F494613

General Info

Members Datasets Scaffolds Average Seq Length
1533 458 1532 290

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10196238|Ga0070710_101962382
Length 324
Sequence MTFFQRWRCATSRSTTRSSRGIWGCSVATVIEFLQAIPYDQILIQTLNGIVTGMILALIASGLTLIFGIMDVVNFAHGELFMLGAYIGVVVLATSGSFWLALIIATLVXXXXGAALQVTTLRPLLGRDPLTTILATFGISLVLQNYALWQFGPVARKIQEPFTGHFPLFYLEYPWYRLVIAVLSAAIIGGFWLFLKYGTYGIWIRATTQDRVMAQAMGIPVPWVHTAVFAIGAGMAAASGVLFGPLVGVNHAMGQDWLLKAFIVVVVGGMGSLGGSIAASIFISLLEAYAAIWVSPAQAVIISFVVLILVLLFRPAGLFVPTPK

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
17 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
18 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
142 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
143 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
162 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
248 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
250 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
254 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
255 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
260 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
261 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
262 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
268 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
269 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
270 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
271 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
272 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
273 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
276 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
277 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
278 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
279 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
280 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
282 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
284 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
285 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
286 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
287 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
288 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
289 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
290 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
291 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
292 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
293 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
294 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
295 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
296 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
297 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
298 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
299 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
300 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
301 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
302 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
308 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
309 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
310 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
311 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
312 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
313 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
314 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
315 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
316 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
317 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
320 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
330 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
337 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
338 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
339 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
340 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
341 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
342 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
343 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
344 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
345 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
349 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
350 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
353 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
354 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
355 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
356 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
357 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
358 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
365 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
366 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
367 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
368 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
369 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
370 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
371 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
372 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
373 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
374 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
375 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
376 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
377 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
378 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
379 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
380 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
381 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
382 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
383 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
384 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
385 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
386 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
387 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
388 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
389 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
390 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
391 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
392 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
393 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
394 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
395 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
417 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
418 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
419 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
420 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
421 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
422 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
