F494609

General Info

Members Datasets Scaffolds Average Seq Length
1532 936 3062 442

Family's Representative Sequence

Representative Sequence 3300025728|Ga0207655_1001748|Ga0207655_100174812
Length 428
Sequence MSTTARQMKLGAFLMATGHHVAAWRHPDVPAGAGLDFKHYRHVARVAEAAKFDALFVADSVAAATGDIASRMARSDHFEPLTLLSALSSVTEHIGLIATATTTYNEPYHVARKFASLDHLSGGRAGWNLVTSDAAAEAQNFGRREFHQVVTGLWDSWADNAFTRDKASGEYYNPARLHVLDHQGEHFSVKGPLNVARSPQGQPVVVQAGSSEVGRDLAAQTAEVVFTAQTSLAGAQAFYADIKGRLSAYGRDVDSLKIMPGVFIVVAETEALAKAKFESFQALVEPQVGVALLGRMLGNFDLSGYPLDGPLPELPLTDSGQRSRQKLLTELADQENLTLAQLGRRIAGGRGHYSLIGTPEQIADELQRWFEQGSADGFNVLVPHLPGGLEDVAQLLVPELQRRGLFRTEYEGTTLRENLGLQRPAYRF

Samples

Sample ID Description Type Environment
1 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
91 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
202 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
205 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
206 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
214 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
229 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
261 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
262 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
263 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
343 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
366 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
377 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
390 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
391 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
392 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
393 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
394 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
409 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
410 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
411 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
412 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
413 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
414 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
415 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
416 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
417 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
418 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
419 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
420 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
421 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
422 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
423 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
424 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
425 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
426 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
427 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
428 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
429 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
430 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
435 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
436 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
437 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
438 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
439 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
440 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
441 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
442 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
443 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
444 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
445 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
446 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
447 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
448 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
449 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
450 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
451 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
452 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
453 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
454 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
455 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
456 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
457 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
458 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
459 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
460 2511231006 Pseudomonas sp. GM17 Isolate Nodule
461 2511231010 Pseudomonas sp. GM25 Isolate Nodule
462 2511231011 Pseudomonas sp. GM30 Isolate Nodule
463 2511231021 Pseudomonas sp. GM78 Isolate Nodule
464 2511231023 Pseudomonas sp. GM80 Isolate Nodule
465 2511231031 Pseudomonas sp. GM16 Isolate Nodule
466 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
467 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
468 2512875024
469 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
470 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
471 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
472 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
473 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
474 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
475 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
476 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
477 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
478 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
479 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
480 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
481 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
482 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
483 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
484 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
485 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
486 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
487 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
488 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
489 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
490 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
491 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
492 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
493 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
494 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
495 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
496 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
497 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
498 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
499 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
500 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
501 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
502 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
503 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
504 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
505 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
506 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
507 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
508 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
509 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
510 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
511 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
512 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
513 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
514 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
515 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
516 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
517 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
518 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
519 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
520 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
521 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
522 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
523 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
524 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
525 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
526 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
527 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
528 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
529 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
530 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
531 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
532 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
533 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
534 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
535 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
536 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
537 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
538 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
539 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
540 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
541 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
542 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
543 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
544 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
545 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
546 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
547 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
548 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
549 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
550 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
551 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
552 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
553 2643221582 Rhizobium sp. Root651 Isolate Unclassified
554 2643221599 Rhizobium sp. Root708 Isolate Unclassified
555 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
556 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
557 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
558 2643221693 Rhizobium sp. Root491 Isolate Unclassified
559 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
560 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
561 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
562 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
563 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
564 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
565 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
566 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
567 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
568 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
569 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
570 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
571 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
572 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
573 2738541277 Variovorax sp. GV051 Isolate Unclassified
574 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
575 2738541307 Variovorax sp. GV008 Isolate Unclassified
576 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
577 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
578 2738543019 Variovorax sp. GV040 Isolate Unclassified
579 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
580 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
581 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
582 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
583 2773857673 Pseudomonas sp. 443 Isolate Unclassified
584 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
585 2784132063 Pseudomonas sp. 424 Isolate Unclassified
586 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
587 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
588 2791355199
589 2791355260 Rhizobium sp. L9 Isolate Nodule
590 2791355266 Rhizobium sp. L43 Isolate Nodule
591 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
592 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
593 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
594 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
595 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
596 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
597 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
598 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
599 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
600 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
601 2818991467 Bosea vestrisii 3192 Isolate Unclassified
602 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
603 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
604 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
605 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
606 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
607 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
608 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
609 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
610 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
611 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
612 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
613 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
614 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
615 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
616 2831426010 Nostoc sp. 106C Isolate Unclassified
617 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
618 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
619 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
620 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
621 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
622 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
623 2841760612 Bosea sp. Tri-49 Isolate Nodule
624 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
625 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
626 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
627 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
628 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
629 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
630 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
631 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
632 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
633 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
634 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
635 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
636 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
637 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
638 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
639 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
640 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
641 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
642 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
643 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
644 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
645 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
646 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
647 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
648 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
649 2844104063 Bosea sp. Tri-39 Isolate Nodule
650 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
651 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
652 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
653 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
654 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
655 2849660919 Nostoc sp. T09 Isolate Unclassified
656 2851182111 Bosea sp. Tri-44 Isolate Nodule
657 2851246043 Bosea sp. Tri-54 Isolate Nodule
658 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
659 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
660 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
661 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
662 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
663 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
664 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
665 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
666 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
667 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
668 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
669 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
670 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
671 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
672 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
673 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
674 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
675 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
676 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
677 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
678 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
679 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
680 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
681 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
