 Ga0496102_0108166 3300048905 Bacteria 2589
1189 Ga0496102_0479472 3300048905 Bacteria 1165
1190 Ga0496102_0486219 3300048905 Bacteria 1156
1191 Ga0496103_0001202 3300048906 Bacteria 17776
1192 Ga0496103_0060214 3300048906 Bacteria 2359
1193 Ga0496103_0339941 3300048906 Bacteria 965
1194 Ga0496103_0700312 3300048906 Bacteria 642
1195 Ga0496103_0768880 3300048906 Bacteria 608
1196 Ga0496104_0457445 3300048907 Bacteria 1188
1197 Ga0496104_1086940 3300048907 Bacteria 703
1198 Ga0496104_1684992 3300048907 Bacteria 536
1199 Ga0496105_0353105 3300048908 Bacteria 1174
1200 Ga0496105_0500816 3300048908 Bacteria 953
1201 Ga0496105_0833650 3300048908 Bacteria 699
1202 Ga0496106_0001390 3300048909 Bacteria 18159
1203 Ga0496106_0073299 3300048909 Bacteria 2619
1204 Ga0496106_1117427 3300048909 Bacteria 617
1205 Ga0496107_0000922 3300048910 Bacteria 17326
1206 Ga0496107_0120432 3300048910 Bacteria 1933
1207 Ga0496107_0212317 3300048910 Bacteria 1439
1208 Ga0496108_0001472 3300048911 Bacteria 18588
1209 Ga0496108_0100844 3300048911 Bacteria 2462
1210 Ga0496108_0551025 3300048911 Bacteria 1006
1211 Ga0496108_0601335 3300048911 Bacteria 958
1212 Ga0496109_0000145 3300048912 Bacteria 70505
1213 Ga0496109_0057047 3300048912 Bacteria 3563
1214 Ga0496109_0057729 3300048912 Bacteria 3544
1215 Ga0496109_0099545 3300048912 Bacteria 2696
1216 Ga0496109_0116031 3300048912 Bacteria 2491
1217 Ga0496109_0126816 3300048912 Bacteria 2380
1218 Ga0496109_0703843 3300048912 Bacteria 948
1219 Ga0496109_0888766 3300048912 Bacteria 829
1220 Ga0496110_0014371 3300048913 Bacteria 6571
1221 Ga0496110_0100279 3300048913 Bacteria 2595
1222 Ga0496110_0120747 3300048913 Bacteria 2360
1223 Ga0496110_0702154 3300048913 Bacteria 913
1224 Ga0496111_0087480 3300048914 Bacteria 2280
1225 Ga0496111_0091624 3300048914 Bacteria 2228
1226 Ga0496111_1110920 3300048914 Bacteria 563
1227 Ga0496112_0033971 3300048915 Bacteria 4961
1228 Ga0496112_0049201 3300048915 Bacteria 4132
1229 Ga0496112_0078841 3300048915 Bacteria 3257
1230 Ga0496112_0216149 3300048915 Bacteria 1873
1231 Ga0496112_0391314 3300048915 Bacteria 1330
1232 Ga0496112_0703160 3300048915 Bacteria 938
1233 Ga0496113_0107912 3300048916 Bacteria 2164
1234 Ga0496113_0660892 3300048916 Bacteria 835
1235 Ga0496113_1091396 3300048916 Bacteria 626
1236 Ga0496114_0000219 3300048917 Bacteria 41685
1237 Ga0496114_0014191 3300048917 Bacteria 6392
1238 Ga0496114_0092010 3300048917 Bacteria 2576
1239 Ga0496114_1363013 3300048917 Bacteria 596
1240 Ga0496114_1718828 3300048917 Bacteria 515
1241 Ga0496115_0014990 3300048918 Bacteria 5875
1242 Ga0496115_0179927 3300048918 Bacteria 1748
1243 Ga0496115_0735458 3300048918 Bacteria 773
1244 Ga0496116_0134410 3300048919 Bacteria 1403
1245 Ga0496117_0069536 3300048920 Bacteria 2370
1246 Ga0496117_0093402 3300048920 Bacteria 1929
1247 Ga0496117_0129596 3300048920 Bacteria 1531
1248 Ga0496117_0547361 3300048920 Bacteria 552
1249 Ga0496118_0095230 3300048921 Bacteria 2033
1250 Ga0496118_0140520 3300048921 Bacteria 1531
1251 Ga0496118_0322667 3300048921 Bacteria 837
1252 Ga0496119_0002652 3300048922 Bacteria 19382
1253 Ga0496119_0010789 3300048922 Bacteria 7649
1254 Ga0496119_0112425 3300048922 Bacteria 1509
1255 Ga0496120_0006209 3300048923 Bacteria 9234
1256 Ga0496120_0018797 3300048923 Bacteria 4440
1257 Ga0496120_0075819 3300048923 Bacteria 1835
1258 Ga0496120_0315952 3300048923 Bacteria 711
1259 Ga0496120_0404508 3300048923 Bacteria 602
1260 Ga0496121_0000002 3300048924 Bacteria 1494588
1261 Ga0496121_0404428 3300048924 Bacteria 893
1262 Ga0496122_0001790 3300048925 Bacteria 32891
1263 Ga0496123_0005125 3300048926 Bacteria 13374
1264 Ga0496123_0010252 3300048926 Bacteria 8313
1265 Ga0496124_0000002 3300048927 Bacteria 1494588
1266 Ga0496124_0091025 3300048927 Bacteria 2486
1267 Ga0496124_0102040 3300048927 Bacteria 2322
1268 Ga0496124_0375015 3300048927 Bacteria 997
1269 Ga0496124_0856058 3300048927 Bacteria 556
1270 Ga0496125_0000002 3300048928 Bacteria 1480920
1271 Ga0496125_0076977 3300048928 Bacteria 2574
1272 Ga0496125_0081127 3300048928 Bacteria 2479
1273 Ga0496125_0156864 3300048928 Bacteria 1553
1274 Ga0496126_0000009 3300048929 Bacteria 750350
1275 Ga0496126_1067892 3300048929 Bacteria 602
1276 Ga0501306_004106 3300049127 Bacteria 1612
1277 Ga0501306_063417 3300049127 Bacteria 612
1278 Ga0501308_058468 3300049128 Bacteria 578
1279 Ga0501309_044547 3300049129 Bacteria 685
1280 Ga0501343_028807 3300049132 Bacteria 509
1281 Ga0501304_044837 3300049160 Bacteria 502
1282 Ga0501305_016403 3300049161 Bacteria 1056
1283 Ga0501311_066454 3300049527 Bacteria 591
1284 Ga0501312_000972 3300049528 Bacteria 2634
1285 Ga0501312_066216 3300049528 Bacteria 633
1286 Ga0501313_049590 3300049529 Bacteria 578
1287 Ga0501313_064311 3300049529 Bacteria 524
1288 Ga0501314_016286 3300049530 Bacteria 741
1289 Ga0501316_058754 3300049532 Bacteria 566
1290 Ga0501316_066726 3300049532 Bacteria 539
1291 Ga0501316_074888 3300049532 Bacteria 517
1292 Ga0501317_007238 3300049533 Bacteria 1246
1293 Ga0501317_008434 3300049533 Bacteria 1187
1294 Ga0501318_004887 3300049534 Bacteria 1306
1295 Ga0501320_001640 3300049536 Bacteria 1681
1296 Ga0501320_024448 3300049536 Bacteria 720
1297 Ga0501321_001128 3300049537 Bacteria 2034
1298 Ga0501321_029022 3300049537 Bacteria 730
1299 Ga0501322_027409 3300049538 Bacteria 526
1300 Ga0501323_050716 3300049539 Bacteria 629
1301 Ga0501324_001209 3300049540 Bacteria 1673
1302 Ga0501324_027992 3300049540 Bacteria 604
1303 Ga0501325_000289 3300049541 Bacteria 2184
1304 Ga0501325_008895 3300049541 Bacteria 881
1305 Ga0501330_010028 3300049546 Bacteria 668
1306 Ga0501330_017478 3300049546 Bacteria 557
1307 Ga0501335_014234 3300049551 Bacteria 802
1308 Ga0501031_0000119 3300049568 Bacteria 43003
1309 Ga0501031_0021571 3300049568 Bacteria 4199
1310 Ga0501031_0054027 3300049568 Bacteria 2617
1311 Ga0501032_0000052 3300049569 Bacteria 101001
1312 Ga0501032_0000405 3300049569 Bacteria 35578
1313 Ga0501032_0002093 3300049569 Bacteria 15734
1314 Ga0501032_0006637 3300049569 Bacteria 8493
1315 Ga0501032_0241970 3300049569 Bacteria 1172
1316 Ga0501032_0280523 3300049569 Bacteria 1079
1317 Ga0501032_0322733 3300049569 Bacteria 996
1318 Ga0501032_1042480 3300049569 Bacteria 513
1319 Ga0501033_0000868 3300049570 Bacteria 27644
1320 Ga0501033_0186116 3300049570 Bacteria 1487
1321 Ga0501034_0020741 3300049571 Bacteria 6708
1322 Ga0501034_0023518 3300049571 Bacteria 6278
1323 Ga0501034_0208155 3300049571 Bacteria 1912
1324 Ga0501034_0211536 3300049571 Bacteria 1894
1325 Ga0501034_0404494 3300049571 Bacteria 1287
1326 Ga0501034_0405593 3300049571 Bacteria 1285
1327 Ga0501034_0568947 3300049571 Bacteria 1041
1328 Ga0501034_0590054 3300049571 Bacteria 1017
1329 Ga0501034_1014454 3300049571 Bacteria 713
1330 Ga0501036_0000061 3300049572 Bacteria 71856
1331 Ga0501036_0087103 3300049572 Bacteria 2640
1332 Ga0501036_0225369 3300049572 Bacteria 1573
1333 Ga0501036_0468844 3300049572 Bacteria 1049
1334 Ga0501037_0000046 3300049573 Bacteria 116524
1335 Ga0501037_0001587 3300049573 Bacteria 16527
1336 Ga0501037_0026512 3300049573 Bacteria 4284
1337 Ga0501037_0036548 3300049573 Bacteria 3620
1338 Ga0501037_0119965 3300049573 Bacteria 1891
1339 Ga0501038_0000068 3300049574 Bacteria 84886
1340 Ga0501038_0019942 3300049574 Bacteria 6035
1341 Ga0501038_0038300 3300049574 Bacteria 4200
1342 Ga0501038_0181392 3300049574 Bacteria 1698
1343 Ga0501038_0331478 3300049574 Bacteria 1188
1344 Ga0501038_0800196 3300049574 Bacteria 700
1345 Ga0501039_0002827 3300049575 Bacteria 12975
1346 Ga0501039_0063921 3300049575 Bacteria 2851
1347 Ga0501039_0187739 3300049575 Bacteria 1625
1348 Ga0501039_0502362 3300049575 Bacteria 952
1349 Ga0501040_0047863 3300049576 Bacteria 2921
1350 Ga0501040_0579034 3300049576 Bacteria 811
1351 Ga0501041_0220280 3300049577 Bacteria 1191
1352 Ga0501042_0624172 3300049578 Bacteria 784
1353 Ga0501043_0000340 3300049579 Bacteria 42317
1354 Ga0501043_0001210 3300049579 Bacteria 22716
1355 Ga0501043_0007110 3300049579 Bacteria 8906
1356 Ga0501043_0050924 3300049579 Bacteria 3255
1357 Ga0501043_0082717 3300049579 Bacteria 2523
1358 Ga0501043_0270763 3300049579 Bacteria 1304
1359 Ga0501043_0877704 3300049579 Bacteria 644
1360 Ga0501046_0000102 3300049580 Bacteria 89938
1361 Ga0501047_0000460 3300049581 Bacteria 44894
1362 Ga0501047_0011318 3300049581 Bacteria 8447
1363 Ga0501047_0079667 3300049581 Bacteria 3149
1364 Ga0501047_0095046 3300049581 Bacteria 2859
1365 Ga0501048_0000006 3300049582 Bacteria 93252
1366 Ga0501048_0944520 3300049582 Bacteria 620
1367 Ga0501067_0416975 3300049583 Bacteria 749
1368 Ga0501068_0008598 3300049584 Bacteria 5689
1369 Ga0501069_0005251 3300049585 Bacteria 6725
1370 Ga0501070_0000139 3300049586 Bacteria 65962
1371 Ga0501070_0033551 3300049586 Bacteria 4296
1372 Ga0501070_0097689 3300049586 Bacteria 2429
1373 Ga0501070_0970605 3300049586 Bacteria 660
1374 Ga0501070_1371719 3300049586 Bacteria 538
1375 Ga0501071_0863419 3300049587 Bacteria 698
1376 Ga0501072_0269920 3300049588 Bacteria 1354
1377 Ga0501073_0038923 3300049589 Bacteria 3371
1378 Ga0501073_0912721 3300049589 Bacteria 605
1379 Ga0501073_1288810 3300049589 Bacteria 501
1380 Ga0501074_0001182 3300049590 Bacteria 17129
1381 Ga0501075_0035573 3300049591 Bacteria 3715
1382 Ga0501075_1035878 3300049591 Bacteria 623
1383 Ga0501076_1152484 3300049592 Bacteria 638
1384 Ga0501202_182283 3300049652 Bacteria 567
1385 Ga0501214_055591 3300049659 Bacteria 613
1386 Ga0501227_211086 3300049665 Bacteria 551
1387 Ga0501250_106589 3300049680 Bacteria 505
1388 Ga0501261_019768 3300049690 Bacteria 959
1389 Ga0501245_107218 3300049708 Bacteria 573
1390 Ga0501079_0475247 3300049741 Bacteria 982
1391 Ga0501079_0890292 3300049741 Bacteria 701
1392 Ga0501080_0003170 3300049742 Bacteria 14496
1393 Ga0501080_0240270 3300049742 Bacteria 1653
1394 Ga0501080_0655899 3300049742 Bacteria 928
1395 Ga0501081_0407581 3300049743 Bacteria 1007
1396 Ga0501081_0708927 3300049743 Bacteria 756
1397 Ga0501083_0010568 3300049744 Bacteria 6498
1398 Ga0501083_0735121 3300049744 Bacteria 642
1399 Ga0501268_061854 3300049765 Bacteria 743
1400 Ga0501270_150251 3300049767 Bacteria 530
1401 Ga0501273_084087 3300049770 Bacteria 533
1402 Ga0501279_031763 3300049775 Bacteria 785
1403 Ga0501279_082399 3300049775 Bacteria 557
1404 Ga0501035_0005470 3300049822 Bacteria 12001
1405 Ga0501035_0157529 3300049822 Bacteria 1967
1406 Ga0501035_0455701 3300049822 Bacteria 1058
1407 Ga0501035_0946228 3300049822 Bacteria 680
1408 Ga0501044_0000137 3300049823 Bacteria 89352
1409 Ga0501044_0032073 3300049823 Bacteria 5524
1410 Ga0501044_0074896 3300049823 Bacteria 3438
1411 Ga0501044_0238050 3300049823 Bacteria 1765
1412 Ga0501044_0404331 3300049823 Bacteria 1277
1413 Ga0501044_0476207 3300049823 Bacteria 1152
1414 Ga0501044_1001269 3300049823 Bacteria 707
1415 Ga0501044_1466551 3300049823 Bacteria 547
1416 Ga0501045_0190180 3300049824 Bacteria 1530
1417 Ga0501045_0413511 3300049824 Bacteria 1003
1418 Ga0501212_104866 3300049851 Bacteria 534
1419 Ga0501212_122104 3300049851 Bacteria 506
1420 nmdc:mga03683_244489_c1 3300050489 Bacteria 832
1421 nmdc:mga03683_259401_c1 3300050489 Bacteria 809
1422 nmdc:mga03683_503106_c1 3300050489 Bacteria 587
1423 nmdc:mga03683_92485_c1 3300050489 Bacteria 1320
1424 nmdc:mga03n38_750373_c1 3300050490 Bacteria 565
1425 nmdc:mga00v17_10944_c1 3300050491 Bacteria 4971
1426 nmdc:mga00v17_196814_c1 3300050491 Bacteria 1302
1427 nmdc:mga00v17_2871_c1 3300050491 Bacteria 8825
1428 nmdc:mga00v17_544486_c1 3300050491 Bacteria 751
1429 nmdc:mga00v17_701709_c1 3300050491 Bacteria 649
1430 nmdc:mga0yw44_76203_c1 3300050492 Bacteria 2093
1431 nmdc:mga0yw44_799152_c1 3300050492 Bacteria 641
1432 nmdc:mga0yw44_926157_c1 3300050492 Bacteria 591
1433 nmdc:mga0k408_336534_c1 3300050493 Bacteria 900
1434 nmdc:mga06z11_690680_c1 3300050494 Bacteria 621
1435 nmdc:mga04h51_284871_c1 3300050495 Bacteria 670
1436 nmdc:mga07m45_132281_c2 3300050496 Bacteria 1143
1437 nmdc:mga07m45_202524_c1 3300050496 Bacteria 1155
1438 nmdc:mga07m45_289094_c1 3300050496 Bacteria 953
1439 nmdc:mga07m45_43749_c1 3300050496 Bacteria 2511
1440 nmdc:mga07m45_608452_c1 3300050496 Bacteria 631
1441 nmdc:mga07m45_625951_c1 3300050496 Bacteria 621
1442 nmdc:mga07m45_709601_c1 3300050496 Bacteria 578
1443 nmdc:mga07m45_788412_c1 3300050496 Bacteria 545
1444 nmdc:mga05p37_1862486_c1 3300050507 Bacteria 577
1445 nmdc:mga06r32_211219_c1 3300050510 Bacteria 1928
1446 nmdc:mga06r32_41763_c2 3300050510 Bacteria 2844
1447 nmdc:mga0n895_65601_c1 3300050512 Bacteria 3594
1448 nmdc:mga0n895_82086_c1 3300050512 Bacteria 3213
1449 nmdc:mga0rr50_1547388_c1 3300050513 Bacteria 560
1450 nmdc:mga0rr50_739426_c1 3300050513 Bacteria 840
1451 nmdc:mga0rr50_97288_c1 3300050513 Bacteria 2304
1452 nmdc:mga0a205_16343_c1 3300050515 Bacteria 6950
1453 nmdc:mga0a205_36939_c1 3300050515 Bacteria 4696
1454 nmdc:mga0a205_62517_c1 3300050515 Bacteria 3597
1455 nmdc:mga0sz30_35896_c1 3300050516 Bacteria 2071
1456 nmdc:mga0sz30_89013_c1 3300050516 Bacteria 1342
1457 Ga0495601_0072154 3300053077 Bacteria 2205
1458 Ga0495655_0262770 3300053083 Bacteria 583
1459 Ga0495595_0022145 3300053084 Bacteria 2786
1460 Ga0495619_0389739 3300053085 Bacteria 962
1461 Ga0495619_1080713 3300053085 Bacteria 534
1462 Ga0500578_0006193 3300053086 Bacteria 8032
1463 Ga0500643_113661 3300053087 Bacteria 730
1464 Ga0500644_0142328 3300053088 Bacteria 954
1465 Ga0500583_0498343 3300053092 Bacteria 572
1466 Ga0500651_0001759 3300053093 Bacteria 11078
1467 Ga0500651_0104729 3300053093 Bacteria 1732
1468 Ga0500651_0571555 3300053093 Bacteria 616
1469 Ga0500641_0004090 3300053096 Bacteria 5150
1470 Ga0500650_0058819 3300053098 Bacteria 1793
1471 Ga0500650_0111097 3300053098 Bacteria 1279