423 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
424 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
425 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
426 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
427 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
428 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
429 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
430 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
433 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
438 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
439 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
440 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
441 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
442 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
443 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
452 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
457 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
458 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.2
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0.07
Rhizoplane 4.17
Rhizosphere 93.35
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000049 3300000041 Bacteria 21869
2 ARSoilYngRDRAFT_c00160 3300000042 Bacteria 11561
3 ARcpr5yngRDRAFT_c000030 3300000043 Bacteria 23301
4 ARSoilOldRDRAFT_c000033 3300000044 Bacteria 30681
5 ARCol0oldRDRAFT_c01542 3300000045 Bacteria 1420
6 ARCol0yngRDRAFT_1000078 3300000652 Bacteria 18395
7 JGI24739J22299_10002387 3300001989 Bacteria 7244
8 JGI24737J22298_10019750 3300001990 Bacteria 2155
9 JGI24750J21931_1000579 3300002070 Bacteria 5590
10 JGI24745J21846_1000593 3300002073 Bacteria 3249
11 JGI24738J21930_10000453 3300002075 Bacteria 11626
12 JGI24035J26624_1000356 3300002126 Bacteria 4312
13 JGI24033J26618_1002015 3300002155 Bacteria 2042
14 JGI24742J22300_10000426 3300002244 Bacteria 6220
15 JGI26145J50221_1004568 3300003371 Bacteria 1124
16 JGI26141J51220_1002987 3300003503 Bacteria 1038
17 Ga0065716_1002581 3300005277 Bacteria 1657
18 Ga0065712_10002685 3300005290 Bacteria 12949
19 Ga0065712_10083652 3300005290 Bacteria 2821
20 Ga0065715_10005190 3300005293 Bacteria 10244
21 Ga0065715_10239077 3300005293 Bacteria 1206
22 Ga0070676_10002407 3300005328 Bacteria 9583
23 Ga0070676_10154057 3300005328 Bacteria 1474
24 Ga0070683_100004780 3300005329 Bacteria 11211
25 Ga0070683_100288265 3300005329 Bacteria 1562
26 Ga0070690_100000577 3300005330 Bacteria 18482
27 Ga0070690_100018789 3300005330 Bacteria 4182
28 Ga0070690_100229719 3300005330 Bacteria 1304
29 Ga0070670_100026119 3300005331 Bacteria 5027
30 Ga0070670_100255607 3300005331 Bacteria 1527
31 Ga0070677_10000943 3300005333 Bacteria 9437
32 Ga0068869_100003812 3300005334 Bacteria 9294
33 Ga0068869_100080432 3300005334 Bacteria 2431
34 Ga0068869_100268236 3300005334 Bacteria 1369
35 Ga0070666_10030069 3300005335 Bacteria 3576
36 Ga0070666_10164933 3300005335 Bacteria 1549
37 Ga0070680_100033842 3300005336 Bacteria 4121
38 Ga0070680_100062248 3300005336 Bacteria 3055
39 Ga0070682_100002906 3300005337 Bacteria 9504
40 Ga0070682_100047308 3300005337 Bacteria 2674
41 Ga0068868_100000892 3300005338 Bacteria 20293
42 Ga0068868_100062551 3300005338 Bacteria 2950
43 Ga0070660_100003390 3300005339 Bacteria 10962
44 Ga0070660_100130908 3300005339 Bacteria 2007
45 Ga0070689_100002855 3300005340 Bacteria 11357
46 Ga0070689_100033685 3300005340 Bacteria 3904
47 Ga0070691_10001992 3300005341 Bacteria 9004
48 Ga0070691_10046825 3300005341 Bacteria 2055
49 Ga0070687_100000895 3300005343 Bacteria 10044
50 Ga0070687_100032929 3300005343 Bacteria 2554
51 Ga0070661_100000804 3300005344 Bacteria 22558
52 Ga0070692_10000830 3300005345 Bacteria 10335
53 Ga0070668_100005596 3300005347 Bacteria 9317
54 Ga0070668_100142910 3300005347 Bacteria 1930
55 Ga0070668_100318330 3300005347 Bacteria 1309
56 Ga0070669_100010788 3300005353 Bacteria 6485
57 Ga0070675_100007817 3300005354 Bacteria 8286
58 Ga0070675_100007876 3300005354 Bacteria 8256
59 Ga0070671_100000144 3300005355 Bacteria 46097
60 Ga0070671_100317343 3300005355 Bacteria 1328
61 Ga0070674_100003771 3300005356 Bacteria 8557
62 Ga0070674_100070743 3300005356 Bacteria 2466
63 Ga0070674_100147943 3300005356 Bacteria 1769
64 Ga0070673_100007016 3300005364 Bacteria 7385
65 Ga0070673_100346336 3300005364 Bacteria 1318
66 Ga0070688_100018496 3300005365 Bacteria 4021
67 Ga0070688_100028335 3300005365 Bacteria 3342
68 Ga0070688_100031244 3300005365 Bacteria 3202
69 Ga0070688_100151260 3300005365 Bacteria 1587
70 Ga0070659_100005098 3300005366 Bacteria 9424
71 Ga0070659_100104616 3300005366 Bacteria 2280
72 Ga0070659_100263755 3300005366 Bacteria 1430
73 Ga0070667_100003448 3300005367 Bacteria 13475
74 Ga0070667_100059407 3300005367 Bacteria 3234
75 Ga0070667_100100919 3300005367 Bacteria 2492
76 Ga0070703_10030769 3300005406 Bacteria 1619
77 Ga0070709_10019643 3300005434 Bacteria 3909
78 Ga0070709_10049135 3300005434 Bacteria 2635
79 Ga0070709_10051670 3300005434 Bacteria 2580
80 Ga0070714_100024062 3300005435 Bacteria 5010
81 Ga0070714_100316891 3300005435 Bacteria 1457
82 Ga0070713_100014908 3300005436 Bacteria 5786
83 Ga0070713_100042795 3300005436 Bacteria 3699
84 Ga0070713_100079712 3300005436 Bacteria 2790
85 Ga0070713_100126428 3300005436 Bacteria 2249
86 Ga0070713_100559201 3300005436 Bacteria 1084
87 Ga0070710_10018841 3300005437 Bacteria 3557
88 Ga0070710_10019293 3300005437 Bacteria 3521
89 Ga0070710_10071882 3300005437 Bacteria 1996
90 Ga0070710_10076413 3300005437 Bacteria 1944
91 Ga0070710_10109167 3300005437 Bacteria 1659
92 Ga0070710_10196238 3300005437 Bacteria 1272
93 Ga0070701_10000951 3300005438 Bacteria 10493
94 Ga0070701_10034402 3300005438 Bacteria 2537
95 Ga0070701_10146738 3300005438 Bacteria 1355
96 Ga0070711_100070782 3300005439 Bacteria 2456
97 Ga0070711_100082465 3300005439 Bacteria 2295
98 Ga0070711_100130271 3300005439 Bacteria 1872
99 Ga0070711_100227224 3300005439 Bacteria 1454
100 Ga0070705_100003034 3300005440 Bacteria 8286
101 Ga0070705_100028819 3300005440 Bacteria 3045
102 Ga0070700_100001925 3300005441 Bacteria 10503
103 Ga0070700_100023724 3300005441 Bacteria 3592
104 Ga0070694_100001870 3300005444 Bacteria 12458
105 Ga0070694_100004146 3300005444 Bacteria 8713
106 Ga0070694_100006591 3300005444 Bacteria 7055
107 Ga0070694_100121825 3300005444 Bacteria 1872
108 Ga0070694_100291769 3300005444 Bacteria 1247
109 Ga0070708_100008649 3300005445 Bacteria 8180
110 Ga0070708_100026754 3300005445 Bacteria 4941
111 Ga0070708_100034020 3300005445 Bacteria 4431
112 Ga0070708_100035567 3300005445 Bacteria 4339
113 Ga0070708_100075567 3300005445 Bacteria 3041
114 Ga0070708_100108366 3300005445 Bacteria 2551
115 Ga0070708_100467856 3300005445 Bacteria 1189
116 Ga0070708_100546278 3300005445 Bacteria 1093
117 Ga0070663_100008331 3300005455 Bacteria 6370
118 Ga0070663_100022198 3300005455 Bacteria 4239
119 Ga0070663_100105614 3300005455 Bacteria 2108