682 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
683 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
684 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
685 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
686 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
687 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
688 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
689 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
690 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
691 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
692 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
693 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
694 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
695 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
696 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
697 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
698 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
699 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
700 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
701 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
702 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
703 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
704 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
705 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
706 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
707 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
708 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
709 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
710 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
711 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
712 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
713 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
714 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
715 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
716 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
717 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
718 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
719 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
720 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
721 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
722 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
723 2899924645 Variovorax sp. 369 Isolate Unclassified
724 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
725 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
726 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
727 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
728 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
729 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
730 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
731 2904699407
732 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
733 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
734 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
735 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
736 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
737 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
738 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
739 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
740 2906610324
741 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
742 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
743 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
744 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
745 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
746 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
747 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
748 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
749 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
750 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
751 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
752 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
753 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
754 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
755 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
756 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
757 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
758 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
759 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
760 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
761 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
762 2922425934
763 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
764 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
765 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
766 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
767 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
768 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
769 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
770 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
771 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
772 2928037797 Variovorax sp. 1126 Isolate Unclassified
773 2928044640 Variovorax sp. 1128 Isolate Unclassified
774 2928051484 Variovorax sp. 1133 Isolate Unclassified
775 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
776 2928070936 Variovorax gossypii 1167 Isolate Unclassified
777 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
778 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
779 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
780 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
781 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
782 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
783 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
784 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
785 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
786 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
787 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
788 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
789 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
790 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
791 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
792 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
793 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
794 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
795 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
796 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
797 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
798 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
799 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
800 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
801 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
802 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
803 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
804 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
805 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
806 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
807 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
808 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
809 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
810 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
811 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
812 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
813 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
814 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
815 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
816 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
817 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
818 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
819 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
820 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
821 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
822 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
823 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
824 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
825 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
826 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
827 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
828 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
829 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
830 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
831 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
832 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
833 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
834 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
835 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
836 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
837 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
838 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
839 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
840 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
841 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
842 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
843 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
844 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
845 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
846 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
847 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
848 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
849 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
850 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
851 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
852 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
853 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
854 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
855 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
856 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
857 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
858 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
859 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
860 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
861 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
862 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
863 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
864 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
865 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
866 2996887358 Rhizobium sp. R711 Isolate Nodule
867 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
868 3004167301 Mesorhizobium loti 582 Isolate Unclassified
869 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
870 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
871 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
872 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
873 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
874 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
875 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
876 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
877 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
878 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
879 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
880 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
881 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
882 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
883 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
884 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
885 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
886 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
887 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
888 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
889 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
890 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
891 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
892 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
893 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
894 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
895 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
896 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
897 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
898 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
899 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
900 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
901 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
902 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
903 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
904 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
905 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
906 8005258706 Rhizobium sp. R693 Isolate Nodule
907 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
908 8005321885 Rhizobium sp. R72 Isolate Nodule
909 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
910 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
911 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
912 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
913 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
914 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
915 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
916 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
917 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
918 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
919 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
920 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
921 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
922 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
923 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
924 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
925 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
926 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
927 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
928 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
929 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
930 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
931 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
932 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
933 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
934 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
935 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
936 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.39
Metatranscriptomes 0
Isolates 31.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 11.81
Nodule 16.91
Rhizoplane 4.83
Rhizosphere 49.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207655_1001748 3300025728 Bacteria 19046
2 JGI25155J39150_1000007 3300002704 Bacteria 238857
3 JGI25156J39149_1000050 3300002705 Bacteria 89634
4 JGI25156J39149_1000295 3300002705 Bacteria 33633
5 JGI25162J39368_1000908 3300002737 Bacteria 19122
6 JGI25154J39366_1000035 3300002738 Bacteria 172224
7 JGI25157J39369_1000036 3300002741 Bacteria 133671
8 JGI25152J39213_1001356 3300002773 Bacteria 10707
9 JGI25150J39212_1002705 3300002774 Bacteria 4319
10 JGI25159J45721_1004063 3300002987 Bacteria 4966
11 JGI25151J46595_10000613 3300003187 Bacteria 31227
12 JGI25151J46595_10003952 3300003187 Bacteria 7995
13 JGI25151J46595_10039711 3300003187 Bacteria 1734
14 JGI25406J46586_10000006 3300003203 Bacteria 114937
15 JGI25406J46586_10002914 3300003203 Bacteria 8066
16 JGI25165J46597_1000375 3300003214 Bacteria 49445
17 JGI25165J46597_1002256 3300003214 Bacteria 6664
18 JGI25165J46597_1003958 3300003214 Bacteria 3396
19 JGI25153J46596_10005791 3300003215 Bacteria 6427
20 JGI25153J46596_10042717 3300003215 Bacteria 1381
21 JGI25160J50197_1002431 3300003354 Bacteria 8678
22 JGI25160J50197_1007040 3300003354 Bacteria 4454
23 JGI25160J50197_1015074 3300003354 Bacteria 2554
24 JGI25161J50226_1001494 3300003374 Bacteria 6959
25 Ga0055539_1000102 3300003752 Bacteria 98557
26 Ga0055533_1000110 3300003756 Bacteria 98557
27 Ga0055532_1000138 3300003758 Bacteria 71966
28 Ga0055532_1000254 3300003758 Bacteria 36666
29 Ga0055525_1000187 3300003759 Bacteria 75518
30 Ga0055535_1002320 3300003761 Bacteria 6920
31 Ga0055535_1002951 3300003761 Bacteria 5259
32 Ga0055542_1000021 3300003762 Bacteria 331499
33 Ga0055542_1000463 3300003762 Bacteria 38338
34 Ga0055526_1003161 3300003771 Bacteria 10671
35 Ga0055537_1000827 3300003773 Bacteria 15208
36 Ga0055524_1002061 3300003775 Bacteria 10671
37 Ga0055524_1009264 3300003775 Bacteria 4025
38 Ga0055536_1000093 3300003781 Bacteria 77156
39 Ga0055536_1000216 3300003781 Bacteria 47208
40 Ga0055534_1002463 3300003784 Bacteria 6391
41 Ga0055528_1001194 3300003790 Bacteria 16759
42 Ga0055528_1001347 3300003790 Bacteria 15208
43 Ga0055528_1007556 3300003790 Bacteria 4791
44 Ga0055530_10000034 3300003791 Bacteria 118012
45 Ga0055530_10002982 3300003791 Bacteria 10179
46 Ga0055540_1000064 3300003792 Bacteria 127318
47 Ga0055540_1000429 3300003792 Bacteria 33431