1472 Ga0500569_293315 3300053109 Bacteria 548
1473 Ga0500628_174259 3300053129 Bacteria 612
1474 Ga0500655_094324 3300053133 Bacteria 623
1475 Ga0500655_132263 3300053133 Bacteria 533
1476 Ga0500658_0006898 3300053134 Bacteria 4204
1477 Ga0500559_0251206 3300053136 Bacteria 833
1478 Ga0500564_198001 3300053138 Bacteria 827
1479 Ga0500568_0065623 3300053139 Bacteria 1397
1480 Ga0500568_0100324 3300053139 Bacteria 1086
1481 Ga0500577_0228244 3300053142 Bacteria 807
1482 Ga0500588_0039510 3300053146 Bacteria 1413
1483 Ga0500588_0296993 3300053146 Bacteria 611
1484 Ga0500590_004888 3300053148 Bacteria 6397
1485 Ga0500604_0066940 3300053151 Bacteria 1139
1486 Ga0500616_0000779 3300053153 Bacteria 36584
1487 Ga0500620_000231 3300053155 Bacteria 11121
1488 Ga0500622_0170332 3300053156 Bacteria 1014
1489 Ga0500611_061588 3300053727 Bacteria 891
1490 Ga0500645_065092 3300053730 Unclassified 1051
1491 Ga0500609_001519 3300053731 Bacteria 3396
1492 Ga0501084_0009305 3300054114 Bacteria 8132
1493 Ga0501084_0680769 3300054114 Bacteria 868
1494 Ga0590075_020432 3300059424 Bacteria 1648
1495 Ga0587084_003200 3300059477 Bacteria 1780
1496 Ga0587066_132392 3300059490 Bacteria 601
1497 Ga0587070_064990 3300059491 Bacteria 764
1498 Ga0587070_125303 3300059491 Bacteria 619
1499 Ga0587077_033689 3300059493 Bacteria 991
1500 Ga0587086_008561 3300059507 Bacteria 1198
1501 Ga0587089_066535 3300059509 Bacteria 605
1502 Ga0587090_000394 3300059510 Bacteria 3530
1503 Ga0587090_110903 3300059510 Bacteria 585
1504 Ga0587092_005257 3300059512 Bacteria 1588
1505 Ga0587094_080005 3300059513 Bacteria 603
1506 Ga0587095_021505 3300059514 Bacteria 622
1507 Ga0587106_090973 3300059605 Bacteria 609
1508 Ga0587101_001978 3300059623 Bacteria 1877
1509 Ga0587101_005211 3300059623 Bacteria 1432
1510 Ga0587115_070811 3300059626 Bacteria 602
1511 Ga0587127_019179 3300059629 Bacteria 595
1512 Ga0587128_000257 3300059630 Bacteria 3449
1513 Ga0587128_130216 3300059630 Bacteria 556
1514 Ga0587069_052982 3300059642 Bacteria 727
1515 Ga0587072_001880 3300059643 Bacteria 2712
1516 Ga0587079_209177 3300059647 Bacteria 536
1517 Ga0587100_028874 3300059648 Bacteria 579
1518 Ga0587114_075769 3300059655 Bacteria 617
1519 Ga0587119_079381 3300059658 Bacteria 533
1520 Ga0587124_000909 3300059660 Bacteria 1796
1521 Ga0587111_0036985 3300060346 Bacteria 1024
1522 Ga0587111_0141062 3300060346 Bacteria 639
1523 Ga0501082_0293975 3300060353 Bacteria 1414
1524 Ga0501082_1884698 3300060353 Bacteria 521
1525 Ga0466962_0298012 3300061719 Bacteria 797
1526 Ga0530510_0999317 3300061734 Bacteria 640

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221575 2643885133 63
2 iso_pu_bacteria 2643221616 2644097548 63
3 iso_pu_bacteria 2884763398 2884767173 63
4 3300014968 Ga0157379_12674977 Ga0157379_126749772 65
5 3300005617 Ga0068859_102561908 Ga0068859_1025619081 66
6 3300006931 Ga0097620_102560380 Ga0097620_1025603801 66
7 3300013307 Ga0157372_11193779 Ga0157372_111937791 66
8 3300014497 Ga0182008_10011168 Ga0182008_100111683 66
9 3300025912 Ga0207707_10008724 Ga0207707_100087242 66
10 3300025921 Ga0207652_10454185 Ga0207652_104541851 66
11 3300025928 Ga0207700_11927573 Ga0207700_119275731 66
12 3300028017 Ga0265356_1028495 Ga0265356_10284951 66
13 3300028800 Ga0265338_10832195 Ga0265338_108321951 66
14 3300030760 Ga0265762_1010635 Ga0265762_10106352 66
15 3300031249 Ga0265339_10054864 Ga0265339_100548641 66
16 3300031731 Ga0307405_11570928 Ga0307405_115709282 66
17 3300039438 Ga0436360_0899858 Ga0436360_0899858_148_351 66
18 3300039438 Ga0436360_1315227 Ga0436360_1315227_434_637 66
19 3300039447 Ga0436361_0605533 Ga0436361_0605533_318_521 66
20 3300039453 Ga0436362_0225406 Ga0436362_0225406_143_346 66
21 3300049568 Ga0501031_0021571 Ga0501031_0021571_26_229 66
22 3300049568 Ga0501031_0054027 Ga0501031_0054027_622_825 66
23 3300049569 Ga0501032_0322733 Ga0501032_0322733_223_426 66
24 3300049570 Ga0501033_0186116 Ga0501033_0186116_1242_1445 66
25 3300049571 Ga0501034_0023518 Ga0501034_0023518_899_1102 66
26 3300049571 Ga0501034_0404494 Ga0501034_0404494_1059_1262 66
27 3300049572 Ga0501036_0225369 Ga0501036_0225369_749_952 66
28 3300049573 Ga0501037_0026512 Ga0501037_0026512_3765_3968 66
29 3300049574 Ga0501038_0181392 Ga0501038_0181392_669_872 66
30 3300049574 Ga0501038_0800196 Ga0501038_0800196_26_229 66
31 3300049575 Ga0501039_0502362 Ga0501039_0502362_332_535 66
32 3300049579 Ga0501043_0270763 Ga0501043_0270763_752_955 66
33 3300049581 Ga0501047_0095046 Ga0501047_0095046_1802_2005 66
34 3300049586 Ga0501070_0097689 Ga0501070_0097689_1525_1728 66
35 3300049822 Ga0501035_0157529 Ga0501035_0157529_1261_1464 66
36 3300049823 Ga0501044_0404331 Ga0501044_0404331_27_230 66
37 3300049823 Ga0501044_1001269 Ga0501044_1001269_478_681 66
38 3300001979 JGI24740J21852_10010643 JGI24740J21852_100106433 67
39 3300001979 JGI24740J21852_10017462 JGI24740J21852_100174622 67
40 3300001979 JGI24740J21852_10028179 JGI24740J21852_100281793 67
41 3300001989 JGI24739J22299_10209495 JGI24739J22299_102094951 67
42 3300001991 JGI24743J22301_10038481 JGI24743J22301_100384814 67
43 3300002067 JGI24735J21928_10099626 JGI24735J21928_100996261 67
44 3300002067 JGI24735J21928_10164583 JGI24735J21928_101645831 67
45 3300002737 JGI25162J39368_1005662 JGI25162J39368_10056622 67
46 3300002772 JGI25164J39214_1000246 JGI25164J39214_100024620 67
47 3300002773 JGI25152J39213_1000114 JGI25152J39213_100011429 67
48 3300002870 Ga0006763J43179_105502 Ga0006763J43179_1055022 67
49 3300002872 Ga0006762J43184_102431 Ga0006762J43184_1024312 67
50 3300002987 JGI25159J45721_1011959 JGI25159J45721_10119591 67
51 3300003187 JGI25151J46595_10000172 JGI25151J46595_1000017296 67
52 3300003203 JGI25406J46586_10192963 JGI25406J46586_101929632 67
53 3300003214 JGI25165J46597_1000005 JGI25165J46597_1000005247 67
54 3300003308 Ga0006777J48905_1010972 Ga0006777J48905_10109721 67
55 3300003354 JGI25160J50197_1028800 JGI25160J50197_10288002 67
56 3300003578 Ga0006562J51391_1002147 Ga0006562J51391_10021471 67
57 3300003579 Ga0007429J51699_1026596 Ga0007429J51699_10265962 67
58 3300003693 Ga0032354_1019578 Ga0032354_10195781 67
59 3300003735 Ga0006780_1011188 Ga0006780_10111881 67
60 3300003752 Ga0055539_1000019 Ga0055539_1000019262 67
61 3300003756 Ga0055533_1000023 Ga0055533_100002363 67
62 3300003759 Ga0055525_1000321 Ga0055525_100032125 67
63 3300003762 Ga0055542_1004061 Ga0055542_10040612 67
64 3300003792 Ga0055540_1000087 Ga0055540_10000876 67
65 3300003792 Ga0055540_1001311 Ga0055540_100131110 67
66 3300003841 Ga0055541_1003090 Ga0055541_10030902 67
67 3300004785 Ga0058858_1338063 Ga0058858_13380631 67
68 3300004799 Ga0058863_11610772 Ga0058863_116107721 67
69 3300005288 Ga0065714_10009230 Ga0065714_100092304 67
70 3300005288 Ga0065714_10044791 Ga0065714_100447912 67
71 3300005288 Ga0065714_10066919 Ga0065714_100669195 67
72 3300005288 Ga0065714_10117391 Ga0065714_101173912 67
73 3300005288 Ga0065714_10139660 Ga0065714_101396602 67
74 3300005288 Ga0065714_10445983 Ga0065714_104459831 67
75 3300005289 Ga0065704_10481833 Ga0065704_104818332 67
76 3300005290 Ga0065712_10014795 Ga0065712_100147952 67
77 3300005295 Ga0065707_10158208 Ga0065707_101582081 67
78 3300005295 Ga0065707_10159123 Ga0065707_101591232 67
79 3300005295 Ga0065707_10196937 Ga0065707_101969373 67
80 3300005327 Ga0070658_10013125 Ga0070658_100131255 67
81 3300005327 Ga0070658_11162531 Ga0070658_111625311 67
82 3300005328 Ga0070676_10012564 Ga0070676_100125642 67
83 3300005329 Ga0070683_100268548 Ga0070683_1002685482 67
84 3300005330 Ga0070690_100124921 Ga0070690_1001249212 67
85 3300005330 Ga0070690_100556928 Ga0070690_1005569281 67
86 3300005331 Ga0070670_100025937 Ga0070670_1000259373 67
87 3300005331 Ga0070670_100104770 Ga0070670_1001047701 67
88 3300005331 Ga0070670_101980494 Ga0070670_1019804941 67
89 3300005333 Ga0070677_10032889 Ga0070677_100328892 67
90 3300005333 Ga0070677_10099294 Ga0070677_100992941 67
91 3300005333 Ga0070677_10229723 Ga0070677_102297232 67
92 3300005335 Ga0070666_10011384 Ga0070666_100113842 67
93 3300005335 Ga0070666_10017527 Ga0070666_100175272 67
94 3300005335 Ga0070666_10059753 Ga0070666_100597532 67
95 3300005335 Ga0070666_10140399 Ga0070666_101403993 67
96 3300005337 Ga0070682_100033294 Ga0070682_1000332941 67
97 3300005337 Ga0070682_101989610 Ga0070682_1019896101 67
98 3300005338 Ga0068868_100241567 Ga0068868_1002415673 67
99 3300005338 Ga0068868_100568222 Ga0068868_1005682222 67
100 3300005338 Ga0068868_100653341 Ga0068868_1006533412 67
101 3300005338 Ga0068868_101084725 Ga0068868_1010847252 67
102 3300005339 Ga0070660_100475194 Ga0070660_1004751941 67
103 3300005339 Ga0070660_100666483 Ga0070660_1006664831 67
104 3300005340 Ga0070689_100018881 Ga0070689_1000188818 67
105 3300005343 Ga0070687_100538201 Ga0070687_1005382012 67
106 3300005343 Ga0070687_100595329 Ga0070687_1005953291 67
107 3300005344 Ga0070661_100020491 Ga0070661_1000204913 67
108 3300005344 Ga0070661_100616808 Ga0070661_1006168081 67
109 3300005344 Ga0070661_101076892 Ga0070661_1010768921 67
110 3300005344 Ga0070661_101421889 Ga0070661_1014218892 67
111 3300005345 Ga0070692_10145822 Ga0070692_101458221 67
112 3300005345 Ga0070692_10352415 Ga0070692_103524152 67
113 3300005347 Ga0070668_100269525 Ga0070668_1002695253 67
114 3300005347 Ga0070668_100364152 Ga0070668_1003641522 67
115 3300005347 Ga0070668_100404109 Ga0070668_1004041091 67
116 3300005347 Ga0070668_101502933 Ga0070668_1015029331 67
117 3300005353 Ga0070669_100010681 Ga0070669_1000106813 67
118 3300005353 Ga0070669_100250290 Ga0070669_1002502902 67
119 3300005354 Ga0070675_100012709 Ga0070675_1000127093 67
120 3300005354 Ga0070675_100590374 Ga0070675_1005903742 67
121 3300005355 Ga0070671_100050847 Ga0070671_1000508472 67
122 3300005355 Ga0070671_100103048 Ga0070671_1001030484 67
123 3300005355 Ga0070671_100122694 Ga0070671_1001226941 67
124 3300005355 Ga0070671_100134904 Ga0070671_1001349043 67
125 3300005356 Ga0070674_100210699 Ga0070674_1002106992 67
126 3300005356 Ga0070674_100249853 Ga0070674_1002498532 67
127 3300005356 Ga0070674_101439508 Ga0070674_1014395081 67
128 3300005356 Ga0070674_102093834 Ga0070674_1020938341 67
129 3300005364 Ga0070673_100225461 Ga0070673_1002254613 67
130 3300005364 Ga0070673_100391725 Ga0070673_1003917252 67
131 3300005365 Ga0070688_100342582 Ga0070688_1003425822 67
132 3300005365 Ga0070688_100775663 Ga0070688_1007756631 67
133 3300005366 Ga0070659_100000875 Ga0070659_1000008755 67
134 3300005366 Ga0070659_101029289 Ga0070659_1010292892 67
135 3300005366 Ga0070659_101599918 Ga0070659_1015999181 67
136 3300005367 Ga0070667_100000389 Ga0070667_10000038923 67
137 3300005367 Ga0070667_100017489 Ga0070667_1000174895 67
138 3300005367 Ga0070667_100043454 Ga0070667_1000434544 67
139 3300005367 Ga0070667_100469671 Ga0070667_1004696712 67
140 3300005406 Ga0070703_10103622 Ga0070703_101036222 67
141 3300005434 Ga0070709_10097774 Ga0070709_100977742 67
142 3300005435 Ga0070714_100000013 Ga0070714_1000000134 67
143 3300005435 Ga0070714_100271571 Ga0070714_1002715713 67
144 3300005435 Ga0070714_100381993 Ga0070714_1003819932 67
145 3300005435 Ga0070714_100965206 Ga0070714_1009652061 67
146 3300005435 Ga0070714_101282696 Ga0070714_1012826962 67
147 3300005436 Ga0070713_100080137 Ga0070713_1000801375 67
148 3300005436 Ga0070713_100111996 Ga0070713_1001119962 67
149 3300005436 Ga0070713_100429384 Ga0070713_1004293842 67
150 3300005437 Ga0070710_10000239 Ga0070710_1000023922 67
151 3300005437 Ga0070710_10011945 Ga0070710_100119451 67
152 3300005438 Ga0070701_10111753 Ga0070701_101117532 67
153 3300005439 Ga0070711_100173666 Ga0070711_1001736663 67
154 3300005439 Ga0070711_100579065 Ga0070711_1005790652 67
155 3300005440 Ga0070705_100022769 Ga0070705_1000227696 67
156 3300005440 Ga0070705_100085158 Ga0070705_1000851583 67
157 3300005441 Ga0070700_100091229 Ga0070700_1000912293 67
158 3300005441 Ga0070700_100666589 Ga0070700_1006665891 67
159 3300005441 Ga0070700_101169859 Ga0070700_1011698592 67
160 3300005444 Ga0070694_100077987 Ga0070694_1000779873 67
161 3300005444 Ga0070694_100079260 Ga0070694_1000792602 67
162 3300005445 Ga0070708_100042829 Ga0070708_1000428292 67
163 3300005455 Ga0070663_100057826 Ga0070663_1000578262 67
164 3300005455 Ga0070663_100379680 Ga0070663_1003796801 67
165 3300005455 Ga0070663_100884156 Ga0070663_1008841562 67
166 3300005456 Ga0070678_100129413 Ga0070678_1001294133 67
167 3300005456 Ga0070678_100535688 Ga0070678_1005356881 67
168 3300005456 Ga0070678_100684498 Ga0070678_1006844982 67
169 3300005456 Ga0070678_102259483 Ga0070678_1022594832 67
170 3300005457 Ga0070662_100000056 Ga0070662_10000005617 67
171 3300005457 Ga0070662_100046036 Ga0070662_1000460364 67
172 3300005466 Ga0070685_10471413 Ga0070685_104714132 67
173 3300005466 Ga0070685_10664713 Ga0070685_106647131 67
174 3300005467 Ga0070706_100042430 Ga0070706_1000424303 67
175 3300005467 Ga0070706_101377740 Ga0070706_1013777401 67
176 3300005468 Ga0070707_100035742 Ga0070707_1000357427 67
177 3300005471 Ga0070698_100022827 Ga0070698_1000228277 67
178 3300005471 Ga0070698_100219092 Ga0070698_1002190922 67
179 3300005471 Ga0070698_100631589 Ga0070698_1006315891 67
180 3300005518 Ga0070699_100000003 Ga0070699_100000003115 67
181 3300005518 Ga0070699_100140681 Ga0070699_1001406814 67
182 3300005518 Ga0070699_100548826 Ga0070699_1005488262 67
183 3300005535 Ga0070684_100775852 Ga0070684_1007758522 67
184 3300005536 Ga0070697_100034318 Ga0070697_1000343183 67
185 3300005536 Ga0070697_101074633 Ga0070697_1010746331 67
186 3300005536 Ga0070697_101468679 Ga0070697_1014686792 67
187 3300005539 Ga0068853_100000855 Ga0068853_10000085511 67
188 3300005539 Ga0068853_100130580 Ga0068853_1001305801 67