120 Ga0070678_100010321 3300005456 Bacteria 5698
121 Ga0070678_100082297 3300005456 Bacteria 2443
122 Ga0070662_100009476 3300005457 Bacteria 6370
123 Ga0070662_100011706 3300005457 Bacteria 5790
124 Ga0070662_100079907 3300005457 Bacteria 2433
125 Ga0070662_100201947 3300005457 Bacteria 1578
126 Ga0070662_100318344 3300005457 Bacteria 1268
127 Ga0070681_10012385 3300005458 Bacteria 8458
128 Ga0070681_10049870 3300005458 Bacteria 4178
129 Ga0068867_100011042 3300005459 Bacteria 6370
130 Ga0068867_100160086 3300005459 Bacteria 1775
131 Ga0070685_10011928 3300005466 Bacteria 4556
132 Ga0070706_100041402 3300005467 Bacteria 4253
133 Ga0070706_100053102 3300005467 Bacteria 3740
134 Ga0070706_100059211 3300005467 Bacteria 3534
135 Ga0070706_100070789 3300005467 Bacteria 3226
136 Ga0070706_100074704 3300005467 Bacteria 3137
137 Ga0070706_100154303 3300005467 Bacteria 2143
138 Ga0070706_100190704 3300005467 Bacteria 1915
139 Ga0070706_100525303 3300005467 Bacteria 1101
140 Ga0070707_100001802 3300005468 Bacteria 20581
141 Ga0070707_100012992 3300005468 Bacteria 7780
142 Ga0070707_100020130 3300005468 Bacteria 6292
143 Ga0070707_100030799 3300005468 Bacteria 5110
144 Ga0070707_100034910 3300005468 Bacteria 4795
145 Ga0070707_100066728 3300005468 Bacteria 3458
146 Ga0070707_100072739 3300005468 Bacteria 3314
147 Ga0070707_100091941 3300005468 Bacteria 2937
148 Ga0070707_100431130 3300005468 Bacteria 1279
149 Ga0070707_100446141 3300005468 Bacteria 1254
150 Ga0070698_100021691 3300005471 Bacteria 6724
151 Ga0070698_100028399 3300005471 Bacteria 5810
152 Ga0070698_100029279 3300005471 Bacteria 5715
153 Ga0070698_100030758 3300005471 Bacteria 5566
154 Ga0070698_100068558 3300005471 Bacteria 3564
155 Ga0070698_100081033 3300005471 Bacteria 3240
156 Ga0070698_100083294 3300005471 Bacteria 3188
157 Ga0070699_100000671 3300005518 Bacteria 31999
158 Ga0070699_100007440 3300005518 Bacteria 9530
159 Ga0070699_100010386 3300005518 Bacteria 8054
160 Ga0070699_100010925 3300005518 Bacteria 7854
161 Ga0070699_100016028 3300005518 Bacteria 6435
162 Ga0070699_100021332 3300005518 Bacteria 5587
163 Ga0070699_100024663 3300005518 Bacteria 5184
164 Ga0070699_100061924 3300005518 Bacteria 3242
165 Ga0070699_100079482 3300005518 Bacteria 2857
166 Ga0070699_100099117 3300005518 Bacteria 2553
167 Ga0070699_100110173 3300005518 Bacteria 2417
168 Ga0070699_100201519 3300005518 Bacteria 1770
169 Ga0070679_100019238 3300005530 Bacteria 6636
170 Ga0070679_100207286 3300005530 Bacteria 1925
171 Ga0070684_100001753 3300005535 Bacteria 15811
172 Ga0070684_100152560 3300005535 Bacteria 2093
173 Ga0070697_100009626 3300005536 Bacteria 7550
174 Ga0070697_100023006 3300005536 Bacteria 4956
175 Ga0070697_100024096 3300005536 Bacteria 4844
176 Ga0070697_100065399 3300005536 Bacteria 2971
177 Ga0070697_100089132 3300005536 Bacteria 2548
178 Ga0070697_100147820 3300005536 Bacteria 1979
179 Ga0070697_100174791 3300005536 Bacteria 1819
180 Ga0070697_100325586 3300005536 Bacteria 1324
181 Ga0068853_100005853 3300005539 Bacteria 9685
182 Ga0068853_100016265 3300005539 Bacteria 6121
183 Ga0070686_100000086 3300005544 Bacteria 65438
184 Ga0070686_100005092 3300005544 Bacteria 7256
185 Ga0070686_100056253 3300005544 Bacteria 2522
186 Ga0070695_100002332 3300005545 Bacteria 10891
187 Ga0070695_100003402 3300005545 Bacteria 9305
188 Ga0070695_100004686 3300005545 Bacteria 8043
189 Ga0070695_100007717 3300005545 Bacteria 6370
190 Ga0070695_100016956 3300005545 Bacteria 4416
191 Ga0070695_100019745 3300005545 Bacteria 4108
192 Ga0070695_100134570 3300005545 Bacteria 1707
193 Ga0070696_100004489 3300005546 Bacteria 9315
194 Ga0070696_100018166 3300005546 Bacteria 4751
195 Ga0070696_100031862 3300005546 Bacteria 3615
196 Ga0070693_100002732 3300005547 Bacteria 8124
197 Ga0070693_100044727 3300005547 Bacteria 2506
198 Ga0070693_100106327 3300005547 Bacteria 1718
199 Ga0070693_100141954 3300005547 Bacteria 1513
200 Ga0070665_100223317 3300005548 Bacteria 1884
201 Ga0070704_100000280 3300005549 Bacteria 22434
202 Ga0070704_100043437 3300005549 Bacteria 3116
203 Ga0070704_100057568 3300005549 Bacteria 2764
204 Ga0070704_100073400 3300005549 Bacteria 2492
205 Ga0070704_100087760 3300005549 Bacteria 2309
206 Ga0070704_100161893 3300005549 Bacteria 1770
207 Ga0068855_100027435 3300005563 Bacteria 6811
208 Ga0070664_100008530 3300005564 Bacteria 8286
209 Ga0068857_100027217 3300005577 Bacteria 5043
210 Ga0068857_100068077 3300005577 Bacteria 3170
211 Ga0068854_100003207 3300005578 Bacteria 10203
212 Ga0068856_100010687 3300005614 Bacteria 8918
213 Ga0070702_100014862 3300005615 Bacteria 3961
214 Ga0068852_100002326 3300005616 Bacteria 13065
215 Ga0068859_100009076 3300005617 Bacteria 10044
216 Ga0068859_100018036 3300005617 Bacteria 7092
217 Ga0068859_100149718 3300005617 Bacteria 2410
218 Ga0068864_100001754 3300005618 Bacteria 17838
219 Ga0068866_10001865 3300005718 Bacteria 8828
220 Ga0068866_10089750 3300005718 Bacteria 1671
221 Ga0068866_10126607 3300005718 Bacteria 1447
222 Ga0068866_10149963 3300005718 Bacteria 1349
223 Ga0068861_100034303 3300005719 Bacteria 3752
224 Ga0068861_100401335 3300005719 Bacteria 1216
225 Ga0068851_10162154 3300005834 Bacteria 1229
226 Ga0068870_10000419 3300005840 Bacteria 15983
227 Ga0068863_100000340 3300005841 Bacteria 47641
228 Ga0068863_100074755 3300005841 Bacteria 3206
229 Ga0068863_100180337 3300005841 Bacteria 2027
230 Ga0068863_100318066 3300005841 Bacteria 1511
231 Ga0068858_100009413 3300005842 Bacteria 9322
232 Ga0068858_100048335 3300005842 Bacteria 3943
233 Ga0068858_100057064 3300005842 Bacteria 3608
234 Ga0068858_100285965 3300005842 Bacteria 1571
235 Ga0068860_100027403 3300005843 Bacteria 5489
236 Ga0068860_100176586 3300005843 Bacteria 2064
237 Ga0068860_100240932 3300005843 Bacteria 1759
238 Ga0068862_100006116 3300005844 Bacteria 10017
239 Ga0068862_100056602 3300005844 Bacteria 3360
240 Ga0068862_100061701 3300005844 Bacteria 3223
241 Ga0068862_100243534 3300005844 Bacteria 1636
242 Ga0068862_100388753 3300005844 Bacteria 1303
243 Ga0081455_10000007 3300005937 Bacteria 269394
244 Ga0081455_10000371 3300005937 Bacteria 59407
245 Ga0081455_10004553 3300005937 Bacteria 15475
246 Ga0081455_10012285 3300005937 Bacteria 8545
247 Ga0081455_10028693 3300005937 Bacteria 5080
248 Ga0081455_10230896 3300005937 Bacteria 1366
249 Ga0081538_10014227 3300005981 Bacteria 6242
250 Ga0081538_10024923 3300005981 Bacteria 4242
251 Ga0081538_10026168 3300005981 Bacteria 4088
252 Ga0081538_10030288 3300005981 Bacteria 3677
253 Ga0081540_1000604 3300005983 Bacteria 34243
254 Ga0081540_1006112 3300005983 Bacteria 8845
255 Ga0081540_1038399 3300005983 Bacteria 2524
256 Ga0081540_1038400 3300005983 Bacteria 2524
257 Ga0081540_1107129 3300005983 Bacteria 1190
258 Ga0081539_10000210 3300005985 Bacteria 136405
259 Ga0081539_10078214 3300005985 Bacteria 1747
260 Ga0070717_10050726 3300006028 Bacteria 3411