48 Ga0055531_10000039 3300003794 Bacteria 141103
49 Ga0055541_1000068 3300003841 Bacteria 98557
50 Ga0058692_1002826 3300003856 Bacteria 5691
51 Ga0055543_1000909 3300004625 Bacteria 13859
52 Ga0065165_1000393 3300005262 Bacteria 71081
53 Ga0065165_1005554 3300005262 Bacteria 7018
54 Ga0065714_10011017 3300005288 Bacteria 3091
55 Ga0065704_10081044 3300005289 Bacteria 3807
56 Ga0065712_10000260 3300005290 Bacteria 16444
57 Ga0070658_10197786 3300005327 Bacteria 1695
58 Ga0070658_10198021 3300005327 Bacteria 1694
59 Ga0070683_100056257 3300005329 Bacteria 3653
60 Ga0070683_100071169 3300005329 Bacteria 3245
61 Ga0070670_100000359 3300005331 Bacteria 38101
62 Ga0070680_100074218 3300005336 Bacteria 2799
63 Ga0070682_100077440 3300005337 Bacteria 2143
64 Ga0070668_100000734 3300005347 Bacteria 22404
65 Ga0070668_100006327 3300005347 Bacteria 8769
66 Ga0070668_100019325 3300005347 Bacteria 5127
67 Ga0070668_100048293 3300005347 Bacteria 3273
68 Ga0070668_100093749 3300005347 Bacteria 2370
69 Ga0070669_100003483 3300005353 Bacteria 11344
70 Ga0070669_100032753 3300005353 Bacteria 3755
71 Ga0070669_100120838 3300005353 Bacteria 1998
72 Ga0070674_100144345 3300005356 Bacteria 1790
73 Ga0070667_100001509 3300005367 Bacteria 20831
74 Ga0070667_100003665 3300005367 Bacteria 13078
75 Ga0070709_10004497 3300005434 Bacteria 7524
76 Ga0070709_10026694 3300005434 Bacteria 3426
77 Ga0070714_100004196 3300005435 Bacteria 10848
78 Ga0070714_100091486 3300005435 Bacteria 2666
79 Ga0070713_100009387 3300005436 Bacteria 6999
80 Ga0070713_100067291 3300005436 Bacteria 3016
81 Ga0070713_100086405 3300005436 Bacteria 2689
82 Ga0070713_100091636 3300005436 Bacteria 2615
83 Ga0070713_100117112 3300005436 Bacteria 2331
84 Ga0070710_10004116 3300005437 Bacteria 6901
85 Ga0070711_100004725 3300005439 Bacteria 8066
86 Ga0070711_100055615 3300005439 Bacteria 2734
87 Ga0070711_100064628 3300005439 Bacteria 2557
88 Ga0070678_100016493 3300005456 Bacteria 4729
89 Ga0070681_10044250 3300005458 Bacteria 4455
90 Ga0070706_100170110 3300005467 Bacteria 2034
91 Ga0070698_100000351 3300005471 Bacteria 47558
92 Ga0070679_100016753 3300005530 Bacteria 7082
93 Ga0070684_100158321 3300005535 Bacteria 2054
94 Ga0070697_100047675 3300005536 Bacteria 3473
95 Ga0070697_100052582 3300005536 Bacteria 3310
96 Ga0068853_100055368 3300005539 Bacteria 3418
97 Ga0068853_100061917 3300005539 Bacteria 3237
98 Ga0068853_100118484 3300005539 Bacteria 2359
99 Ga0070665_100001296 3300005548 Bacteria 29934
100 Ga0070665_100011759 3300005548 Bacteria 8837
101 Ga0070665_100023461 3300005548 Bacteria 6212
102 Ga0070665_100056340 3300005548 Bacteria 3941
103 Ga0068855_100048315 3300005563 Bacteria 5023
104 Ga0070664_100041024 3300005564 Bacteria 3904
105 Ga0068854_100044261 3300005578 Bacteria 3159
106 Ga0068856_100000427 3300005614 Bacteria 46259
107 Ga0068856_100124864 3300005614 Bacteria 2577
108 Ga0068856_100145970 3300005614 Bacteria 2374
109 Ga0068852_100215524 3300005616 Bacteria 1824
110 Ga0068859_100002889 3300005617 Bacteria 17455
111 Ga0068859_100197269 3300005617 Bacteria 2097
112 Ga0068851_10029404 3300005834 Bacteria 2720
113 Ga0068851_10035695 3300005834 Bacteria 2487
114 Ga0068863_100245583 3300005841 Bacteria 1728
115 Ga0068860_100000265 3300005843 Bacteria 76672
116 Ga0068860_100294113 3300005843 Bacteria 1590
117 Ga0068862_100070026 3300005844 Bacteria 3028
118 Ga0068862_100258304 3300005844 Bacteria 1589
119 Ga0081455_10000058 3300005937 Bacteria 119171
120 Ga0081455_10000366 3300005937 Bacteria 59625
121 Ga0081455_10000764 3300005937 Bacteria 41761
122 Ga0081455_10001795 3300005937 Bacteria 25921
123 Ga0081538_10005836 3300005981 Bacteria 10970
124 Ga0081538_10026519 3300005981 Bacteria 4049
125 Ga0081540_1000040 3300005983 Bacteria 136968
126 Ga0081540_1000916 3300005983 Bacteria 26580
127 Ga0081540_1001739 3300005983 Bacteria 18329
128 Ga0081540_1002782 3300005983 Bacteria 14184
129 Ga0081540_1013100 3300005983 Bacteria 5415
130 Ga0081540_1021438 3300005983 Bacteria 3846
131 Ga0081540_1049839 3300005983 Bacteria 2085
132 Ga0081539_10000176 3300005985 Bacteria 150292
133 Ga0081539_10000231 3300005985 Bacteria 131197
134 Ga0081539_10009227 3300005985 Bacteria 8305
135 Ga0081539_10062309 3300005985 Bacteria 2039
136 Ga0070717_10076107 3300006028 Bacteria 2808
137 Ga0075365_10002455 3300006038 Bacteria 9101
138 Ga0075365_10002499 3300006038 Bacteria 9051
139 Ga0075365_10025473 3300006038 Bacteria 3745
140 Ga0075368_10002158 3300006042 Bacteria 6361
141 Ga0075363_100002264 3300006048 Bacteria 7796
142 Ga0070716_100005587 3300006173 Bacteria 6104
143 Ga0070716_100078614 3300006173 Bacteria 1962
144 Ga0070712_100028636 3300006175 Bacteria 3728
145 Ga0070712_100066082 3300006175 Bacteria 2569
146 Ga0075367_10026312 3300006178 Bacteria 3299
147 Ga0075366_10008450 3300006195 Bacteria 5727
148 Ga0075370_10098471 3300006353 Bacteria 1691
149 Ga0068871_100219901 3300006358 Bacteria 1645
150 Ga0075430_100155975 3300006846 Bacteria 1901
151 Ga0075431_100001187 3300006847 Bacteria 23494
152 Ga0075433_10001198 3300006852 Bacteria 18880
153 Ga0075433_10212747 3300006852 Bacteria 1718
154 Ga0075434_100005705 3300006871 Bacteria 11367
155 Ga0097620_100002889 3300006931 Bacteria 17455
156 Ga0097620_100197255 3300006931 Bacteria 2097
157 Ga0099824_1006719 3300006942 Bacteria 15641
158 Ga0099822_1001392 3300006943 Bacteria 27954
159 Ga0099826_10007333 3300006948 Bacteria 8130
160 Ga0075435_100096255 3300007076 Bacteria 2449
161 Ga0099794_10048101 3300007265 Bacteria 2046
162 Ga0105251_10000274 3300009011 Bacteria 51694
163 Ga0105251_10001467 3300009011 Bacteria 20259
164 Ga0105244_10000607 3300009036 Bacteria 31826
165 Ga0105244_10013667 3300009036 Bacteria 4731
166 Ga0105244_10023885 3300009036 Bacteria 3344
167 Ga0105244_10034350 3300009036 Bacteria 2670
168 Ga0105244_10047892 3300009036 Bacteria 2190
169 Ga0105250_10000078 3300009092 Bacteria 84506
170 Ga0105250_10000191 3300009092 Bacteria 52429
171 Ga0105250_10001522 3300009092 Bacteria 12502
172 Ga0105250_10030412 3300009092 Bacteria 2171
173 Ga0105240_10000019 3300009093 Bacteria 406211
174 Ga0105240_10067903 3300009093 Bacteria 4418
175 Ga0105240_10086641 3300009093 Bacteria 3836
176 Ga0105240_10142232 3300009093 Bacteria 2867
177 Ga0111539_10004293 3300009094 Bacteria 18644
178 Ga0111539_10026576 3300009094 Bacteria 7077
179 Ga0105245_10069337 3300009098 Bacteria 3197
180 Ga0114129_10033150 3300009147 Bacteria 7299
181 Ga0105243_10003033 3300009148 Bacteria 13848
182 Ga0105243_10004474 3300009148 Bacteria 11050
183 Ga0105243_10017593 3300009148 Bacteria 5406
184 Ga0105243_10024978 3300009148 Bacteria 4562
185 Ga0105241_10074952 3300009174 Bacteria 2636
186 Ga0105241_10144679 3300009174 Bacteria 1939
187 Ga0105241_10230665 3300009174 Bacteria 1560
188 Ga0105237_10001204 3300009545 Bacteria 34612
189 Ga0105237_10002159 3300009545 Bacteria 24750
190 Ga0105237_10006864 3300009545 Bacteria 12549
191 Ga0105237_10026637 3300009545 Bacteria 5908
192 Ga0105237_10216874 3300009545 Bacteria 1913
193 Ga0105238_10007002 3300009551 Bacteria 11276
194 Ga0105238_10018527 3300009551 Bacteria 7085
195 Ga0105249_10295590 3300009553 Bacteria 1622
196 Ga0105249_10315408 3300009553 Bacteria 1573
197 Ga0123342_1026161 3300009766 Bacteria 3421
198 Ga0105239_10001427 3300010375 Bacteria 31882
199 Ga0105239_10002299 3300010375 Bacteria 24398
200 Ga0105239_10064579 3300010375 Bacteria 4018
201 Ga0105239_10091118 3300010375 Bacteria 3364
202 Ga0105239_10098729 3300010375 Bacteria 3228
203 Ga0105246_10001379 3300011119 Bacteria 14334
204 Ga0105246_10009601 3300011119 Bacteria 5963
205 Ga0157345_1000006 3300012498 Bacteria 72396
206 Ga0157373_10020395 3300013100 Bacteria 4818
207 Ga0157373_10109812 3300013100 Bacteria 1939
208 Ga0157371_10000042 3300013102 Bacteria 198938
209 Ga0157371_10004709 3300013102 Bacteria 11792
210 Ga0157371_10083815 3300013102 Bacteria 2257
211 Ga0157370_10000035 3300013104 Bacteria 137103
212 Ga0157370_10000131 3300013104 Bacteria 89805
213 Ga0157370_10069515 3300013104 Bacteria 3325
214 Ga0157370_10094735 3300013104 Bacteria 2801
215 Ga0157370_10126123 3300013104 Bacteria 2389
216 Ga0157370_10227157 3300013104 Bacteria 1728
217 Ga0157369_10005587 3300013105 Bacteria 14604
218 Ga0157369_10006177 3300013105 Bacteria 13901
219 Ga0157369_10009585 3300013105 Bacteria 11074
220 Ga0157369_10010643 3300013105 Bacteria 10470
221 Ga0157369_10067587 3300013105 Bacteria 3841
222 Ga0157369_10101511 3300013105 Bacteria 3066
223 Ga0157369_10115729 3300013105 Bacteria 2847
224 Ga0157369_10142127 3300013105 Bacteria 2539
225 Ga0157374_10033704 3300013296 Bacteria 4674
226 Ga0157374_10037116 3300013296 Bacteria 4470
227 Ga0157374_10072122 3300013296 Bacteria 3257
228 Ga0157378_10009614 3300013297 Bacteria 8418
229 Ga0163162_10000199 3300013306 Bacteria 55532
230 Ga0157372_10005780 3300013307 Bacteria 13176
231 Ga0157375_10000820 3300013308 Bacteria 27191
232 Ga0157375_10019193 3300013308 Bacteria 6212
233 Ga0157375_10296274 3300013308 Bacteria 1781
234 Ga0163163_10092729 3300014325 Bacteria 3036
235 Ga0182008_10002472 3300014497 Bacteria 11564
236 Ga0182008_10037101 3300014497 Bacteria 2439
237 Ga0157376_10137365 3300014969 Bacteria 2189
238 Ga0182006_1001883 3300015261 Bacteria 11976
239 Ga0182006_1003283 3300015261 Bacteria 8358
240 Ga0183362_10008 3300015683 Bacteria 223037
241 Ga0163161_10000139 3300017792 Bacteria 67878
242 Ga0163161_10006288 3300017792 Bacteria 8220
243 Ga0163161_10038439 3300017792 Bacteria 3433
244 Ga0213872_10007327 3300021361 Bacteria 5444
245 Ga0213872_10023178 3300021361 Bacteria 2857
246 Ga0213876_10038944 3300021384 Bacteria 2510
247 Ga0213871_10000078 3300021441 Bacteria 8306
248 Ga0209435_100005 3300025206 Bacteria 573745
249 Ga0209435_100373 3300025206 Bacteria 10012
250 Ga0209436_108537 3300025208 Bacteria 2031
251 Ga0209784_100057 3300025224 Bacteria 167476
252 Ga0209566_100073 3300025225 Bacteria 167476
253 Ga0209674_100095 3300025226 Bacteria 167476
254 Ga0209672_100295 3300025228 Bacteria 34529
255 Ga0209147_100021 3300025229 Bacteria 464719
256 Ga0209147_100092 3300025229 Bacteria 167476
257 Ga0209563_100093 3300025230 Bacteria 167476
258 Ga0209563_101932 3300025230 Bacteria 5007
259 Ga0209437_100058 3300025233 Bacteria 357279
260 Ga0209437_100060 3300025233 Bacteria 355034
261 Ga0209258_100058 3300025242 Bacteria 331567
262 Ga0209258_100300 3300025242 Bacteria 80484
263 Ga0207425_1000157 3300025245 Bacteria 57625
264 Ga0209646_1000011 3300025246 Bacteria 573745
265 Ga0209646_1000617 3300025246 Bacteria 13677
266 Ga0209646_1007185 3300025246 Bacteria 1830
267 Ga0209026_1000005 3300025250 Bacteria 731387
268 Ga0209026_1000008 3300025250 Bacteria 573745
269 Ga0209026_1002172 3300025250 Bacteria 7614
270 Ga0209677_100054 3300025253 Bacteria 167476
271 Ga0209677_101475 3300025253 Bacteria 10119
272 Ga0209148_1000057 3300025254 Bacteria 360463
273 Ga0209148_1000071 3300025254 Bacteria 331551
274 Ga0209759_1000004 3300025256 Bacteria 573745
275 Ga0209759_1000082 3300025256 Bacteria 169562
276 Ga0209759_1000265 3300025256 Bacteria 75472
277 Ga0209759_1010198 3300025256 Bacteria 2772
278 Ga0209129_1000483 3300025258 Bacteria 29091
279 Ga0209129_1002306 3300025258 Bacteria 9481
280 Ga0209233_1000240 3300025261 Bacteria 90758
281 Ga0209233_1000275 3300025261 Bacteria 72941
282 Ga0209233_1000814 3300025261 Bacteria 13897
283 Ga0209233_1004380 3300025261 Bacteria 4812
284 Ga0209565_1000038 3300025263 Bacteria 286433
285 Ga0209455_1000205 3300025272 Bacteria 84765
286 Ga0209455_1003651 3300025272 Bacteria 5340
287 Ga0209673_1000362 3300025273 Bacteria 81651
288 Ga0209673_1001694 3300025273 Bacteria 18740
289 Ga0209673_1012725 3300025273 Bacteria 3370
290 Ga0209130_1000061 3300025284 Bacteria 200990
291 Ga0209130_1000664 3300025284 Bacteria 31314
292 Ga0209130_1001275 3300025284 Bacteria 17462
293 Ga0209675_1000102 3300025291 Bacteria 123742
294 Ga0209675_1002094 3300025291 Bacteria 10587
295 Ga0209676_1000025 3300025292 Bacteria 577569
296 Ga0209676_1000032 3300025292 Bacteria 469558
297 Ga0209676_1000404 3300025292 Bacteria 77964
298 Ga0209676_1003421 3300025292 Bacteria 9780
299 Ga0209025_1000056 3300025294 Bacteria 316188
300 Ga0209025_1000486 3300025294 Bacteria 76804
301 Ga0209025_1002869 3300025294 Bacteria 17281
302 Ga0209025_1011019 3300025294 Bacteria 6029
303 Ga0209025_1041756 3300025294 Bacteria 1959
304 Ga0209564_1000542 3300025295 Bacteria 60997
305 Ga0209564_1004853 3300025295 Bacteria 7994
306 Ga0209758_1000044 3300025297 Bacteria 398448
307 Ga0209758_1001732 3300025297 Bacteria 24300
308 Ga0209758_1001986 3300025297 Bacteria 22053
309 Ga0209758_1002282 3300025297 Bacteria 19849
310 Ga0209758_1003333 3300025297 Bacteria 14770
311 Ga0209758_1003786 3300025297 Bacteria 13331
312 Ga0209758_1023382 3300025297 Bacteria 2796
313 Ga0209050_1000025 3300025298 Bacteria 528225
314 Ga0209050_1000099 3300025298 Bacteria 232176
315 Ga0209256_1000020 3300025299 Bacteria 542402
316 Ga0209256_1001947 3300025299 Bacteria 18747
317 Ga0207426_1000001 3300025302 Bacteria 1341301
318 Ga0207426_1000451 3300025302 Bacteria 65459
319 Ga0207426_1002786 3300025302 Bacteria 10498
320 Ga0209051_1000026 3300025303 Bacteria 413311
321 Ga0209051_1000039 3300025303 Bacteria 319632
322 Ga0209051_1000047 3300025303 Bacteria 293227
323 Ga0209051_1003798 3300025303 Bacteria 9663
324 Ga0209051_1011280 3300025303 Bacteria 4427
325 Ga0209257_1000034 3300025304 Bacteria 662719
326 Ga0209257_1001689 3300025304 Bacteria 24828
327 Ga0207656_10005610 3300025321 Bacteria 4451
328 Ga0207696_1000071 3300025711 Bacteria 225219
329 Ga0207696_1000078 3300025711 Bacteria 207623
330 Ga0207696_1000212 3300025711 Bacteria 87811
331 Ga0207696_1000961 3300025711 Bacteria 17531
332 Ga0207696_1021437 3300025711 Bacteria 2069
333 Ga0207655_1000014 3300025728 Bacteria 607124
334 Ga0207655_1000441 3300025728 Bacteria 55196
335 Ga0207655_1001362 3300025728 Bacteria 22923
336 Ga0207655_1006386 3300025728 Bacteria 7825
337 Ga0207655_1014596 3300025728 Bacteria 4428
338 Ga0207713_1000010 3300025735 Bacteria 528374
339 Ga0207713_1001597 3300025735 Bacteria 17721
340 Ga0207713_1003526 3300025735 Bacteria 10607
341 Ga0207713_1006493 3300025735 Bacteria 7112
342 Ga0207713_1011892 3300025735 Bacteria 4696
343 Ga0207713_1014554 3300025735 Bacteria 4082
344 Ga0207692_10001246 3300025898 Bacteria 9460
345 Ga0207699_10000763 3300025906 Bacteria 15426
346 Ga0207699_10062447 3300025906 Bacteria 2246
347 Ga0207645_10043988 3300025907 Bacteria 2858
348 Ga0207705_10163338 3300025909 Bacteria 1674
349 Ga0207684_10114167 3300025910 Bacteria 2313
350 Ga0207654_10086047 3300025911 Bacteria 1904
351 Ga0207707_10029007 3300025912 Bacteria 4836
352 Ga0207707_10056027 3300025912 Bacteria 3429
353 Ga0207707_10080667 3300025912 Bacteria 2841
354 Ga0207695_10000049 3300025913 Bacteria 406233
355 Ga0207695_10003498 3300025913 Bacteria 22039
356 Ga0207695_10043878 3300025913 Bacteria 4760
357 Ga0207695_10096753 3300025913 Bacteria 2954
358 Ga0207695_10198549 3300025913 Bacteria 1921
359 Ga0207671_10001771 3300025914 Bacteria 24269
360 Ga0207671_10009517 3300025914 Bacteria 8114
361 Ga0207671_10020040 3300025914 Bacteria 5101
362 Ga0207671_10040867 3300025914 Bacteria 3432
363 Ga0207671_10050623 3300025914 Bacteria 3076
364 Ga0207671_10082481 3300025914 Bacteria 2413
365 Ga0207693_10081334 3300025915 Bacteria 2536
366 Ga0207663_10042162 3300025916 Bacteria 2787
367 Ga0207663_10111722 3300025916 Bacteria 1855
368 Ga0207663_10135336 3300025916 Bacteria 1709
369 Ga0207660_10003538 3300025917 Bacteria 10179
370 Ga0207660_10154060 3300025917 Bacteria 1768
371 Ga0207657_10085467 3300025919 Bacteria 2643
372 Ga0207652_10010392 3300025921 Bacteria 7494
373 Ga0207652_10057070 3300025921 Bacteria 3362
374 Ga0207681_10001048 3300025923 Bacteria 17940
375 Ga0207681_10001413 3300025923 Bacteria 15506
376 Ga0207681_10060130 3300025923 Bacteria 2607
377 Ga0207694_10004900 3300025924 Bacteria 10394
378 Ga0207694_10069419 3300025924 Bacteria 2753
379 Ga0207650_10000295 3300025925 Bacteria 50101
380 Ga0207650_10002333 3300025925 Bacteria 13220
381 Ga0207700_10032960 3300025928 Bacteria 3702
382 Ga0207700_10053019 3300025928 Bacteria 3036
383 Ga0207700_10064987 3300025928 Bacteria 2782
384 Ga0207664_10019001 3300025929 Bacteria 5071
385 Ga0207664_10097018 3300025929 Bacteria 2428
386 Ga0207644_10218694 3300025931 Bacteria 1509
387 Ga0207706_10153171 3300025933 Bacteria 2028
388 Ga0207709_10000040 3300025935 Bacteria 259497
389 Ga0207709_10019621 3300025935 Bacteria 3804
390 Ga0207665_10002269 3300025939 Bacteria 12975
391 Ga0207665_10119013 3300025939 Bacteria 1864
392 Ga0207711_10084540 3300025941 Bacteria 2778
393 Ga0207711_10149314 3300025941 Bacteria 2108
394 Ga0207689_10046690 3300025942 Bacteria 3579
395 Ga0207661_10034196 3300025944 Bacteria 3951
396 Ga0207667_10046644 3300025949 Bacteria 4588
397 Ga0207667_10161664 3300025949 Bacteria 2303
398 Ga0207712_10184219 3300025961 Bacteria 1643
399 Ga0207668_10000033 3300025972 Bacteria 121080
400 Ga0207668_10012379 3300025972 Bacteria 5221
401 Ga0207668_10042899 3300025972 Bacteria 3066
402 Ga0207640_10030435 3300025981 Bacteria 3324