189 3300005539 Ga0068853_100170103 Ga0068853_1001701032 67
190 3300005539 Ga0068853_100310977 Ga0068853_1003109772 67
191 3300005543 Ga0070672_100091740 Ga0070672_1000917402 67
192 3300005543 Ga0070672_100691159 Ga0070672_1006911592 67
193 3300005544 Ga0070686_100151725 Ga0070686_1001517252 67
194 3300005544 Ga0070686_101457893 Ga0070686_1014578931 67
195 3300005545 Ga0070695_100251135 Ga0070695_1002511352 67
196 3300005546 Ga0070696_100085329 Ga0070696_1000853293 67
197 3300005547 Ga0070693_100559664 Ga0070693_1005596642 67
198 3300005548 Ga0070665_100066631 Ga0070665_1000666315 67
199 3300005548 Ga0070665_100133640 Ga0070665_1001336402 67
200 3300005548 Ga0070665_100412670 Ga0070665_1004126702 67
201 3300005548 Ga0070665_100857691 Ga0070665_1008576911 67
202 3300005548 Ga0070665_101083284 Ga0070665_1010832842 67
203 3300005548 Ga0070665_101788677 Ga0070665_1017886771 67
204 3300005549 Ga0070704_100108545 Ga0070704_1001085452 67
205 3300005549 Ga0070704_101485449 Ga0070704_1014854491 67
206 3300005563 Ga0068855_100379719 Ga0068855_1003797192 67
207 3300005563 Ga0068855_101528274 Ga0068855_1015282742 67
208 3300005564 Ga0070664_100344297 Ga0070664_1003442972 67
209 3300005564 Ga0070664_100948579 Ga0070664_1009485791 67
210 3300005577 Ga0068857_100036171 Ga0068857_1000361714 67
211 3300005577 Ga0068857_100218798 Ga0068857_1002187982 67
212 3300005577 Ga0068857_100290934 Ga0068857_1002909342 67
213 3300005577 Ga0068857_101698459 Ga0068857_1016984591 67
214 3300005577 Ga0068857_102242880 Ga0068857_1022428801 67
215 3300005578 Ga0068854_100153819 Ga0068854_1001538192 67
216 3300005578 Ga0068854_101530256 Ga0068854_1015302561 67
217 3300005614 Ga0068856_100044137 Ga0068856_1000441371 67
218 3300005614 Ga0068856_100254399 Ga0068856_1002543992 67
219 3300005614 Ga0068856_102651461 Ga0068856_1026514612 67
220 3300005615 Ga0070702_100011033 Ga0070702_1000110333 67
221 3300005615 Ga0070702_100217602 Ga0070702_1002176022 67
222 3300005616 Ga0068852_100028415 Ga0068852_1000284154 67
223 3300005616 Ga0068852_100039832 Ga0068852_1000398324 67
224 3300005616 Ga0068852_100723340 Ga0068852_1007233402 67
225 3300005617 Ga0068859_100043630 Ga0068859_1000436303 67
226 3300005617 Ga0068859_100110205 Ga0068859_1001102053 67
227 3300005617 Ga0068859_100113932 Ga0068859_1001139326 67
228 3300005618 Ga0068864_100067443 Ga0068864_1000674433 67
229 3300005618 Ga0068864_100069350 Ga0068864_1000693503 67
230 3300005618 Ga0068864_101680423 Ga0068864_1016804231 67
231 3300005718 Ga0068866_10618551 Ga0068866_106185511 67
232 3300005719 Ga0068861_100069899 Ga0068861_1000698994 67
233 3300005719 Ga0068861_100480381 Ga0068861_1004803812 67
234 3300005719 Ga0068861_102703278 Ga0068861_1027032781 67
235 3300005834 Ga0068851_10000003 Ga0068851_10000003139 67
236 3300005834 Ga0068851_10216563 Ga0068851_102165632 67
237 3300005834 Ga0068851_10559338 Ga0068851_105593381 67
238 3300005834 Ga0068851_10648484 Ga0068851_106484842 67
239 3300005841 Ga0068863_100017921 Ga0068863_1000179217 67
240 3300005841 Ga0068863_100025461 Ga0068863_1000254616 67
241 3300005841 Ga0068863_100152319 Ga0068863_1001523193 67
242 3300005841 Ga0068863_100205252 Ga0068863_1002052522 67
243 3300005841 Ga0068863_101419364 Ga0068863_1014193643 67
244 3300005842 Ga0068858_100000114 Ga0068858_10000011426 67
245 3300005842 Ga0068858_100469635 Ga0068858_1004696351 67
246 3300005842 Ga0068858_101395160 Ga0068858_1013951602 67
247 3300005843 Ga0068860_100001136 Ga0068860_10000113631 67
248 3300005843 Ga0068860_100236589 Ga0068860_1002365894 67
249 3300005843 Ga0068860_100575934 Ga0068860_1005759342 67
250 3300005844 Ga0068862_100003322 Ga0068862_10000332216 67
251 3300005844 Ga0068862_100630733 Ga0068862_1006307332 67
252 3300005844 Ga0068862_101847700 Ga0068862_1018477002 67
253 3300005937 Ga0081455_10011679 Ga0081455_100116797 67
254 3300005937 Ga0081455_10161957 Ga0081455_101619573 67
255 3300005983 Ga0081540_1040223 Ga0081540_10402233 67
256 3300005985 Ga0081539_10004731 Ga0081539_1000473112 67
257 3300005985 Ga0081539_10032362 Ga0081539_100323624 67
258 3300005985 Ga0081539_10074027 Ga0081539_100740273 67
259 3300005985 Ga0081539_10085308 Ga0081539_100853084 67
260 3300006028 Ga0070717_10104109 Ga0070717_101041093 67
261 3300006028 Ga0070717_10130641 Ga0070717_101306414 67
262 3300006028 Ga0070717_10175246 Ga0070717_101752463 67
263 3300006028 Ga0070717_10186462 Ga0070717_101864622 67
264 3300006028 Ga0070717_11097531 Ga0070717_110975311 67
265 3300006028 Ga0070717_11140921 Ga0070717_111409213 67
266 3300006038 Ga0075365_10256026 Ga0075365_102560261 67
267 3300006038 Ga0075365_10672555 Ga0075365_106725552 67
268 3300006038 Ga0075365_10952790 Ga0075365_109527901 67
269 3300006038 Ga0075365_11004403 Ga0075365_110044032 67
270 3300006038 Ga0075365_11099734 Ga0075365_110997341 67
271 3300006048 Ga0075363_100199466 Ga0075363_1001994663 67
272 3300006048 Ga0075363_100601948 Ga0075363_1006019482 67
273 3300006048 Ga0075363_100819783 Ga0075363_1008197831 67
274 3300006048 Ga0075363_101040550 Ga0075363_1010405501 67
275 3300006051 Ga0075364_10003345 Ga0075364_100033458 67
276 3300006051 Ga0075364_10141997 Ga0075364_101419972 67
277 3300006051 Ga0075364_10355480 Ga0075364_103554802 67
278 3300006051 Ga0075364_10493027 Ga0075364_104930272 67
279 3300006051 Ga0075364_10847603 Ga0075364_108476031 67
280 3300006051 Ga0075364_11028838 Ga0075364_110288381 67
281 3300006051 Ga0075364_11215528 Ga0075364_112155282 67
282 3300006058 Ga0075432_10001110 Ga0075432_100011107 67
283 3300006058 Ga0075432_10001540 Ga0075432_100015406 67
284 3300006163 Ga0070715_11083242 Ga0070715_110832421 67
285 3300006173 Ga0070716_100012511 Ga0070716_1000125116 67
286 3300006173 Ga0070716_100590170 Ga0070716_1005901702 67
287 3300006173 Ga0070716_101506368 Ga0070716_1015063682 67
288 3300006175 Ga0070712_100142880 Ga0070712_1001428802 67
289 3300006175 Ga0070712_102053512 Ga0070712_1020535122 67
290 3300006177 Ga0075362_10256512 Ga0075362_102565121 67
291 3300006177 Ga0075362_10304136 Ga0075362_103041362 67
292 3300006177 Ga0075362_10562911 Ga0075362_105629111 67
293 3300006178 Ga0075367_10106945 Ga0075367_101069453 67
294 3300006178 Ga0075367_10377506 Ga0075367_103775062 67
295 3300006186 Ga0075369_10059148 Ga0075369_100591482 67
296 3300006195 Ga0075366_10326752 Ga0075366_103267521 67
297 3300006237 Ga0097621_100018661 Ga0097621_1000186618 67
298 3300006237 Ga0097621_102313961 Ga0097621_1023139612 67
299 3300006353 Ga0075370_10018219 Ga0075370_100182194 67
300 3300006353 Ga0075370_10129004 Ga0075370_101290043 67
301 3300006353 Ga0075370_10227378 Ga0075370_102273782 67
302 3300006353 Ga0075370_10290289 Ga0075370_102902891 67
303 3300006353 Ga0075370_10436324 Ga0075370_104363242 67
304 3300006358 Ga0068871_100292952 Ga0068871_1002929523 67
305 3300006358 Ga0068871_102229816 Ga0068871_1022298161 67
306 3300006844 Ga0075428_100995376 Ga0075428_1009953761 67
307 3300006847 Ga0075431_100055591 Ga0075431_1000555912 67
308 3300006847 Ga0075431_100133936 Ga0075431_1001339362 67
309 3300006847 Ga0075431_101864641 Ga0075431_1018646412 67
310 3300006852 Ga0075433_10006838 Ga0075433_100068383 67
311 3300006852 Ga0075433_10056663 Ga0075433_100566632 67
312 3300006852 Ga0075433_10188363 Ga0075433_101883633 67
313 3300006871 Ga0075434_100067699 Ga0075434_1000676993 67
314 3300006871 Ga0075434_100134546 Ga0075434_1001345463 67
315 3300006881 Ga0068865_100385951 Ga0068865_1003859514 67
316 3300006881 Ga0068865_100513179 Ga0068865_1005131794 67
317 3300006914 Ga0075436_100254738 Ga0075436_1002547384 67
318 3300006931 Ga0097620_100043629 Ga0097620_1000436293 67
319 3300006931 Ga0097620_100110207 Ga0097620_1001102073 67
320 3300006931 Ga0097620_100113924 Ga0097620_1001139246 67
321 3300007076 Ga0075435_100052021 Ga0075435_1000520212 67
322 3300007265 Ga0099794_10280778 Ga0099794_102807783 67
323 3300007788 Ga0099795_10003109 Ga0099795_100031093 67
324 3300009011 Ga0105251_10298728 Ga0105251_102987281 67
325 3300009011 Ga0105251_10506754 Ga0105251_105067542 67
326 3300009036 Ga0105244_10383444 Ga0105244_103834442 67
327 3300009092 Ga0105250_10321285 Ga0105250_103212851 67
328 3300009093 Ga0105240_10001674 Ga0105240_1000167412 67
329 3300009093 Ga0105240_10075070 Ga0105240_100750702 67
330 3300009093 Ga0105240_10083169 Ga0105240_100831692 67
331 3300009093 Ga0105240_10343760 Ga0105240_103437603 67
332 3300009093 Ga0105240_10547016 Ga0105240_105470162 67
333 3300009098 Ga0105245_10123391 Ga0105245_101233912 67
334 3300009098 Ga0105245_10163980 Ga0105245_101639802 67
335 3300009098 Ga0105245_10193143 Ga0105245_101931431 67
336 3300009098 Ga0105245_10194690 Ga0105245_101946904 67
337 3300009098 Ga0105245_10458861 Ga0105245_104588611 67
338 3300009098 Ga0105245_10914994 Ga0105245_109149943 67
339 3300009101 Ga0105247_10160865 Ga0105247_101608652 67
340 3300009101 Ga0105247_11816051 Ga0105247_118160511 67
341 3300009147 Ga0114129_10352904 Ga0114129_103529045 67
342 3300009147 Ga0114129_11642911 Ga0114129_116429111 67
343 3300009148 Ga0105243_10127253 Ga0105243_101272533 67
344 3300009148 Ga0105243_10327527 Ga0105243_103275271 67
345 3300009148 Ga0105243_10589302 Ga0105243_105893022 67
346 3300009148 Ga0105243_10867679 Ga0105243_108676791 67
347 3300009148 Ga0105243_11021698 Ga0105243_110216982 67
348 3300009174 Ga0105241_10099103 Ga0105241_100991033 67
349 3300009174 Ga0105241_10238058 Ga0105241_102380582 67
350 3300009176 Ga0105242_10028632 Ga0105242_100286324 67
351 3300009176 Ga0105242_10110705 Ga0105242_101107052 67
352 3300009176 Ga0105242_10165046 Ga0105242_101650463 67
353 3300009177 Ga0105248_10015196 Ga0105248_100151964 67
354 3300009177 Ga0105248_10172691 Ga0105248_101726913 67
355 3300009177 Ga0105248_10315207 Ga0105248_103152072 67
356 3300009545 Ga0105237_10197968 Ga0105237_101979683 67
357 3300009545 Ga0105237_10283994 Ga0105237_102839941 67
358 3300009545 Ga0105237_10937803 Ga0105237_109378031 67
359 3300009545 Ga0105237_12154879 Ga0105237_121548791 67
360 3300009551 Ga0105238_10123243 Ga0105238_101232433 67
361 3300009551 Ga0105238_11724987 Ga0105238_117249872 67
362 3300009551 Ga0105238_11914525 Ga0105238_119145252 67
363 3300009551 Ga0105238_11942143 Ga0105238_119421431 67
364 3300009551 Ga0105238_12036507 Ga0105238_120365071 67
365 3300009551 Ga0105238_13063567 Ga0105238_130635671 67
366 3300009553 Ga0105249_10057208 Ga0105249_100572083 67
367 3300009553 Ga0105249_11542253 Ga0105249_115422532 67
368 3300010159 Ga0099796_10078087 Ga0099796_100780873 67
369 3300010375 Ga0105239_10123750 Ga0105239_101237502 67
370 3300010375 Ga0105239_10261619 Ga0105239_102616191 67
371 3300010375 Ga0105239_10285489 Ga0105239_102854891 67
372 3300010375 Ga0105239_10901767 Ga0105239_109017672 67
373 3300010375 Ga0105239_11306118 Ga0105239_113061182 67
374 3300010375 Ga0105239_12235461 Ga0105239_122354611 67
375 3300011119 Ga0105246_10002237 Ga0105246_100022378 67
376 3300011119 Ga0105246_10021144 Ga0105246_100211441 67
377 3300011119 Ga0105246_10062191 Ga0105246_100621912 67
378 3300011119 Ga0105246_10086326 Ga0105246_100863263 67
379 3300011119 Ga0105246_10159254 Ga0105246_101592542 67
380 3300011119 Ga0105246_10324169 Ga0105246_103241692 67
381 3300011119 Ga0105246_10691200 Ga0105246_106912001 67
382 3300011119 Ga0105246_11031499 Ga0105246_110314992 67
383 3300011119 Ga0105246_11418456 Ga0105246_114184561 67
384 3300013100 Ga0157373_10012518 Ga0157373_100125185 67
385 3300013100 Ga0157373_10182921 Ga0157373_101829211 67
386 3300013100 Ga0157373_10424749 Ga0157373_104247491 67
387 3300013100 Ga0157373_10680666 Ga0157373_106806662 67
388 3300013102 Ga0157371_10005274 Ga0157371_100052748 67
389 3300013102 Ga0157371_10230458 Ga0157371_102304583 67
390 3300013102 Ga0157371_10375366 Ga0157371_103753663 67
391 3300013102 Ga0157371_10528770 Ga0157371_105287702 67
392 3300013102 Ga0157371_10705786 Ga0157371_107057862 67
393 3300013102 Ga0157371_10747911 Ga0157371_107479111 67
394 3300013104 Ga0157370_10001466 Ga0157370_1000146625 67
395 3300013104 Ga0157370_10153691 Ga0157370_101536912 67
396 3300013104 Ga0157370_10539497 Ga0157370_105394972 67
397 3300013104 Ga0157370_10774986 Ga0157370_107749862 67
398 3300013104 Ga0157370_11440189 Ga0157370_114401891 67
399 3300013104 Ga0157370_11895228 Ga0157370_118952281 67
400 3300013105 Ga0157369_10039429 Ga0157369_100394294 67
401 3300013105 Ga0157369_10166239 Ga0157369_101662392 67
402 3300013105 Ga0157369_10783074 Ga0157369_107830741 67
403 3300013105 Ga0157369_10784953 Ga0157369_107849532 67
404 3300013105 Ga0157369_11496108 Ga0157369_114961081 67
405 3300013105 Ga0157369_11793463 Ga0157369_117934632 67
406 3300013296 Ga0157374_10000337 Ga0157374_100003379 67
407 3300013296 Ga0157374_10263709 Ga0157374_102637092 67
408 3300013297 Ga0157378_10015607 Ga0157378_100156072 67
409 3300013297 Ga0157378_10070642 Ga0157378_100706424 67
410 3300013297 Ga0157378_10208506 Ga0157378_102085062 67
411 3300013297 Ga0157378_11447242 Ga0157378_114472422 67
412 3300013306 Ga0163162_10324336 Ga0163162_103243362 67
413 3300013306 Ga0163162_10533590 Ga0163162_105335902 67
414 3300013306 Ga0163162_10792386 Ga0163162_107923861 67
415 3300013307 Ga0157372_10873466 Ga0157372_108734662 67
416 3300013307 Ga0157372_10876808 Ga0157372_108768083 67
417 3300013307 Ga0157372_11093042 Ga0157372_110930422 67
418 3300013307 Ga0157372_12214052 Ga0157372_122140522 67
419 3300013307 Ga0157372_13081839 Ga0157372_130818391 67
420 3300013308 Ga0157375_10024616 Ga0157375_100246163 67
421 3300013308 Ga0157375_10636782 Ga0157375_106367821 67
422 3300013308 Ga0157375_12396421 Ga0157375_123964211 67
423 3300014325 Ga0163163_10021218 Ga0163163_100212182 67
424 3300014325 Ga0163163_10061827 Ga0163163_100618274 67
425 3300014325 Ga0163163_10384717 Ga0163163_103847171 67
426 3300014325 Ga0163163_10833465 Ga0163163_108334651 67