261 Ga0070717_10079448 3300006028 Bacteria 2751
262 Ga0070717_10131111 3300006028 Bacteria 2155
263 Ga0070717_10142621 3300006028 Bacteria 2067
264 Ga0070717_10147315 3300006028 Bacteria 2034
265 Ga0070717_10229340 3300006028 Bacteria 1635
266 Ga0070717_10241289 3300006028 Bacteria 1594
267 Ga0075365_10004953 3300006038 Bacteria 7125
268 Ga0075365_10062017 3300006038 Bacteria 2499
269 Ga0075365_10079598 3300006038 Bacteria 2217
270 Ga0075368_10000940 3300006042 Bacteria 9056
271 Ga0075363_100005500 3300006048 Bacteria 5646
272 Ga0075363_100009758 3300006048 Bacteria 4523
273 Ga0075364_10014387 3300006051 Bacteria 4888
274 Ga0075432_10008949 3300006058 Bacteria 3413
275 Ga0070715_10070962 3300006163 Bacteria 1556
276 Ga0070716_100007236 3300006173 Bacteria 5458
277 Ga0070716_100152395 3300006173 Bacteria 1489
278 Ga0070712_100000165 3300006175 Bacteria 35992
279 Ga0070712_100023832 3300006175 Bacteria 4047
280 Ga0070712_100031582 3300006175 Bacteria 3569
281 Ga0070712_100089000 3300006175 Bacteria 2257
282 Ga0070712_100104562 3300006175 Bacteria 2101
283 Ga0070712_100195467 3300006175 Bacteria 1586
284 Ga0070712_100239963 3300006175 Bacteria 1443
285 Ga0070712_100369413 3300006175 Bacteria 1178
286 Ga0075367_10000844 3300006178 Bacteria 12187
287 Ga0075367_10004355 3300006178 Bacteria 6900
288 Ga0075367_10144273 3300006178 Bacteria 1476
289 Ga0075427_10000264 3300006194 Bacteria 5650
290 Ga0097621_100000880 3300006237 Bacteria 21059
291 Ga0097621_100159470 3300006237 Bacteria 1938
292 Ga0075370_10192227 3300006353 Bacteria 1203
293 Ga0068871_100006040 3300006358 Bacteria 8523
294 Ga0068871_100153883 3300006358 Bacteria 1962
295 Ga0075428_100000498 3300006844 Bacteria 39836
296 Ga0075428_100001723 3300006844 Bacteria 23380
297 Ga0075428_100001793 3300006844 Bacteria 22956
298 Ga0075428_100011732 3300006844 Bacteria 9755
299 Ga0075428_100021035 3300006844 Bacteria 7225
300 Ga0075428_100024377 3300006844 Bacteria 6695
301 Ga0075428_100030351 3300006844 Bacteria 5979
302 Ga0075428_100056048 3300006844 Bacteria 4318
303 Ga0075428_100207998 3300006844 Bacteria 2115
304 Ga0075428_100288827 3300006844 Bacteria 1764
305 Ga0075428_100293401 3300006844 Bacteria 1749
306 Ga0075428_100468986 3300006844 Bacteria 1348
307 Ga0075428_100629486 3300006844 Bacteria 1145
308 Ga0075428_100660435 3300006844 Bacteria 1115
309 Ga0075430_100000201 3300006846 Bacteria 40551
310 Ga0075430_100003716 3300006846 Bacteria 12821
311 Ga0075430_100004765 3300006846 Bacteria 11411
312 Ga0075430_100031977 3300006846 Bacteria 4466
313 Ga0075430_100116978 3300006846 Bacteria 2222
314 Ga0075430_100192472 3300006846 Bacteria 1695
315 Ga0075431_100000136 3300006847 Bacteria 49311
316 Ga0075431_100000260 3300006847 Bacteria 40551
317 Ga0075431_100000692 3300006847 Bacteria 29010
318 Ga0075431_100003907 3300006847 Bacteria 14506
319 Ga0075431_100005578 3300006847 Bacteria 12424
320 Ga0075431_100005773 3300006847 Bacteria 12242
321 Ga0075431_100006673 3300006847 Bacteria 11464
322 Ga0075431_100020999 3300006847 Bacteria 6673
323 Ga0075431_100051429 3300006847 Bacteria 4249
324 Ga0075431_100064131 3300006847 Bacteria 3793
325 Ga0075431_100084216 3300006847 Bacteria 3283
326 Ga0075431_100129633 3300006847 Bacteria 2602
327 Ga0075431_100170206 3300006847 Bacteria 2238
328 Ga0075431_100286372 3300006847 Bacteria 1668
329 Ga0075431_100563976 3300006847 Unclassified 1125
330 Ga0075433_10000007 3300006852 Bacteria 75995
331 Ga0075433_10000237 3300006852 Bacteria 31546
332 Ga0075433_10001149 3300006852 Bacteria 19217
333 Ga0075433_10003530 3300006852 Bacteria 12068
334 Ga0075433_10008207 3300006852 Bacteria 8321
335 Ga0075433_10013677 3300006852 Bacteria 6609
336 Ga0075433_10042277 3300006852 Bacteria 3953
337 Ga0075433_10088710 3300006852 Bacteria 2733
338 Ga0075433_10096078 3300006852 Bacteria 2622
339 Ga0075433_10099537 3300006852 Bacteria 2574
340 Ga0075433_10112050 3300006852 Bacteria 2420
341 Ga0075433_10377036 3300006852 Bacteria 1253
342 Ga0075434_100000091 3300006871 Bacteria 49489
343 Ga0075434_100000381 3300006871 Bacteria 32406
344 Ga0075434_100000906 3300006871 Bacteria 23754
345 Ga0075434_100005057 3300006871 Bacteria 11975
346 Ga0075434_100015470 3300006871 Bacteria 7317
347 Ga0075434_100018407 3300006871 Bacteria 6749
348 Ga0075434_100057453 3300006871 Bacteria 3867
349 Ga0075434_100084804 3300006871 Bacteria 3166
350 Ga0075434_100090290 3300006871 Bacteria 3065
351 Ga0075434_100117309 3300006871 Bacteria 2675
352 Ga0075434_100166446 3300006871 Bacteria 2225
353 Ga0075434_100174598 3300006871 Bacteria 2168
354 Ga0075434_100175136 3300006871 Bacteria 2165
355 Ga0075434_100190438 3300006871 Bacteria 2071
356 Ga0075434_100298472 3300006871 Bacteria 1631
357 Ga0075434_100343802 3300006871 Bacteria 1513
358 Ga0075429_100000042 3300006880 Bacteria 57742
359 Ga0075429_100001265 3300006880 Bacteria 20558
360 Ga0075429_100009627 3300006880 Bacteria 8383
361 Ga0075429_100015762 3300006880 Bacteria 6545
362 Ga0075429_100016285 3300006880 Bacteria 6443
363 Ga0075429_100017672 3300006880 Bacteria 6168
364 Ga0075429_100064065 3300006880 Bacteria 3202
365 Ga0075429_100067487 3300006880 Bacteria 3112
366 Ga0075429_100154494 3300006880 Bacteria 2009
367 Ga0075429_100260011 3300006880 Bacteria 1520
368 Ga0075429_100389106 3300006880 Bacteria 1221
369 Ga0075429_100393225 3300006880 Unclassified 1214
370 Ga0068865_100000615 3300006881 Bacteria 20013
371 Ga0068865_100028289 3300006881 Bacteria 3709
372 Ga0075436_100034161 3300006914 Bacteria 3506
373 Ga0075436_100043885 3300006914 Bacteria 3082
374 Ga0075436_100126538 3300006914 Bacteria 1790
375 Ga0097620_100009075 3300006931 Bacteria 10044
376 Ga0097620_100018036 3300006931 Bacteria 7092
377 Ga0097620_100149712 3300006931 Bacteria 2410
378 Ga0075435_100007819 3300007076 Bacteria 7648
379 Ga0075435_100019064 3300007076 Bacteria 5230
380 Ga0075435_100037410 3300007076 Bacteria 3864
381 Ga0075435_100051516 3300007076 Bacteria 3316
382 Ga0075435_100096477 3300007076 Bacteria 2446
383 Ga0075435_100189451 3300007076 Bacteria 1741
384 Ga0075435_100191643 3300007076 Bacteria 1730
385 Ga0075435_100249559 3300007076 Bacteria 1511
386 Ga0099794_10001274 3300007265 Bacteria 8730
387 Ga0099794_10003296 3300007265 Bacteria 6134
388 Ga0099794_10005574 3300007265 Bacteria 5059
389 Ga0099794_10015829 3300007265 Bacteria 3336
390 Ga0099794_10043801 3300007265 Bacteria 2137
391 Ga0099794_10054015 3300007265 Bacteria 1938
392 Ga0099795_10022044 3300007788 Bacteria 2098
393 Ga0099795_10031237 3300007788 Bacteria 1832
394 Ga0099795_10044559 3300007788 Bacteria 1592
395 Ga0105251_10033916 3300009011 Bacteria 2530
396 Ga0105250_10059418 3300009092 Bacteria 1535
397 Ga0105240_10282154 3300009093 Bacteria 1907
398 Ga0111539_10000405 3300009094 Bacteria 53738
399 Ga0111539_10001412 3300009094 Bacteria 31985
400 Ga0111539_10001936 3300009094 Bacteria 27603
401 Ga0111539_10004302 3300009094 Bacteria 18624