403 Ga0207640_10107267 3300025981 Bacteria 1972
404 Ga0207640_10138929 3300025981 Bacteria 1768
405 Ga0207658_10001268 3300025986 Bacteria 19958
406 Ga0207658_10004077 3300025986 Bacteria 10198
407 Ga0207703_10260727 3300026035 Bacteria 1567
408 Ga0207639_10007940 3300026041 Bacteria 7250
409 Ga0207639_10075984 3300026041 Bacteria 2643
410 Ga0207639_10088242 3300026041 Bacteria 2474
411 Ga0207702_10002818 3300026078 Bacteria 16258
412 Ga0207702_10006542 3300026078 Bacteria 10021
413 Ga0207702_10043495 3300026078 Bacteria 3771
414 Ga0207702_10083796 3300026078 Bacteria 2774
415 Ga0207702_10170448 3300026078 Bacteria 1995
416 Ga0207641_10115717 3300026088 Bacteria 2385
417 Ga0207674_10092290 3300026116 Bacteria 3018
418 Ga0207683_10044288 3300026121 Bacteria 3890
419 Ga0207683_10158234 3300026121 Bacteria 2047
420 Ga0209389_1000068 3300027296 Bacteria 98954
421 Ga0209371_1000003 3300027312 Bacteria 1122971
422 Ga0209371_1003295 3300027312 Bacteria 7996
423 Ga0209371_1004989 3300027312 Bacteria 5487
424 Ga0209589_1000023 3300027357 Bacteria 177856
425 Ga0209489_100032 3300027361 Bacteria 177856
426 Ga0209489_113471 3300027361 Bacteria 6562
427 Ga0209700_100040 3300027363 Bacteria 177856
428 Ga0209700_100117 3300027363 Bacteria 115595
429 Ga0209282_1013642 3300027666 Bacteria 5171
430 Ga0207428_10039670 3300027907 Bacteria 3824
431 Ga0268266_10004462 3300028379 Bacteria 13381
432 Ga0268266_10007442 3300028379 Bacteria 9880
433 Ga0268266_10014083 3300028379 Bacteria 6884
434 Ga0268266_10034015 3300028379 Bacteria 4332
435 Ga0268266_10056761 3300028379 Bacteria 3368
436 Ga0268266_10104048 3300028379 Bacteria 2506
437 Ga0268266_10166119 3300028379 Bacteria 1999
438 Ga0268266_10192613 3300028379 Bacteria 1862
439 Ga0268264_10000318 3300028381 Bacteria 76687
440 Ga0265334_10012389 3300028573 Bacteria 3584
441 Ga0265334_10017805 3300028573 Bacteria 2931
442 Ga0265318_10006964 3300028577 Bacteria 5152
443 Ga0307515_10082124 3300028794 Bacteria 4174
444 Ga0268256_1000004 3300030500 Bacteria 1122967
445 Ga0268256_1002990 3300030500 Bacteria 7996
446 Ga0307511_10086694 3300030521 Bacteria 2155
447 Ga0316181_1206187 3300030744 Bacteria 10221
448 Ga0316182_1118994 3300030745 Bacteria 1556
449 Ga0265340_10004049 3300031247 Bacteria 8231
450 Ga0265340_10059627 3300031247 Bacteria 1830
451 Ga0265327_10002922 3300031251 Bacteria 17100
452 Ga0307509_10147409 3300031507 Bacteria 2276
453 Ga0307508_10000010 3300031616 Bacteria 255747
454 Ga0265314_10047018 3300031711 Bacteria 3040
455 Ga0307416_100284656 3300032002 Bacteria 1632
456 Ga0307411_10006188 3300032005 Bacteria 5960
457 Ga0307507_10063344 3300033179 Bacteria 3424
458 Ga0307510_10000085 3300033180 Bacteria 70352
459 Ga0307510_10007185 3300033180 Bacteria 13262
460 Ga0315911_1000029 3300033442 Bacteria 82350
461 Ga0373934_0006326 3300035086 Bacteria 4390
462 Ga0373934_0028433 3300035086 Bacteria 2179
463 Ga0373940_0014749 3300035088 Bacteria 1911
464 Ga0373949_0014712 3300035090 Bacteria 1744
465 Ga0373936_0000012 3300035113 Bacteria 228915
466 Ga0373936_0000048 3300035113 Bacteria 69508
467 Ga0373936_0052766 3300035113 Bacteria 1648
468 Ga0373953_0000640 3300035117 Bacteria 9722
469 Ga0373953_0011634 3300035117 Bacteria 3095
470 Ga0373954_0000067 3300035118 Bacteria 37060
471 Ga0373956_0002213 3300035119 Bacteria 8017
472 Ga0373956_0012978 3300035119 Bacteria 3462
473 Ga0373957_0001550 3300035120 Bacteria 6266
474 Ga0373955_0003543 3300035172 Bacteria 6870
475 Ga0373955_0009025 3300035172 Bacteria 4656
476 Ga0373962_0001722 3300035242 Bacteria 5202
477 Ga0373924_0000928 3300035410 Bacteria 9241
478 Ga0373924_0006108 3300035410 Bacteria 4301
479 Ga0373931_0003739 3300035691 Bacteria 6883
480 Ga0373931_0023668 3300035691 Bacteria 3103
481 Ga0373931_0064578 3300035691 Bacteria 1982
482 Ga0373935_0093265 3300035692 Bacteria 1974
483 Ga0373935_0107883 3300035692 Bacteria 1844
484 Ga0373935_0141194 3300035692 Bacteria 1627
485 Ga0373927_0017434 3300035695 Bacteria 4725
486 Ga0373927_0162396 3300035695 Bacteria 1464
487 Ga0373933_0000324 3300035724 Bacteria 30843
488 Ga0373933_0000746 3300035724 Bacteria 19870
489 Ga0373933_0006219 3300035724 Bacteria 6496
490 Ga0373933_0022874 3300035724 Bacteria 3564
491 Ga0373947_0011851 3300035725 Bacteria 4997
492 Ga0373947_0015707 3300035725 Bacteria 4349
493 Ga0373937_0000413 3300036401 Bacteria 39908
494 Ga0373937_0001425 3300036401 Bacteria 19991
495 Ga0373937_0001548 3300036401 Bacteria 19310
496 Ga0373937_0023468 3300036401 Bacteria 5554
497 Ga0373937_0025703 3300036401 Bacteria 5318
498 Ga0373925_0013237 3300037068 Bacteria 5970
499 Ga0373925_0063685 3300037068 Bacteria 2775
500 Ga0373925_0086422 3300037068 Bacteria 2392
501 Ga0395899_0003559 3300037312 Bacteria 12330
502 Ga0395899_0030722 3300037312 Bacteria 4039
503 Ga0395900_0001064 3300037418 Bacteria 35026
504 Ga0395900_0025676 3300037418 Bacteria 6031
505 Ga0395900_0028557 3300037418 Bacteria 5716
506 Ga0395900_0087840 3300037418 Bacteria 3195
507 Ga0395900_0126534 3300037418 Bacteria 2621
508 Ga0395900_0130163 3300037418 Bacteria 2579
509 Ga0395900_0291392 3300037418 Bacteria 1621
510 Ga0395898_0128102 3300037466 Bacteria 2432
511 Ga0395898_0151633 3300037466 Bacteria 2217
512 Ga0395905_0035462 3300037471 Bacteria 4684
513 Ga0395905_0171592 3300037471 Bacteria 2037
514 Ga0436364_0867524 3300037853 Bacteria 16925
515 Ga0395901_0029508 3300038443 Bacteria 5648
516 Ga0395901_0035567 3300038443 Bacteria 5147
517 Ga0395901_0060827 3300038443 Bacteria 3930
518 Ga0395901_0256413 3300038443 Bacteria 1821
519 Ga0237819_02648 3300038705 Bacteria 3502
520 Ga0436365_0871323 3300039437 Bacteria 58014
521 Ga0436365_1607850 3300039437 Bacteria 28034
522 Ga0436360_1295423 3300039438 Bacteria 34613
523 Ga0436361_0144287 3300039447 Bacteria 22519
524 Ga0436361_0183072 3300039447 Bacteria 4156
525 Ga0436361_0256362 3300039447 Bacteria 3344
526 Ga0436361_0294136 3300039447 Bacteria 3610
527 Ga0436361_0488499 3300039447 Bacteria 8012
528 Ga0436361_0983753 3300039447 Bacteria 1638
529 Ga0436361_1199195 3300039447 Bacteria 1589
530 Ga0436363_1134489 3300039450 Bacteria 2109
531 Ga0436363_1329538 3300039450 Bacteria 2770
532 Ga0439465_0020010 3300041413 Bacteria 2094
533 Ga0451793_1407387 3300041452 Bacteria 3413
534 Ga0451797_0747061 3300041453 Bacteria 3557
535 Ga0451807_0031918 3300041486 Bacteria 10646
536 Ga0439451_007601 3300042009 Bacteria 2205
537 Ga0439463_000088 3300042016 Bacteria 21428
538 Ga0450911_000132 3300042115 Bacteria 29769
539 Ga0450904_001603 3300042139 Bacteria 3069
540 Ga0466972_0000076 3300044658 Bacteria 92672
541 Ga0466966_0014368 3300044684 Bacteria 5241
542 Ga0466961_0000600 3300044693 Bacteria 22699
543 Ga0466963_0066091 3300044694 Bacteria 2425
544 Ga0466970_0010203 3300044765 Bacteria 4760
545 Ga0466960_0006169 3300044901 Bacteria 4798
546 Ga0466959_0000651 3300045049 Bacteria 20259
547 Ga0466959_0003113 3300045049 Bacteria 10757
548 Ga0466958_0050355 3300045836 Bacteria 2522
549 Ga0495627_000962 3300046453 Bacteria 19713
550 Ga0495627_001135 3300046453 Bacteria 17214
551 Ga0495627_003213 3300046453 Bacteria 7353
552 Ga0495592_0000629 3300046454 Bacteria 24609
553 Ga0495592_0001030 3300046454 Bacteria 19355
554 Ga0495603_0059365 3300046455 Bacteria 2261
555 Ga0495591_001034 3300046458 Bacteria 18824
556 Ga0495591_001961 3300046458 Bacteria 12020
557 Ga0495591_003002 3300046458 Bacteria 8990
558 Ga0495591_006316 3300046458 Bacteria 5265
559 Ga0495591_025435 3300046458 Bacteria 1857
560 Ga0495629_0000398 3300046459 Bacteria 36605
561 Ga0495629_0000948 3300046459 Bacteria 23342
562 Ga0495638_0000120 3300046460 Bacteria 127382
563 Ga0495638_0000830 3300046460 Bacteria 32408
564 Ga0495638_0007158 3300046460 Bacteria 8039
565 Ga0495638_0010795 3300046460 Bacteria 6317
566 Ga0495651_0000319 3300046462 Bacteria 37294
567 Ga0495651_0004166 3300046462 Bacteria 11071
568 Ga0495653_0000391 3300046463 Bacteria 35079
569 Ga0495653_0000598 3300046463 Bacteria 27691
570 Ga0495653_0002549 3300046463 Bacteria 14521
571 Ga0495650_0020937 3300046471 Bacteria 3175
572 Ga0495650_0059865 3300046471 Bacteria 1531
573 Ga0495580_0007113 3300046472 Bacteria 9013
574 Ga0495582_0094401 3300046473 Bacteria 1670
575 Ga0495582_0116066 3300046473 Bacteria 1506
576 Ga0495605_0000158 3300046474 Bacteria 86829
577 Ga0495605_0000164 3300046474 Bacteria 84623
578 Ga0495605_0000220 3300046474 Bacteria 70521
579 Ga0495605_0009203 3300046474 Bacteria 5553
580 Ga0495605_0043870 3300046474 Bacteria 2214
581 Ga0495605_0061269 3300046474 Bacteria 1801
582 Ga0495664_0000849 3300046477 Bacteria 15703
583 Ga0495584_0057027 3300046491 Bacteria 1965
584 Ga0495585_0033962 3300046492 Bacteria 2884
585 Ga0495585_0054980 3300046492 Bacteria 2200
586 Ga0495585_0104414 3300046492 Bacteria 1512
587 Ga0495596_0011116 3300046500 Bacteria 3893
588 Ga0495607_0000013 3300046501 Bacteria 189755
589 Ga0495607_0000032 3300046501 Bacteria 153288
590 Ga0495607_0000082 3300046501 Bacteria 96822
591 Ga0495607_0002081 3300046501 Bacteria 16718
592 Ga0495607_0003493 3300046501 Bacteria 12023
593 Ga0495607_0007523 3300046501 Bacteria 7524
594 Ga0495607_0053320 3300046501 Bacteria 2338
595 Ga0495607_0077763 3300046501 Bacteria 1832
596 Ga0495607_0084209 3300046501 Bacteria 1740
597 Ga0495583_0000086 3300046506 Bacteria 165176
598 Ga0495583_0000226 3300046506 Bacteria 95293
599 Ga0495583_0009346 3300046506 Bacteria 5869
600 Ga0495606_0000061 3300046507 Bacteria 185384
601 Ga0495606_0003058 3300046507 Bacteria 18238
602 Ga0495606_0004653 3300046507 Bacteria 13571
603 Ga0495606_0005451 3300046507 Bacteria 12180
604 Ga0495606_0088820 3300046507 Bacteria 1905
605 Ga0495606_0117021 3300046507 Bacteria 1600
606 Ga0495606_0133929 3300046507 Eukaryota 1470
607 Ga0495608_0000916 3300046511 Bacteria 20676
608 Ga0495608_0002252 3300046511 Bacteria 13923
609 Ga0495608_0003379 3300046511 Bacteria 11423
610 Ga0495608_0071490 3300046511 Bacteria 2263
611 Ga0495610_0000138 3300046512 Bacteria 81842
612 Ga0495610_0005026 3300046512 Bacteria 9562
613 Ga0495610_0008977 3300046512 Bacteria 6391
614 Ga0495610_0016998 3300046512 Bacteria 4163
615 Ga0495616_0003497 3300046513 Bacteria 10047
616 Ga0495616_0003740 3300046513 Bacteria 9705
617 Ga0495616_0003971 3300046513 Bacteria 9413
618 Ga0495616_0038331 3300046513 Bacteria 2461
619 Ga0495616_0081280 3300046513 Bacteria 1550
620 Ga0495616_0084874 3300046513 Bacteria 1509
621 Ga0495620_0000047 3300046515 Bacteria 107032
622 Ga0495620_0001699 3300046515 Bacteria 12996
623 Ga0495620_0014504 3300046515 Bacteria 4004
624 Ga0495628_0017882 3300046516 Bacteria 5884
625 Ga0495628_0030305 3300046516 Bacteria 4381
626 Ga0495630_0025184 3300046517 Bacteria 4398
627 Ga0495631_0019496 3300046518 Bacteria 3179
628 Ga0495632_0000719 3300046519 Bacteria 30093
629 Ga0495632_0011234 3300046519 Bacteria 5238
630 Ga0495632_0034577 3300046519 Bacteria 2585
631 Ga0495632_0060532 3300046519 Bacteria 1839
632 Ga0495637_0002352 3300046520 Bacteria 10476
633 Ga0495637_0010199 3300046520 Bacteria 4553
634 Ga0495637_0011909 3300046520 Bacteria 4168
635 Ga0495637_0042753 3300046520 Bacteria 1937
636 Ga0495643_0008772 3300046522 Bacteria 6370
637 Ga0495643_0044851 3300046522 Bacteria 2401
638 Ga0495643_0065956 3300046522 Bacteria 1910
639 Ga0495648_0000552 3300046524 Bacteria 40192
640 Ga0495648_0001770 3300046524 Bacteria 20832
641 Ga0495648_0003462 3300046524 Bacteria 13885
642 Ga0495648_0005888 3300046524 Bacteria 10079
643 Ga0495648_0036428 3300046524 Bacteria 3175
644 Ga0495648_0049091 3300046524 Bacteria 2591
645 Ga0495666_0064554 3300046526 Bacteria 1747
646 Ga0495652_0001170 3300046529 Bacteria 29592
647 Ga0495652_0009435 3300046529 Bacteria 8863
648 Ga0495654_0000117 3300046530 Bacteria 89307
649 Ga0495654_0000224 3300046530 Bacteria 52709
650 Ga0495654_0000732 3300046530 Bacteria 25488
651 Ga0495654_0001955 3300046530 Bacteria 13613
652 Ga0495654_0003210 3300046530 Bacteria 10121
653 Ga0495654_0019243 3300046530 Bacteria 3572
654 Ga0495665_0088474 3300046531 Bacteria 1628
655 Ga0495640_0035357 3300046533 Bacteria 3536
656 Ga0495640_0103047 3300046533 Bacteria 1872
657 Ga0495587_0001521 3300046536 Bacteria 15413
658 Ga0495587_0008765 3300046536 Bacteria 6488
659 Ga0495587_0018340 3300046536 Bacteria 4340
660 Ga0495609_0000156 3300046538 Bacteria 70241
661 Ga0495609_0006521 3300046538 Bacteria 5945
662 Ga0495609_0037939 3300046538 Bacteria 2173
663 Ga0495597_0000013 3300046542 Bacteria 203829
664 Ga0495597_0002855 3300046542 Bacteria 10559
665 Ga0495597_0033929 3300046542 Bacteria 2308
666 Ga0495645_0013413 3300046543 Bacteria 5792
667 Ga0495645_0090314 3300046543 Bacteria 2189
668 Ga0495645_0112991 3300046543 Bacteria 1920
669 Ga0495622_0001594 3300046557 Bacteria 11206
670 Ga0495633_0000453 3300046558 Bacteria 42087
671 Ga0495633_0023805 3300046558 Bacteria 3031
672 Ga0495633_0030237 3300046558 Bacteria 2632
673 Ga0495633_0052648 3300046558 Bacteria 1917
674 Ga0495667_0000305 3300046559 Bacteria 31224
675 Ga0495667_0002351 3300046559 Bacteria 12645
676 Ga0495667_0013747 3300046559 Bacteria 5467
677 Ga0495667_0043230 3300046559 Bacteria 2986
678 Ga0495656_0005918 3300046615 Bacteria 4255
679 Ga0495668_0001200 3300046616 Bacteria 26319
680 Ga0495668_0031490 3300046616 Bacteria 2989
681 Ga0495668_0057348 3300046616 Bacteria 2149
682 Ga0495634_0001959 3300046642 Bacteria 17575
683 Ga0495634_0003266 3300046642 Bacteria 13085
684 Ga0495634_0084101 3300046642 Bacteria 2075
685 Ga0495611_0000339 3300046648 Bacteria 30358
686 Ga0495625_0004731 3300046660 Bacteria 12748
687 Ga0495625_0005554 3300046660 Bacteria 11447
688 Ga0495625_0006484 3300046660 Bacteria 10402
689 Ga0495625_0032089 3300046660 Bacteria 3900
690 Ga0495625_0066117 3300046660 Bacteria 2547
691 Ga0495635_0000102 3300046663 Bacteria 50623
692 Ga0495635_0003651 3300046663 Bacteria 10674
693 Ga0495635_0069033 3300046663 Bacteria 2423
694 Ga0495661_0000007 3300046665 Bacteria 411832
695 Ga0495661_0000154 3300046665 Bacteria 80795
696 Ga0495661_0000172 3300046665 Bacteria 74827
697 Ga0495661_0011508 3300046665 Bacteria 6002
698 Ga0495661_0012271 3300046665 Bacteria 5787
699 Ga0495661_0036529 3300046665 Bacteria 3076
700 Ga0495588_0012716 3300046674 Bacteria 3987
701 Ga0495657_0000677 3300046675 Bacteria 30671
702 Ga0495657_0011228 3300046675 Bacteria 6710
703 Ga0495599_0001494 3300046678 Bacteria 13444
704 Ga0495599_0001882 3300046678 Bacteria 12160
705 Ga0495599_0021326 3300046678 Bacteria 4041
706 Ga0495623_0005677 3300046679 Bacteria 8147
707 Ga0495646_0005928 3300046680 Bacteria 7744
708 Ga0495646_0007052 3300046680 Bacteria 7139
709 Ga0495646_0067017 3300046680 Bacteria 2123
710 Ga0495647_0026488 3300046681 Bacteria 2125
711 Ga0495613_0046524 3300046689 Bacteria 3208
712 Ga0495613_0183622 3300046689 Bacteria 1480
713 Ga0495624_0002316 3300046690 Bacteria 14498
714 Ga0495624_0053891 3300046690 Bacteria 2538
715 Ga0495670_0002847 3300046691 Bacteria 8553
716 Ga0495670_0009646 3300046691 Bacteria 4744
717 Ga0495671_0029777 3300046692 Bacteria 2800
718 Ga0495671_0086739 3300046692 Bacteria 1533
719 Ga0495649_0000685 3300046694 Bacteria 27597
720 Ga0495649_0008434 3300046694 Bacteria 6202
721 Ga0495649_0021189 3300046694 Bacteria 3642
722 Ga0495649_0048237 3300046694 Bacteria 2314
723 Ga0495649_0066095 3300046694 Bacteria 1940
724 Ga0495649_0069243 3300046694 Bacteria 1893
725 Ga0495589_0010970 3300046794 Bacteria 4704
726 Ga0495589_0015004 3300046794 Bacteria 3986
727 Ga0495589_0053544 3300046794 Bacteria 1991
728 Ga0495589_0054925 3300046794 Bacteria 1963
729 Ga0495660_0000333 3300046810 Bacteria 41657
730 Ga0495660_0003395 3300046810 Bacteria 9852
731 Ga0495660_0015649 3300046810 Bacteria 4380
732 Ga0495660_0036141 3300046810 Bacteria 2756
733 Ga0495660_0056579 3300046810 Bacteria 2118
734 Ga0495660_0065580 3300046810 Bacteria 1938
735 Ga0495581_0026545 3300047315 Bacteria 3357
736 Ga0495604_0000580 3300047317 Bacteria 32005
737 Ga0495604_0001099 3300047317 Bacteria 22454
738 Ga0495604_0063570 3300047317 Bacteria 2815
739 Ga0495674_0001292 3300047319 Bacteria 24333
740 Ga0495674_0013937 3300047319 Bacteria 7542
741 Ga0495674_0071933 3300047319 Bacteria 2984
742 Ga0495674_0257629 3300047319 Bacteria 1434
743 Ga0495672_0004828 3300047320 Bacteria 10864
744 Ga0495672_0029603 3300047320 Bacteria 3446
745 Ga0495672_0036625 3300047320 Bacteria 3011
746 Ga0495672_0041227 3300047320 Bacteria 2793
747 Ga0495672_0077600 3300047320 Bacteria 1861
748 Ga0495680_0000636 3300047322 Bacteria 39417
749 Ga0495680_0018405 3300047322 Bacteria 5932
750 Ga0495680_0156163 3300047322 Bacteria 1659
751 Ga0495683_0000099 3300047323 Bacteria 88483
752 Ga0495683_0000113 3300047323 Bacteria 82670
753 Ga0495687_000572 3300047443 Bacteria 43367
754 Ga0495687_035975 3300047443 Bacteria 2220
755 Ga0495687_052619 3300047443 Bacteria 1720
756 Ga0495675_0007147 3300047444 Bacteria 6873
757 Ga0495675_0024914 3300047444 Bacteria 3816
758 Ga0495679_000549 3300047446 Bacteria 26435
759 Ga0495679_007354 3300047446 Bacteria 4600
760 Ga0495679_023488 3300047446 Bacteria 2090
761 Ga0495679_028495 3300047446 Bacteria 1832
762 Ga0495673_0003314 3300047469 Bacteria 10675