427 3300014325 Ga0163163_12071330 Ga0163163_120713301 67
428 3300014325 Ga0163163_12829085 Ga0163163_128290851 67
429 3300014325 Ga0163163_12913425 Ga0163163_129134251 67
430 3300014326 Ga0157380_10695307 Ga0157380_106953072 67
431 3300014326 Ga0157380_11907696 Ga0157380_119076961 67
432 3300014326 Ga0157380_11951655 Ga0157380_119516552 67
433 3300014326 Ga0157380_12187982 Ga0157380_121879821 67
434 3300014497 Ga0182008_10133121 Ga0182008_101331212 67
435 3300014497 Ga0182008_10731959 Ga0182008_107319591 67
436 3300014745 Ga0157377_11611487 Ga0157377_116114871 67
437 3300014968 Ga0157379_10060551 Ga0157379_100605511 67
438 3300014968 Ga0157379_10667602 Ga0157379_106676021 67
439 3300014968 Ga0157379_10756072 Ga0157379_107560722 67
440 3300014969 Ga0157376_10014760 Ga0157376_100147601 67
441 3300014969 Ga0157376_10340710 Ga0157376_103407102 67
442 3300014969 Ga0157376_10774504 Ga0157376_107745042 67
443 3300014969 Ga0157376_13090627 Ga0157376_130906271 67
444 3300017792 Ga0163161_10246130 Ga0163161_102461301 67
445 3300019162 Ga0184597_116904 Ga0184597_1169042 67
446 3300019166 Ga0184595_117929 Ga0184595_1179291 67
447 3300019188 Ga0184599_135484 Ga0184599_1354842 67
448 3300020069 Ga0197907_11039717 Ga0197907_110397172 67
449 3300020069 Ga0197907_11415606 Ga0197907_114156062 67
450 3300020070 Ga0206356_11762204 Ga0206356_117622042 67
451 3300020076 Ga0206355_1509001 Ga0206355_15090012 67
452 3300020078 Ga0206352_10996824 Ga0206352_109968242 67
453 3300020080 Ga0206350_10969978 Ga0206350_109699782 67
454 3300020080 Ga0206350_11360594 Ga0206350_113605941 67
455 3300020081 Ga0206354_11072124 Ga0206354_110721242 67
456 3300020081 Ga0206354_11207445 Ga0206354_112074452 67
457 3300020081 Ga0206354_11286028 Ga0206354_112860281 67
458 3300020082 Ga0206353_10573202 Ga0206353_105732022 67
459 3300020082 Ga0206353_11713086 Ga0206353_117130862 67
460 3300020610 Ga0154015_1239549 Ga0154015_12395492 67
461 3300021361 Ga0213872_10068875 Ga0213872_100688753 67
462 3300021384 Ga0213876_10044095 Ga0213876_100440952 67
463 3300021384 Ga0213876_10209239 Ga0213876_102092392 67
464 3300021384 Ga0213876_10606923 Ga0213876_106069231 67
465 3300021388 Ga0213875_10240368 Ga0213875_102403682 67
466 3300022467 Ga0224712_10565085 Ga0224712_105650851 67
467 3300025225 Ga0209566_100031 Ga0209566_10003163 67
468 3300025226 Ga0209674_100001 Ga0209674_1000012088 67
469 3300025230 Ga0209563_100001 Ga0209563_1000012088 67
470 3300025230 Ga0209563_100205 Ga0209563_10020523 67
471 3300025231 Ga0207427_100024 Ga0207427_100024361 67
472 3300025233 Ga0209437_100467 Ga0209437_10046721 67
473 3300025245 Ga0207425_1000100 Ga0207425_10001005 67
474 3300025245 Ga0207425_1005944 Ga0207425_10059442 67
475 3300025253 Ga0209677_100001 Ga0209677_1000012088 67
476 3300025254 Ga0209148_1000702 Ga0209148_100070221 67
477 3300025254 Ga0209148_1002471 Ga0209148_10024713 67
478 3300025256 Ga0209759_1028627 Ga0209759_10286272 67
479 3300025258 Ga0209129_1000028 Ga0209129_1000028181 67
480 3300025258 Ga0209129_1000191 Ga0209129_10001915 67
481 3300025261 Ga0209233_1000001 Ga0209233_1000001403 67
482 3300025263 Ga0209565_1084707 Ga0209565_10847071 67
483 3300025272 Ga0209455_1003427 Ga0209455_10034273 67
484 3300025273 Ga0209673_1019086 Ga0209673_10190862 67
485 3300025284 Ga0209130_1000358 Ga0209130_100035836 67
486 3300025294 Ga0209025_1000112 Ga0209025_100011289 67
487 3300025294 Ga0209025_1000427 Ga0209025_10004275 67
488 3300025297 Ga0209758_1000352 Ga0209758_100035288 67
489 3300025302 Ga0207426_1001302 Ga0207426_10013026 67
490 3300025303 Ga0209051_1000014 Ga0209051_100001460 67
491 3300025303 Ga0209051_1000546 Ga0209051_100054629 67
492 3300025303 Ga0209051_1001222 Ga0209051_10012225 67
493 3300025303 Ga0209051_1001430 Ga0209051_10014304 67
494 3300025303 Ga0209051_1029296 Ga0209051_10292962 67
495 3300025303 Ga0209051_1089221 Ga0209051_10892212 67
496 3300025303 Ga0209051_1091111 Ga0209051_10911111 67
497 3300025315 Ga0207697_10011855 Ga0207697_100118552 67
498 3300025315 Ga0207697_10016522 Ga0207697_100165222 67
499 3300025315 Ga0207697_10057166 Ga0207697_100571661 67
500 3300025315 Ga0207697_10474123 Ga0207697_104741231 67
501 3300025321 Ga0207656_10000002 Ga0207656_1000000298 67
502 3300025321 Ga0207656_10259561 Ga0207656_102595611 67
503 3300025728 Ga0207655_1003093 Ga0207655_10030932 67
504 3300025728 Ga0207655_1004839 Ga0207655_10048391 67
505 3300025728 Ga0207655_1005444 Ga0207655_10054443 67
506 3300025735 Ga0207713_1055246 Ga0207713_10552461 67
507 3300025885 Ga0207653_10009297 Ga0207653_100092973 67
508 3300025893 Ga0207682_10008648 Ga0207682_100086484 67
509 3300025898 Ga0207692_10016869 Ga0207692_100168692 67
510 3300025898 Ga0207692_10458843 Ga0207692_104588431 67
511 3300025899 Ga0207642_10444589 Ga0207642_104445891 67
512 3300025900 Ga0207710_10004760 Ga0207710_100047609 67
513 3300025900 Ga0207710_10065858 Ga0207710_100658582 67
514 3300025900 Ga0207710_10067040 Ga0207710_100670402 67
515 3300025901 Ga0207688_10007435 Ga0207688_100074353 67
516 3300025901 Ga0207688_10363148 Ga0207688_103631481 67
517 3300025903 Ga0207680_10006719 Ga0207680_100067195 67
518 3300025903 Ga0207680_10006982 Ga0207680_100069822 67
519 3300025904 Ga0207647_10015036 Ga0207647_100150362 67
520 3300025904 Ga0207647_10075384 Ga0207647_100753841 67
521 3300025905 Ga0207685_10840279 Ga0207685_108402791 67
522 3300025906 Ga0207699_10167321 Ga0207699_101673213 67
523 3300025907 Ga0207645_10017244 Ga0207645_100172444 67
524 3300025908 Ga0207643_10126509 Ga0207643_101265092 67
525 3300025908 Ga0207643_11031773 Ga0207643_110317731 67
526 3300025909 Ga0207705_10037465 Ga0207705_100374653 67
527 3300025909 Ga0207705_10140911 Ga0207705_101409112 67
528 3300025909 Ga0207705_11014991 Ga0207705_110149911 67
529 3300025910 Ga0207684_10015324 Ga0207684_100153247 67
530 3300025911 Ga0207654_10000001 Ga0207654_100000011757 67
531 3300025911 Ga0207654_10486723 Ga0207654_104867232 67
532 3300025913 Ga0207695_10002367 Ga0207695_1000236728 67
533 3300025913 Ga0207695_10007138 Ga0207695_100071385 67
534 3300025914 Ga0207671_10000002 Ga0207671_10000002392 67
535 3300025914 Ga0207671_10049308 Ga0207671_100493083 67
536 3300025914 Ga0207671_10063749 Ga0207671_100637491 67
537 3300025914 Ga0207671_10891702 Ga0207671_108917021 67
538 3300025915 Ga0207693_10018369 Ga0207693_100183693 67
539 3300025915 Ga0207693_10246628 Ga0207693_102466283 67
540 3300025916 Ga0207663_11423790 Ga0207663_114237901 67
541 3300025917 Ga0207660_10650228 Ga0207660_106502281 67
542 3300025917 Ga0207660_11521208 Ga0207660_115212081 67
543 3300025918 Ga0207662_10387285 Ga0207662_103872852 67
544 3300025918 Ga0207662_10461371 Ga0207662_104613713 67
545 3300025919 Ga0207657_10016812 Ga0207657_100168122 67
546 3300025919 Ga0207657_10157641 Ga0207657_101576413 67
547 3300025919 Ga0207657_10683727 Ga0207657_106837271 67
548 3300025920 Ga0207649_10366280 Ga0207649_103662802 67
549 3300025920 Ga0207649_10476235 Ga0207649_104762352 67
550 3300025920 Ga0207649_11539091 Ga0207649_115390911 67
551 3300025922 Ga0207646_10008173 Ga0207646_1000817318 67
552 3300025923 Ga0207681_10199759 Ga0207681_101997593 67
553 3300025923 Ga0207681_10938174 Ga0207681_109381741 67
554 3300025924 Ga0207694_10000656 Ga0207694_1000065628 67
555 3300025924 Ga0207694_10297320 Ga0207694_102973203 67
556 3300025924 Ga0207694_11874675 Ga0207694_118746751 67
557 3300025925 Ga0207650_10011784 Ga0207650_100117843 67
558 3300025925 Ga0207650_10305848 Ga0207650_103058482 67
559 3300025925 Ga0207650_10512872 Ga0207650_105128722 67
560 3300025926 Ga0207659_10368084 Ga0207659_103680842 67
561 3300025926 Ga0207659_11812915 Ga0207659_118129151 67
562 3300025927 Ga0207687_10058985 Ga0207687_100589854 67
563 3300025927 Ga0207687_10060554 Ga0207687_100605542 67
564 3300025927 Ga0207687_10083104 Ga0207687_100831043 67
565 3300025927 Ga0207687_10093319 Ga0207687_100933193 67
566 3300025927 Ga0207687_10169610 Ga0207687_101696101 67
567 3300025928 Ga0207700_10420644 Ga0207700_104206441 67
568 3300025928 Ga0207700_10497764 Ga0207700_104977641 67
569 3300025928 Ga0207700_10558393 Ga0207700_105583932 67
570 3300025928 Ga0207700_10789354 Ga0207700_107893541 67
571 3300025929 Ga0207664_10000001 Ga0207664_10000001510 67
572 3300025929 Ga0207664_10829357 Ga0207664_108293572 67
573 3300025929 Ga0207664_10923512 Ga0207664_109235121 67
574 3300025929 Ga0207664_10951558 Ga0207664_109515582 67
575 3300025929 Ga0207664_11617916 Ga0207664_116179161 67
576 3300025931 Ga0207644_10020676 Ga0207644_100206762 67
577 3300025931 Ga0207644_10036195 Ga0207644_100361954 67
578 3300025931 Ga0207644_10166907 Ga0207644_101669073 67
579 3300025931 Ga0207644_10461593 Ga0207644_104615931 67
580 3300025932 Ga0207690_10008330 Ga0207690_100083305 67
581 3300025932 Ga0207690_10730812 Ga0207690_107308121 67
582 3300025933 Ga0207706_10003017 Ga0207706_1000301716 67
583 3300025933 Ga0207706_10095189 Ga0207706_100951892 67
584 3300025934 Ga0207686_10222629 Ga0207686_102226291 67
585 3300025934 Ga0207686_10483549 Ga0207686_104835492 67
586 3300025934 Ga0207686_10757720 Ga0207686_107577201 67
587 3300025935 Ga0207709_10061998 Ga0207709_100619983 67
588 3300025935 Ga0207709_10080992 Ga0207709_100809922 67
589 3300025935 Ga0207709_10096170 Ga0207709_100961702 67
590 3300025935 Ga0207709_10384000 Ga0207709_103840002 67
591 3300025935 Ga0207709_10674695 Ga0207709_106746951 67
592 3300025935 Ga0207709_11240436 Ga0207709_112404361 67
593 3300025937 Ga0207669_10026766 Ga0207669_100267665 67
594 3300025937 Ga0207669_10131285 Ga0207669_101312852 67
595 3300025938 Ga0207704_10930672 Ga0207704_109306721 67
596 3300025939 Ga0207665_10011709 Ga0207665_100117096 67
597 3300025939 Ga0207665_10312578 Ga0207665_103125783 67
598 3300025939 Ga0207665_11498929 Ga0207665_114989291 67
599 3300025940 Ga0207691_10000527 Ga0207691_1000052718 67
600 3300025940 Ga0207691_10611640 Ga0207691_106116401 67
601 3300025940 Ga0207691_10691711 Ga0207691_106917111 67
602 3300025941 Ga0207711_10000675 Ga0207711_100006756 67
603 3300025941 Ga0207711_10001556 Ga0207711_1000155619 67
604 3300025941 Ga0207711_10097111 Ga0207711_100971114 67
605 3300025941 Ga0207711_10479988 Ga0207711_104799882 67
606 3300025941 Ga0207711_11212416 Ga0207711_112124161 67
607 3300025942 Ga0207689_10017267 Ga0207689_100172673 67
608 3300025942 Ga0207689_11760193 Ga0207689_117601931 67
609 3300025944 Ga0207661_10365898 Ga0207661_103658982 67
610 3300025944 Ga0207661_10645584 Ga0207661_106455841 67
611 3300025944 Ga0207661_11038622 Ga0207661_110386222 67
612 3300025945 Ga0207679_10346660 Ga0207679_103466601 67
613 3300025945 Ga0207679_11036036 Ga0207679_110360362 67
614 3300025949 Ga0207667_10001125 Ga0207667_100011254 67
615 3300025949 Ga0207667_10017539 Ga0207667_100175393 67
616 3300025949 Ga0207667_10119327 Ga0207667_101193273 67
617 3300025949 Ga0207667_10504307 Ga0207667_105043072 67
618 3300025960 Ga0207651_10010498 Ga0207651_100104982 67
619 3300025960 Ga0207651_11678228 Ga0207651_116782281 67
620 3300025960 Ga0207651_11903572 Ga0207651_119035721 67
621 3300025961 Ga0207712_10000002 Ga0207712_100000025 67
622 3300025961 Ga0207712_10049885 Ga0207712_100498854 67
623 3300025961 Ga0207712_11555212 Ga0207712_115552121 67
624 3300025972 Ga0207668_10106841 Ga0207668_101068412 67
625 3300025972 Ga0207668_11058869 Ga0207668_110588691 67
626 3300025981 Ga0207640_10075142 Ga0207640_100751422 67
627 3300025981 Ga0207640_10413879 Ga0207640_104138792 67
628 3300025981 Ga0207640_10569844 Ga0207640_105698442 67
629 3300025981 Ga0207640_11605549 Ga0207640_116055491 67
630 3300025986 Ga0207658_10003656 Ga0207658_1000365611 67
631 3300025986 Ga0207658_10031533 Ga0207658_100315335 67
632 3300025986 Ga0207658_10049393 Ga0207658_100493931 67
633 3300025986 Ga0207658_10712074 Ga0207658_107120741 67
634 3300026023 Ga0207677_10528205 Ga0207677_105282052 67
635 3300026023 Ga0207677_10904139 Ga0207677_109041392 67
636 3300026035 Ga0207703_10000315 Ga0207703_1000031537 67
637 3300026035 Ga0207703_10000676 Ga0207703_1000067629 67
638 3300026035 Ga0207703_10289518 Ga0207703_102895182 67
639 3300026041 Ga0207639_10010682 Ga0207639_100106825 67
640 3300026041 Ga0207639_10099007 Ga0207639_100990072 67
641 3300026041 Ga0207639_10314078 Ga0207639_103140782 67
642 3300026041 Ga0207639_11408325 Ga0207639_114083251 67
643 3300026067 Ga0207678_10154354 Ga0207678_101543541 67
644 3300026067 Ga0207678_10172176 Ga0207678_101721762 67
645 3300026067 Ga0207678_10280149 Ga0207678_102801492 67
646 3300026067 Ga0207678_10489965 Ga0207678_104899652 67
647 3300026067 Ga0207678_11432650 Ga0207678_114326502 67
648 3300026075 Ga0207708_10019564 Ga0207708_100195642 67
649 3300026075 Ga0207708_11472027 Ga0207708_114720271 67
650 3300026078 Ga0207702_10023823 Ga0207702_100238232 67
651 3300026078 Ga0207702_10643676 Ga0207702_106436762 67
652 3300026078 Ga0207702_11000642 Ga0207702_110006421 67
653 3300026078 Ga0207702_11161400 Ga0207702_111614001 67
654 3300026088 Ga0207641_10013108 Ga0207641_100131087 67
655 3300026088 Ga0207641_10034952 Ga0207641_100349524 67
656 3300026088 Ga0207641_10088299 Ga0207641_100882993 67
657 3300026088 Ga0207641_10282525 Ga0207641_102825251 67
658 3300026088 Ga0207641_11879757 Ga0207641_118797571 67
659 3300026095 Ga0207676_10102976 Ga0207676_101029763 67
660 3300026095 Ga0207676_10131422 Ga0207676_101314221 67
661 3300026095 Ga0207676_10233598 Ga0207676_102335983 67
662 3300026116 Ga0207674_10429108 Ga0207674_104291082 67
663 3300026118 Ga0207675_100011376 Ga0207675_1000113764 67
664 3300026118 Ga0207675_100441613 Ga0207675_1004416131 67
665 3300026121 Ga0207683_10001988 Ga0207683_100019882 67
666 3300026121 Ga0207683_10005105 Ga0207683_100051053 67
667 3300026121 Ga0207683_11135942 Ga0207683_111359423 67