402 Ga0111539_10006123 3300009094 Bacteria 15530
403 Ga0111539_10017112 3300009094 Bacteria 8974
404 Ga0111539_10024531 3300009094 Bacteria 7397
405 Ga0111539_10042630 3300009094 Bacteria 5446
406 Ga0111539_10046377 3300009094 Bacteria 5198
407 Ga0111539_10534417 3300009094 Bacteria 1366
408 Ga0111539_10584661 3300009094 Bacteria 1300
409 Ga0105245_10041176 3300009098 Bacteria 4118
410 Ga0105247_10026019 3300009101 Bacteria 3532
411 Ga0105247_10059134 3300009101 Bacteria 2372
412 Ga0105247_10071690 3300009101 Bacteria 2167
413 Ga0114129_10000728 3300009147 Bacteria 41762
414 Ga0114129_10001292 3300009147 Bacteria 33369
415 Ga0114129_10001993 3300009147 Bacteria 27939
416 Ga0114129_10002465 3300009147 Bacteria 25697
417 Ga0114129_10002647 3300009147 Bacteria 24920
418 Ga0114129_10003264 3300009147 Bacteria 22763
419 Ga0114129_10003625 3300009147 Bacteria 21723
420 Ga0114129_10003627 3300009147 Bacteria 21719
421 Ga0114129_10005016 3300009147 Bacteria 18630
422 Ga0114129_10008761 3300009147 Bacteria 14429
423 Ga0114129_10017987 3300009147 Bacteria 10065
424 Ga0114129_10027216 3300009147 Bacteria 8095
425 Ga0114129_10035010 3300009147 Bacteria 7093
426 Ga0114129_10042614 3300009147 Bacteria 6389
427 Ga0114129_10054353 3300009147 Bacteria 5614
428 Ga0114129_10056719 3300009147 Bacteria 5484
429 Ga0114129_10076569 3300009147 Bacteria 4657
430 Ga0114129_10081183 3300009147 Bacteria 4507
431 Ga0114129_10116521 3300009147 Bacteria 3681
432 Ga0114129_10413311 3300009147 Bacteria 1776
433 Ga0114129_10463205 3300009147 Bacteria 1661
434 Ga0114129_10464857 3300009147 Bacteria 1658
435 Ga0114129_10678839 3300009147 Bacteria 1326
436 Ga0114129_10688134 3300009147 Bacteria 1315
437 Ga0114129_10756636 3300009147 Bacteria 1243
438 Ga0114129_10760356 3300009147 Unclassified 1240
439 Ga0105243_10006356 3300009148 Bacteria 9125
440 Ga0105243_10007677 3300009148 Bacteria 8286
441 Ga0105243_10042044 3300009148 Bacteria 3576
442 Ga0105243_10408949 3300009148 Bacteria 1262
443 Ga0105241_10013233 3300009174 Bacteria 6047
444 Ga0105241_10021798 3300009174 Bacteria 4740
445 Ga0105241_10172931 3300009174 Bacteria 1785
446 Ga0105241_10257723 3300009174 Bacteria 1481
447 Ga0105242_10007702 3300009176 Bacteria 8286
448 Ga0105242_10147831 3300009176 Bacteria 2046
449 Ga0105242_10344473 3300009176 Bacteria 1374
450 Ga0105248_10004655 3300009177 Bacteria 15184
451 Ga0105248_10020286 3300009177 Bacteria 7364
452 Ga0105248_10185600 3300009177 Bacteria 2343
453 Ga0105248_10720478 3300009177 Bacteria 1126
454 Ga0105248_10767515 3300009177 Bacteria 1088
455 Ga0105248_10802681 3300009177 Bacteria 1062
456 Ga0105237_10042077 3300009545 Bacteria 4607
457 Ga0105237_10252931 3300009545 Bacteria 1764
458 Ga0105238_10087827 3300009551 Bacteria 3096
459 Ga0105249_10010100 3300009553 Bacteria 8286
460 Ga0105249_10140097 3300009553 Bacteria 2318
461 Ga0105249_10258684 3300009553 Bacteria 1729
462 Ga0105249_10513598 3300009553 Bacteria 1245
463 Ga0099796_10001221 3300010159 Bacteria 5021
464 Ga0099796_10063185 3300010159 Bacteria 1318
465 Ga0099796_10074070 3300010159 Bacteria 1235
466 Ga0105239_10233362 3300010375 Bacteria 2064
467 Ga0105239_10322102 3300010375 Bacteria 1743
468 Ga0105246_10001908 3300011119 Bacteria 12559
469 Ga0105246_10204338 3300011119 Bacteria 1538
470 Ga0157344_1003302 3300012476 Bacteria 904
471 Ga0157347_1003554 3300012502 Bacteria 1403
472 Ga0157342_1000599 3300012507 Bacteria 2292
473 Ga0157373_10081190 3300013100 Bacteria 2286
474 Ga0157371_10143088 3300013102 Bacteria 1703
475 Ga0157369_10434083 3300013105 Bacteria 1361
476 Ga0157374_10010364 3300013296 Bacteria 8018
477 Ga0157378_10009964 3300013297 Bacteria 8286
478 Ga0157378_10116190 3300013297 Bacteria 2460
479 Ga0157378_10260833 3300013297 Bacteria 1663
480 Ga0163162_10005621 3300013306 Bacteria 12115
481 Ga0163162_10014215 3300013306 Bacteria 7777
482 Ga0163162_10018107 3300013306 Bacteria 6895
483 Ga0163162_10054423 3300013306 Bacteria 4025
484 Ga0163162_10489251 3300013306 Bacteria 1361
485 Ga0163162_10800505 3300013306 Bacteria 1060
486 Ga0157372_10027038 3300013307 Bacteria 6246
487 Ga0157372_10359520 3300013307 Bacteria 1696
488 Ga0157372_10488928 3300013307 Bacteria 1435
489 Ga0157375_10007981 3300013308 Bacteria 9268
490 Ga0157375_10270745 3300013308 Bacteria 1860
491 Ga0157375_10419868 3300013308 Bacteria 1504
492 Ga0157375_10674707 3300013308 Bacteria 1188
493 Ga0163163_10002823 3300014325 Bacteria 14683
494 Ga0163163_10156001 3300014325 Bacteria 2327
495 Ga0163163_10525612 3300014325 Bacteria 1246
496 Ga0157380_10004902 3300014326 Bacteria 9325
497 Ga0157380_10012253 3300014326 Bacteria 6212
498 Ga0157380_10287350 3300014326 Bacteria 1508
499 Ga0157380_10408638 3300014326 Bacteria 1290
500 Ga0182008_10100343 3300014497 Bacteria 1430
501 Ga0157377_10002529 3300014745 Bacteria 8107
502 Ga0157377_10075546 3300014745 Bacteria 1957
503 Ga0157379_10000036 3300014968 Bacteria 81888
504 Ga0157376_10027787 3300014969 Bacteria 4489
505 Ga0157376_10307023 3300014969 Bacteria 1504
506 Ga0163161_10006198 3300017792 Bacteria 8286
507 Ga0213873_10004074 3300021358 Bacteria 2694
508 Ga0213875_10000089 3300021388 Bacteria 105772
509 Ga0213875_10112145 3300021388 Bacteria 1274
510 Ga0213871_10058937 3300021441 Bacteria 1066
511 Ga0207666_1000147 3300025271 Bacteria 11003
512 Ga0207666_1002036 3300025271 Bacteria 2419
513 Ga0207673_1000767 3300025290 Bacteria 3463
514 Ga0209758_1000158 3300025297 Bacteria 156129
515 Ga0207697_10004223 3300025315 Bacteria 6903
516 Ga0207697_10011422 3300025315 Bacteria 3755
517 Ga0207656_10134785 3300025321 Bacteria 1160
518 Ga0207653_10001409 3300025885 Bacteria 7795
519 Ga0207653_10003233 3300025885 Bacteria 5150
520 Ga0207682_10001723 3300025893 Bacteria 10024
521 Ga0207692_10010637 3300025898 Bacteria 3886
522 Ga0207692_10011719 3300025898 Bacteria 3743
523 Ga0207692_10015380 3300025898 Bacteria 3366
524 Ga0207692_10083257 3300025898 Bacteria 1716
525 Ga0207692_10119437 3300025898 Bacteria 1474
526 Ga0207692_10188648 3300025898 Bacteria 1205
527 Ga0207642_10001921 3300025899 Bacteria 6411
528 Ga0207642_10056486 3300025899 Bacteria 1801
529 Ga0207710_10010654 3300025900 Bacteria 3871
530 Ga0207710_10097248 3300025900 Bacteria 1385
531 Ga0207688_10000167 3300025901 Bacteria 28809
532 Ga0207688_10068753 3300025901 Bacteria 2006
533 Ga0207685_10017622 3300025905 Bacteria 2315
534 Ga0207685_10029858 3300025905 Bacteria 1935
535 Ga0207699_10001769 3300025906 Bacteria 10200
536 Ga0207699_10057442 3300025906 Bacteria 2323
537 Ga0207699_10242016 3300025906 Bacteria 1240
538 Ga0207645_10005140 3300025907 Bacteria 9571
539 Ga0207645_10070515 3300025907 Bacteria 2235
540 Ga0207645_10156494 3300025907 Bacteria 1489
541 Ga0207643_10004063 3300025908 Bacteria 7870
542 Ga0207643_10067428 3300025908 Bacteria 2054
543 Ga0207684_10000770 3300025910 Bacteria 37234
544 Ga0207684_10002456 3300025910 Bacteria 18699
545 Ga0207684_10004661 3300025910 Bacteria 12875