763 Ga0495673_0003583 3300047469 Bacteria 10190
764 Ga0495673_0020162 3300047469 Bacteria 3324
765 Ga0495673_0052489 3300047469 Bacteria 1781
766 Ga0495673_0074076 3300047469 Bacteria 1425
767 Ga0495681_0002645 3300047470 Bacteria 12709
768 Ga0495681_0002739 3300047470 Bacteria 12474
769 Ga0495681_0003661 3300047470 Bacteria 10675
770 Ga0495681_0004812 3300047470 Bacteria 9146
771 Ga0495681_0037021 3300047470 Bacteria 2408
772 Ga0495681_0056181 3300047470 Bacteria 1832
773 Ga0495684_0000088 3300047471 Bacteria 64704
774 Ga0495684_0112571 3300047471 Bacteria 2052
775 Ga0495684_0220346 3300047471 Bacteria 1391
776 Ga0495686_0001608 3300047472 Bacteria 23795
777 Ga0495686_0004287 3300047472 Bacteria 11814
778 Ga0495686_0014472 3300047472 Bacteria 5426
779 Ga0495686_0015085 3300047472 Bacteria 5292
780 Ga0495686_0039136 3300047472 Bacteria 3030
781 Ga0495593_0009454 3300047673 Bacteria 5657
782 Ga0495602_0000162 3300048088 Bacteria 62143
783 Ga0495602_0004623 3300048088 Bacteria 14359
784 Ga0495602_0006564 3300048088 Bacteria 12199
785 Ga0495602_0028311 3300048088 Bacteria 5364
786 Ga0495626_0000162 3300048091 Bacteria 81809
787 Ga0495626_0004818 3300048091 Bacteria 8135
788 Ga0496100_0010556 3300048903 Bacteria 5230
789 Ga0496100_0018696 3300048903 Bacteria 4117
790 Ga0496101_0008338 3300048904 Bacteria 6770
791 Ga0496101_0011098 3300048904 Bacteria 5970
792 Ga0496101_0117825 3300048904 Bacteria 2005
793 Ga0496102_0000613 3300048905 Bacteria 36995
794 Ga0496102_0002326 3300048905 Bacteria 16233
795 Ga0496103_0002825 3300048906 Bacteria 10796
796 Ga0496103_0008910 3300048906 Bacteria 5948
797 Ga0496103_0090578 3300048906 Bacteria 1930
798 Ga0496104_0002277 3300048907 Bacteria 16556
799 Ga0496104_0005539 3300048907 Bacteria 11061
800 Ga0496104_0036850 3300048907 Bacteria 4573
801 Ga0496104_0038908 3300048907 Bacteria 4451
802 Ga0496104_0096350 3300048907 Bacteria 2830
803 Ga0496105_0001309 3300048908 Bacteria 17421
804 Ga0496105_0055730 3300048908 Bacteria 3263
805 Ga0496106_0001425 3300048909 Bacteria 17950
806 Ga0496107_0003742 3300048910 Eukaryota 10217
807 Ga0496107_0014938 3300048910 Bacteria 5438
808 Ga0496108_0029179 3300048911 Bacteria 4568
809 Ga0496108_0139543 3300048911 Bacteria 2088
810 Ga0496110_0041157 3300048913 Bacteria 4031
811 Ga0496110_0142856 3300048913 Bacteria 2164
812 Ga0496110_0294871 3300048913 Bacteria 1477
813 Ga0496111_0098314 3300048914 Bacteria 2149
814 Ga0496112_0016228 3300048915 Bacteria 6969
815 Ga0496112_0105054 3300048915 Bacteria 2794
816 Ga0496112_0215061 3300048915 Bacteria 1879
817 Ga0496113_0000100 3300048916 Bacteria 36225
818 Ga0496113_0179574 3300048916 Bacteria 1678
819 Ga0496114_0081585 3300048917 Bacteria 2732
820 Ga0496114_0120405 3300048917 Bacteria 2257
821 Ga0496115_0003736 3300048918 Bacteria 10949
822 Ga0496115_0068101 3300048918 Bacteria 2881
823 Ga0496115_0070947 3300048918 Bacteria 2825
824 Ga0496116_0000042 3300048919 Bacteria 330516
825 Ga0496116_0002293 3300048919 Bacteria 20293
826 Ga0496117_0000036 3300048920 Bacteria 325635
827 Ga0496117_0000218 3300048920 Bacteria 109766
828 Ga0496117_0001162 3300048920 Bacteria 39563
829 Ga0496117_0017563 3300048920 Bacteria 5969
830 Ga0496117_0022908 3300048920 Bacteria 4998
831 Ga0496117_0032539 3300048920 Bacteria 3960
832 Ga0496117_0043984 3300048920 Bacteria 3239
833 Ga0496117_0070470 3300048920 Bacteria 2348
834 Ga0496117_0086916 3300048920 Bacteria 2029
835 Ga0496117_0098792 3300048920 Bacteria 1854
836 Ga0496118_0000729 3300048921 Bacteria 53121
837 Ga0496118_0002112 3300048921 Bacteria 27854
838 Ga0496118_0017938 3300048921 Bacteria 6417
839 Ga0496118_0037856 3300048921 Bacteria 3874
840 Ga0496118_0038443 3300048921 Bacteria 3835
841 Ga0496118_0044009 3300048921 Bacteria 3500
842 Ga0496118_0093332 3300048921 Bacteria 2062
843 Ga0496119_0002625 3300048922 Bacteria 19507
844 Ga0496119_0003738 3300048922 Bacteria 15572
845 Ga0496119_0005237 3300048922 Bacteria 12498
846 Ga0496119_0012527 3300048922 Bacteria 6877
847 Ga0496119_0032141 3300048922 Bacteria 3502
848 Ga0496119_0047055 3300048922 Bacteria 2687
849 Ga0496120_0000036 3300048923 Bacteria 206505
850 Ga0496120_0003787 3300048923 Bacteria 13333
851 Ga0496120_0003789 3300048923 Bacteria 13331
852 Ga0496120_0004614 3300048923 Bacteria 11431
853 Ga0496120_0004974 3300048923 Bacteria 10797
854 Ga0496120_0072515 3300048923 Bacteria 1887
855 Ga0496121_0000033 3300048924 Bacteria 377542
856 Ga0496121_0000077 3300048924 Bacteria 235293
857 Ga0496121_0000570 3300048924 Bacteria 69574
858 Ga0496121_0000664 3300048924 Bacteria 64277
859 Ga0496121_0006454 3300048924 Bacteria 14545
860 Ga0496121_0009406 3300048924 Bacteria 11240
861 Ga0496121_0016116 3300048924 Bacteria 7743
862 Ga0496121_0019411 3300048924 Bacteria 6796
863 Ga0496121_0023336 3300048924 Bacteria 5962
864 Ga0496121_0052814 3300048924 Bacteria 3409
865 Ga0496121_0057807 3300048924 Bacteria 3211
866 Ga0496121_0087611 3300048924 Bacteria 2443
867 Ga0496122_0000002 3300048925 Bacteria 905834
868 Ga0496122_0000428 3300048925 Bacteria 88816
869 Ga0496122_0000996 3300048925 Bacteria 50450
870 Ga0496122_0006539 3300048925 Bacteria 13331
871 Ga0496122_0021606 3300048925 Bacteria 5753
872 Ga0496122_0028116 3300048925 Bacteria 4784
873 Ga0496122_0066047 3300048925 Bacteria 2617
874 Ga0496122_0084221 3300048925 Bacteria 2200
875 Ga0496122_0138454 3300048925 Bacteria 1528
876 Ga0496123_0000002 3300048926 Bacteria 1811682
877 Ga0496123_0000337 3300048926 Bacteria 88727
878 Ga0496123_0001068 3300048926 Bacteria 41396
879 Ga0496123_0004528 3300048926 Bacteria 14519
880 Ga0496123_0005027 3300048926 Bacteria 13532
881 Ga0496123_0011126 3300048926 Bacteria 7845
882 Ga0496123_0041597 3300048926 Bacteria 3183
883 Ga0496123_0046469 3300048926 Bacteria 2944
884 Ga0496123_0050340 3300048926 Bacteria 2784
885 Ga0496124_0000259 3300048927 Bacteria 101764
886 Ga0496124_0000812 3300048927 Bacteria 50806
887 Ga0496124_0001166 3300048927 Bacteria 41149
888 Ga0496124_0001679 3300048927 Bacteria 31447
889 Ga0496124_0002048 3300048927 Bacteria 27374
890 Ga0496124_0005729 3300048927 Bacteria 13838
891 Ga0496124_0016064 3300048927 Bacteria 7142
892 Ga0496124_0021308 3300048927 Bacteria 5973
893 Ga0496124_0029306 3300048927 Bacteria 4907
894 Ga0496124_0051980 3300048927 Bacteria 3483
895 Ga0496124_0081579 3300048927 Bacteria 2657
896 Ga0496125_0000235 3300048928 Bacteria 113379
897 Ga0496125_0000681 3300048928 Bacteria 56691
898 Ga0496125_0000760 3300048928 Bacteria 52776
899 Ga0496125_0006813 3300048928 Bacteria 12261
900 Ga0496125_0039434 3300048928 Bacteria 4067
901 Ga0496125_0050297 3300048928 Bacteria 3452
902 Ga0496125_0066080 3300048928 Bacteria 2860
903 Ga0496125_0127718 3300048928 Bacteria 1798
904 Ga0496126_0001647 3300048929 Bacteria 33697
905 Ga0496126_0002030 3300048929 Bacteria 28578
906 Ga0496126_0004349 3300048929 Bacteria 16993
907 Ga0496126_0010785 3300048929 Bacteria 9540
908 Ga0496126_0012038 3300048929 Bacteria 8889
909 Ga0496126_0016102 3300048929 Bacteria 7492
910 Ga0496126_0039056 3300048929 Bacteria 4408
911 Ga0496126_0040697 3300048929 Bacteria 4307
912 Ga0496126_0057675 3300048929 Bacteria 3504
913 Ga0496126_0103810 3300048929 Bacteria 2483
914 Ga0496126_0127421 3300048929 Bacteria 2202
915 Ga0496126_0213249 3300048929 Bacteria 1624
916 Ga0495678_000124 3300049459 Bacteria 90202
917 Ga0495678_026948 3300049459 Bacteria 2444
918 Ga0495678_043782 3300049459 Bacteria 1775
919 Ga0501031_0000620 3300049568 Bacteria 20973
920 Ga0501032_0003195 3300049569 Bacteria 12615
921 Ga0501033_0000241 3300049570 Bacteria 52500
922 Ga0501033_0026589 3300049570 Bacteria 4354
923 Ga0501033_0049249 3300049570 Bacteria 3127
924 Ga0501034_0000021 3300049571 Bacteria 266023
925 Ga0501034_0000109 3300049571 Bacteria 151550
926 Ga0501034_0001751 3300049571 Bacteria 27824
927 Ga0501034_0091961 3300049571 Bacteria 3031
928 Ga0501036_0000055 3300049572 Bacteria 73738
929 Ga0501037_0000398 3300049573 Bacteria 36170
930 Ga0501038_0001235 3300049574 Bacteria 23202
931 Ga0501039_0000293 3300049575 Bacteria 35520
932 Ga0501043_0000033 3300049579 Bacteria 139500
933 Ga0501046_0000452 3300049580 Bacteria 41240
934 Ga0501046_0158687 3300049580 Bacteria 1702
935 Ga0501047_0000574 3300049581 Bacteria 39096
936 Ga0501048_0000261 3300049582 Bacteria 35293
937 Ga0501067_0000045 3300049583 Bacteria 73394
938 Ga0501067_0120805 3300049583 Bacteria 1458
939 Ga0501068_0003740 3300049584 Bacteria 8231
940 Ga0501068_0019486 3300049584 Bacteria 3941
941 Ga0501069_0003820 3300049585 Bacteria 7754
942 Ga0501070_0002498 3300049586 Bacteria 16116
943 Ga0501070_0006242 3300049586 Bacteria 10144
944 Ga0501070_0053039 3300049586 Bacteria 3365
945 Ga0501071_0017446 3300049587 Bacteria 4951
946 Ga0501072_0010633 3300049588 Bacteria 7009
947 Ga0501073_0010956 3300049589 Bacteria 6634
948 Ga0501073_0023935 3300049589 Bacteria 4385
949 Ga0501073_0034888 3300049589 Bacteria 3578
950 Ga0501074_0003795 3300049590 Bacteria 10738
951 Ga0501074_0015583 3300049590 Bacteria 5525
952 Ga0501077_0023333 3300049593 Bacteria 3923
953 Ga0501077_0030316 3300049593 Bacteria 3442
954 Ga0501080_0004826 3300049742 Bacteria 12024
955 Ga0501081_0034632 3300049743 Bacteria 3436
956 Ga0501083_0000182 3300049744 Bacteria 40680
957 Ga0501035_0000241 3300049822 Bacteria 65546
958 Ga0501035_0111993 3300049822 Bacteria 2391
959 Ga0501044_0000640 3300049823 Bacteria 42246
960 Ga0501044_0034874 3300049823 Bacteria 5273
961 Ga0501045_0088025 3300049824 Bacteria 2294
962 nmdc:mga03683_718_c1 3300050489 Bacteria 9504
963 nmdc:mga03n38_2026_c1 3300050490 Bacteria 6103
964 nmdc:mga00v17_19_c1 3300050491 Bacteria 115002
965 nmdc:mga00v17_2987_c1 3300050491 Bacteria 8682
966 nmdc:mga0yw44_386_c1 3300050492 Bacteria 15352
967 nmdc:mga0yw44_575_c1 3300050492 Bacteria 13288
968 nmdc:mga09592_38638_c1 3300050508 Bacteria 4007
969 nmdc:mga0qj67_106915_c1 3300050509 Bacteria 2257
970 nmdc:mga08y16_13395_c1 3300050511 Bacteria 8625
971 nmdc:mga08y16_46635_c1 3300050511 Bacteria 4537
972 nmdc:mga08y16_83612_c1 3300050511 Bacteria 3327
973 nmdc:mga0n895_1221_c1 3300050512 Bacteria 18979
974 nmdc:mga0sz30_8616_c1 3300050516 Bacteria 3855
975 Ga0495601_0002864 3300053077 Bacteria 9804
976 Ga0495601_0012935 3300053077 Bacteria 5011
977 Ga0495601_0020150 3300053077 Bacteria 4071
978 Ga0495601_0098530 3300053077 Bacteria 1887
979 Ga0495612_0004607 3300053078 Bacteria 5715
980 Ga0495612_0016518 3300053078 Bacteria 2957
981 Ga0500610_0004055 3300053079 Bacteria 5742
982 Ga0495595_0000112 3300053084 Bacteria 37201
983 Ga0495595_0003426 3300053084 Bacteria 6293
984 Ga0495619_0000166 3300053085 Bacteria 48296
985 Ga0495619_0001541 3300053085 Bacteria 15178
986 Ga0495619_0027730 3300053085 Bacteria 3651
987 Ga0495619_0027922 3300053085 Bacteria 3640
988 Ga0500578_0100810 3300053086 Bacteria 1827
989 Ga0500643_000362 3300053087 Bacteria 35932
990 Ga0500643_043512 3300053087 Bacteria 1309
991 Ga0500566_0002077 3300053094 Bacteria 11838
992 Ga0500641_0054968 3300053096 Bacteria 1647
993 Ga0500555_003622 3300053103 Bacteria 4398
994 Ga0500556_0000030 3300053104 Bacteria 165098
995 Ga0500556_0001124 3300053104 Bacteria 13249
996 Ga0500557_000223 3300053105 Bacteria 8865
997 Ga0500560_000050 3300053107 Bacteria 11659
998 Ga0500560_001099 3300053107 Bacteria 4423
999 Ga0500572_000055 3300053111 Bacteria 34260
1000 Ga0500572_001371 3300053111 Bacteria 6719
1001 Ga0500572_001447 3300053111 Bacteria 6498
1002 Ga0500572_020641 3300053111 Bacteria 1735
1003 Ga0500591_051586 3300053115 Bacteria 1928
1004 Ga0500595_008373 3300053119 Bacteria 4226
1005 Ga0500595_011111 3300053119 Bacteria 3541
1006 Ga0500595_015948 3300053119 Bacteria 2807
1007 Ga0500595_024033 3300053119 Bacteria 2132
1008 Ga0500595_035614 3300053119 Bacteria 1637
1009 Ga0500608_015526 3300053122 Bacteria 3423
1010 Ga0500618_006987 3300053125 Bacteria 3261
1011 Ga0500658_0072713 3300053134 Bacteria 1454
1012 Ga0500559_0000678 3300053136 Bacteria 22700
1013 Ga0500559_0000870 3300053136 Bacteria 19374
1014 Ga0500559_0001368 3300053136 Bacteria 13979
1015 Ga0500559_0003497 3300053136 Bacteria 7705
1016 Ga0500559_0029135 3300053136 Bacteria 2362
1017 Ga0500568_0000323 3300053139 Bacteria 37840
1018 Ga0500568_0000361 3300053139 Bacteria 35246
1019 Ga0500573_0014832 3300053140 Bacteria 4413
1020 Ga0500573_0021953 3300053140 Bacteria 3663
1021 Ga0500573_0074730 3300053140 Bacteria 1930
1022 Ga0500603_001487 3300053150 Bacteria 5345
1023 Ga0500604_0028580 3300053151 Bacteria 1620
1024 Ga0500616_0009600 3300053153 Bacteria 5871
1025 Ga0500622_0015058 3300053156 Bacteria 4147
1026 Ga0500624_000424 3300053157 Bacteria 12877
1027 Ga0500624_002884 3300053157 Bacteria 2279
1028 Ga0500627_0000105 3300053158 Bacteria 28056
1029 Ga0500627_0008706 3300053158 Bacteria 3621
1030 Ga0500630_032865 3300053159 Bacteria 2545
1031 Ga0500634_0006837 3300053161 Bacteria 5557
1032 Ga0500634_0022929 3300053161 Bacteria 3391
1033 Ga0500639_000004 3300053163 Bacteria 216921
1034 Ga0500636_0000367 3300053177 Bacteria 24765
1035 Ga0500636_0003604 3300053177 Bacteria 8733
1036 Ga0500637_0000106 3300053178 Bacteria 29937
1037 Ga0500645_001373 3300053730 Bacteria 12495
1038 Ga0500645_001822 3300053730 Bacteria 10210
1039 Ga0500596_000144 3300053735 Bacteria 10776
1040 Ga0500596_007152 3300053735 Bacteria 1842
1041 Ga0501084_0016986 3300054114 Bacteria 6047
1042 Ga0501084_0118168 3300054114 Bacteria 2229
1043 Ga0501082_0055942 3300060353 Bacteria 3398
1044 Ga0530510_0202558 3300061734 Bacteria 1474
1045 2501407805 2501025504 Bacteria 8008976
1046 2509153250 2508501128 Bacteria 8613869
1047 2510137779 2510065019 Bacteria 6903379
1048 2510316217 2510065059 Bacteria 6847884
1049 2511097681 2510917014 Bacteria 8296963
1050 2511137257 2510917022 Bacteria 6504556
1051 2511173644 2510917026 Bacteria 7046020
1052 2511183689 2510917028 Bacteria 6185411
1053 2511200207 2510917030 Bacteria 7460662
1054 2511264300 2511231006 Bacteria 6794709
1055 2511288980 2511231010 Bacteria 6373152
1056 2511295893 2511231011 Bacteria 6149768
1057 2511355673 2511231021 Bacteria 7302637
1058 2511371945 2511231023 Bacteria 6808468
1059 2511415384 2511231031 Bacteria 6558529
1060 2512328877 2512047018 Bacteria 6663241
1061 2512929370 2512875016 Bacteria 6529530
1062 2512964167 2512875024 Bacteria 7195110
1063 2513607968 2513237090 Bacteria 7096802
1064 2513659593 2513237096 Bacteria 8722461
1065 2513691643 2513237101 Bacteria 7952346
1066 2513705181 2513237102 Bacteria 7703324
1067 2513712757 2513237103 Bacteria 7647401
1068 2513717626 2513237104 Bacteria 10034502
1069 2513859646 2513237137 Bacteria 9558895
1070 2513871510 2513237138 Bacteria 7368160
1071 2513879375 2513237139 Bacteria 8737671
1072 2513889395 2513237141 Bacteria 8496279
1073 2513921687 2513237145 Bacteria 8979722
1074 2514018973 2513237162 Bacteria 7468464
1075 2514034089 2513237164 Bacteria 7563725
1076 2514418842 2513237305 Bacteria 7293571
1077 2515109362 2515075009 Bacteria 7288508
1078 2517042235 2516653077 Bacteria 7555578
1079 2517099573 2517093000 Bacteria 7412387
1080 2517411774 2517287029 Bacteria 6905599
1081 2517893274 2517572143 Bacteria 9484767
1082 2524439701 2524023205 Bacteria 8918781
1083 2537873452 2537561587 Bacteria 5425293
1084 2554245873 2554235003 Bacteria 5877155
1085 2555667199 2554235341 Bacteria 6867980
1086 2559296361 2558860242 Bacteria 5568029
1087 2583792927 2582580891 Bacteria 6800976
1088 2585222362 2582581298 Bacteria 7315509
1089 2585230307 2582581299 Bacteria 6518058
1090 2585274084 2582581307 Bacteria 6597605
1091 2585280502 2582581308 Bacteria 7413247
1092 2585322774 2582581315 Bacteria 7318924
1093 2585330942 2582581316 Bacteria 7774528
1094 2585390209 2582581865 Bacteria 6644329
1095 2585400762 2582581867 Bacteria 7184437
1096 2585532729 2585427527 Bacteria 7273426
1097 2585539365 2585427528 Bacteria 6842387
1098 2585544686 2585427529 Bacteria 7395659
1099 2585554255 2585427530 Bacteria 7383882
1100 2585560534 2585427531 Bacteria 6992870
1101 2585819677 2585427590 Bacteria 6824633
1102 2585837319 2585427593 Bacteria 7141551
1103 2585898746 2585427608 Bacteria 6544331
1104 2585903683 2585427609 Bacteria 6667127
1105 2586003169 2585427634 Bacteria 6455027
1106 2587981198 2585428125 Bacteria 6662905
1107 2588514939 2588253730 Bacteria 6881675
1108 2597855466 2597489887 Bacteria 6666321
1109 2597864819 2597489888 Bacteria 6179543
1110 2597870674 2597489889 Bacteria 6297495
1111 2599331195 2599185155 Bacteria 5827168
1112 2599356424 2599185160 Bacteria 6844013
1113 2599363549 2599185161 Bacteria 6960462
1114 2599369499 2599185162 Bacteria 6957254
1115 2599376658 2599185163 Bacteria 6995158
1116 2599381529 2599185164 Bacteria 6841688
1117 2599388327 2599185165 Bacteria 6843250
1118 2599395146 2599185166 Bacteria 6959206
1119 2599406911 2599185168 Bacteria 6997636
1120 2599463257 2599185181 Bacteria 6844519
1121 2599469396 2599185182 Bacteria 6883168
1122 2599485351 2599185185 Bacteria 6652270
1123 2599492274 2599185186 Bacteria 6831633
1124 2599507002 2599185189 Bacteria 5862825
1125 2599605587 2599185210 Bacteria 5624189
1126 2599616521 2599185212 Bacteria 6765997
1127 2599626551 2599185214 Bacteria 8209958