668 3300026142 Ga0207698_10001558 Ga0207698_1000155814 67
669 3300026142 Ga0207698_10280821 Ga0207698_102808212 67
670 3300026142 Ga0207698_10284038 Ga0207698_102840382 67
671 3300026142 Ga0207698_10731855 Ga0207698_107318552 67
672 3300026142 Ga0207698_11400398 Ga0207698_114003981 67
673 3300027312 Ga0209371_1046461 Ga0209371_10464611 67
674 3300027512 Ga0209179_1002471 Ga0209179_10024717 67
675 3300027876 Ga0209974_10202245 Ga0209974_102022452 67
676 3300027876 Ga0209974_10416211 Ga0209974_104162112 67
677 3300027907 Ga0207428_10001932 Ga0207428_1000193216 67
678 3300027907 Ga0207428_10205041 Ga0207428_102050412 67
679 3300027907 Ga0207428_10225265 Ga0207428_102252652 67
680 3300028379 Ga0268266_10020090 Ga0268266_100200905 67
681 3300028379 Ga0268266_10306426 Ga0268266_103064262 67
682 3300028379 Ga0268266_10483999 Ga0268266_104839991 67
683 3300028379 Ga0268266_10742643 Ga0268266_107426432 67
684 3300028380 Ga0268265_10026539 Ga0268265_100265396 67
685 3300028381 Ga0268264_10005182 Ga0268264_100051826 67
686 3300028381 Ga0268264_11066015 Ga0268264_110660151 67
687 3300028381 Ga0268264_11545577 Ga0268264_115455771 67
688 3300028786 Ga0307517_10572196 Ga0307517_105721961 67
689 3300028794 Ga0307515_10235852 Ga0307515_102358522 67
690 3300028794 Ga0307515_10377329 Ga0307515_103773291 67
691 3300030500 Ga0268256_1052414 Ga0268256_10524142 67
692 3300030522 Ga0307512_10470834 Ga0307512_104708341 67
693 3300030732 Ga0316176_1002176 Ga0316176_10021762 67
694 3300030735 Ga0316178_1092568 Ga0316178_10925681 67
695 3300030736 Ga0316180_1140247 Ga0316180_11402471 67
696 3300030742 Ga0316183_1164821 Ga0316183_11648211 67
697 3300030744 Ga0316181_1000529 Ga0316181_10005291 67
698 3300030745 Ga0316182_1131057 Ga0316182_11310572 67
699 3300030760 Ga0265762_1154113 Ga0265762_11541132 67
700 3300030863 Ga0265766_1023954 Ga0265766_10239541 67
701 3300031239 Ga0265328_10060565 Ga0265328_100605653 67
702 3300031241 Ga0265325_10211851 Ga0265325_102118511 67
703 3300031250 Ga0265331_10000393 Ga0265331_1000039318 67
704 3300031251 Ga0265327_10001930 Ga0265327_1000193013 67
705 3300031251 Ga0265327_10007612 Ga0265327_100076126 67
706 3300031251 Ga0265327_10012338 Ga0265327_100123382 67
707 3300031251 Ga0265327_10358605 Ga0265327_103586052 67
708 3300031344 Ga0265316_10078353 Ga0265316_100783534 67
709 3300031456 Ga0307513_10017299 Ga0307513_100172996 67
710 3300031456 Ga0307513_10075355 Ga0307513_100753554 67
711 3300031456 Ga0307513_10362823 Ga0307513_103628231 67
712 3300031456 Ga0307513_10385307 Ga0307513_103853072 67
713 3300031507 Ga0307509_10493699 Ga0307509_104936991 67
714 3300031548 Ga0307408_100004096 Ga0307408_1000040968 67
715 3300031548 Ga0307408_100027283 Ga0307408_1000272834 67
716 3300031548 Ga0307408_100029844 Ga0307408_1000298442 67
717 3300031548 Ga0307408_100037161 Ga0307408_1000371613 67
718 3300031548 Ga0307408_100037908 Ga0307408_1000379082 67
719 3300031548 Ga0307408_100056630 Ga0307408_1000566302 67
720 3300031548 Ga0307408_100089677 Ga0307408_1000896774 67
721 3300031548 Ga0307408_100124786 Ga0307408_1001247863 67
722 3300031548 Ga0307408_100149275 Ga0307408_1001492752 67
723 3300031548 Ga0307408_100388887 Ga0307408_1003888873 67
724 3300031548 Ga0307408_100408750 Ga0307408_1004087504 67
725 3300031548 Ga0307408_100486561 Ga0307408_1004865612 67
726 3300031548 Ga0307408_102391130 Ga0307408_1023911302 67
727 3300031616 Ga0307508_10234030 Ga0307508_102340301 67
728 3300031649 Ga0307514_10538232 Ga0307514_105382321 67
729 3300031727 Ga0316576_10866716 Ga0316576_108667161 67
730 3300031731 Ga0307405_10001824 Ga0307405_100018247 67
731 3300031731 Ga0307405_10049986 Ga0307405_100499864 67
732 3300031731 Ga0307405_10058059 Ga0307405_100580592 67
733 3300031731 Ga0307405_10061947 Ga0307405_100619474 67
734 3300031731 Ga0307405_10208555 Ga0307405_102085552 67
735 3300031731 Ga0307405_10247616 Ga0307405_102476162 67
736 3300031731 Ga0307405_10290980 Ga0307405_102909802 67
737 3300031731 Ga0307405_10357635 Ga0307405_103576352 67
738 3300031731 Ga0307405_10445243 Ga0307405_104452432 67
739 3300031731 Ga0307405_10470966 Ga0307405_104709662 67
740 3300031731 Ga0307405_10602688 Ga0307405_106026882 67
741 3300031731 Ga0307405_10707280 Ga0307405_107072802 67
742 3300031731 Ga0307405_11418389 Ga0307405_114183891 67
743 3300031824 Ga0307413_10007146 Ga0307413_100071464 67
744 3300031824 Ga0307413_10012044 Ga0307413_100120443 67
745 3300031824 Ga0307413_10043973 Ga0307413_100439732 67
746 3300031824 Ga0307413_10050698 Ga0307413_100506983 67
747 3300031824 Ga0307413_10117255 Ga0307413_101172551 67
748 3300031824 Ga0307413_10135921 Ga0307413_101359212 67
749 3300031824 Ga0307413_10261513 Ga0307413_102615132 67
750 3300031824 Ga0307413_10421462 Ga0307413_104214622 67
751 3300031824 Ga0307413_10586556 Ga0307413_105865561 67
752 3300031824 Ga0307413_10956618 Ga0307413_109566182 67
753 3300031824 Ga0307413_10973471 Ga0307413_109734712 67
754 3300031824 Ga0307413_11294872 Ga0307413_112948722 67
755 3300031824 Ga0307413_11320218 Ga0307413_113202182 67
756 3300031838 Ga0307518_10064062 Ga0307518_100640623 67
757 3300031852 Ga0307410_10004562 Ga0307410_100045627 67
758 3300031852 Ga0307410_10006834 Ga0307410_100068342 67
759 3300031852 Ga0307410_10021301 Ga0307410_100213012 67
760 3300031852 Ga0307410_10025907 Ga0307410_100259072 67
761 3300031852 Ga0307410_10032973 Ga0307410_100329732 67
762 3300031852 Ga0307410_10184774 Ga0307410_101847742 67
763 3300031852 Ga0307410_10239035 Ga0307410_102390352 67
764 3300031852 Ga0307410_10832107 Ga0307410_108321073 67
765 3300031852 Ga0307410_11065894 Ga0307410_110658941 67
766 3300031852 Ga0307410_11355210 Ga0307410_113552101 67
767 3300031852 Ga0307410_11660228 Ga0307410_116602282 67
768 3300031852 Ga0307410_11666567 Ga0307410_116665671 67
769 3300031901 Ga0307406_10011101 Ga0307406_100111016 67
770 3300031901 Ga0307406_10021863 Ga0307406_100218635 67
771 3300031901 Ga0307406_10092243 Ga0307406_100922432 67
772 3300031901 Ga0307406_10095491 Ga0307406_100954912 67
773 3300031901 Ga0307406_10146643 Ga0307406_101466431 67
774 3300031901 Ga0307406_10149054 Ga0307406_101490541 67
775 3300031901 Ga0307406_10342988 Ga0307406_103429882 67
776 3300031901 Ga0307406_10498923 Ga0307406_104989231 67
777 3300031901 Ga0307406_11253740 Ga0307406_112537401 67
778 3300031903 Ga0307407_10016800 Ga0307407_100168002 67
779 3300031903 Ga0307407_10023952 Ga0307407_100239523 67
780 3300031903 Ga0307407_10063249 Ga0307407_100632492 67
781 3300031903 Ga0307407_10098440 Ga0307407_100984401 67
782 3300031903 Ga0307407_10170372 Ga0307407_101703721 67
783 3300031903 Ga0307407_10181446 Ga0307407_101814462 67
784 3300031903 Ga0307407_10188886 Ga0307407_101888861 67
785 3300031903 Ga0307407_11623756 Ga0307407_116237561 67
786 3300031911 Ga0307412_10001098 Ga0307412_1000109813 67
787 3300031911 Ga0307412_10028533 Ga0307412_100285331 67
788 3300031911 Ga0307412_10040148 Ga0307412_100401482 67
789 3300031911 Ga0307412_10054535 Ga0307412_100545353 67
790 3300031911 Ga0307412_10064294 Ga0307412_100642942 67
791 3300031911 Ga0307412_10075565 Ga0307412_100755652 67
792 3300031911 Ga0307412_10101590 Ga0307412_101015902 67
793 3300031911 Ga0307412_10109144 Ga0307412_101091442 67
794 3300031911 Ga0307412_10267823 Ga0307412_102678232 67
795 3300031911 Ga0307412_10327764 Ga0307412_103277641 67
796 3300031911 Ga0307412_10374615 Ga0307412_103746151 67
797 3300031911 Ga0307412_10384432 Ga0307412_103844322 67
798 3300031911 Ga0307412_10508614 Ga0307412_105086141 67
799 3300031911 Ga0307412_10551346 Ga0307412_105513461 67
800 3300031911 Ga0307412_10734830 Ga0307412_107348301 67
801 3300031911 Ga0307412_10866759 Ga0307412_108667592 67
802 3300031911 Ga0307412_10870528 Ga0307412_108705282 67
803 3300031911 Ga0307412_11367813 Ga0307412_113678131 67
804 3300031995 Ga0307409_100017036 Ga0307409_1000170363 67
805 3300031995 Ga0307409_100034644 Ga0307409_1000346441 67
806 3300031995 Ga0307409_100043092 Ga0307409_1000430925 67
807 3300031995 Ga0307409_100047789 Ga0307409_1000477894 67
808 3300031995 Ga0307409_100055044 Ga0307409_1000550442 67
809 3300031995 Ga0307409_100063933 Ga0307409_1000639332 67
810 3300031995 Ga0307409_100095980 Ga0307409_1000959801 67
811 3300031995 Ga0307409_100197086 Ga0307409_1001970862 67
812 3300031995 Ga0307409_100210360 Ga0307409_1002103601 67
813 3300031995 Ga0307409_100360534 Ga0307409_1003605341 67
814 3300031995 Ga0307409_100505904 Ga0307409_1005059041 67
815 3300031995 Ga0307409_100540907 Ga0307409_1005409072 67
816 3300031995 Ga0307409_100733313 Ga0307409_1007333132 67
817 3300031995 Ga0307409_100927340 Ga0307409_1009273402 67
818 3300031995 Ga0307409_101373263 Ga0307409_1013732631 67
819 3300031995 Ga0307409_101510148 Ga0307409_1015101481 67
820 3300031995 Ga0307409_102947937 Ga0307409_1029479372 67
821 3300032002 Ga0307416_100014730 Ga0307416_1000147303 67
822 3300032002 Ga0307416_100072215 Ga0307416_1000722152 67
823 3300032002 Ga0307416_100077052 Ga0307416_1000770524 67
824 3300032002 Ga0307416_100094749 Ga0307416_1000947494 67
825 3300032002 Ga0307416_100096528 Ga0307416_1000965284 67
826 3300032002 Ga0307416_100120934 Ga0307416_1001209343 67
827 3300032002 Ga0307416_100213681 Ga0307416_1002136811 67
828 3300032002 Ga0307416_100231574 Ga0307416_1002315742 67
829 3300032002 Ga0307416_100244194 Ga0307416_1002441942 67
830 3300032002 Ga0307416_100275746 Ga0307416_1002757461 67
831 3300032002 Ga0307416_100280500 Ga0307416_1002805002 67
832 3300032002 Ga0307416_100288524 Ga0307416_1002885242 67
833 3300032002 Ga0307416_100326581 Ga0307416_1003265812 67
834 3300032002 Ga0307416_100352939 Ga0307416_1003529391 67
835 3300032002 Ga0307416_100430466 Ga0307416_1004304662 67
836 3300032002 Ga0307416_100602041 Ga0307416_1006020412 67
837 3300032002 Ga0307416_102168302 Ga0307416_1021683021 67
838 3300032002 Ga0307416_103143038 Ga0307416_1031430381 67
839 3300032004 Ga0307414_10049175 Ga0307414_100491755 67
840 3300032004 Ga0307414_10148169 Ga0307414_101481691 67
841 3300032004 Ga0307414_10191870 Ga0307414_101918701 67
842 3300032004 Ga0307414_10201130 Ga0307414_102011301 67
843 3300032004 Ga0307414_10260111 Ga0307414_102601112 67
844 3300032004 Ga0307414_10312710 Ga0307414_103127102 67
845 3300032004 Ga0307414_10333565 Ga0307414_103335651 67
846 3300032004 Ga0307414_11132362 Ga0307414_111323621 67
847 3300032004 Ga0307414_11796089 Ga0307414_117960891 67
848 3300032005 Ga0307411_10029428 Ga0307411_100294284 67
849 3300032005 Ga0307411_10086652 Ga0307411_100866521 67
850 3300032005 Ga0307411_10274877 Ga0307411_102748772 67
851 3300032005 Ga0307411_10531447 Ga0307411_105314472 67
852 3300032005 Ga0307411_10550441 Ga0307411_105504412 67
853 3300032005 Ga0307411_10652831 Ga0307411_106528311 67
854 3300032005 Ga0307411_11107021 Ga0307411_111070211 67
855 3300032005 Ga0307411_11854232 Ga0307411_118542322 67
856 3300032005 Ga0307411_12144187 Ga0307411_121441871 67
857 3300032126 Ga0307415_100015143 Ga0307415_1000151436 67
858 3300032126 Ga0307415_100060105 Ga0307415_1000601055 67
859 3300032126 Ga0307415_100158387 Ga0307415_1001583871 67
860 3300032126 Ga0307415_100200892 Ga0307415_1002008923 67
861 3300032126 Ga0307415_100340209 Ga0307415_1003402092 67
862 3300032126 Ga0307415_100500845 Ga0307415_1005008452 67
863 3300032126 Ga0307415_100502025 Ga0307415_1005020252 67
864 3300032126 Ga0307415_100865120 Ga0307415_1008651202 67
865 3300032168 Ga0316593_10099211 Ga0316593_100992113 67
866 3300033179 Ga0307507_10062721 Ga0307507_100627214 67
867 3300033180 Ga0307510_10032524 Ga0307510_100325245 67
868 3300033180 Ga0307510_10116554 Ga0307510_101165543 67
869 3300033524 Ga0316592_1068630 Ga0316592_10686302 67
870 3300033541 Ga0316596_1072203 Ga0316596_10722032 67
871 3300033541 Ga0316596_1081265 Ga0316596_10812652 67
872 3300033541 Ga0316596_1228058 Ga0316596_12280582 67
873 3300034816 Ga0373930_0059307 Ga0373930_0059307_230_433 67
874 3300034819 Ga0373958_0159944 Ga0373958_0159944_124_327 67
875 3300035091 Ga0373951_0001434 Ga0373951_0001434_316_519 67
876 3300035091 Ga0373951_0005165 Ga0373951_0005165_1010_1213 67
877 3300035111 Ga0373923_0593976 Ga0373923_0593976_101_307 67
878 3300035112 Ga0373932_0233220 Ga0373932_0233220_340_543 67
879 3300035115 Ga0373941_0219279 Ga0373941_0219279_274_477 67
880 3300035116 Ga0373945_0209981 Ga0373945_0209981_550_756 67
881 3300035119 Ga0373956_0173050 Ga0373956_0173050_329_535 67
882 3300035120 Ga0373957_0037179 Ga0373957_0037179_1098_1304 67
883 3300035172 Ga0373955_0097921 Ga0373955_0097921_324_530 67
884 3300035242 Ga0373962_0099230 Ga0373962_0099230_341_544 67
885 3300035691 Ga0373931_0092338 Ga0373931_0092338_706_909 67
886 3300035692 Ga0373935_0776355 Ga0373935_0776355_329_535 67
887 3300035725 Ga0373947_0593340 Ga0373947_0593340_361_567 67
888 3300036401 Ga0373937_0240356 Ga0373937_0240356_619_825 67
889 3300037068 Ga0373925_0128972 Ga0373925_0128972_994_1200 67
890 3300037312 Ga0395899_0002071 Ga0395899_0002071_15438_15641 67
891 3300037312 Ga0395899_0012150 Ga0395899_0012150_4816_5019 67
892 3300037312 Ga0395899_0042478 Ga0395899_0042478_1273_1476 67
893 3300037312 Ga0395899_0044343 Ga0395899_0044343_749_952 67
894 3300037312 Ga0395899_0122284 Ga0395899_0122284_1170_1373 67
895 3300037312 Ga0395899_1002677 Ga0395899_1002677_251_454 67
896 3300037418 Ga0395900_0002047 Ga0395900_0002047_7136_7363 67
897 3300037418 Ga0395900_0007771 Ga0395900_0007771_5817_6020 67
898 3300037418 Ga0395900_0063331 Ga0395900_0063331_973_1176 67
899 3300037418 Ga0395900_0091319 Ga0395900_0091319_1498_1701 67
900 3300037418 Ga0395900_0119281 Ga0395900_0119281_2361_2564 67
901 3300037418 Ga0395900_0162275 Ga0395900_0162275_1661_1864 67
902 3300037418 Ga0395900_0276018 Ga0395900_0276018_1263_1466 67
903 3300037418 Ga0395900_0472686 Ga0395900_0472686_414_617 67