546 Ga0207684_10008401 3300025910 Bacteria 9180
547 Ga0207684_10011632 3300025910 Bacteria 7686
548 Ga0207684_10017510 3300025910 Bacteria 6145
549 Ga0207684_10049940 3300025910 Bacteria 3548
550 Ga0207684_10053390 3300025910 Bacteria 3431
551 Ga0207684_10142307 3300025910 Bacteria 2062
552 Ga0207684_10155122 3300025910 Bacteria 1971
553 Ga0207684_10270039 3300025910 Bacteria 1467
554 Ga0207654_10003427 3300025911 Bacteria 8018
555 Ga0207707_10016807 3300025912 Bacteria 6375
556 Ga0207695_10191240 3300025913 Bacteria 1964
557 Ga0207671_10035659 3300025914 Bacteria 3690
558 Ga0207671_10251610 3300025914 Bacteria 1389
559 Ga0207693_10001566 3300025915 Bacteria 20200
560 Ga0207693_10002927 3300025915 Bacteria 14777
561 Ga0207693_10006981 3300025915 Bacteria 9327
562 Ga0207693_10012939 3300025915 Bacteria 6735
563 Ga0207693_10023031 3300025915 Bacteria 4946
564 Ga0207693_10024826 3300025915 Bacteria 4753
565 Ga0207693_10031005 3300025915 Bacteria 4223
566 Ga0207693_10051273 3300025915 Bacteria 3239
567 Ga0207693_10061970 3300025915 Bacteria 2930
568 Ga0207693_10076742 3300025915 Bacteria 2617
569 Ga0207693_10097296 3300025915 Bacteria 2308
570 Ga0207663_10025337 3300025916 Bacteria 3428
571 Ga0207663_10076310 3300025916 Bacteria 2177
572 Ga0207663_10082297 3300025916 Bacteria 2111
573 Ga0207663_10151795 3300025916 Bacteria 1626
574 Ga0207663_10227543 3300025916 Unclassified 1360
575 Ga0207660_10001661 3300025917 Bacteria 14915
576 Ga0207660_10076246 3300025917 Bacteria 2451
577 Ga0207660_10086755 3300025917 Bacteria 2311
578 Ga0207660_10096622 3300025917 Bacteria 2200
579 Ga0207660_10106745 3300025917 Bacteria 2100
580 Ga0207662_10000195 3300025918 Bacteria 28315
581 Ga0207662_10004491 3300025918 Bacteria 7344
582 Ga0207657_10012031 3300025919 Bacteria 8558
583 Ga0207657_10085483 3300025919 Bacteria 2642
584 Ga0207657_10272144 3300025919 Bacteria 1346
585 Ga0207649_10000944 3300025920 Bacteria 18174
586 Ga0207652_10028891 3300025921 Bacteria 4629
587 Ga0207652_10100652 3300025921 Bacteria 2551
588 Ga0207652_10191196 3300025921 Bacteria 1841
589 Ga0207646_10007372 3300025922 Bacteria 11194
590 Ga0207646_10007643 3300025922 Bacteria 10942
591 Ga0207646_10009737 3300025922 Bacteria 9470
592 Ga0207646_10017807 3300025922 Bacteria 6636
593 Ga0207646_10046454 3300025922 Bacteria 3896
594 Ga0207646_10077061 3300025922 Bacteria 2980
595 Ga0207646_10081180 3300025922 Bacteria 2899
596 Ga0207646_10082521 3300025922 Bacteria 2874
597 Ga0207646_10102883 3300025922 Bacteria 2561
598 Ga0207646_10190243 3300025922 Bacteria 1854
599 Ga0207646_10603796 3300025922 Bacteria 985
600 Ga0207681_10004024 3300025923 Bacteria 9118
601 Ga0207681_10015699 3300025923 Bacteria 4727
602 Ga0207681_10205354 3300025923 Bacteria 1515
603 Ga0207694_10343993 3300025924 Bacteria 1234
604 Ga0207650_10011209 3300025925 Bacteria 6165
605 Ga0207650_10118783 3300025925 Bacteria 2056
606 Ga0207659_10001128 3300025926 Bacteria 15843
607 Ga0207659_10020864 3300025926 Bacteria 4338
608 Ga0207687_10006293 3300025927 Bacteria 7850
609 Ga0207700_10000389 3300025928 Bacteria 25605
610 Ga0207700_10003921 3300025928 Bacteria 8691
611 Ga0207700_10035400 3300025928 Bacteria 3596
612 Ga0207700_10038715 3300025928 Bacteria 3463
613 Ga0207700_10046114 3300025928 Bacteria 3221
614 Ga0207700_10049750 3300025928 Bacteria 3120
615 Ga0207700_10338534 3300025928 Bacteria 1307
616 Ga0207664_10088470 3300025929 Bacteria 2534
617 Ga0207664_10095864 3300025929 Bacteria 2441
618 Ga0207644_10016379 3300025931 Bacteria 4987
619 Ga0207644_10017054 3300025931 Bacteria 4897
620 Ga0207644_10043334 3300025931 Bacteria 3193
621 Ga0207644_10326406 3300025931 Bacteria 1242
622 Ga0207644_10494605 3300025931 Bacteria 1008
623 Ga0207690_10010455 3300025932 Bacteria 5516
624 Ga0207690_10097585 3300025932 Bacteria 2091
625 Ga0207690_10130390 3300025932 Bacteria 1839
626 Ga0207706_10010273 3300025933 Bacteria 8558
627 Ga0207706_10015026 3300025933 Bacteria 7009
628 Ga0207706_10018959 3300025933 Bacteria 6187
629 Ga0207706_10088588 3300025933 Bacteria 2721
630 Ga0207706_10294632 3300025933 Bacteria 1414
631 Ga0207706_10334553 3300025933 Unclassified 1317
632 Ga0207686_10002278 3300025934 Bacteria 10539
633 Ga0207686_10012067 3300025934 Bacteria 4746
634 Ga0207709_10093443 3300025935 Bacteria 1972
635 Ga0207670_10000792 3300025936 Bacteria 16529
636 Ga0207670_10017940 3300025936 Bacteria 4288
637 Ga0207670_10114236 3300025936 Bacteria 1951
638 Ga0207670_10123770 3300025936 Bacteria 1884
639 Ga0207670_10162379 3300025936 Bacteria 1669
640 Ga0207669_10001389 3300025937 Bacteria 10299
641 Ga0207669_10044242 3300025937 Bacteria 2614
642 Ga0207669_10121244 3300025937 Bacteria 1776
643 Ga0207704_10001138 3300025938 Bacteria 11824
644 Ga0207704_10117400 3300025938 Bacteria 1812
645 Ga0207665_10001576 3300025939 Bacteria 15389
646 Ga0207665_10013888 3300025939 Bacteria 5296
647 Ga0207665_10050547 3300025939 Bacteria 2796
648 Ga0207665_10065456 3300025939 Bacteria 2472
649 Ga0207665_10077764 3300025939 Bacteria 2278
650 Ga0207665_10117699 3300025939 Bacteria 1874
651 Ga0207665_10253441 3300025939 Bacteria 1301
652 Ga0207691_10009001 3300025940 Bacteria 9573
653 Ga0207711_10011627 3300025941 Bacteria 7313
654 Ga0207711_10055850 3300025941 Bacteria 3391
655 Ga0207711_10068308 3300025941 Bacteria 3078
656 Ga0207711_10564255 3300025941 Bacteria 1062
657 Ga0207689_10000008 3300025942 Bacteria 127942
658 Ga0207689_10001241 3300025942 Bacteria 24582
659 Ga0207689_10014179 3300025942 Bacteria 6780
660 Ga0207689_10378309 3300025942 Bacteria 1179
661 Ga0207661_10002577 3300025944 Bacteria 12474
662 Ga0207679_10004919 3300025945 Bacteria 8331
663 Ga0207667_10008690 3300025949 Bacteria 12035
664 Ga0207651_10000292 3300025960 Bacteria 21406
665 Ga0207651_10028919 3300025960 Bacteria 3504
666 Ga0207651_10052565 3300025960 Bacteria 2779
667 Ga0207651_10107323 3300025960 Bacteria 2087
668 Ga0207712_10007532 3300025961 Bacteria 6875
669 Ga0207712_10093870 3300025961 Bacteria 2215
670 Ga0207712_10177802 3300025961 Bacteria 1669
671 Ga0207668_10001329 3300025972 Bacteria 14678
672 Ga0207668_10066414 3300025972 Bacteria 2557
673 Ga0207668_10081971 3300025972 Bacteria 2342
674 Ga0207668_10124124 3300025972 Bacteria 1960
675 Ga0207668_10209841 3300025972 Bacteria 1557
676 Ga0207640_10001339 3300025981 Bacteria 13347
677 Ga0207640_10216675 3300025981 Bacteria 1463
678 Ga0207658_10014450 3300025986 Bacteria 5406
679 Ga0207658_10057511 3300025986 Bacteria 2890
680 Ga0207658_10087334 3300025986 Bacteria 2408
681 Ga0207658_10294652 3300025986 Bacteria 1396
682 Ga0207677_10011475 3300026023 Bacteria 5057
683 Ga0207703_10006686 3300026035 Bacteria 9198
684 Ga0207703_10044383 3300026035 Bacteria 3573
685 Ga0207703_10047471 3300026035 Bacteria 3462
686 Ga0207703_10085108 3300026035 Bacteria 2645
687 Ga0207639_10011886 3300026041 Bacteria 6056
688 Ga0207639_10085826 3300026041 Bacteria 2505