1128 2599675615 2599185226 Bacteria 8233575
1129 2599684088 2599185227 Bacteria 8246414
1130 2599696102 2599185229 Bacteria 8216126
1131 2599806496 2599185257 Bacteria 6492581
1132 2599878156 2599185288 Bacteria 6666191
1133 2600038721 2599185318 Bacteria 6961590
1134 2600062604 2599185322 Bacteria 6763055
1135 2600215886 2599185356 Bacteria 6843884
1136 2601689911 2600255296 Bacteria 5784754
1137 2601776053 2600255313 Bacteria 6842543
1138 2601797647 2600255318 Bacteria 6383414
1139 2603859778 2602042107 Bacteria 6226103
1140 2606076871 2603880185 Bacteria 6379190
1141 2606128716 2603880199 Bacteria 6377649
1142 2616554743 2615840698 Bacteria 7319877
1143 2617354038 2617270735 Bacteria 9163226
1144 2617376651 2617270741 Bacteria 8201522
1145 2617383096 2617270742 Bacteria 6808054
1146 2624478023 2623620443 Bacteria 6427864
1147 2643921976 2643221582 Bacteria 5804683
1148 2644003071 2643221599 Bacteria 6292121
1149 2644191935 2643221634 Bacteria 6705461
1150 2644240985 2643221643 Bacteria 5749658
1151 2644498061 2643221689 Bacteria 6042950
1152 2644522837 2643221693 Bacteria 5513853
1153 2644622365 2643221713 Bacteria 6554480
1154 2671100189 2667528171 Bacteria 6900659
1155 2671111980 2667528174 Bacteria 6435400
1156 2671117919 2667528175 Bacteria 7532676
1157 2671772147 2671180172 Bacteria 6495783
1158 2688597819 2687453392 Bacteria 6880454
1159 2694632755 2693429783 Bacteria 7019804
1160 2694639516 2693429784 Bacteria 7241525
1161 2715754289 2713897149 Bacteria 6506249
1162 2723249577 2721755607 Bacteria 5841722
1163 2723577870 2721755686 Bacteria 7343952
1164 2723845937 2721755755 Bacteria 8322773
1165 2725948178 2724679232 Bacteria 7646494
1166 2728754482 2728368998 Bacteria 8720350
1167 2738717968 2738541277 Bacteria 7458140
1168 2738809859 2738541294 Bacteria 6925949
1169 2738879637 2738541307 Bacteria 8606193
1170 2738897219 2738541309 Bacteria 6926455
1171 2739264136 2738543016 Bacteria 5657564
1172 2739278654 2738543019 Bacteria 7459457
1173 2739311084 2738543025 Bacteria 6600348
1174 2743738090 2740892503 Bacteria 6855563
1175 2745082156 2744054633 Bacteria 8678936
1176 2756676296 2756170246 Bacteria 7451806
1177 2774134534 2773857673 Bacteria 6513460
1178 2778175818 2775507266 Bacteria 7392367
1179 2784261257 2784132063 Bacteria 6262788
1180 2792750065 2791355123 Bacteria 8049106
1181 2793069856 2791355197 Bacteria 8420563
1182 2793079741
1183 2793322525 2791355260 Bacteria 6598818
1184 2793359904 2791355266 Bacteria 7116587
1185 2805920273 2802429603 Bacteria 8777136
1186 2808988579 2808606387 Bacteria 5697198
1187 2809217784 2808606445 Bacteria 6057339
1188 2818240357 2816332527 Bacteria 8933356
1189 2819557843 2818991439 Bacteria 6907412
1190 2819609796 2818991448 Bacteria 6772224
1191 2819639898 2818991453 Bacteria 7181617
1192 2819657048 2818991456 Bacteria 6123676
1193 2819682539 2818991461 Bacteria 7026071
1194 2819704995 2818991464 Bacteria 6907494
1195 2819717596 2818991467 Bacteria 5893227
1196 2821444435 2821443989 Bacteria 7658172
1197 2824606589 2824600985 Bacteria 8488197
1198 2824613091 2824609381 Bacteria 8672835
1199 2824624552 2824617872 Bacteria 8814715
1200 2824630701 2824626560 Bacteria 8813858
1201 2824640363 2824635225 Bacteria 8785348
1202 2824647842 2824644064 Bacteria 8743947
1203 2824655812 2824653114 Bacteria 8493680
1204 2824700649 2824696289 Bacteria 8335049
1205 2824718892 2824714736 Bacteria 8717648
1206 2824730568 2824723954 Bacteria 8758240
1207 2824735740 2824732956 Bacteria 7810675
1208 2824751684 2824746037 Bacteria 7911610
1209 2826582538 2826581358 Bacteria 5963467
1210 2831428903 2831426010 Bacteria 8662725
1211 2835313151 2835312727 Bacteria 7413381
1212 2838034019 2838029111 Bacteria 6603031
1213 2838679757 2838675328 Bacteria 4909118
1214 2838717473 2838714209 Bacteria 5525906
1215 2838724326 2838719591 Bacteria 5523910
1216 2838729357 2838724970 Bacteria 4908691
1217 2841762370 2841760612 Bacteria 6454112
1218 2841850784 2841846520 Bacteria 5345850
1219 2841864071 2841859092 Bacteria 5436171
1220 2842129589 2842124991 Bacteria 5346824
1221 2842134734 2842130223 Bacteria 4909145
1222 2842156748 2842152218 Bacteria 4908957
1223 2842173006 2842170452 Bacteria 5525737
1224 2842180366 2842175837 Bacteria 4908771
1225 2842191975 2842187318 Bacteria 5524014
1226 2842216291 2842211629 Bacteria 5523832
1227 2842222843 2842217011 Bacteria 7497767
1228 2842229011 2842224351 Bacteria 5524473
1229 2842326981 2842324504 Bacteria 9364110
1230 2842350586 2842348783 Bacteria 9002918
1231 2842480813 2842475841 Bacteria 6603183
1232 2842483582 2842482326 Bacteria 7212537
1233 2842507376 2842502639 Bacteria 6604161
1234 2842520853 2842515876 Bacteria 5436280
1235 2842778766 2842775625 Bacteria 5587290
1236 2842817612 2842815866 Bacteria 5947510
1237 2842831187 2842826826 Bacteria 5974129
1238 2842842450 2842837860 Bacteria 6066181
1239 2842846543 2842843487 Bacteria 6004777
1240 2842851573 2842849001 Bacteria 5924277
1241 2844004785 2844002411 Bacteria 7168230
1242 2844009684 2844009547 Bacteria 6728125
1243 2844109908 2844104063 Bacteria 6440972
1244 2844667693 2844665904 Bacteria 6817974
1245 2847935077 2847930680 Bacteria 9342022
1246 2847945636 2847939898 Bacteria 8606328
1247 2848697371 2848694841 Bacteria 9205737
1248 2849080186 2849076700 Bacteria 7039503
1249 2849660932 2849660919 Bacteria 8251853
1250 2851186937 2851182111 Bacteria 6047226
1251 2851248383 2851246043 Bacteria 6439203
1252 2852390957 2852387548 Bacteria 8025568
1253 2852661523 2852657418 Bacteria 6472974
1254 2856326250 2856320880 Bacteria 7263508
1255 2856329918 2856328259 Bacteria 6528202
1256 2856337072 2856334872 Bacteria 7037011
1257 2856365217 2856364286 Bacteria 6939991
1258 2857354643 2857349434 Bacteria 7926032
1259 2857371508 2857367948 Bacteria 6965560
1260 2857510430 2857509624 Bacteria 7472071
1261 2857522534 2857516855 Bacteria 7787325
1262 2857530616 2857524615 Bacteria 6615449
1263 2857536804 2857531043 Bacteria 6754041
1264 2857546898 2857542790 Bacteria 5326616
1265 2869237173 2869234852 Bacteria 6654993
1266 2869245227 2869242130 Bacteria 6609239
1267 2869252100 2869249662 Bacteria 6868783
1268 2869260440 2869256925 Bacteria 6981691
1269 2869270615 2869264136 Bacteria 6880765
1270 2869272248 2869271264 Bacteria 6908218
1271 2869284127 2869278585 Bacteria 7077053
1272 2869288685 2869285874 Bacteria 6901219
1273 2871432043 2871429161 Bacteria 6547891
1274 2871443518 2871435913 Bacteria 6880295
1275 2871460389 2871459585 Bacteria 6866887
1276 2871484786 2871481445 Bacteria 6700002
1277 2874115098 2874109183 Bacteria 6517025
1278 2874120645 2874116593 Bacteria 6674494
1279 2874132505 2874131515 Bacteria 6820270
1280 2874144751 2874139085 Bacteria 7021506
1281 2874150684 2874146452 Bacteria 7533118
1282 2874156139 2874155637 Bacteria 6724144
1283 2874163901 2874162495 Bacteria 6174670
1284 2874171232 2874168670 Bacteria 8062617
1285 2874609407 2874604998 Bacteria 7834745
1286 2874651197 2874645413 Bacteria 8214782
1287 2876367072 2876363079 Bacteria 6544991
1288 2876388684 2876386047 Bacteria 6698674
1289 2876401559 2876399893 Bacteria 6927900
1290 2876411095 2876406927 Bacteria 6191900
1291 2876416724 2876413966 Bacteria 6831344
1292 2876426457 2876420981 Bacteria 6687741
1293 2876813208 2876808645 Bacteria 8824342
1294 2878029968 2878029506 Bacteria 6418441
1295 2878743879 2878738818 Bacteria 7136951
1296 2878748707 2878745973 Bacteria 6867388
1297 2878774756 2878774303 Bacteria 6108671
1298 2878781769 2878781027 Bacteria 6834456
1299 2879090806 2879083081 Bacteria 8587928
1300 2879110370 2879110137 Bacteria 8907982
1301 2880230926 2880230671 Bacteria 6140320
1302 2881673075 2881665667 Bacteria 8175609
1303 2883578052 2883577096 Bacteria 4709178
1304 2885328942 2885326080 Bacteria 7134805
1305 2885374868 2885374607 Bacteria 8927485
1306 2886628645 2886627955 Bacteria 7618130
1307 2888383063 2888378607 Bacteria 9652610
1308 2888394765 2888388044 Bacteria 7304136
1309 2888423521 2888419890 Bacteria 7857137
1310 2889013580 2889010040 Bacteria 6749192
1311 2889021702 2889016732 Bacteria 6700763
1312 2889307561 2889306138 Bacteria 6358934
1313 2893070261 2893066018 Bacteria 6158120
1314 2894776557 2894772417 Bacteria 5305674
1315 2899793616 2899792073 Bacteria 4926588
1316 2899848706 2899845264 Bacteria 5672268
1317 2899925008 2899924645 Bacteria 7487985
1318 2903453459 2903448605 Bacteria 7357801
1319 2903503011 2903492973 Bacteria 13473544
1320 2903526563 2903521522 Bacteria 6525694
1321 2903530818 2903528002 Bacteria 6586099
1322 2903755738 2903748898 Bacteria 9972761
1323 2904519386 2904518522 Bacteria 6068986
1324 2904696681 2904690495 Bacteria 9412302
1325 2904704330
1326 2906311118 2906308376 Bacteria 6841989
1327 2906323158 2906321335 Bacteria 6579571
1328 2906369306 2906363423 Bacteria 6856682
1329 2906371725 2906370794 Bacteria 6881062
1330 2906392923 2906386501 Bacteria 5977019
1331 2906399065 2906393657 Bacteria 6790866
1332 2906403596 2906401398 Bacteria 6693206
1333 2906409588 2906408224 Bacteria 6162342
1334 2906617520
1335 2906636177 2906635258 Bacteria 8601019
1336 2906647718 2906643746 Bacteria 8722424
1337 2906667980 2906660503 Bacteria 8595048
1338 2908450639 2908446538 Bacteria 6829095
1339 2908743670 2908739725 Bacteria 8628932
1340 2908761302 2908756301 Bacteria 8864324
1341 2913848143 2913844669 Bacteria 8381711
1342 2913943507 2913939268 Bacteria 8559644
1343 2917070948 2917070673 Bacteria 6868303
1344 2919066344 2919063839 Bacteria 6302690
1345 2919076212 2919073203 Bacteria 6531949
1346 2919102922 2919100787 Bacteria 7710546
1347 2919119225 2919114240 Bacteria 5700270
1348 2919410484 2919408235 Bacteria 6149349
1349 2919454889 2919450847 Bacteria 5631160
1350 2922134655 2922130491 Bacteria 7173936
1351 2922151578 2922151315 Bacteria 6902399
1352 2922178074 2922172374 Bacteria 6167644
1353 2922193513 2922185730 Bacteria 7113964
1354 2922367889 2922361189 Bacteria 7436256
1355 2922395454 2922393267 Bacteria 8285685
1356 2922429197
1357 2923157138 2923153595 Bacteria 6870622
1358 2923558115 2923556063 Bacteria 6793593
1359 2924713991 2924710171 Bacteria 6752351
1360 2924740709 2924733363 Bacteria 7574837
1361 2924744071 2924741084 Bacteria 6661321
1362 2924754662 2924748358 Bacteria 6154725
1363 2924781796 2924776078 Bacteria 7492003
1364 2926759256 2926754445 Bacteria 5964435
1365 2926763307 2926760298 Bacteria 5505990
1366 2928038867 2928037797 Bacteria 7273642
1367 2928045528 2928044640 Bacteria 7271509
1368 2928053144 2928051484 Bacteria 7773759
1369 2928066750 2928064002 Bacteria 7419480
1370 2928071363 2928070936 Bacteria 8062541
1371 2928961953 2928959182 Bacteria 4725774
1372 2929144123 2929138655 Bacteria 5810547
1373 2929193336 2929189879 Bacteria 5930554
1374 2932796320 2932794094 Bacteria 7915132
1375 2932804374 2932801729 Bacteria 7987968
1376 2933011353 2933006813 Bacteria 4912075
1377 2933016534 2933011516 Bacteria 5439334
1378 2935358776 2935353572 Unclassified 6955622
1379 2935634212 2935630451 Bacteria 8169952
1380 2935888785 2935883170 Bacteria 7964738
1381 2937076418 2937071275 Bacteria 6984483
1382 2937818761 2937813078 Bacteria 7783518
1383 2937838504 2937836603 Bacteria 6811263
1384 2937850418 2937848649 Bacteria 6983481
1385 2937865105 2937861824 Bacteria 6660327
1386 2937874487 2937868953 Bacteria 6639878
1387 2937884876 2937877337 Bacteria 7246526
1388 2937978148 2937972304 Bacteria 7532020
1389 2937984610 2937980651 Bacteria 6517427
1390 2938017913 2938014810 Bacteria 6700592
1391 2941511102 2941507105 Bacteria 8166816
1392 2941518486 2941515067 Bacteria 8166720
1393 2941527251 2941523033 Bacteria 8169134
1394 2946031630 2946027586 Bacteria 6049274
1395 2958040516 2958034702 Bacteria 6989922
1396 2958055364 2958041894 Bacteria 13082850
1397 2958092185 2958084443 Bacteria 7312792
1398 2958107159 2958100919 Bacteria 6800575
1399 2958108768 2958108152 Bacteria 6681128
1400 2958128337 2958122699 Bacteria 7280457
1401 2958133082 2958130278 Bacteria 6897202
1402 2958144235 2958137437 Bacteria 6050276
1403 2958161550 2958158011 Bacteria 6058449
1404 2958173269 2958172287 Bacteria 6716688
1405 2958182776 2958179912 Bacteria 6874908
1406 2961080633 2961077736 Bacteria 7079850
1407 2961138369 2961136820 Bacteria 6775228
1408 2961188764 2961183825 Bacteria 6688536
1409 2963649865 2963644680 Bacteria 6530403
1410 2965031107 2965025482 Bacteria 6532201
1411 2965045384 2965040258 Bacteria 6855979
1412 2965053659 2965047637 Bacteria 6623551
1413 2965089892 2965089291 Bacteria 6866420
1414 2965115799 2965110997 Bacteria 6693150
1415 2965123352 2965119406 Bacteria 6956431
1416 2968021858 2968016561 Bacteria 7022047
1417 2968086823 2968083720 Bacteria 7351627
1418 2968118767 2968117919 Bacteria 6536078
1419 2968139851 2968138860 Bacteria 6605449
1420 2970474448 2970469710 Bacteria 6969209
1421 2970491448 2970489779 Bacteria 6517260
1422 2970517746 2970510686 Bacteria 7006402
1423 2970538152 2970532167 Bacteria 6553173
1424 2970554598 2970547951 Bacteria 6931819
1425 2970598739 2970593180 Bacteria 7073582
1426 2970624091 2970619444 Bacteria 6986144
1427 2970631920 2970627176 Bacteria 6680862
1428 2974293533 2974289157 Bacteria 6080362
1429 2977844442 2977843712 Bacteria 6753583
1430 2977854737 2977851361 Bacteria 6694324
1431 2977879290 2977872689 Bacteria 7270173
1432 2977906308 2977898635 Bacteria 6675551
1433 2977909340 2977907340 Bacteria 6577984
1434 2977918174 2977915119 Bacteria 6829656
1435 2977927894 2977922695 Bacteria 6956781
1436 2977937126 2977935797 Bacteria 6252826
1437 2977946422 2977942078 Bacteria 7570577
1438 2977954058 2977950692 Bacteria 6893264
1439 2977958299 2977957713 Bacteria 6877875
1440 2977990746 2977986579 Bacteria 6581278
1441 2979091660 2979089926 Bacteria 5670289
1442 2979097181 2979095461 Bacteria 5669583
1443 2979102884 2979100975 Bacteria 5423623
1444 2979717145 2979710463 Bacteria 6785254
1445 2979765997 2979764755 Bacteria 6610066
1446 2979773074 2979772303 Bacteria 6618277
1447 2979798603 2979793036 Bacteria 6808957
1448 2984509227 2984509177 Bacteria 5274802
1449 2984520075 2984518228 Bacteria 5277463
1450 2984537556 2984537506 Bacteria 5277481
1451 2984604304 2984601300 Bacteria 5455244
1452 2987643245 2987636660 Bacteria 8088555
1453 2987652122 2987645492 Bacteria 6117018
1454 2987652394 2987652177 Bacteria 6969023
1455 2987671272 2987666974 Bacteria 6509233
1456 2987674735 2987673487 Bacteria 6884027
1457 2996312991 2996310559 Bacteria 6357320
1458 2996353857 2996348954 Bacteria 7239054
1459 2996388436 2996386984 Bacteria 6978667
1460 2996892465 2996887358 Bacteria 5795980
1461 3002144307 3002141150 Bacteria 5254435
1462 3004172004 3004167301 Bacteria 8330599
1463 3004198143 3004195979 Bacteria 6776956
1464 3004206792 3004203850 Bacteria 7307914
1465 3004213722 3004211236 Bacteria 7417683
1466 3004223313 3004218560 Bacteria 7421728
1467 3004239716 3004232784 Bacteria 6662140
1468 3004242346 3004239961 Bacteria 6892290
1469 3004254369 3004248173 Bacteria 6563236
1470 3004271531 3004268573 Bacteria 7043476
1471 3004280525 3004275668 Bacteria 7114440
1472 3004338906 3004334049 Bacteria 8449246
1473 3005418684 3005416602 Bacteria 7064308
1474 3005450857 3005445848 Bacteria 6906074
1475 3005455211 3005452660 Bacteria 5889319
1476 3005479367 3005474847 Bacteria 9259049
1477 3005490047 3005483717 Bacteria 7877331
1478 3005713990 3005710791 Bacteria 7622528
1479 3005721439 3005718088 Bacteria 8283608
1480 3007396052 3007395558 Bacteria 6755444
1481 3007397853 3007395558 Bacteria 6755444
1482 3007419786 3007419365 Bacteria 7026924
1483 3007615629 3007614139 Bacteria 6053559
1484 3007624718 3007619802 Bacteria 6411688
1485 3007723414 3007718800 Bacteria 5971527
1486 3007864600 3007861166 Bacteria 6045338
1487 637079119 637000159 Bacteria 7596297
1488 637317599 637000220 Bacteria 7074893
1489 639645782 639633055 Bacteria 7751309
1490 642617685 642555113 Bacteria 8214658
1491 649872361 649633066 Bacteria 6690028
1492 650842754 650716007 Bacteria 5573770
1493 8001849370 8001845381 Bacteria 5804942
1494 8003574644 8003570095 Bacteria 5747666
1495 8004301392 8004300914 Bacteria 6132239
1496 8004369160 8004361976 Bacteria 6858373
1497 8004390764 8004387939 Bacteria 7049250
1498 8004645896 8004640170 Bacteria 6723001
1499 8004697003 8004695233 Bacteria 6731676
1500 8004717342 8004714634 Bacteria 6776161
1501 8005259765 8005258706 Bacteria 6184835
1502 8005318424 8005314921 Bacteria 7072929
1503 8005326992 8005321885 Bacteria 5795980
1504 8005466490 8005460587 Bacteria 7157962
1505 8005488692 8005484373 Bacteria 6297373
1506 8005558710 8005556819 Bacteria 6908598
1507 8005563681 8005563573 Bacteria 7153261
1508 8005645927 8005645114 Bacteria 6950293
1509 8005682395 8005682033 Bacteria 6726518
1510 8006968722 8006964411 Bacteria 8966052
1511 8006990537 8006984368 Bacteria 9651211
1512 8015691320 8015687852 Bacteria 6613826
1513 8016574197 8016566248 Bacteria 8158151
1514 8016593001 8016583857 Bacteria 10421953
1515 8018153860 8018150411 Bacteria 5549903
1516 8018164064 8018163183 Bacteria 7277977
1517 8019557689 8019555841 Bacteria 9642137
1518 8019567609 8019565922 Bacteria 9639779
1519 8046772499 8046767195 Bacteria 7547379