904 3300037418 Ga0395900_1119541 Ga0395900_1119541_29_232 67
905 3300037466 Ga0395898_0010620 Ga0395898_0010620_2296_2499 67
906 3300037466 Ga0395898_0024316 Ga0395898_0024316_1755_1958 67
907 3300037466 Ga0395898_0039323 Ga0395898_0039323_2903_3130 67
908 3300037466 Ga0395898_0053014 Ga0395898_0053014_168_371 67
909 3300037466 Ga0395898_0060072 Ga0395898_0060072_228_431 67
910 3300037466 Ga0395898_0069594 Ga0395898_0069594_2653_2856 67
911 3300037466 Ga0395898_0107768 Ga0395898_0107768_1376_1579 67
912 3300037466 Ga0395898_0185881 Ga0395898_0185881_570_773 67
913 3300037466 Ga0395898_0197932 Ga0395898_0197932_501_704 67
914 3300037471 Ga0395905_0011108 Ga0395905_0011108_1157_1360 67
915 3300037471 Ga0395905_0550049 Ga0395905_0550049_490_693 67
916 3300037471 Ga0395905_0553332 Ga0395905_0553332_822_1025 67
917 3300037471 Ga0395905_0708485 Ga0395905_0708485_228_431 67
918 3300037471 Ga0395905_0924892 Ga0395905_0924892_496_699 67
919 3300037471 Ga0395905_1781441 Ga0395905_1781441_271_483 67
920 3300038443 Ga0395901_0018181 Ga0395901_0018181_6410_6613 67
921 3300038443 Ga0395901_0062464 Ga0395901_0062464_2880_3083 67
922 3300038443 Ga0395901_0063679 Ga0395901_0063679_676_903 67
923 3300038443 Ga0395901_0065762 Ga0395901_0065762_2161_2364 67
924 3300038443 Ga0395901_0067956 Ga0395901_0067956_2056_2259 67
925 3300038443 Ga0395901_0118943 Ga0395901_0118943_1386_1589 67
926 3300038443 Ga0395901_0361299 Ga0395901_0361299_143_346 67
927 3300038443 Ga0395901_1092670 Ga0395901_1092670_102_305 67
928 3300038443 Ga0395901_1257550 Ga0395901_1257550_359_562 67
929 3300038996 Ga0242420_148478 Ga0242420_148478_224_427 67
930 3300039437 Ga0436365_0091043 Ga0436365_0091043_407_610 67
931 3300039437 Ga0436365_0779361 Ga0436365_0779361_2052_2258 67
932 3300039437 Ga0436365_1937032 Ga0436365_1937032_299_505 67
933 3300039450 Ga0436363_0309976 Ga0436363_0309976_933_1139 67
934 3300039453 Ga0436362_0126685 Ga0436362_0126685_2625_2831 67
935 3300041404 Ga0439436_0000426 Ga0439436_0000426_1615_1818 67
936 3300041404 Ga0439436_0002918 Ga0439436_0002918_4341_4559 67
937 3300041404 Ga0439436_0037321 Ga0439436_0037321_1030_1233 67
938 3300041405 Ga0439438_001015 Ga0439438_001015_2416_2634 67
939 3300041405 Ga0439438_041334 Ga0439438_041334_769_972 67
940 3300041405 Ga0439438_081595 Ga0439438_081595_40_243 67
941 3300041406 Ga0439439_0000182 Ga0439439_0000182_6079_6297 67
942 3300041406 Ga0439439_0115147 Ga0439439_0115147_362_565 67
943 3300041410 Ga0439461_0016623 Ga0439461_0016623_329_547 67
944 3300041410 Ga0439461_0053203 Ga0439461_0053203_267_470 67
945 3300041410 Ga0439461_0112112 Ga0439461_0112112_225_428 67
946 3300041411 Ga0439466_0001588 Ga0439466_0001588_1903_2121 67
947 3300041411 Ga0439466_0118738 Ga0439466_0118738_112_315 67
948 3300041411 Ga0439466_0245538 Ga0439466_0245538_255_458 67
949 3300041413 Ga0439465_0019982 Ga0439465_0019982_1589_1792 67
950 3300041413 Ga0439465_0060523 Ga0439465_0060523_125_343 67
951 3300041413 Ga0439465_0268007 Ga0439465_0268007_344_556 67
952 3300041441 Ga0451787_429570 Ga0451787_429570_263_466 67
953 3300041441 Ga0451787_454270 Ga0451787_454270_233_436 67
954 3300041443 Ga0451789_0449262 Ga0451789_0449262_286_489 67
955 3300041443 Ga0451789_0954465 Ga0451789_0954465_1223_1426 67
956 3300041444 Ga0451790_29369 Ga0451790_29369_551_754 67
957 3300041451 Ga0451791_0333509 Ga0451791_0333509_213_419 67
958 3300041451 Ga0451791_0425394 Ga0451791_0425394_748_951 67
959 3300041451 Ga0451791_0746838 Ga0451791_0746838_354_557 67
960 3300041451 Ga0451791_1365422 Ga0451791_1365422_284_487 67
961 3300041451 Ga0451791_1684038 Ga0451791_1684038_77_280 67
962 3300041452 Ga0451793_0107442 Ga0451793_0107442_571_774 67
963 3300041452 Ga0451793_0375343 Ga0451793_0375343_262_465 67
964 3300041452 Ga0451793_0394566 Ga0451793_0394566_603_806 67
965 3300041453 Ga0451797_0414603 Ga0451797_0414603_359_562 67
966 3300041453 Ga0451797_0578603 Ga0451797_0578603_158_361 67
967 3300041453 Ga0451797_0820372 Ga0451797_0820372_705_908 67
968 3300041456 Ga0451795_0000828 Ga0451795_0000828_435_638 67
969 3300041459 Ga0451800_0128843 Ga0451800_0128843_123_326 67
970 3300041459 Ga0451800_0298232 Ga0451800_0298232_162_365 67
971 3300041459 Ga0451800_0575305 Ga0451800_0575305_434_637 67
972 3300041460 Ga0451802_0089278 Ga0451802_0089278_941_1144 67
973 3300041460 Ga0451802_0278509 Ga0451802_0278509_61_264 67
974 3300041460 Ga0451802_0708891 Ga0451802_0708891_286_489 67
975 3300041462 Ga0451806_674951 Ga0451806_674951_265_468 67
976 3300041486 Ga0451807_0181775 Ga0451807_0181775_333_536 67
977 3300041486 Ga0451807_1758962 Ga0451807_1758962_454_657 67
978 3300041486 Ga0451807_2590362 Ga0451807_2590362_216_419 67
979 3300041491 Ga0451833_1376670 Ga0451833_1376670_31_234 67
980 3300041494 Ga0451837_1258306 Ga0451837_1258306_301_507 67
981 3300041494 Ga0451837_1568330 Ga0451837_1568330_75_281 67
982 3300041496 Ga0451839_1351262 Ga0451839_1351262_552_764 67
983 3300041496 Ga0451839_1586779 Ga0451839_1586779_142_345 67
984 3300041498 Ga0451841_0147103 Ga0451841_0147103_243_446 67
985 3300041503 Ga0451847_0602894 Ga0451847_0602894_256_459 67
986 3300041505 Ga0451849_0833272 Ga0451849_0833272_144_347 67
987 3300041507 Ga0451851_0537676 Ga0451851_0537676_277_480 67
988 3300041509 Ga0451843_1119515 Ga0451843_1119515_560_763 67
989 3300041511 Ga0451855_0050733 Ga0451855_0050733_266_469 67
990 3300041512 Ga0451853_0358524 Ga0451853_0358524_313_516 67
991 3300041512 Ga0451853_2739900 Ga0451853_2739900_182_385 67
992 3300041997 Ga0439431_0046537 Ga0439431_0046537_248_466 67
993 3300041999 Ga0439433_0000242 Ga0439433_0000242_4122_4340 67
994 3300041999 Ga0439433_0000467 Ga0439433_0000467_4845_5048 67
995 3300041999 Ga0439433_0016129 Ga0439433_0016129_1416_1619 67
996 3300041999 Ga0439433_0061981 Ga0439433_0061981_486_695 67
997 3300042002 Ga0439442_000016 Ga0439442_000016_15445_15648 67
998 3300042002 Ga0439442_000282 Ga0439442_000282_4772_4975 67
999 3300042002 Ga0439442_001917 Ga0439442_001917_1903_2121 67
1000 3300042002 Ga0439442_005349 Ga0439442_005349_2319_2522 67
1001 3300042002 Ga0439442_007158 Ga0439442_007158_1888_2091 67
1002 3300042005 Ga0439448_0127540 Ga0439448_0127540_102_305 67
1003 3300042006 Ga0439432_010951 Ga0439432_010951_154_372 67
1004 3300042006 Ga0439432_022430 Ga0439432_022430_1386_1589 67
1005 3300042007 Ga0439449_0000230 Ga0439449_0000230_8138_8341 67
1006 3300042007 Ga0439449_0001930 Ga0439449_0001930_2623_2826 67
1007 3300042007 Ga0439449_0016620 Ga0439449_0016620_1351_1569 67
1008 3300042007 Ga0439449_0084853 Ga0439449_0084853_133_336 67
1009 3300042007 Ga0439449_0108314 Ga0439449_0108314_381_584 67
1010 3300042007 Ga0439449_0197236 Ga0439449_0197236_47_250 67
1011 3300042007 Ga0439449_0398914 Ga0439449_0398914_144_347 67
1012 3300042010 Ga0439452_001317 Ga0439452_001317_8623_8841 67
1013 3300042010 Ga0439452_045896 Ga0439452_045896_780_983 67
1014 3300042010 Ga0439452_064252 Ga0439452_064252_425_628 67
1015 3300042013 Ga0439456_108413 Ga0439456_108413_172_381 67
1016 3300042014 Ga0439457_000356 Ga0439457_000356_8571_8789 67
1017 3300042014 Ga0439457_006669 Ga0439457_006669_1381_1584 67
1018 3300042014 Ga0439457_027578 Ga0439457_027578_804_1007 67
1019 3300042015 Ga0439462_0003349 Ga0439462_0003349_1530_1748 67
1020 3300042015 Ga0439462_0012078 Ga0439462_0012078_1908_2111 67
1021 3300042015 Ga0439462_0013073 Ga0439462_0013073_54_257 67
1022 3300042015 Ga0439462_0077392 Ga0439462_0077392_573_776 67
1023 3300042115 Ga0450911_008837 Ga0450911_008837_307_510 67
1024 3300042115 Ga0450911_016469 Ga0450911_016469_590_793 67
1025 3300042115 Ga0450911_017875 Ga0450911_017875_292_510 67
1026 3300042121 Ga0450919_000012 Ga0450919_000012_2572_2790 67
1027 3300042121 Ga0450919_001784 Ga0450919_001784_293_496 67
1028 3300042122 Ga0450920_007814 Ga0450920_007814_1529_1747 67
1029 3300042122 Ga0450920_126027 Ga0450920_126027_43_246 67
1030 3300042124 Ga0450922_024543 Ga0450922_024543_387_605 67
1031 3300042131 Ga0450894_073519 Ga0450894_073519_12_215 67
1032 3300042145 Ga0450906_014699 Ga0450906_014699_546_749 67
1033 3300042146 Ga0450907_000308 Ga0450907_000308_11237_11440 67
1034 3300042146 Ga0450907_001905 Ga0450907_001905_1529_1747 67
1035 3300042147 Ga0450910_045591 Ga0450910_045591_241_444 67
1036 3300042156 Ga0439446_0006482 Ga0439446_0006482_1826_2044 67
1037 3300042156 Ga0439446_0315801 Ga0439446_0315801_12_215 67
1038 3300042157 Ga0439458_0184367 Ga0439458_0184367_266_469 67
1039 3300042184 Ga0450908_001115 Ga0450908_001115_2090_2308 67
1040 3300042184 Ga0450908_004272 Ga0450908_004272_1571_1774 67
1041 3300042185 Ga0450909_001836 Ga0450909_001836_1037_1255 67
1042 3300042185 Ga0450909_020841 Ga0450909_020841_368_571 67
1043 3300042185 Ga0450909_038462 Ga0450909_038462_302_505 67
1044 3300042435 Ga0439434_0000231 Ga0439434_0000231_8570_8788 67
1045 3300042435 Ga0439434_0012022 Ga0439434_0012022_341_544 67
1046 3300042531 Ga0450918_004338 Ga0450918_004338_1726_1929 67
1047 3300042531 Ga0450918_004412 Ga0450918_004412_383_601 67
1048 3300042876 Ga0451577_0014128 Ga0451577_0014128_7139_7342 67
1049 3300042876 Ga0451577_0050819 Ga0451577_0050819_2291_2494 67
1050 3300042876 Ga0451577_0128561 Ga0451577_0128561_2009_2212 67
1051 3300044656 Ga0466969_0162001 Ga0466969_0162001_74_277 67
1052 3300044656 Ga0466969_0505183 Ga0466969_0505183_28_234 67
1053 3300044658 Ga0466972_0112550 Ga0466972_0112550_82_285 67
1054 3300044658 Ga0466972_0230080 Ga0466972_0230080_424_627 67
1055 3300044658 Ga0466972_0393401 Ga0466972_0393401_387_593 67
1056 3300044673 Ga0453683_0048494 Ga0453683_0048494_1676_1879 67
1057 3300044673 Ga0453683_0129992 Ga0453683_0129992_230_433 67
1058 3300044673 Ga0453683_0147082 Ga0453683_0147082_682_888 67
1059 3300044673 Ga0453683_1115461 Ga0453683_1115461_305_508 67
1060 3300044683 Ga0466965_0051221 Ga0466965_0051221_957_1160 67
1061 3300044684 Ga0466966_0007964 Ga0466966_0007964_3250_3456 67
1062 3300044684 Ga0466966_0770770 Ga0466966_0770770_10_213 67
1063 3300044684 Ga0466966_0854820 Ga0466966_0854820_300_503 67
1064 3300044684 Ga0466966_0998319 Ga0466966_0998319_283_486 67
1065 3300044693 Ga0466961_0006228 Ga0466961_0006228_7141_7344 67
1066 3300044693 Ga0466961_0032065 Ga0466961_0032065_861_1064 67
1067 3300044693 Ga0466961_0039290 Ga0466961_0039290_1930_2136 67
1068 3300044693 Ga0466961_0048204 Ga0466961_0048204_119_322 67
1069 3300044693 Ga0466961_0338980 Ga0466961_0338980_462_665 67
1070 3300044694 Ga0466963_0119372 Ga0466963_0119372_734_937 67
1071 3300044694 Ga0466963_0579048 Ga0466963_0579048_221_424 67
1072 3300044694 Ga0466963_0919926 Ga0466963_0919926_215_421 67
1073 3300044712 Ga0453684_0012179 Ga0453684_0012179_693_896 67
1074 3300044719 Ga0466971_0190511 Ga0466971_0190511_496_699 67
1075 3300044735 Ga0466968_0010303 Ga0466968_0010303_2856_3062 67
1076 3300044735 Ga0466968_0216792 Ga0466968_0216792_320_526 67
1077 3300044735 Ga0466968_0742086 Ga0466968_0742086_264_467 67
1078 3300044765 Ga0466970_0000055 Ga0466970_0000055_13561_13764 67
1079 3300044765 Ga0466970_0002327 Ga0466970_0002327_2664_2870 67
1080 3300044765 Ga0466970_0009014 Ga0466970_0009014_2608_2811 67
1081 3300044765 Ga0466970_0086594 Ga0466970_0086594_902_1105 67
1082 3300044765 Ga0466970_0086932 Ga0466970_0086932_653_859 67
1083 3300044765 Ga0466970_0247452 Ga0466970_0247452_739_945 67
1084 3300044765 Ga0466970_0823343 Ga0466970_0823343_30_233 67
1085 3300044765 Ga0466970_0872377 Ga0466970_0872377_305_508 67
1086 3300044842 Ga0466957_0025992 Ga0466957_0025992_2639_2845 67
1087 3300044842 Ga0466957_0118149 Ga0466957_0118149_1233_1436 67
1088 3300044842 Ga0466957_1299102 Ga0466957_1299102_86_289 67
1089 3300044901 Ga0466960_0102179 Ga0466960_0102179_1165_1371 67
1090 3300044901 Ga0466960_0151059 Ga0466960_0151059_462_665 67
1091 3300044901 Ga0466960_0345090 Ga0466960_0345090_52_255 67
1092 3300044901 Ga0466960_0446825 Ga0466960_0446825_258_464 67
1093 3300045049 Ga0466959_0001374 Ga0466959_0001374_2668_2874 67
1094 3300045049 Ga0466959_0004730 Ga0466959_0004730_3353_3559 67
1095 3300045049 Ga0466959_0660839 Ga0466959_0660839_99_302 67
1096 3300045049 Ga0466959_1026321 Ga0466959_1026321_112_315 67
1097 3300045051 Ga0451576_0001029 Ga0451576_0001029_19896_20102 67
1098 3300045051 Ga0451576_0068343 Ga0451576_0068343_2665_2868 67
1099 3300045051 Ga0451576_0214471 Ga0451576_0214471_1433_1636 67
1100 3300045051 Ga0451576_0455613 Ga0451576_0455613_245_448 67
1101 3300045976 Ga0466967_0911577 Ga0466967_0911577_128_331 67
1102 3300045976 Ga0466967_1221047 Ga0466967_1221047_97_300 67
1103 3300045976 Ga0466967_1284178 Ga0466967_1284178_412_618 67
1104 3300045976 Ga0466967_2571254 Ga0466967_2571254_102_329 67
1105 3300046454 Ga0495592_0077419 Ga0495592_0077419_1154_1360 67
1106 3300046457 Ga0495590_0000299 Ga0495590_0000299_11463_11666 67
1107 3300046458 Ga0495591_014573 Ga0495591_014573_1830_2075 67
1108 3300046459 Ga0495629_0051856 Ga0495629_0051856_1082_1285 67
1109 3300046459 Ga0495629_0286927 Ga0495629_0286927_476_682 67
1110 3300046459 Ga0495629_0521741 Ga0495629_0521741_534_737 67
1111 3300046460 Ga0495638_0215485 Ga0495638_0215485_638_850 67
1112 3300046460 Ga0495638_0275826 Ga0495638_0275826_700_903 67
1113 3300046463 Ga0495653_0030310 Ga0495653_0030310_3448_3651 67
1114 3300046463 Ga0495653_0076958 Ga0495653_0076958_2100_2303 67
1115 3300046471 Ga0495650_0000474 Ga0495650_0000474_45848_46051 67
1116 3300046472 Ga0495580_0008811 Ga0495580_0008811_230_433 67
1117 3300046472 Ga0495580_0352475 Ga0495580_0352475_21_224 67
1118 3300046472 Ga0495580_0414220 Ga0495580_0414220_261_464 67
1119 3300046473 Ga0495582_0213070 Ga0495582_0213070_50_253 67
1120 3300046475 Ga0495639_0002597 Ga0495639_0002597_615_818 67
1121 3300046476 Ga0495662_0032943 Ga0495662_0032943_557_760 67