689 Ga0207678_10009486 3300026067 Bacteria 8558
690 Ga0207678_10045570 3300026067 Bacteria 3792
691 Ga0207678_10059491 3300026067 Bacteria 3287
692 Ga0207678_10090327 3300026067 Bacteria 2618
693 Ga0207708_10006642 3300026075 Bacteria 8558
694 Ga0207708_10039536 3300026075 Bacteria 3594
695 Ga0207708_10053317 3300026075 Bacteria 3082
696 Ga0207708_10256681 3300026075 Bacteria 1410
697 Ga0207702_10025513 3300026078 Bacteria 4906
698 Ga0207702_10066149 3300026078 Bacteria 3097
699 Ga0207702_10451662 3300026078 Bacteria 1247
700 Ga0207641_10013154 3300026088 Bacteria 6784
701 Ga0207641_10023725 3300026088 Bacteria 5055
702 Ga0207641_10034139 3300026088 Bacteria 4230
703 Ga0207648_10009518 3300026089 Bacteria 9297
704 Ga0207648_10048730 3300026089 Bacteria 3708
705 Ga0207648_10183962 3300026089 Bacteria 1850
706 Ga0207676_10000182 3300026095 Bacteria 55544
707 Ga0207676_10026757 3300026095 Bacteria 4290
708 Ga0207676_10247250 3300026095 Bacteria 1604
709 Ga0207674_10012281 3300026116 Bacteria 9578
710 Ga0207674_10016568 3300026116 Bacteria 8061
711 Ga0207674_10161042 3300026116 Bacteria 2198
712 Ga0207674_10165578 3300026116 Bacteria 2165
713 Ga0207675_100009202 3300026118 Bacteria 9264
714 Ga0207675_100013355 3300026118 Bacteria 7663
715 Ga0207675_100015613 3300026118 Bacteria 7083
716 Ga0207675_100060950 3300026118 Bacteria 3522
717 Ga0207675_100142481 3300026118 Bacteria 2277
718 Ga0207675_100352555 3300026118 Bacteria 1442
719 Ga0207675_100512378 3300026118 Bacteria 1195
720 Ga0207683_10008899 3300026121 Bacteria 8558
721 Ga0207683_10050970 3300026121 Bacteria 3626
722 Ga0207698_10029219 3300026142 Bacteria 3944
723 Ga0209973_1004953 3300027252 Bacteria 1395
724 Ga0209969_1001687 3300027360 Bacteria 3051
725 Ga0209981_1000658 3300027378 Bacteria 4366
726 Ga0209996_1000275 3300027395 Bacteria 6450
727 Ga0209984_1004768 3300027424 Bacteria 1608
728 Ga0210000_1007839 3300027462 Bacteria 1563
729 Ga0209995_1000408 3300027471 Bacteria 6687
730 Ga0209179_1008199 3300027512 Bacteria 1753
731 Ga0209968_1001134 3300027526 Bacteria 4060
732 Ga0209999_1000305 3300027543 Bacteria 7289
733 Ga0209970_1000685 3300027614 Bacteria 5879
734 Ga0210002_1002183 3300027617 Bacteria 2826
735 Ga0209983_1001147 3300027665 Bacteria 5856
736 Ga0209588_1002131 3300027671 Bacteria 5337
737 Ga0209588_1003520 3300027671 Bacteria 4349
738 Ga0209588_1006390 3300027671 Bacteria 3424
739 Ga0209588_1028287 3300027671 Bacteria 1784
740 Ga0209588_1097739 3300027671 Bacteria 945
741 Ga0209971_1000054 3300027682 Bacteria 37135
742 Ga0209966_1000059 3300027695 Bacteria 48677
743 Ga0209966_1001377 3300027695 Bacteria 4251
744 Ga0209998_10000066 3300027717 Bacteria 41640
745 Ga0209998_10001521 3300027717 Bacteria 5575
746 Ga0209998_10005041 3300027717 Bacteria 2775
747 Ga0209998_10005227 3300027717 Bacteria 2721
748 Ga0209813_10000776 3300027866 Bacteria 7259
749 Ga0209974_10001584 3300027876 Bacteria 8235
750 Ga0209974_10004634 3300027876 Bacteria 4889
751 Ga0209974_10037708 3300027876 Bacteria 1605
752 Ga0207428_10000095 3300027907 Bacteria 123199
753 Ga0207428_10000115 3300027907 Bacteria 109072
754 Ga0207428_10000994 3300027907 Bacteria 31445
755 Ga0207428_10001793 3300027907 Bacteria 21978
756 Ga0207428_10004461 3300027907 Bacteria 13282
757 Ga0207428_10010349 3300027907 Bacteria 8337
758 Ga0207428_10012572 3300027907 Bacteria 7427
759 Ga0207428_10099667 3300027907 Bacteria 2246
760 Ga0207428_10110089 3300027907 Bacteria 2121
761 Ga0207428_10318732 3300027907 Bacteria 1148
762 Ga0207428_10338088 3300027907 Bacteria 1109
763 Ga0268266_10096012 3300028379 Bacteria 2604
764 Ga0268266_10396255 3300028379 Bacteria 1305
765 Ga0268265_10006061 3300028380 Bacteria 8213
766 Ga0268265_10046547 3300028380 Bacteria 3243
767 Ga0268265_10061066 3300028380 Bacteria 2891
768 Ga0268265_10244335 3300028380 Bacteria 1586
769 Ga0268264_10015470 3300028381 Bacteria 6255
770 Ga0268264_10183108 3300028381 Bacteria 1904
771 Ga0268264_10211135 3300028381 Bacteria 1782
772 Ga0268264_10244001 3300028381 Bacteria 1665
773 Ga0265337_1000403 3300028556 Bacteria 23321
774 Ga0265338_10026253 3300028800 Bacteria 5882
775 Ga0265338_10323267 3300028800 Bacteria 1116
776 Ga0265763_1000087 3300030763 Bacteria 4099
777 Ga0265773_1002184 3300031018 Bacteria 1159
778 Ga0265760_10011007 3300031090 Bacteria 2584
779 Ga0265325_10000026 3300031241 Bacteria 109937
780 Ga0265325_10001121 3300031241 Bacteria 19201
781 Ga0265325_10001871 3300031241 Bacteria 14513
782 Ga0265325_10027955 3300031241 Bacteria 3044
783 Ga0265340_10113878 3300031247 Bacteria 1248
784 Ga0265339_10000128 3300031249 Bacteria 62891
785 Ga0265339_10061153 3300031249 Bacteria 2028
786 Ga0265313_10000223 3300031595 Bacteria 61143
787 Ga0265313_10008004 3300031595 Bacteria 7094
788 Ga0265313_10016824 3300031595 Bacteria 4191
789 Ga0265313_10090130 3300031595 Bacteria 1378
790 Ga0316579_10005606 3300031691 Bacteria 5079
791 Ga0307407_10123852 3300031903 Bacteria 1643
792 Ga0307409_100248250 3300031995 Bacteria 1625
793 Ga0307416_100007124 3300032002 Bacteria 7070
794 Ga0307416_100136026 3300032002 Bacteria 2223
795 Ga0307411_10111327 3300032005 Bacteria 1960
796 Ga0373948_0000329 3300034817 Bacteria 5778
797 Ga0373948_0003500 3300034817 Bacteria 2421
798 Ga0373950_0001205 3300034818 Bacteria 3335
799 Ga0373958_0000094 3300034819 Bacteria 9294
800 Ga0373958_0006140 3300034819 Bacteria 1858
801 Ga0373959_0000480 3300034820 Bacteria 7330
802 Ga0373938_0000194 3300034957 Bacteria 9090
803 Ga0373938_0002338 3300034957 Bacteria 3050
804 Ga0373928_0000247 3300035084 Bacteria 10651
805 Ga0373928_0000963 3300035084 Bacteria 5644
806 Ga0373929_0000208 3300035085 Bacteria 10586
807 Ga0373934_0130763 3300035086 Bacteria 1024
808 Ga0373940_0000026 3300035088 Bacteria 16296
809 Ga0373940_0004161 3300035088 Bacteria 3035
810 Ga0373940_0007021 3300035088 Bacteria 2527
811 Ga0373944_0000671 3300035089 Bacteria 8184
812 Ga0373949_0001813 3300035090 Bacteria 5835
813 Ga0373949_0003387 3300035090 Bacteria 3821
814 Ga0373949_0016741 3300035090 Bacteria 1646
815 Ga0373949_0038110 3300035090 Bacteria 1172
816 Ga0373951_0000727 3300035091 Bacteria 9041
817 Ga0373951_0009956 3300035091 Bacteria 2135
818 Ga0373951_0015179 3300035091 Bacteria 1734
819 Ga0373952_0000997 3300035092 Bacteria 5173
820 Ga0373952_0026976 3300035092 Bacteria 1251
821 Ga0373923_0022613 3300035111 Bacteria 2467
822 Ga0373923_0028252 3300035111 Bacteria 2243
823 Ga0373923_0058356 3300035111 Bacteria 1634
824 Ga0373932_0000407 3300035112 Bacteria 13181
825 Ga0373932_0001744 3300035112 Bacteria 5904
826 Ga0373932_0003491 3300035112 Bacteria 3775
827 Ga0373932_0071713 3300035112 Unclassified 1076
828 Ga0373936_0003453 3300035113 Bacteria 5928
829 Ga0373939_0000587 3300035114 Bacteria 9064
830 Ga0373939_0001754 3300035114 Bacteria 5227
831 Ga0373939_0032056 3300035114 Bacteria 1524
832 Ga0373941_0007006 3300035115 Bacteria 2740