1520 8054289839 8054285046 Bacteria 6919322
1521 8054348639 8054347763 Bacteria 5901107
1522 8054507171 8054503363 Bacteria 6101651
1523 8055774496 8055770955 Bacteria 6827675
1524 8055822099 8055817908 Bacteria 6609162
1525 8056572132 8056569372 Bacteria 5997322
1526 8056684073 8056681323 Bacteria 8472857
1527 8056695773 8056689827 Bacteria 6712655
1528 8057105826 8057101203 Bacteria 5034064
1529 8057535477 8057529695 Bacteria 6306553
1530 8057577042 8057575449 Bacteria 7367519
1531 8057876884 8057874678 Bacteria 7494653
1532 Ga0207655_1001748
1533 JGI25155J39150_1000007
1534 JGI25156J39149_1000050
1535 JGI25156J39149_1000295
1536 JGI25162J39368_1000908
1537 JGI25154J39366_1000035
1538 JGI25157J39369_1000036
1539 JGI25152J39213_1001356
1540 JGI25150J39212_1002705
1541 JGI25159J45721_1004063
1542 JGI25151J46595_10000613
1543 JGI25151J46595_10003952
1544 JGI25151J46595_10039711
1545 JGI25406J46586_10000006
1546 JGI25406J46586_10002914
1547 JGI25165J46597_1000375
1548 JGI25165J46597_1002256
1549 JGI25165J46597_1003958
1550 JGI25153J46596_10005791
1551 JGI25153J46596_10042717
1552 JGI25160J50197_1002431
1553 JGI25160J50197_1007040
1554 JGI25160J50197_1015074
1555 JGI25161J50226_1001494
1556 Ga0055539_1000102
1557 Ga0055533_1000110
1558 Ga0055532_1000138
1559 Ga0055532_1000254
1560 Ga0055525_1000187
1561 Ga0055535_1002320
1562 Ga0055535_1002951
1563 Ga0055542_1000021
1564 Ga0055542_1000463
1565 Ga0055526_1003161
1566 Ga0055537_1000827
1567 Ga0055524_1002061
1568 Ga0055524_1009264
1569 Ga0055536_1000093
1570 Ga0055536_1000216
1571 Ga0055534_1002463
1572 Ga0055528_1001194
1573 Ga0055528_1001347
1574 Ga0055528_1007556
1575 Ga0055530_10000034
1576 Ga0055530_10002982
1577 Ga0055540_1000064
1578 Ga0055540_1000429
1579 Ga0055531_10000039
1580 Ga0055541_1000068
1581 Ga0058692_1002826
1582 Ga0055543_1000909
1583 Ga0065165_1000393
1584 Ga0065165_1005554
1585 Ga0065714_10011017
1586 Ga0065704_10081044
1587 Ga0065712_10000260
1588 Ga0070658_10197786
1589 Ga0070658_10198021
1590 Ga0070683_100056257
1591 Ga0070683_100071169
1592 Ga0070670_100000359
1593 Ga0070680_100074218
1594 Ga0070682_100077440
1595 Ga0070668_100000734
1596 Ga0070668_100006327
1597 Ga0070668_100019325
1598 Ga0070668_100048293
1599 Ga0070668_100093749
1600 Ga0070669_100003483
1601 Ga0070669_100032753
1602 Ga0070669_100120838
1603 Ga0070674_100144345
1604 Ga0070667_100001509
1605 Ga0070667_100003665
1606 Ga0070709_10004497
1607 Ga0070709_10026694
1608 Ga0070714_100004196
1609 Ga0070714_100091486
1610 Ga0070713_100009387
1611 Ga0070713_100067291
1612 Ga0070713_100086405
1613 Ga0070713_100091636
1614 Ga0070713_100117112
1615 Ga0070710_10004116
1616 Ga0070711_100004725
1617 Ga0070711_100055615
1618 Ga0070711_100064628
1619 Ga0070678_100016493
1620 Ga0070681_10044250
1621 Ga0070706_100170110
1622 Ga0070698_100000351
1623 Ga0070679_100016753
1624 Ga0070684_100158321
1625 Ga0070697_100047675
1626 Ga0070697_100052582
1627 Ga0068853_100055368
1628 Ga0068853_100061917
1629 Ga0068853_100118484
1630 Ga0070665_100001296
1631 Ga0070665_100011759
1632 Ga0070665_100023461
1633 Ga0070665_100056340
1634 Ga0068855_100048315
1635 Ga0070664_100041024
1636 Ga0068854_100044261
1637 Ga0068856_100000427
1638 Ga0068856_100124864
1639 Ga0068856_100145970
1640 Ga0068852_100215524
1641 Ga0068859_100002889
1642 Ga0068859_100197269
1643 Ga0068851_10029404
1644 Ga0068851_10035695
1645 Ga0068863_100245583
1646 Ga0068860_100000265
1647 Ga0068860_100294113
1648 Ga0068862_100070026
1649 Ga0068862_100258304
1650 Ga0081455_10000058
1651 Ga0081455_10000366
1652 Ga0081455_10000764
1653 Ga0081455_10001795
1654 Ga0081538_10005836
1655 Ga0081538_10026519
1656 Ga0081540_1000040
1657 Ga0081540_1000916
1658 Ga0081540_1001739
1659 Ga0081540_1002782
1660 Ga0081540_1013100
1661 Ga0081540_1021438
1662 Ga0081540_1049839
1663 Ga0081539_10000176
1664 Ga0081539_10000231
1665 Ga0081539_10009227
1666 Ga0081539_10062309
1667 Ga0070717_10076107
1668 Ga0075365_10002455
1669 Ga0075365_10002499
1670 Ga0075365_10025473
1671 Ga0075368_10002158
1672 Ga0075363_100002264
1673 Ga0070716_100005587
1674 Ga0070716_100078614
1675 Ga0070712_100028636
1676 Ga0070712_100066082
1677 Ga0075367_10026312
1678 Ga0075366_10008450
1679 Ga0075370_10098471
1680 Ga0068871_100219901
1681 Ga0075430_100155975
1682 Ga0075431_100001187
1683 Ga0075433_10001198
1684 Ga0075433_10212747
1685 Ga0075434_100005705
1686 Ga0097620_100002889
1687 Ga0097620_100197255
1688 Ga0099824_1006719
1689 Ga0099822_1001392
1690 Ga0099826_10007333
1691 Ga0075435_100096255
1692 Ga0099794_10048101
1693 Ga0105251_10000274
1694 Ga0105251_10001467
1695 Ga0105244_10000607
1696 Ga0105244_10013667
1697 Ga0105244_10023885
1698 Ga0105244_10034350
1699 Ga0105244_10047892
1700 Ga0105250_10000078
1701 Ga0105250_10000191
1702 Ga0105250_10001522
1703 Ga0105250_10030412
1704 Ga0105240_10000019
1705 Ga0105240_10067903
1706 Ga0105240_10086641
1707 Ga0105240_10142232
1708 Ga0111539_10004293
1709 Ga0111539_10026576
1710 Ga0105245_10069337
1711 Ga0114129_10033150
1712 Ga0105243_10003033
1713 Ga0105243_10004474
1714 Ga0105243_10017593
1715 Ga0105243_10024978
1716 Ga0105241_10074952
1717 Ga0105241_10144679
1718 Ga0105241_10230665
1719 Ga0105237_10001204
1720 Ga0105237_10002159
1721 Ga0105237_10006864
1722 Ga0105237_10026637
1723 Ga0105237_10216874
1724 Ga0105238_10007002
1725 Ga0105238_10018527
1726 Ga0105249_10295590
1727 Ga0105249_10315408
1728 Ga0123342_1026161
1729 Ga0105239_10001427
1730 Ga0105239_10002299
1731 Ga0105239_10064579
1732 Ga0105239_10091118
1733 Ga0105239_10098729
1734 Ga0105246_10001379
1735 Ga0105246_10009601
1736 Ga0157345_1000006
1737 Ga0157373_10020395
1738 Ga0157373_10109812
1739 Ga0157371_10000042
1740 Ga0157371_10004709
1741 Ga0157371_10083815
1742 Ga0157370_10000035
1743 Ga0157370_10000131
1744 Ga0157370_10069515
1745 Ga0157370_10094735
1746 Ga0157370_10126123
1747 Ga0157370_10227157
1748 Ga0157369_10005587
1749 Ga0157369_10006177
1750 Ga0157369_10009585
1751 Ga0157369_10010643
1752 Ga0157369_10067587
1753 Ga0157369_10101511
1754 Ga0157369_10115729
1755 Ga0157369_10142127
1756 Ga0157374_10033704
1757 Ga0157374_10037116
1758 Ga0157374_10072122
1759 Ga0157378_10009614
1760 Ga0163162_10000199
1761 Ga0157372_10005780
1762 Ga0157375_10000820
1763 Ga0157375_10019193
1764 Ga0157375_10296274
1765 Ga0163163_10092729
1766 Ga0182008_10002472
1767 Ga0182008_10037101
1768 Ga0157376_10137365
1769 Ga0182006_1001883
1770 Ga0182006_1003283
1771 Ga0183362_10008
1772 Ga0163161_10000139
1773 Ga0163161_10006288
1774 Ga0163161_10038439
1775 Ga0213872_10007327
1776 Ga0213872_10023178
1777 Ga0213876_10038944
1778 Ga0213871_10000078
1779 Ga0209435_100005
1780 Ga0209435_100373
1781 Ga0209436_108537
1782 Ga0209784_100057
1783 Ga0209566_100073
1784 Ga0209674_100095
1785 Ga0209672_100295
1786 Ga0209147_100021
1787 Ga0209147_100092
1788 Ga0209563_100093
1789 Ga0209563_101932
1790 Ga0209437_100058
1791 Ga0209437_100060
1792 Ga0209258_100058
1793 Ga0209258_100300
1794 Ga0207425_1000157
1795 Ga0209646_1000011
1796 Ga0209646_1000617
1797 Ga0209646_1007185
1798 Ga0209026_1000005
1799 Ga0209026_1000008
1800 Ga0209026_1002172
1801 Ga0209677_100054
1802 Ga0209677_101475
1803 Ga0209148_1000057
1804 Ga0209148_1000071
1805 Ga0209759_1000004
1806 Ga0209759_1000082
1807 Ga0209759_1000265
1808 Ga0209759_1010198
1809 Ga0209129_1000483
1810 Ga0209129_1002306
1811 Ga0209233_1000240
1812 Ga0209233_1000275
1813 Ga0209233_1000814
1814 Ga0209233_1004380
1815 Ga0209565_1000038
1816 Ga0209455_1000205
1817 Ga0209455_1003651
1818 Ga0209673_1000362
1819 Ga0209673_1001694
1820 Ga0209673_1012725
1821 Ga0209130_1000061
1822 Ga0209130_1000664
1823 Ga0209130_1001275
1824 Ga0209675_1000102
1825 Ga0209675_1002094
1826 Ga0209676_1000025
1827 Ga0209676_1000032
1828 Ga0209676_1000404
1829 Ga0209676_1003421
1830 Ga0209025_1000056
1831 Ga0209025_1000486
1832 Ga0209025_1002869
1833 Ga0209025_1011019
1834 Ga0209025_1041756
1835 Ga0209564_1000542
1836 Ga0209564_1004853
1837 Ga0209758_1000044
1838 Ga0209758_1001732
1839 Ga0209758_1001986
1840 Ga0209758_1002282
1841 Ga0209758_1003333
1842 Ga0209758_1003786
1843 Ga0209758_1023382
1844 Ga0209050_1000025
1845 Ga0209050_1000099
1846 Ga0209256_1000020
1847 Ga0209256_1001947
1848 Ga0207426_1000001
1849 Ga0207426_1000451
1850 Ga0207426_1002786
1851 Ga0209051_1000026
1852 Ga0209051_1000039
1853 Ga0209051_1000047
1854 Ga0209051_1003798
1855 Ga0209051_1011280
1856 Ga0209257_1000034
1857 Ga0209257_1001689
1858 Ga0207656_10005610
1859 Ga0207696_1000071
1860 Ga0207696_1000078
1861 Ga0207696_1000212
1862 Ga0207696_1000961
1863 Ga0207696_1021437
1864 Ga0207655_1000014
1865 Ga0207655_1000441
1866 Ga0207655_1001362
1867 Ga0207655_1006386
1868 Ga0207655_1014596
1869 Ga0207713_1000010
1870 Ga0207713_1001597
1871 Ga0207713_1003526
1872 Ga0207713_1006493
1873 Ga0207713_1011892
1874 Ga0207713_1014554
1875 Ga0207692_10001246
1876 Ga0207699_10000763
1877 Ga0207699_10062447
1878 Ga0207645_10043988
1879 Ga0207705_10163338
1880 Ga0207684_10114167
1881 Ga0207654_10086047
1882 Ga0207707_10029007
1883 Ga0207707_10056027
1884 Ga0207707_10080667
1885 Ga0207695_10000049
1886 Ga0207695_10003498
1887 Ga0207695_10043878
1888 Ga0207695_10096753
1889 Ga0207695_10198549
1890 Ga0207671_10001771
1891 Ga0207671_10009517
1892 Ga0207671_10020040
1893 Ga0207671_10040867
1894 Ga0207671_10050623
1895 Ga0207671_10082481
1896 Ga0207693_10081334
1897 Ga0207663_10042162
1898 Ga0207663_10111722
1899 Ga0207663_10135336
1900 Ga0207660_10003538
1901 Ga0207660_10154060
1902 Ga0207657_10085467
1903 Ga0207652_10010392
1904 Ga0207652_10057070
1905 Ga0207681_10001048
1906 Ga0207681_10001413
1907 Ga0207681_10060130
1908 Ga0207694_10004900
1909 Ga0207694_10069419
1910 Ga0207650_10000295
1911 Ga0207650_10002333
1912 Ga0207700_10032960
1913 Ga0207700_10053019
1914 Ga0207700_10064987
1915 Ga0207664_10019001
1916 Ga0207664_10097018
1917 Ga0207644_10218694
1918 Ga0207706_10153171
1919 Ga0207709_10000040
1920 Ga0207709_10019621
1921 Ga0207665_10002269
1922 Ga0207665_10119013
1923 Ga0207711_10084540
1924 Ga0207711_10149314
1925 Ga0207689_10046690
1926 Ga0207661_10034196
1927 Ga0207667_10046644
1928 Ga0207667_10161664
1929 Ga0207712_10184219
1930 Ga0207668_10000033
1931 Ga0207668_10012379
1932 Ga0207668_10042899
1933 Ga0207640_10030435
1934 Ga0207640_10107267
1935 Ga0207640_10138929
1936 Ga0207658_10001268
1937 Ga0207658_10004077
1938 Ga0207703_10260727
1939 Ga0207639_10007940
1940 Ga0207639_10075984
1941 Ga0207639_10088242
1942 Ga0207702_10002818
1943 Ga0207702_10006542
1944 Ga0207702_10043495
1945 Ga0207702_10083796
1946 Ga0207702_10170448
1947 Ga0207641_10115717
1948 Ga0207674_10092290
1949 Ga0207683_10044288
1950 Ga0207683_10158234
1951 Ga0209389_1000068
1952 Ga0209371_1000003
1953 Ga0209371_1003295
1954 Ga0209371_1004989
1955 Ga0209589_1000023
1956 Ga0209489_100032
1957 Ga0209489_113471
1958 Ga0209700_100040
1959 Ga0209700_100117
1960 Ga0209282_1013642
1961 Ga0207428_10039670
1962 Ga0268266_10004462
1963 Ga0268266_10007442
1964 Ga0268266_10014083
1965 Ga0268266_10034015
1966 Ga0268266_10056761
1967 Ga0268266_10104048
1968 Ga0268266_10166119
1969 Ga0268266_10192613
1970 Ga0268264_10000318
1971 Ga0265334_10012389
1972 Ga0265334_10017805
1973 Ga0265318_10006964
1974 Ga0307515_10082124
1975 Ga0268256_1000004
1976 Ga0268256_1002990
1977 Ga0307511_10086694
1978 Ga0316181_1206187
1979 Ga0316182_1118994
1980 Ga0265340_10004049
1981 Ga0265340_10059627
1982 Ga0265327_10002922
1983 Ga0307509_10147409
1984 Ga0307508_10000010
1985 Ga0265314_10047018
1986 Ga0307416_100284656
1987 Ga0307411_10006188
1988 Ga0307507_10063344
1989 Ga0307510_10000085
1990 Ga0307510_10007185
1991 Ga0315911_1000029
1992 Ga0373934_0006326
1993 Ga0373934_0028433
1994 Ga0373940_0014749
1995 Ga0373949_0014712
1996 Ga0373936_0000012
1997 Ga0373936_0000048
1998 Ga0373936_0052766
1999 Ga0373953_0000640
2000 Ga0373953_0011634
2001 Ga0373954_0000067
2002 Ga0373956_0002213
2003 Ga0373956_0012978
2004 Ga0373957_0001550
2005 Ga0373955_0003543
2006 Ga0373955_0009025
2007 Ga0373962_0001722
2008 Ga0373924_0000928
2009 Ga0373924_0006108
2010 Ga0373931_0003739
2011 Ga0373931_0023668
2012 Ga0373931_0064578
2013 Ga0373935_0093265
2014 Ga0373935_0107883
2015 Ga0373935_0141194
2016 Ga0373927_0017434
2017 Ga0373927_0162396
2018 Ga0373933_0000324
2019 Ga0373933_0000746
2020 Ga0373933_0006219
2021 Ga0373933_0022874
2022 Ga0373947_0011851
2023 Ga0373947_0015707
2024 Ga0373937_0000413
2025 Ga0373937_0001425
2026 Ga0373937_0001548
2027 Ga0373937_0023468
2028 Ga0373937_0025703
2029 Ga0373925_0013237
2030 Ga0373925_0063685
2031 Ga0373925_0086422
2032 Ga0395899_0003559
2033 Ga0395899_0030722
2034 Ga0395900_0001064
2035 Ga0395900_0025676
2036 Ga0395900_0028557
2037 Ga0395900_0087840
2038 Ga0395900_0126534
2039 Ga0395900_0130163
2040 Ga0395900_0291392
2041 Ga0395898_0128102
2042 Ga0395898_0151633
2043 Ga0395905_0035462
2044 Ga0395905_0171592
2045 Ga0436364_0867524
2046 Ga0395901_0029508
2047 Ga0395901_0035567
2048 Ga0395901_0060827
2049 Ga0395901_0256413
2050 Ga0237819_02648
2051 Ga0436365_0871323
2052 Ga0436365_1607850
2053 Ga0436360_1295423
2054 Ga0436361_0144287
2055 Ga0436361_0183072
2056 Ga0436361_0256362
2057 Ga0436361_0294136
2058 Ga0436361_0488499
2059 Ga0436361_0983753
2060 Ga0436361_1199195
2061 Ga0436363_1134489
2062 Ga0436363_1329538
2063 Ga0439465_0020010
2064 Ga0451793_1407387
2065 Ga0451797_0747061
2066 Ga0451807_0031918
2067 Ga0439451_007601
2068 Ga0439463_000088
2069 Ga0450911_000132
2070 Ga0450904_001603
2071 Ga0466972_0000076
2072 Ga0466966_0014368
2073 Ga0466961_0000600
2074 Ga0466963_0066091
2075 Ga0466970_0010203
2076 Ga0466960_0006169
2077 Ga0466959_0000651
2078 Ga0466959_0003113
2079 Ga0466958_0050355
2080 Ga0495627_000962
2081 Ga0495627_001135
2082 Ga0495627_003213
2083 Ga0495592_0000629
2084 Ga0495592_0001030
2085 Ga0495603_0059365
2086 Ga0495591_001034
2087 Ga0495591_001961
2088 Ga0495591_003002
2089 Ga0495591_006316
2090 Ga0495591_025435
2091 Ga0495629_0000398
2092 Ga0495629_0000948
2093 Ga0495638_0000120
2094 Ga0495638_0000830
2095 Ga0495638_0007158
2096 Ga0495638_0010795
2097 Ga0495651_0000319
2098 Ga0495651_0004166
2099 Ga0495653_0000391
2100 Ga0495653_0000598
2101 Ga0495653_0002549
2102 Ga0495650_0020937
2103 Ga0495650_0059865
2104 Ga0495580_0007113
2105 Ga0495582_0094401
2106 Ga0495582_0116066
2107 Ga0495605_0000158
2108 Ga0495605_0000164
2109 Ga0495605_0000220
2110 Ga0495605_0009203
2111 Ga0495605_0043870
2112 Ga0495605_0061269
2113 Ga0495664_0000849
2114 Ga0495584_0057027
2115 Ga0495585_0033962
2116 Ga0495585_0054980
2117 Ga0495585_0104414
2118 Ga0495596_0011116
2119 Ga0495607_0000013
2120 Ga0495607_0000032
2121 Ga0495607_0000082
2122 Ga0495607_0002081
2123 Ga0495607_0003493
2124 Ga0495607_0007523
2125 Ga0495607_0053320
2126 Ga0495607_0077763
2127 Ga0495607_0084209
2128 Ga0495583_0000086
2129 Ga0495583_0000226
2130 Ga0495583_0009346
2131 Ga0495606_0000061
2132 Ga0495606_0003058
2133 Ga0495606_0004653
2134 Ga0495606_0005451
2135 Ga0495606_0088820
2136 Ga0495606_0117021
2137 Ga0495606_0133929
2138 Ga0495608_0000916
2139 Ga0495608_0002252
2140 Ga0495608_0003379
2141 Ga0495608_0071490
2142 Ga0495610_0000138
2143 Ga0495610_0005026
2144 Ga0495610_0008977
2145 Ga0495610_0016998
2146 Ga0495616_0003497
2147 Ga0495616_0003740
2148 Ga0495616_0003971
2149 Ga0495616_0038331
2150 Ga0495616_0081280
2151 Ga0495616_0084874
2152 Ga0495620_0000047
2153 Ga0495620_0001699
2154 Ga0495620_0014504
2155 Ga0495628_0017882
2156 Ga0495628_0030305
2157 Ga0495630_0025184
2158 Ga0495631_0019496
2159 Ga0495632_0000719
2160 Ga0495632_0011234
2161 Ga0495632_0034577
2162 Ga0495632_0060532
2163 Ga0495637_0002352
2164 Ga0495637_0010199
2165 Ga0495637_0011909
2166 Ga0495637_0042753
2167 Ga0495643_0008772
2168 Ga0495643_0044851
2169 Ga0495643_0065956
2170 Ga0495648_0000552
2171 Ga0495648_0001770
2172 Ga0495648_0003462
2173 Ga0495648_0005888
2174 Ga0495648_0036428
2175 Ga0495648_0049091
2176 Ga0495666_0064554
2177 Ga0495652_0001170
2178 Ga0495652_0009435
2179 Ga0495654_0000117
2180 Ga0495654_0000224
2181 Ga0495654_0000732
2182 Ga0495654_0001955
2183 Ga0495654_0003210
2184 Ga0495654_0019243
2185 Ga0495665_0088474
2186 Ga0495640_0035357
2187 Ga0495640_0103047
2188 Ga0495587_0001521
2189 Ga0495587_0008765
2190 Ga0495587_0018340
2191 Ga0495609_0000156
2192 Ga0495609_0006521
2193 Ga0495609_0037939
2194 Ga0495597_0000013
2195 Ga0495597_0002855
2196 Ga0495597_0033929
2197 Ga0495645_0013413
2198 Ga0495645_0090314
2199 Ga0495645_0112991
2200 Ga0495622_0001594
2201 Ga0495633_0000453
2202 Ga0495633_0023805
2203 Ga0495633_0030237
2204 Ga0495633_0052648
2205 Ga0495667_0000305
2206 Ga0495667_0002351
2207 Ga0495667_0013747
2208 Ga0495667_0043230
2209 Ga0495656_0005918
2210 Ga0495668_0001200
2211 Ga0495668_0031490
2212 Ga0495668_0057348
2213 Ga0495634_0001959
2214 Ga0495634_0003266
2215 Ga0495634_0084101
2216 Ga0495611_0000339
2217 Ga0495625_0004731
2218 Ga0495625_0005554
2219 Ga0495625_0006484
2220 Ga0495625_0032089
2221 Ga0495625_0066117
2222 Ga0495635_0000102
2223 Ga0495635_0003651
2224 Ga0495635_0069033
2225 Ga0495661_0000007
2226 Ga0495661_0000154
2227 Ga0495661_0000172
2228 Ga0495661_0011508
2229 Ga0495661_0012271
2230 Ga0495661_0036529
2231 Ga0495588_0012716
2232 Ga0495657_0000677
2233 Ga0495657_0011228
2234 Ga0495599_0001494