1122 3300046477 Ga0495664_0012743 Ga0495664_0012743_1450_1653 67
1123 3300046492 Ga0495585_0283120 Ga0495585_0283120_530_733 67
1124 3300046499 Ga0495594_0071733 Ga0495594_0071733_12_215 67
1125 3300046499 Ga0495594_0864155 Ga0495594_0864155_143_346 67
1126 3300046506 Ga0495583_0150527 Ga0495583_0150527_118_321 67
1127 3300046506 Ga0495583_0208673 Ga0495583_0208673_535_738 67
1128 3300046507 Ga0495606_0359042 Ga0495606_0359042_535_738 67
1129 3300046507 Ga0495606_0579260 Ga0495606_0579260_142_345 67
1130 3300046514 Ga0495618_0085855 Ga0495618_0085855_876_1082 67
1131 3300046516 Ga0495628_0929415 Ga0495628_0929415_329_535 67
1132 3300046517 Ga0495630_0363768 Ga0495630_0363768_853_1056 67
1133 3300046518 Ga0495631_0064693 Ga0495631_0064693_561_764 67
1134 3300046519 Ga0495632_0165084 Ga0495632_0165084_223_426 67
1135 3300046524 Ga0495648_0336888 Ga0495648_0336888_350_553 67
1136 3300046526 Ga0495666_0508700 Ga0495666_0508700_261_464 67
1137 3300046530 Ga0495654_0033163 Ga0495654_0033163_606_851 67
1138 3300046530 Ga0495654_0314740 Ga0495654_0314740_49_252 67
1139 3300046530 Ga0495654_0339648 Ga0495654_0339648_239_442 67
1140 3300046531 Ga0495665_0001291 Ga0495665_0001291_5143_5346 67
1141 3300046531 Ga0495665_0021883 Ga0495665_0021883_1116_1319 67
1142 3300046531 Ga0495665_0236591 Ga0495665_0236591_694_897 67
1143 3300046533 Ga0495640_0144418 Ga0495640_0144418_101_307 67
1144 3300046535 Ga0495586_0024557 Ga0495586_0024557_419_622 67
1145 3300046535 Ga0495586_0040492 Ga0495586_0040492_1125_1331 67
1146 3300046536 Ga0495587_0005826 Ga0495587_0005826_5741_5944 67
1147 3300046543 Ga0495645_0014732 Ga0495645_0014732_5038_5241 67
1148 3300046543 Ga0495645_0032859 Ga0495645_0032859_188_391 67
1149 3300046557 Ga0495622_0409393 Ga0495622_0409393_36_239 67
1150 3300046558 Ga0495633_0160556 Ga0495633_0160556_689_892 67
1151 3300046559 Ga0495667_0029880 Ga0495667_0029880_1144_1347 67
1152 3300046559 Ga0495667_0038040 Ga0495667_0038040_702_908 67
1153 3300046559 Ga0495667_0874373 Ga0495667_0874373_61_264 67
1154 3300046615 Ga0495656_0004079 Ga0495656_0004079_4399_4602 67
1155 3300046615 Ga0495656_0152222 Ga0495656_0152222_868_1074 67
1156 3300046616 Ga0495668_0814608 Ga0495668_0814608_265_468 67
1157 3300046642 Ga0495634_0122562 Ga0495634_0122562_1130_1336 67
1158 3300046648 Ga0495611_0358968 Ga0495611_0358968_408_611 67
1159 3300046660 Ga0495625_0618425 Ga0495625_0618425_259_471 67
1160 3300046663 Ga0495635_0096007 Ga0495635_0096007_1139_1345 67
1161 3300046663 Ga0495635_0156730 Ga0495635_0156730_1132_1335 67
1162 3300046664 Ga0495659_0149392 Ga0495659_0149392_718_921 67
1163 3300046674 Ga0495588_0001739 Ga0495588_0001739_6697_6900 67
1164 3300046674 Ga0495588_0022049 Ga0495588_0022049_1581_1784 67
1165 3300046674 Ga0495588_0049220 Ga0495588_0049220_373_576 67
1166 3300046674 Ga0495588_0117980 Ga0495588_0117980_397_600 67
1167 3300046674 Ga0495588_0259755 Ga0495588_0259755_696_899 67
1168 3300046675 Ga0495657_0691121 Ga0495657_0691121_283_486 67
1169 3300046691 Ga0495670_0001877 Ga0495670_0001877_5577_5780 67
1170 3300046691 Ga0495670_0775590 Ga0495670_0775590_135_338 67
1171 3300046692 Ga0495671_0326119 Ga0495671_0326119_71_274 67
1172 3300046694 Ga0495649_0031008 Ga0495649_0031008_1916_2161 67
1173 3300046809 Ga0495600_0015732 Ga0495600_0015732_4320_4523 67
1174 3300046810 Ga0495660_0235900 Ga0495660_0235900_86_289 67
1175 3300047315 Ga0495581_0001511 Ga0495581_0001511_4034_4237 67
1176 3300047315 Ga0495581_0012051 Ga0495581_0012051_290_493 67
1177 3300047315 Ga0495581_0017028 Ga0495581_0017028_2912_3115 67
1178 3300047317 Ga0495604_0758318 Ga0495604_0758318_63_266 67
1179 3300047318 Ga0495636_0006129 Ga0495636_0006129_1925_2128 67
1180 3300047319 Ga0495674_0236146 Ga0495674_0236146_1256_1459 67
1181 3300047320 Ga0495672_0019264 Ga0495672_0019264_4052_4255 67
1182 3300047320 Ga0495672_0370373 Ga0495672_0370373_245_448 67
1183 3300047321 Ga0495676_0221974 Ga0495676_0221974_113_316 67
1184 3300047322 Ga0495680_0150219 Ga0495680_0150219_317_520 67
1185 3300047322 Ga0495680_0944236 Ga0495680_0944236_329_535 67
1186 3300047444 Ga0495675_0079559 Ga0495675_0079559_491_694 67
1187 3300047445 Ga0495677_0390075 Ga0495677_0390075_34_237 67
1188 3300047445 Ga0495677_0458341 Ga0495677_0458341_194_397 67
1189 3300047446 Ga0495679_006855 Ga0495679_006855_228_473 67
1190 3300047447 Ga0495685_005367 Ga0495685_005367_1175_1378 67
1191 3300047447 Ga0495685_199418 Ga0495685_199418_142_345 67
1192 3300047471 Ga0495684_0537386 Ga0495684_0537386_198_401 67
1193 3300047472 Ga0495686_0010064 Ga0495686_0010064_68_271 67
1194 3300047472 Ga0495686_0077884 Ga0495686_0077884_1107_1319 67
1195 3300047673 Ga0495593_0071938 Ga0495593_0071938_518_721 67
1196 3300047673 Ga0495593_0150797 Ga0495593_0150797_170_373 67
1197 3300048090 Ga0495615_0194990 Ga0495615_0194990_157_360 67
1198 3300048903 Ga0496100_0000039 Ga0496100_0000039_8650_8853 67
1199 3300048903 Ga0496100_0078944 Ga0496100_0078944_694_897 67
1200 3300048903 Ga0496100_0444386 Ga0496100_0444386_111_326 67
1201 3300048903 Ga0496100_1369110 Ga0496100_1369110_147_350 67
1202 3300048903 Ga0496100_1393389 Ga0496100_1393389_282_485 67
1203 3300048904 Ga0496101_0000043 Ga0496101_0000043_130409_130612 67
1204 3300048904 Ga0496101_0004549 Ga0496101_0004549_3728_3931 67
1205 3300048905 Ga0496102_0014569 Ga0496102_0014569_677_880 67
1206 3300048905 Ga0496102_0027486 Ga0496102_0027486_1372_1575 67
1207 3300048905 Ga0496102_0049022 Ga0496102_0049022_2704_2907 67
1208 3300048905 Ga0496102_0108166 Ga0496102_0108166_2110_2313 67
1209 3300048905 Ga0496102_0479472 Ga0496102_0479472_149_352 67
1210 3300048905 Ga0496102_0486219 Ga0496102_0486219_609_812 67
1211 3300048906 Ga0496103_0001202 Ga0496103_0001202_13632_13835 67
1212 3300048906 Ga0496103_0060214 Ga0496103_0060214_429_632 67
1213 3300048906 Ga0496103_0339941 Ga0496103_0339941_10_213 67
1214 3300048906 Ga0496103_0700312 Ga0496103_0700312_296_499 67
1215 3300048906 Ga0496103_0768880 Ga0496103_0768880_118_321 67
1216 3300048907 Ga0496104_0457445 Ga0496104_0457445_548_751 67
1217 3300048907 Ga0496104_1086940 Ga0496104_1086940_148_351 67
1218 3300048907 Ga0496104_1684992 Ga0496104_1684992_182_385 67
1219 3300048908 Ga0496105_0353105 Ga0496105_0353105_441_644 67
1220 3300048908 Ga0496105_0500816 Ga0496105_0500816_579_782 67
1221 3300048908 Ga0496105_0833650 Ga0496105_0833650_65_268 67
1222 3300048909 Ga0496106_0001390 Ga0496106_0001390_11977_12180 67
1223 3300048909 Ga0496106_0073299 Ga0496106_0073299_1336_1539 67
1224 3300048909 Ga0496106_1117427 Ga0496106_1117427_370_573 67
1225 3300048910 Ga0496107_0000922 Ga0496107_0000922_831_1034 67
1226 3300048910 Ga0496107_0120432 Ga0496107_0120432_488_691 67
1227 3300048910 Ga0496107_0212317 Ga0496107_0212317_446_649 67
1228 3300048911 Ga0496108_0001472 Ga0496108_0001472_13298_13501 67
1229 3300048911 Ga0496108_0100844 Ga0496108_0100844_687_890 67
1230 3300048911 Ga0496108_0551025 Ga0496108_0551025_759_962 67
1231 3300048911 Ga0496108_0601335 Ga0496108_0601335_546_749 67
1232 3300048912 Ga0496109_0000145 Ga0496109_0000145_31017_31220 67
1233 3300048912 Ga0496109_0057047 Ga0496109_0057047_1451_1654 67
1234 3300048912 Ga0496109_0057729 Ga0496109_0057729_1805_2008 67
1235 3300048912 Ga0496109_0099545 Ga0496109_0099545_507_710 67
1236 3300048912 Ga0496109_0116031 Ga0496109_0116031_2270_2473 67
1237 3300048912 Ga0496109_0126816 Ga0496109_0126816_290_493 67
1238 3300048912 Ga0496109_0703843 Ga0496109_0703843_37_240 67
1239 3300048912 Ga0496109_0888766 Ga0496109_0888766_469_672 67
1240 3300048913 Ga0496110_0014371 Ga0496110_0014371_1572_1775 67
1241 3300048913 Ga0496110_0100279 Ga0496110_0100279_1988_2191 67
1242 3300048913 Ga0496110_0120747 Ga0496110_0120747_515_718 67
1243 3300048913 Ga0496110_0702154 Ga0496110_0702154_673_876 67
1244 3300048914 Ga0496111_0087480 Ga0496111_0087480_1613_1816 67
1245 3300048914 Ga0496111_0091624 Ga0496111_0091624_99_302 67
1246 3300048914 Ga0496111_1110920 Ga0496111_1110920_303_506 67
1247 3300048915 Ga0496112_0033971 Ga0496112_0033971_2672_2875 67
1248 3300048915 Ga0496112_0049201 Ga0496112_0049201_464_667 67
1249 3300048915 Ga0496112_0078841 Ga0496112_0078841_2254_2457 67
1250 3300048915 Ga0496112_0216149 Ga0496112_0216149_1567_1770 67
1251 3300048915 Ga0496112_0391314 Ga0496112_0391314_968_1171 67
1252 3300048915 Ga0496112_0703160 Ga0496112_0703160_461_664 67
1253 3300048916 Ga0496113_0107912 Ga0496113_0107912_1016_1219 67
1254 3300048916 Ga0496113_0660892 Ga0496113_0660892_11_214 67
1255 3300048916 Ga0496113_1091396 Ga0496113_1091396_321_524 67
1256 3300048917 Ga0496114_0000219 Ga0496114_0000219_31026_31229 67
1257 3300048917 Ga0496114_0014191 Ga0496114_0014191_4938_5141 67
1258 3300048917 Ga0496114_0092010 Ga0496114_0092010_2140_2343 67
1259 3300048917 Ga0496114_1363013 Ga0496114_1363013_354_557 67
1260 3300048917 Ga0496114_1718828 Ga0496114_1718828_267_470 67
1261 3300048918 Ga0496115_0014990 Ga0496115_0014990_4236_4439 67
1262 3300048918 Ga0496115_0179927 Ga0496115_0179927_156_359 67
1263 3300048918 Ga0496115_0735458 Ga0496115_0735458_46_249 67
1264 3300048919 Ga0496116_0134410 Ga0496116_0134410_814_1017 67
1265 3300048920 Ga0496117_0069536 Ga0496117_0069536_165_368 67
1266 3300048920 Ga0496117_0093402 Ga0496117_0093402_933_1136 67
1267 3300048920 Ga0496117_0129596 Ga0496117_0129596_814_1017 67
1268 3300048920 Ga0496117_0547361 Ga0496117_0547361_309_512 67
1269 3300048921 Ga0496118_0095230 Ga0496118_0095230_1734_1937 67
1270 3300048921 Ga0496118_0140520 Ga0496118_0140520_814_1017 67
1271 3300048921 Ga0496118_0322667 Ga0496118_0322667_366_569 67
1272 3300048922 Ga0496119_0002652 Ga0496119_0002652_18665_18868 67
1273 3300048922 Ga0496119_0010789 Ga0496119_0010789_5345_5548 67
1274 3300048922 Ga0496119_0112425 Ga0496119_0112425_794_997 67
1275 3300048923 Ga0496120_0006209 Ga0496120_0006209_7455_7658 67
1276 3300048923 Ga0496120_0018797 Ga0496120_0018797_2965_3168 67
1277 3300048923 Ga0496120_0075819 Ga0496120_0075819_1095_1298 67
1278 3300048923 Ga0496120_0315952 Ga0496120_0315952_370_573 67
1279 3300048923 Ga0496120_0404508 Ga0496120_0404508_28_231 67
1280 3300048924 Ga0496121_0000002 Ga0496121_0000002_31044_31247 67
1281 3300048924 Ga0496121_0404428 Ga0496121_0404428_53_256 67
1282 3300048925 Ga0496122_0001790 Ga0496122_0001790_31044_31247 67
1283 3300048926 Ga0496123_0005125 Ga0496123_0005125_8413_8628 67
1284 3300048926 Ga0496123_0010252 Ga0496123_0010252_6845_7048 67
1285 3300048927 Ga0496124_0000002 Ga0496124_0000002_1463342_1463545 67
1286 3300048927 Ga0496124_0091025 Ga0496124_0091025_1510_1755 67
1287 3300048927 Ga0496124_0102040 Ga0496124_0102040_269_472 67
1288 3300048927 Ga0496124_0375015 Ga0496124_0375015_236_439 67
1289 3300048927 Ga0496124_0856058 Ga0496124_0856058_298_501 67
1290 3300048928 Ga0496125_0000002 Ga0496125_0000002_31044_31247 67
1291 3300048928 Ga0496125_0076977 Ga0496125_0076977_2361_2564 67
1292 3300048928 Ga0496125_0081127 Ga0496125_0081127_2058_2261 67
1293 3300048928 Ga0496125_0156864 Ga0496125_0156864_801_1004 67
1294 3300048929 Ga0496126_0000009 Ga0496126_0000009_719104_719307 67
1295 3300048929 Ga0496126_1067892 Ga0496126_1067892_325_528 67
1296 3300049127 Ga0501306_004106 Ga0501306_004106_589_792 67
1297 3300049127 Ga0501306_063417 Ga0501306_063417_360_563 67
1298 3300049128 Ga0501308_058468 Ga0501308_058468_328_531 67
1299 3300049129 Ga0501309_044547 Ga0501309_044547_327_530 67
1300 3300049132 Ga0501343_028807 Ga0501343_028807_23_229 67
1301 3300049160 Ga0501304_044837 Ga0501304_044837_252_455 67
1302 3300049161 Ga0501305_016403 Ga0501305_016403_674_877 67
1303 3300049527 Ga0501311_066454 Ga0501311_066454_33_236 67
1304 3300049528 Ga0501312_000972 Ga0501312_000972_2274_2477 67
1305 3300049528 Ga0501312_066216 Ga0501312_066216_276_482 67
1306 3300049529 Ga0501313_049590 Ga0501313_049590_339_542 67
1307 3300049529 Ga0501313_064311 Ga0501313_064311_276_482 67
1308 3300049530 Ga0501314_016286 Ga0501314_016286_481_684 67
1309 3300049532 Ga0501316_058754 Ga0501316_058754_52_255 67
1310 3300049532 Ga0501316_066726 Ga0501316_066726_53_256 67
1311 3300049532 Ga0501316_074888 Ga0501316_074888_271_477 67
1312 3300049533 Ga0501317_007238 Ga0501317_007238_860_1063 67
1313 3300049533 Ga0501317_008434 Ga0501317_008434_948_1151 67
1314 3300049534 Ga0501318_004887 Ga0501318_004887_975_1178 67
1315 3300049536 Ga0501320_001640 Ga0501320_001640_1400_1603 67
1316 3300049536 Ga0501320_024448 Ga0501320_024448_477_683 67
1317 3300049537 Ga0501321_001128 Ga0501321_001128_972_1175 67
1318 3300049537 Ga0501321_029022 Ga0501321_029022_345_548 67
1319 3300049538 Ga0501322_027409 Ga0501322_027409_50_253 67
1320 3300049539 Ga0501323_050716 Ga0501323_050716_177_380 67
1321 3300049540 Ga0501324_001209 Ga0501324_001209_1288_1491 67
1322 3300049540 Ga0501324_027992 Ga0501324_027992_254_457 67
1323 3300049541 Ga0501325_000289 Ga0501325_000289_964_1167 67
1324 3300049541 Ga0501325_008895 Ga0501325_008895_660_863 67
1325 3300049546 Ga0501330_010028 Ga0501330_010028_91_294 67
1326 3300049546 Ga0501330_017478 Ga0501330_017478_242_445 67
1327 3300049551 Ga0501335_014234 Ga0501335_014234_437_640 67
1328 3300049568 Ga0501031_0000119 Ga0501031_0000119_7055_7258 67
1329 3300049569 Ga0501032_0000052 Ga0501032_0000052_30232_30435 67
1330 3300049569 Ga0501032_0000405 Ga0501032_0000405_16213_16416 67
1331 3300049569 Ga0501032_0002093 Ga0501032_0002093_15447_15650 67
1332 3300049569 Ga0501032_0006637 Ga0501032_0006637_544_747 67
1333 3300049569 Ga0501032_0241970 Ga0501032_0241970_576_779 67
1334 3300049569 Ga0501032_0280523 Ga0501032_0280523_603_815 67
1335 3300049569 Ga0501032_1042480 Ga0501032_1042480_73_279 67
1336 3300049570 Ga0501033_0000868 Ga0501033_0000868_1646_1849 67
1337 3300049571 Ga0501034_0020741 Ga0501034_0020741_1668_1871 67