2235 Ga0495599_0001882
2236 Ga0495599_0021326
2237 Ga0495623_0005677
2238 Ga0495646_0005928
2239 Ga0495646_0007052
2240 Ga0495646_0067017
2241 Ga0495647_0026488
2242 Ga0495613_0046524
2243 Ga0495613_0183622
2244 Ga0495624_0002316
2245 Ga0495624_0053891
2246 Ga0495670_0002847
2247 Ga0495670_0009646
2248 Ga0495671_0029777
2249 Ga0495671_0086739
2250 Ga0495649_0000685
2251 Ga0495649_0008434
2252 Ga0495649_0021189
2253 Ga0495649_0048237
2254 Ga0495649_0066095
2255 Ga0495649_0069243
2256 Ga0495589_0010970
2257 Ga0495589_0015004
2258 Ga0495589_0053544
2259 Ga0495589_0054925
2260 Ga0495660_0000333
2261 Ga0495660_0003395
2262 Ga0495660_0015649
2263 Ga0495660_0036141
2264 Ga0495660_0056579
2265 Ga0495660_0065580
2266 Ga0495581_0026545
2267 Ga0495604_0000580
2268 Ga0495604_0001099
2269 Ga0495604_0063570
2270 Ga0495674_0001292
2271 Ga0495674_0013937
2272 Ga0495674_0071933
2273 Ga0495674_0257629
2274 Ga0495672_0004828
2275 Ga0495672_0029603
2276 Ga0495672_0036625
2277 Ga0495672_0041227
2278 Ga0495672_0077600
2279 Ga0495680_0000636
2280 Ga0495680_0018405
2281 Ga0495680_0156163
2282 Ga0495683_0000099
2283 Ga0495683_0000113
2284 Ga0495687_000572
2285 Ga0495687_035975
2286 Ga0495687_052619
2287 Ga0495675_0007147
2288 Ga0495675_0024914
2289 Ga0495679_000549
2290 Ga0495679_007354
2291 Ga0495679_023488
2292 Ga0495679_028495
2293 Ga0495673_0003314
2294 Ga0495673_0003583
2295 Ga0495673_0020162
2296 Ga0495673_0052489
2297 Ga0495673_0074076
2298 Ga0495681_0002645
2299 Ga0495681_0002739
2300 Ga0495681_0003661
2301 Ga0495681_0004812
2302 Ga0495681_0037021
2303 Ga0495681_0056181
2304 Ga0495684_0000088
2305 Ga0495684_0112571
2306 Ga0495684_0220346
2307 Ga0495686_0001608
2308 Ga0495686_0004287
2309 Ga0495686_0014472
2310 Ga0495686_0015085
2311 Ga0495686_0039136
2312 Ga0495593_0009454
2313 Ga0495602_0000162
2314 Ga0495602_0004623
2315 Ga0495602_0006564
2316 Ga0495602_0028311
2317 Ga0495626_0000162
2318 Ga0495626_0004818
2319 Ga0496100_0010556
2320 Ga0496100_0018696
2321 Ga0496101_0008338
2322 Ga0496101_0011098
2323 Ga0496101_0117825
2324 Ga0496102_0000613
2325 Ga0496102_0002326
2326 Ga0496103_0002825
2327 Ga0496103_0008910
2328 Ga0496103_0090578
2329 Ga0496104_0002277
2330 Ga0496104_0005539
2331 Ga0496104_0036850
2332 Ga0496104_0038908
2333 Ga0496104_0096350
2334 Ga0496105_0001309
2335 Ga0496105_0055730
2336 Ga0496106_0001425
2337 Ga0496107_0003742
2338 Ga0496107_0014938
2339 Ga0496108_0029179
2340 Ga0496108_0139543
2341 Ga0496110_0041157
2342 Ga0496110_0142856
2343 Ga0496110_0294871
2344 Ga0496111_0098314
2345 Ga0496112_0016228
2346 Ga0496112_0105054
2347 Ga0496112_0215061
2348 Ga0496113_0000100
2349 Ga0496113_0179574
2350 Ga0496114_0081585
2351 Ga0496114_0120405
2352 Ga0496115_0003736
2353 Ga0496115_0068101
2354 Ga0496115_0070947
2355 Ga0496116_0000042
2356 Ga0496116_0002293
2357 Ga0496117_0000036
2358 Ga0496117_0000218
2359 Ga0496117_0001162
2360 Ga0496117_0017563
2361 Ga0496117_0022908
2362 Ga0496117_0032539
2363 Ga0496117_0043984
2364 Ga0496117_0070470
2365 Ga0496117_0086916
2366 Ga0496117_0098792
2367 Ga0496118_0000729
2368 Ga0496118_0002112
2369 Ga0496118_0017938
2370 Ga0496118_0037856
2371 Ga0496118_0038443
2372 Ga0496118_0044009
2373 Ga0496118_0093332
2374 Ga0496119_0002625
2375 Ga0496119_0003738
2376 Ga0496119_0005237
2377 Ga0496119_0012527
2378 Ga0496119_0032141
2379 Ga0496119_0047055
2380 Ga0496120_0000036
2381 Ga0496120_0003787
2382 Ga0496120_0003789
2383 Ga0496120_0004614
2384 Ga0496120_0004974
2385 Ga0496120_0072515
2386 Ga0496121_0000033
2387 Ga0496121_0000077
2388 Ga0496121_0000570
2389 Ga0496121_0000664
2390 Ga0496121_0006454
2391 Ga0496121_0009406
2392 Ga0496121_0016116
2393 Ga0496121_0019411
2394 Ga0496121_0023336
2395 Ga0496121_0052814
2396 Ga0496121_0057807
2397 Ga0496121_0087611
2398 Ga0496122_0000002
2399 Ga0496122_0000428
2400 Ga0496122_0000996
2401 Ga0496122_0006539
2402 Ga0496122_0021606
2403 Ga0496122_0028116
2404 Ga0496122_0066047
2405 Ga0496122_0084221
2406 Ga0496122_0138454
2407 Ga0496123_0000002
2408 Ga0496123_0000337
2409 Ga0496123_0001068
2410 Ga0496123_0004528
2411 Ga0496123_0005027
2412 Ga0496123_0011126
2413 Ga0496123_0041597
2414 Ga0496123_0046469
2415 Ga0496123_0050340
2416 Ga0496124_0000259
2417 Ga0496124_0000812
2418 Ga0496124_0001166
2419 Ga0496124_0001679
2420 Ga0496124_0002048
2421 Ga0496124_0005729
2422 Ga0496124_0016064
2423 Ga0496124_0021308
2424 Ga0496124_0029306
2425 Ga0496124_0051980
2426 Ga0496124_0081579
2427 Ga0496125_0000235
2428 Ga0496125_0000681
2429 Ga0496125_0000760
2430 Ga0496125_0006813
2431 Ga0496125_0039434
2432 Ga0496125_0050297
2433 Ga0496125_0066080
2434 Ga0496125_0127718
2435 Ga0496126_0001647
2436 Ga0496126_0002030
2437 Ga0496126_0004349
2438 Ga0496126_0010785
2439 Ga0496126_0012038
2440 Ga0496126_0016102
2441 Ga0496126_0039056
2442 Ga0496126_0040697
2443 Ga0496126_0057675
2444 Ga0496126_0103810
2445 Ga0496126_0127421
2446 Ga0496126_0213249
2447 Ga0495678_000124
2448 Ga0495678_026948
2449 Ga0495678_043782
2450 Ga0501031_0000620
2451 Ga0501032_0003195
2452 Ga0501033_0000241
2453 Ga0501033_0026589
2454 Ga0501033_0049249
2455 Ga0501034_0000021
2456 Ga0501034_0000109
2457 Ga0501034_0001751
2458 Ga0501034_0091961
2459 Ga0501036_0000055
2460 Ga0501037_0000398
2461 Ga0501038_0001235
2462 Ga0501039_0000293
2463 Ga0501043_0000033
2464 Ga0501046_0000452
2465 Ga0501046_0158687
2466 Ga0501047_0000574
2467 Ga0501048_0000261
2468 Ga0501067_0000045
2469 Ga0501067_0120805
2470 Ga0501068_0003740
2471 Ga0501068_0019486
2472 Ga0501069_0003820
2473 Ga0501070_0002498
2474 Ga0501070_0006242
2475 Ga0501070_0053039
2476 Ga0501071_0017446
2477 Ga0501072_0010633
2478 Ga0501073_0010956
2479 Ga0501073_0023935
2480 Ga0501073_0034888
2481 Ga0501074_0003795
2482 Ga0501074_0015583
2483 Ga0501077_0023333
2484 Ga0501077_0030316
2485 Ga0501080_0004826
2486 Ga0501081_0034632
2487 Ga0501083_0000182
2488 Ga0501035_0000241
2489 Ga0501035_0111993
2490 Ga0501044_0000640
2491 Ga0501044_0034874
2492 Ga0501045_0088025
2493 nmdc:mga03683_718_c1
2494 nmdc:mga03n38_2026_c1
2495 nmdc:mga00v17_19_c1
2496 nmdc:mga00v17_2987_c1
2497 nmdc:mga0yw44_386_c1
2498 nmdc:mga0yw44_575_c1
2499 nmdc:mga09592_38638_c1
2500 nmdc:mga0qj67_106915_c1
2501 nmdc:mga08y16_13395_c1
2502 nmdc:mga08y16_46635_c1
2503 nmdc:mga08y16_83612_c1
2504 nmdc:mga0n895_1221_c1
2505 nmdc:mga0sz30_8616_c1
2506 Ga0495601_0002864
2507 Ga0495601_0012935
2508 Ga0495601_0020150
2509 Ga0495601_0098530
2510 Ga0495612_0004607
2511 Ga0495612_0016518
2512 Ga0500610_0004055
2513 Ga0495595_0000112
2514 Ga0495595_0003426
2515 Ga0495619_0000166
2516 Ga0495619_0001541
2517 Ga0495619_0027730
2518 Ga0495619_0027922
2519 Ga0500578_0100810
2520 Ga0500643_000362
2521 Ga0500643_043512
2522 Ga0500566_0002077
2523 Ga0500641_0054968
2524 Ga0500555_003622
2525 Ga0500556_0000030
2526 Ga0500556_0001124
2527 Ga0500557_000223
2528 Ga0500560_000050
2529 Ga0500560_001099
2530 Ga0500572_000055
2531 Ga0500572_001371
2532 Ga0500572_001447
2533 Ga0500572_020641
2534 Ga0500591_051586
2535 Ga0500595_008373
2536 Ga0500595_011111
2537 Ga0500595_015948
2538 Ga0500595_024033
2539 Ga0500595_035614
2540 Ga0500608_015526
2541 Ga0500618_006987
2542 Ga0500658_0072713
2543 Ga0500559_0000678
2544 Ga0500559_0000870
2545 Ga0500559_0001368
2546 Ga0500559_0003497
2547 Ga0500559_0029135
2548 Ga0500568_0000323
2549 Ga0500568_0000361
2550 Ga0500573_0014832
2551 Ga0500573_0021953
2552 Ga0500573_0074730
2553 Ga0500603_001487
2554 Ga0500604_0028580
2555 Ga0500616_0009600
2556 Ga0500622_0015058
2557 Ga0500624_000424
2558 Ga0500624_002884
2559 Ga0500627_0000105
2560 Ga0500627_0008706
2561 Ga0500630_032865
2562 Ga0500634_0006837
2563 Ga0500634_0022929
2564 Ga0500639_000004
2565 Ga0500636_0000367
2566 Ga0500636_0003604
2567 Ga0500637_0000106
2568 Ga0500645_001373
2569 Ga0500645_001822
2570 Ga0500596_000144
2571 Ga0500596_007152
2572 Ga0501084_0016986
2573 Ga0501084_0118168
2574 Ga0501082_0055942
2575 Ga0530510_0202558
2576 2501407805
2577 2509153250
2578 2510137779
2579 2510316217
2580 2511097681
2581 2511137257
2582 2511173644
2583 2511183689
2584 2511200207
2585 2511264300
2586 2511288980
2587 2511295893
2588 2511355673
2589 2511371945
2590 2511415384
2591 2512328877
2592 2512929370
2593 2512964167
2594 2513607968
2595 2513659593
2596 2513691643
2597 2513705181
2598 2513712757
2599 2513717626
2600 2513859646
2601 2513871510
2602 2513879375
2603 2513889395
2604 2513921687
2605 2514018973
2606 2514034089
2607 2514418842
2608 2515109362
2609 2517042235
2610 2517099573
2611 2517411774
2612 2517893274
2613 2524439701
2614 2537873452
2615 2554245873
2616 2555667199
2617 2559296361
2618 2583792927
2619 2585222362
2620 2585230307
2621 2585274084
2622 2585280502
2623 2585322774
2624 2585330942
2625 2585390209
2626 2585400762
2627 2585532729
2628 2585539365
2629 2585544686
2630 2585554255
2631 2585560534
2632 2585819677
2633 2585837319
2634 2585898746
2635 2585903683
2636 2586003169
2637 2587981198
2638 2588514939
2639 2597855466
2640 2597864819
2641 2597870674
2642 2599331195
2643 2599356424
2644 2599363549
2645 2599369499
2646 2599376658
2647 2599381529
2648 2599388327
2649 2599395146
2650 2599406911
2651 2599463257
2652 2599469396
2653 2599485351
2654 2599492274
2655 2599507002
2656 2599605587
2657 2599616521
2658 2599626551
2659 2599675615
2660 2599684088
2661 2599696102
2662 2599806496
2663 2599878156
2664 2600038721
2665 2600062604
2666 2600215886
2667 2601689911
2668 2601776053
2669 2601797647
2670 2603859778
2671 2606076871
2672 2606128716
2673 2616554743
2674 2617354038
2675 2617376651
2676 2617383096
2677 2624478023
2678 2643921976
2679 2644003071
2680 2644191935
2681 2644240985
2682 2644498061
2683 2644522837
2684 2644622365
2685 2671100189
2686 2671111980
2687 2671117919
2688 2671772147
2689 2688597819
2690 2694632755
2691 2694639516
2692 2715754289
2693 2723249577
2694 2723577870
2695 2723845937
2696 2725948178
2697 2728754482
2698 2738717968
2699 2738809859
2700 2738879637
2701 2738897219
2702 2739264136
2703 2739278654
2704 2739311084
2705 2743738090
2706 2745082156
2707 2756676296
2708 2774134534
2709 2778175818
2710 2784261257
2711 2792750065
2712 2793069856
2713 2793079741
2714 2793322525
2715 2793359904
2716 2805920273
2717 2808988579
2718 2809217784
2719 2818240357
2720 2819557843
2721 2819609796
2722 2819639898
2723 2819657048
2724 2819682539
2725 2819704995
2726 2819717596
2727 2821444435
2728 2824606589
2729 2824613091
2730 2824624552
2731 2824630701
2732 2824640363
2733 2824647842
2734 2824655812
2735 2824700649
2736 2824718892
2737 2824730568
2738 2824735740
2739 2824751684
2740 2826582538
2741 2831428903
2742 2835313151
2743 2838034019
2744 2838679757
2745 2838717473
2746 2838724326
2747 2838729357
2748 2841762370
2749 2841850784
2750 2841864071
2751 2842129589
2752 2842134734
2753 2842156748
2754 2842173006
2755 2842180366
2756 2842191975
2757 2842216291
2758 2842222843
2759 2842229011
2760 2842326981
2761 2842350586
2762 2842480813
2763 2842483582
2764 2842507376
2765 2842520853
2766 2842778766
2767 2842817612
2768 2842831187
2769 2842842450
2770 2842846543
2771 2842851573
2772 2844004785
2773 2844009684
2774 2844109908
2775 2844667693
2776 2847935077
2777 2847945636
2778 2848697371
2779 2849080186
2780 2849660932
2781 2851186937
2782 2851248383
2783 2852390957
2784 2852661523
2785 2856326250
2786 2856329918
2787 2856337072
2788 2856365217
2789 2857354643
2790 2857371508
2791 2857510430
2792 2857522534
2793 2857530616
2794 2857536804
2795 2857546898
2796 2869237173
2797 2869245227
2798 2869252100
2799 2869260440
2800 2869270615
2801 2869272248
2802 2869284127
2803 2869288685
2804 2871432043
2805 2871443518
2806 2871460389
2807 2871484786
2808 2874115098
2809 2874120645
2810 2874132505
2811 2874144751
2812 2874150684
2813 2874156139
2814 2874163901
2815 2874171232
2816 2874609407
2817 2874651197
2818 2876367072
2819 2876388684
2820 2876401559
2821 2876411095
2822 2876416724
2823 2876426457
2824 2876813208
2825 2878029968
2826 2878743879
2827 2878748707
2828 2878774756
2829 2878781769
2830 2879090806
2831 2879110370
2832 2880230926
2833 2881673075
2834 2883578052
2835 2885328942
2836 2885374868
2837 2886628645
2838 2888383063
2839 2888394765
2840 2888423521
2841 2889013580
2842 2889021702
2843 2889307561
2844 2893070261
2845 2894776557
2846 2899793616
2847 2899848706
2848 2899925008
2849 2903453459
2850 2903503011
2851 2903526563
2852 2903530818
2853 2903755738
2854 2904519386
2855 2904696681
2856 2904704330
2857 2906311118
2858 2906323158
2859 2906369306
2860 2906371725
2861 2906392923
2862 2906399065
2863 2906403596
2864 2906409588
2865 2906617520
2866 2906636177
2867 2906647718
2868 2906667980
2869 2908450639
2870 2908743670
2871 2908761302
2872 2913848143
2873 2913943507
2874 2917070948
2875 2919066344
2876 2919076212
2877 2919102922
2878 2919119225
2879 2919410484
2880 2919454889
2881 2922134655
2882 2922151578
2883 2922178074
2884 2922193513
2885 2922367889
2886 2922395454
2887 2922429197
2888 2923157138
2889 2923558115
2890 2924713991
2891 2924740709
2892 2924744071
2893 2924754662
2894 2924781796
2895 2926759256
2896 2926763307
2897 2928038867
2898 2928045528
2899 2928053144
2900 2928066750
2901 2928071363
2902 2928961953
2903 2929144123
2904 2929193336
2905 2932796320
2906 2932804374
2907 2933011353
2908 2933016534
2909 2935358776
2910 2935634212
2911 2935888785
2912 2937076418
2913 2937818761
2914 2937838504
2915 2937850418
2916 2937865105
2917 2937874487
2918 2937884876
2919 2937978148
2920 2937984610
2921 2938017913
2922 2941511102
2923 2941518486
2924 2941527251
2925 2946031630
2926 2958040516
2927 2958055364
2928 2958092185
2929 2958107159
2930 2958108768
2931 2958128337
2932 2958133082
2933 2958144235
2934 2958161550
2935 2958173269
2936 2958182776
2937 2961080633
2938 2961138369
2939 2961188764
2940 2963649865
2941 2965031107
2942 2965045384
2943 2965053659
2944 2965089892
2945 2965115799
2946 2965123352
2947 2968021858
2948 2968086823
2949 2968118767
2950 2968139851
2951 2970474448
2952 2970491448
2953 2970517746
2954 2970538152
2955 2970554598
2956 2970598739
2957 2970624091
2958 2970631920
2959 2974293533
2960 2977844442
2961 2977854737
2962 2977879290
2963 2977906308
2964 2977909340
2965 2977918174
2966 2977927894
2967 2977937126
2968 2977946422
2969 2977954058
2970 2977958299
2971 2977990746
2972 2979091660
2973 2979097181
2974 2979102884
2975 2979717145
2976 2979765997
2977 2979773074
2978 2979798603
2979 2984509227
2980 2984520075
2981 2984537556
2982 2984604304
2983 2987643245
2984 2987652122
2985 2987652394
2986 2987671272
2987 2987674735
2988 2996312991
2989 2996353857
2990 2996388436
2991 2996892465
2992 3002144307
2993 3004172004
2994 3004198143
2995 3004206792
2996 3004213722
2997 3004223313
2998 3004239716
2999 3004242346
3000 3004254369
3001 3004271531
3002 3004280525
3003 3004338906
3004 3005418684
3005 3005450857
3006 3005455211
3007 3005479367
3008 3005490047
3009 3005713990
3010 3005721439
3011 3007396052
3012 3007397853
3013 3007419786
3014 3007615629
3015 3007624718
3016 3007723414
3017 3007864600
3018 637079119
3019 637317599
3020 639645782
3021 642617685
3022 649872361
3023 650842754
3024 8001849370
3025 8003574644
3026 8004301392
3027 8004369160
3028 8004390764
3029 8004645896
3030 8004697003
3031 8004717342
3032 8005259765
3033 8005318424
3034 8005326992
3035 8005466490
3036 8005488692
3037 8005558710
3038 8005563681
3039 8005645927
3040 8005682395
3041 8006968722
3042 8006990537
3043 8015691320
3044 8016574197
3045 8016593001
3046 8018153860
3047 8018164064
3048 8019557689
3049 8019567609
3050 8046772499
3051 8054289839
3052 8054348639
3053 8054507171
3054 8055774496
3055 8055822099
3056 8056572132
3057 8056684073
3058 8056695773
3059 8057105826
3060 8057535477
3061 8057577042
3062 8057876884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

11

376

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tlc-assembly1.cif.gz_A crystal structure of bdsa from bacillus subtilis wu-s2b 0.9414 6 432
5tlc-assembly1.cif.gz_D crystal structure of bdsa from bacillus subtilis wu-s2b 0.9411 6 432
5tlc-assembly1.cif.gz_B crystal structure of bdsa from bacillus subtilis wu-s2b 0.9363 6 432
5xkd-assembly1.cif.gz_B crystal structure of dibenzothiophene sulfone monooxygenase bdsa in complex with fmn at 2.4 angstrom 0.9342 5 436
5tlc-assembly1.cif.gz_D crystal structure of bdsa from bacillus subtilis wu-s2b 0.934 6 432
ID Description Score Start End Superfamily
5tlcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9411 6 432 3.20.20.30
5tlcB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9363 6 432 3.20.20.30
5tlcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.934 6 432 3.20.20.30
3sdoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9339 4 440 3.20.20.30
3sdoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9316 4 440 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A5J6N0G9-F1-model_v4 Nrd protein 0.984 2 441 GO:0004497
GO:0016705
AF-A0A529XC09-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9835 80 225 GO:0016705
AF-A0A810Y8Z0-F1-model_v4 deleted 0.9825 13 442
AF-A0A810Y8Z0-F1-model_v4 deleted 0.9802 13 442
AF-A0A3S1H9R1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9789 1 283 GO:0004497
GO:0016705

Map