1338 3300049571 Ga0501034_0208155 Ga0501034_0208155_1478_1681 67
1339 3300049571 Ga0501034_0211536 Ga0501034_0211536_831_1034 67
1340 3300049571 Ga0501034_0405593 Ga0501034_0405593_804_1007 67
1341 3300049571 Ga0501034_0568947 Ga0501034_0568947_780_983 67
1342 3300049571 Ga0501034_0590054 Ga0501034_0590054_506_709 67
1343 3300049571 Ga0501034_1014454 Ga0501034_1014454_404_610 67
1344 3300049572 Ga0501036_0000061 Ga0501036_0000061_31336_31539 67
1345 3300049572 Ga0501036_0087103 Ga0501036_0087103_2127_2330 67
1346 3300049572 Ga0501036_0468844 Ga0501036_0468844_561_764 67
1347 3300049573 Ga0501037_0000046 Ga0501037_0000046_82420_82623 67
1348 3300049573 Ga0501037_0001587 Ga0501037_0001587_12158_12361 67
1349 3300049573 Ga0501037_0036548 Ga0501037_0036548_926_1129 67
1350 3300049573 Ga0501037_0119965 Ga0501037_0119965_1503_1706 67
1351 3300049574 Ga0501038_0000068 Ga0501038_0000068_29607_29810 67
1352 3300049574 Ga0501038_0019942 Ga0501038_0019942_1433_1639 67
1353 3300049574 Ga0501038_0038300 Ga0501038_0038300_1693_1896 67
1354 3300049574 Ga0501038_0331478 Ga0501038_0331478_817_1020 67
1355 3300049575 Ga0501039_0002827 Ga0501039_0002827_5846_6049 67
1356 3300049575 Ga0501039_0063921 Ga0501039_0063921_1733_1936 67
1357 3300049575 Ga0501039_0187739 Ga0501039_0187739_1069_1272 67
1358 3300049576 Ga0501040_0047863 Ga0501040_0047863_303_506 67
1359 3300049576 Ga0501040_0579034 Ga0501040_0579034_31_237 67
1360 3300049577 Ga0501041_0220280 Ga0501041_0220280_668_871 67
1361 3300049578 Ga0501042_0624172 Ga0501042_0624172_123_326 67
1362 3300049579 Ga0501043_0000340 Ga0501043_0000340_3127_3330 67
1363 3300049579 Ga0501043_0001210 Ga0501043_0001210_1696_1899 67
1364 3300049579 Ga0501043_0007110 Ga0501043_0007110_7101_7313 67
1365 3300049579 Ga0501043_0050924 Ga0501043_0050924_1196_1399 67
1366 3300049579 Ga0501043_0082717 Ga0501043_0082717_815_1018 67
1367 3300049579 Ga0501043_0877704 Ga0501043_0877704_14_217 67
1368 3300049580 Ga0501046_0000102 Ga0501046_0000102_34659_34862 67
1369 3300049581 Ga0501047_0000460 Ga0501047_0000460_13836_14039 67
1370 3300049581 Ga0501047_0011318 Ga0501047_0011318_5025_5228 67
1371 3300049581 Ga0501047_0079667 Ga0501047_0079667_2370_2582 67
1372 3300049582 Ga0501048_0000006 Ga0501048_0000006_35168_35371 67
1373 3300049582 Ga0501048_0944520 Ga0501048_0944520_27_230 67
1374 3300049583 Ga0501067_0416975 Ga0501067_0416975_89_301 67
1375 3300049584 Ga0501068_0008598 Ga0501068_0008598_5415_5618 67
1376 3300049585 Ga0501069_0005251 Ga0501069_0005251_3396_3599 67
1377 3300049586 Ga0501070_0000139 Ga0501070_0000139_33192_33395 67
1378 3300049586 Ga0501070_0033551 Ga0501070_0033551_972_1175 67
1379 3300049586 Ga0501070_0970605 Ga0501070_0970605_93_302 67
1380 3300049586 Ga0501070_1371719 Ga0501070_1371719_23_226 67
1381 3300049587 Ga0501071_0863419 Ga0501071_0863419_476_679 67
1382 3300049588 Ga0501072_0269920 Ga0501072_0269920_729_932 67
1383 3300049589 Ga0501073_0038923 Ga0501073_0038923_1926_2129 67
1384 3300049589 Ga0501073_0912721 Ga0501073_0912721_21_224 67
1385 3300049589 Ga0501073_1288810 Ga0501073_1288810_174_377 67
1386 3300049590 Ga0501074_0001182 Ga0501074_0001182_9983_10186 67
1387 3300049591 Ga0501075_0035573 Ga0501075_0035573_2859_3065 67
1388 3300049591 Ga0501075_1035878 Ga0501075_1035878_386_589 67
1389 3300049592 Ga0501076_1152484 Ga0501076_1152484_354_557 67
1390 3300049652 Ga0501202_182283 Ga0501202_182283_61_264 67
1391 3300049659 Ga0501214_055591 Ga0501214_055591_119_325 67
1392 3300049665 Ga0501227_211086 Ga0501227_211086_170_373 67
1393 3300049680 Ga0501250_106589 Ga0501250_106589_198_404 67
1394 3300049690 Ga0501261_019768 Ga0501261_019768_640_843 67
1395 3300049708 Ga0501245_107218 Ga0501245_107218_221_424 67
1396 3300049741 Ga0501079_0475247 Ga0501079_0475247_274_477 67
1397 3300049741 Ga0501079_0890292 Ga0501079_0890292_116_322 67
1398 3300049742 Ga0501080_0003170 Ga0501080_0003170_8978_9181 67
1399 3300049742 Ga0501080_0240270 Ga0501080_0240270_476_688 67
1400 3300049742 Ga0501080_0655899 Ga0501080_0655899_455_658 67
1401 3300049743 Ga0501081_0407581 Ga0501081_0407581_638_844 67
1402 3300049743 Ga0501081_0708927 Ga0501081_0708927_59_262 67
1403 3300049744 Ga0501083_0010568 Ga0501083_0010568_276_479 67
1404 3300049744 Ga0501083_0735121 Ga0501083_0735121_68_271 67
1405 3300049765 Ga0501268_061854 Ga0501268_061854_264_467 67
1406 3300049767 Ga0501270_150251 Ga0501270_150251_222_425 67
1407 3300049770 Ga0501273_084087 Ga0501273_084087_203_406 67
1408 3300049775 Ga0501279_031763 Ga0501279_031763_252_455 67
1409 3300049775 Ga0501279_082399 Ga0501279_082399_180_383 67
1410 3300049822 Ga0501035_0005470 Ga0501035_0005470_9028_9231 67
1411 3300049822 Ga0501035_0455701 Ga0501035_0455701_44_256 67
1412 3300049822 Ga0501035_0946228 Ga0501035_0946228_247_450 67
1413 3300049823 Ga0501044_0000137 Ga0501044_0000137_32710_32913 67
1414 3300049823 Ga0501044_0032073 Ga0501044_0032073_2467_2679 67
1415 3300049823 Ga0501044_0074896 Ga0501044_0074896_1829_2032 67
1416 3300049823 Ga0501044_0238050 Ga0501044_0238050_361_564 67
1417 3300049823 Ga0501044_0476207 Ga0501044_0476207_867_1070 67
1418 3300049823 Ga0501044_1466551 Ga0501044_1466551_89_292 67
1419 3300049824 Ga0501045_0190180 Ga0501045_0190180_445_648 67
1420 3300049824 Ga0501045_0413511 Ga0501045_0413511_641_847 67
1421 3300049851 Ga0501212_104866 Ga0501212_104866_58_261 67
1422 3300049851 Ga0501212_122104 Ga0501212_122104_33_239 67
1423 3300050489 nmdc:mga03683_244489_c1 nmdc:mga03683_244489_c1_486_689 67
1424 3300050489 nmdc:mga03683_259401_c1 nmdc:mga03683_259401_c1_83_286 67
1425 3300050489 nmdc:mga03683_503106_c1 nmdc:mga03683_503106_c1_325_528 67
1426 3300050489 nmdc:mga03683_92485_c1 nmdc:mga03683_92485_c1_172_375 67
1427 3300050490 nmdc:mga03n38_750373_c1 nmdc:mga03n38_750373_c1_61_267 67
1428 3300050491 nmdc:mga00v17_10944_c1 nmdc:mga00v17_10944_c1_153_356 67
1429 3300050491 nmdc:mga00v17_196814_c1 nmdc:mga00v17_196814_c1_720_923 67
1430 3300050491 nmdc:mga00v17_2871_c1 nmdc:mga00v17_2871_c1_2529_2732 67
1431 3300050491 nmdc:mga00v17_544486_c1 nmdc:mga00v17_544486_c1_440_643 67
1432 3300050491 nmdc:mga00v17_701709_c1 nmdc:mga00v17_701709_c1_21_224 67
1433 3300050492 nmdc:mga0yw44_76203_c1 nmdc:mga0yw44_76203_c1_390_593 67
1434 3300050492 nmdc:mga0yw44_799152_c1 nmdc:mga0yw44_799152_c1_229_432 67
1435 3300050492 nmdc:mga0yw44_926157_c1 nmdc:mga0yw44_926157_c1_277_480 67
1436 3300050493 nmdc:mga0k408_336534_c1 nmdc:mga0k408_336534_c1_65_268 67
1437 3300050494 nmdc:mga06z11_690680_c1 nmdc:mga06z11_690680_c1_396_599 67
1438 3300050495 nmdc:mga04h51_284871_c1 nmdc:mga04h51_284871_c1_267_470 67
1439 3300050496 nmdc:mga07m45_132281_c2 nmdc:mga07m45_132281_c2_469_672 67
1440 3300050496 nmdc:mga07m45_202524_c1 nmdc:mga07m45_202524_c1_124_327 67
1441 3300050496 nmdc:mga07m45_289094_c1 nmdc:mga07m45_289094_c1_400_603 67
1442 3300050496 nmdc:mga07m45_43749_c1 nmdc:mga07m45_43749_c1_2159_2362 67
1443 3300050496 nmdc:mga07m45_608452_c1 nmdc:mga07m45_608452_c1_153_356 67
1444 3300050496 nmdc:mga07m45_625951_c1 nmdc:mga07m45_625951_c1_230_433 67
1445 3300050496 nmdc:mga07m45_709601_c1 nmdc:mga07m45_709601_c1_279_485 67
1446 3300050496 nmdc:mga07m45_788412_c1 nmdc:mga07m45_788412_c1_163_366 67
1447 3300050507 nmdc:mga05p37_1862486_c1 nmdc:mga05p37_1862486_c1_173_376 67
1448 3300050510 nmdc:mga06r32_211219_c1 nmdc:mga06r32_211219_c1_902_1105 67
1449 3300050510 nmdc:mga06r32_41763_c2 nmdc:mga06r32_41763_c2_1591_1797 67
1450 3300050512 nmdc:mga0n895_65601_c1 nmdc:mga0n895_65601_c1_750_953 67
1451 3300050512 nmdc:mga0n895_82086_c1 nmdc:mga0n895_82086_c1_1148_1351 67
1452 3300050513 nmdc:mga0rr50_1547388_c1 nmdc:mga0rr50_1547388_c1_278_481 67
1453 3300050513 nmdc:mga0rr50_739426_c1 nmdc:mga0rr50_739426_c1_289_492 67
1454 3300050513 nmdc:mga0rr50_97288_c1 nmdc:mga0rr50_97288_c1_1469_1672 67
1455 3300050515 nmdc:mga0a205_16343_c1 nmdc:mga0a205_16343_c1_176_379 67
1456 3300050515 nmdc:mga0a205_36939_c1 nmdc:mga0a205_36939_c1_2895_3098 67
1457 3300050515 nmdc:mga0a205_62517_c1 nmdc:mga0a205_62517_c1_2230_2433 67
1458 3300050516 nmdc:mga0sz30_35896_c1 nmdc:mga0sz30_35896_c1_464_667 67
1459 3300050516 nmdc:mga0sz30_89013_c1 nmdc:mga0sz30_89013_c1_434_637 67
1460 3300053077 Ga0495601_0072154 Ga0495601_0072154_871_1077 67
1461 3300053083 Ga0495655_0262770 Ga0495655_0262770_72_275 67
1462 3300053084 Ga0495595_0022145 Ga0495595_0022145_695_901 67
1463 3300053085 Ga0495619_0389739 Ga0495619_0389739_701_907 67
1464 3300053085 Ga0495619_1080713 Ga0495619_1080713_306_509 67
1465 3300053086 Ga0500578_0006193 Ga0500578_0006193_5987_6199 67
1466 3300053087 Ga0500643_113661 Ga0500643_113661_310_522 67
1467 3300053088 Ga0500644_0142328 Ga0500644_0142328_255_467 67
1468 3300053092 Ga0500583_0498343 Ga0500583_0498343_312_524 67
1469 3300053093 Ga0500651_0001759 Ga0500651_0001759_5226_5429 67
1470 3300053093 Ga0500651_0104729 Ga0500651_0104729_1043_1255 67
1471 3300053093 Ga0500651_0571555 Ga0500651_0571555_304_516 67
1472 3300053096 Ga0500641_0004090 Ga0500641_0004090_2413_2625 67
1473 3300053098 Ga0500650_0058819 Ga0500650_0058819_750_962 67
1474 3300053098 Ga0500650_0111097 Ga0500650_0111097_80_292 67
1475 3300053109 Ga0500569_293315 Ga0500569_293315_232_444 67
1476 3300053129 Ga0500628_174259 Ga0500628_174259_253_465 67
1477 3300053133 Ga0500655_094324 Ga0500655_094324_259_471 67
1478 3300053133 Ga0500655_132263 Ga0500655_132263_226_438 67
1479 3300053134 Ga0500658_0006898 Ga0500658_0006898_1642_1854 67
1480 3300053136 Ga0500559_0251206 Ga0500559_0251206_233_436 67
1481 3300053138 Ga0500564_198001 Ga0500564_198001_158_361 67
1482 3300053139 Ga0500568_0065623 Ga0500568_0065623_249_452 67
1483 3300053139 Ga0500568_0100324 Ga0500568_0100324_94_297 67
1484 3300053142 Ga0500577_0228244 Ga0500577_0228244_207_419 67
1485 3300053146 Ga0500588_0039510 Ga0500588_0039510_1013_1216 67
1486 3300053146 Ga0500588_0296993 Ga0500588_0296993_34_246 67
1487 3300053148 Ga0500590_004888 Ga0500590_004888_1648_1851 67
1488 3300053151 Ga0500604_0066940 Ga0500604_0066940_595_807 67
1489 3300053153 Ga0500616_0000779 Ga0500616_0000779_7672_7884 67
1490 3300053155 Ga0500620_000231 Ga0500620_000231_4535_4738 67
1491 3300053156 Ga0500622_0170332 Ga0500622_0170332_419_631 67
1492 3300053727 Ga0500611_061588 Ga0500611_061588_267_479 67
1493 3300053730 Ga0500645_065092 Ga0500645_065092_201_413 67
1494 3300053731 Ga0500609_001519 Ga0500609_001519_445_657 67
1495 3300054114 Ga0501084_0009305 Ga0501084_0009305_1513_1716 67
1496 3300054114 Ga0501084_0680769 Ga0501084_0680769_422_628 67
1497 3300059424 Ga0590075_020432 Ga0590075_020432_295_498 67
1498 3300059477 Ga0587084_003200 Ga0587084_003200_739_945 67
1499 3300059490 Ga0587066_132392 Ga0587066_132392_356_559 67
1500 3300059491 Ga0587070_064990 Ga0587070_064990_162_368 67
1501 3300059491 Ga0587070_125303 Ga0587070_125303_213_416 67
1502 3300059493 Ga0587077_033689 Ga0587077_033689_584_790 67
1503 3300059507 Ga0587086_008561 Ga0587086_008561_15_218 67
1504 3300059509 Ga0587089_066535 Ga0587089_066535_172_378 67
1505 3300059510 Ga0587090_000394 Ga0587090_000394_1140_1343 67
1506 3300059510 Ga0587090_110903 Ga0587090_110903_165_377 67
1507 3300059512 Ga0587092_005257 Ga0587092_005257_824_1030 67
1508 3300059513 Ga0587094_080005 Ga0587094_080005_164_370 67
1509 3300059514 Ga0587095_021505 Ga0587095_021505_103_309 67
1510 3300059605 Ga0587106_090973 Ga0587106_090973_322_525 67
1511 3300059623 Ga0587101_001978 Ga0587101_001978_919_1125 67
1512 3300059623 Ga0587101_005211 Ga0587101_005211_152_355 67
1513 3300059626 Ga0587115_070811 Ga0587115_070811_360_566 67
1514 3300059629 Ga0587127_019179 Ga0587127_019179_230_436 67
1515 3300059630 Ga0587128_000257 Ga0587128_000257_3042_3245 67
1516 3300059630 Ga0587128_130216 Ga0587128_130216_178_381 67
1517 3300059642 Ga0587069_052982 Ga0587069_052982_167_373 67
1518 3300059643 Ga0587072_001880 Ga0587072_001880_988_1191 67
1519 3300059647 Ga0587079_209177 Ga0587079_209177_282_485 67
1520 3300059648 Ga0587100_028874 Ga0587100_028874_278_484 67
1521 3300059655 Ga0587114_075769 Ga0587114_075769_266_469 67
1522 3300059658 Ga0587119_079381 Ga0587119_079381_103_306 67
1523 3300059660 Ga0587124_000909 Ga0587124_000909_963_1166 67
1524 3300060346 Ga0587111_0036985 Ga0587111_0036985_41_259 67
1525 3300060346 Ga0587111_0141062 Ga0587111_0141062_267_473 67
1526 3300060353 Ga0501082_0293975 Ga0501082_0293975_627_839 67
1527 3300060353 Ga0501082_1884698 Ga0501082_1884698_240_443 67
1528 3300061719 Ga0466962_0298012 Ga0466962_0298012_226_429 67
1529 3300061734 Ga0530510_0999317 Ga0530510_0999317_88_294 67

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

16

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.985 2 67
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9772 1 67
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9755 2 67
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9737 1 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9662 1 67
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.966 2 64 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9637 2 64 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9627 2 64 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9586 2 64 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9572 2 64 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0M2HNG0-F1-model_v4 Putative cold shock protein A 1.012 2 67 GO:0003676
GO:0005737
AF-A0A4Y4G4A9-F1-model_v4 deleted 1.01 2 67
AF-A0A849DLQ8-F1-model_v4 Cold-shock protein 1.01 1 67 GO:0003676
GO:0005737
AF-A0A7Y7WNA6-F1-model_v4 Cold-shock protein 1.009 2 67 GO:0003676
GO:0005829
AF-A0A345CDC2-F1-model_v4 deleted 1.009 2 67

Feature Viewer

pLDDT pTM Quality
93.43 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map