833 Ga0373941_0010097 3300035115 Bacteria 2399
834 Ga0373941_0015027 3300035115 Bacteria 2080
835 Ga0373941_0035246 3300035115 Bacteria 1514
836 Ga0373941_0116338 3300035115 Bacteria 948
837 Ga0373945_0004819 3300035116 Bacteria 4298
838 Ga0373945_0012078 3300035116 Bacteria 2863
839 Ga0373953_0023257 3300035117 Bacteria 2345
840 Ga0373953_0145289 3300035117 Bacteria 1015
841 Ga0373954_0001647 3300035118 Bacteria 9138
842 Ga0373956_0007852 3300035119 Bacteria 4306
843 Ga0373956_0033736 3300035119 Bacteria 2252
844 Ga0373956_0105548 3300035119 Bacteria 1309
845 Ga0373957_0030354 3300035120 Bacteria 1981
846 Ga0373957_0032910 3300035120 Bacteria 1912
847 Ga0373957_0034628 3300035120 Bacteria 1872
848 Ga0373960_0000582 3300035121 Bacteria 7460
849 Ga0373960_0004777 3300035121 Bacteria 3119
850 Ga0373960_0025997 3300035121 Bacteria 1596
851 Ga0373943_0004095 3300035170 Bacteria 6619
852 Ga0373943_0010807 3300035170 Bacteria 4097
853 Ga0373943_0222933 3300035170 Bacteria 1051
854 Ga0373946_0003226 3300035171 Bacteria 5789
855 Ga0373946_0010987 3300035171 Bacteria 3366
856 Ga0373946_0012694 3300035171 Bacteria 3156
857 Ga0373955_0001161 3300035172 Bacteria 11178
858 Ga0373955_0006219 3300035172 Bacteria 5431
859 Ga0373955_0010246 3300035172 Bacteria 4420
860 Ga0373955_0030028 3300035172 Bacteria 2833
861 Ga0373955_0156070 3300035172 Bacteria 1344
862 Ga0373942_0000429 3300035207 Bacteria 11745
863 Ga0373942_0001181 3300035207 Bacteria 6902
864 Ga0373942_0009403 3300035207 Bacteria 2289
865 Ga0373961_0001623 3300035241 Bacteria 6349
866 Ga0373961_0007174 3300035241 Bacteria 2690
867 Ga0373961_0035017 3300035241 Bacteria 1423
868 Ga0373962_0000098 3300035242 Bacteria 19016
869 Ga0373962_0003444 3300035242 Bacteria 3798
870 Ga0373962_0009516 3300035242 Bacteria 2410
871 Ga0373962_0020497 3300035242 Bacteria 1737
872 Ga0373924_0004747 3300035410 Bacteria 4771
873 Ga0373924_0039137 3300035410 Bacteria 1937
874 Ga0373931_0000208 3300035691 Bacteria 25048
875 Ga0373931_0000378 3300035691 Bacteria 18340
876 Ga0373931_0002812 3300035691 Bacteria 7751
877 Ga0373931_0002834 3300035691 Bacteria 7732
878 Ga0373931_0045072 3300035691 Bacteria 2327
879 Ga0373931_0067852 3300035691 Bacteria 1939
880 Ga0373931_0236585 3300035691 Bacteria 1105
881 Ga0373935_0019863 3300035692 Bacteria 4100
882 Ga0373935_0081297 3300035692 Bacteria 2106
883 Ga0373935_0126598 3300035692 Bacteria 1712
884 Ga0373935_0179900 3300035692 Bacteria 1451
885 Ga0373935_0204751 3300035692 Bacteria 1365
886 Ga0373927_0003203 3300035695 Bacteria 11789
887 Ga0373927_0028014 3300035695 Bacteria 3676
888 Ga0373927_0035441 3300035695 Bacteria 3244
889 Ga0373927_0045572 3300035695 Bacteria 2836
890 Ga0373927_0102437 3300035695 Bacteria 1862
891 Ga0373927_0132494 3300035695 Bacteria 1629
892 Ga0373933_0000862 3300035724 Bacteria 18590
893 Ga0373933_0017896 3300035724 Bacteria 3979
894 Ga0373933_0093509 3300035724 Bacteria 1858
895 Ga0373947_0000063 3300035725 Bacteria 53746
896 Ga0373947_0028401 3300035725 Bacteria 3280
897 Ga0373947_0039226 3300035725 Bacteria 2817
898 Ga0373937_0004708 3300036401 Bacteria 11605
899 Ga0373937_0009801 3300036401 Bacteria 8352
900 Ga0373937_0016752 3300036401 Bacteria 6514
901 Ga0373937_0018534 3300036401 Bacteria 6217
902 Ga0373937_0021905 3300036401 Bacteria 5738
903 Ga0373937_0170380 3300036401 Bacteria 2043
904 Ga0373937_0626001 3300036401 Bacteria 1021
905 Ga0373925_0000456 3300037068 Bacteria 41315
906 Ga0373925_0025094 3300037068 Bacteria 4353
907 Ga0373925_0030749 3300037068 Bacteria 3942
908 Ga0373925_0054744 3300037068 Bacteria 2984
909 Ga0373925_0244329 3300037068 Bacteria 1438
910 Ga0373925_0246133 3300037068 Bacteria 1433
911 Ga0373925_0505213 3300037068 Bacteria 993
912 Ga0395899_0047620 3300037312 Bacteria 3191
913 Ga0395899_0059863 3300037312 Bacteria 2807
914 Ga0395900_0028085 3300037418 Bacteria 5761
915 Ga0395900_0101403 3300037418 Bacteria 2957
916 Ga0395900_0118889 3300037418 Bacteria 2712
917 Ga0395898_0003646 3300037466 Bacteria 17121
918 Ga0395898_0019646 3300037466 Bacteria 6872
919 Ga0395898_0360203 3300037466 Bacteria 1387
920 Ga0395905_0027008 3300037471 Bacteria 5413
921 Ga0395905_0347015 3300037471 Bacteria 1376
922 Ga0436364_0394206 3300037853 Bacteria 2066
923 Ga0436364_0547572 3300037853 Bacteria 21281
924 Ga0436364_0602945 3300037853 Bacteria 1461
925 Ga0436364_1157451 3300037853 Bacteria 1366
926 Ga0395901_0006664 3300038443 Bacteria 11672
927 Ga0395901_0071224 3300038443 Bacteria 3622
928 Ga0395901_0560527 3300038443 Bacteria 1157
929 Ga0436365_0927538 3300039437 Bacteria 5894
930 Ga0436360_0059562 3300039438 Bacteria 1755
931 Ga0436360_0839106 3300039438 Bacteria 2004
932 Ga0436361_0303893 3300039447 Bacteria 1825
933 Ga0436361_0952666 3300039447 Bacteria 8602
934 Ga0436363_0574967 3300039450 Bacteria 1745
935 Ga0436362_0171704 3300039453 Bacteria 1494
936 Ga0436362_0527587 3300039453 Bacteria 6786
937 Ga0436362_0676786 3300039453 Bacteria 2164
938 Ga0436362_1170800 3300039453 Bacteria 1225
939 Ga0439455_0018214 3300042012 Bacteria 1645
940 Ga0439460_0006679 3300042461 Bacteria 2867
941 Ga0451577_0002938 3300042876 Bacteria 19529
942 Ga0451577_0010773 3300042876 Bacteria 8699
943 Ga0451577_0047989 3300042876 Bacteria 3816
944 Ga0451577_0147867 3300042876 Bacteria 2113
945 Ga0451577_0291686 3300042876 Bacteria 1478
946 Ga0439440_0023425 3300042993 Bacteria 1408
947 Ga0453683_0008017 3300044673 Bacteria 7117
948 Ga0453683_0008336 3300044673 Bacteria 6963
949 Ga0453683_0014702 3300044673 Bacteria 5079
950 Ga0453683_0030929 3300044673 Bacteria 3383
951 Ga0466963_0149356 3300044694 Bacteria 1622
952 Ga0453684_0010714 3300044712 Bacteria 15585
953 Ga0466957_0077050 3300044842 Bacteria 2071
954 Ga0466959_0428557 3300045049 Bacteria 897
955 Ga0451576_0007972 3300045051 Bacteria 12526
956 Ga0451576_0013391 3300045051 Bacteria 9176
957 Ga0451576_0028084 3300045051 Bacteria 6032
958 Ga0451576_0041637 3300045051 Bacteria 4855
959 Ga0451576_0286310 3300045051 Bacteria 1723
960 Ga0451576_0629281 3300045051 Bacteria 1127
961 Ga0466958_0002114 3300045836 Bacteria 9857
962 Ga0466967_0348141 3300045976 Bacteria 1434
963 Ga0495592_0009003 3300046454 Bacteria 7501
964 Ga0495592_0087482 3300046454 Bacteria 2241
965 Ga0495603_0089296 3300046455 Bacteria 1803
966 Ga0495603_0113697 3300046455 Bacteria 1578
967 Ga0495591_013259 3300046458 Bacteria 3027
968 Ga0495629_0000183 3300046459 Bacteria 56534
969 Ga0495629_0039835 3300046459 Bacteria 3306
970 Ga0495641_0020362 3300046461 Bacteria 3365
971 Ga0495651_0006676 3300046462 Bacteria 8825
972 Ga0495651_0018701 3300046462 Bacteria 5368
973 Ga0495653_0008179 3300046463 Bacteria 8565
974 Ga0495653_0017231 3300046463 Bacteria 5875
975 Ga0495580_0002500 3300046472 Bacteria 16034
976 Ga0495580_0015636 3300046472 Bacteria 5718
977 Ga0495580_0016429 3300046472 Bacteria 5553
978 Ga0495582_0001121 3300046473 Bacteria 15057
979 Ga0495582_0005330 3300046473 Bacteria 7180
980 Ga0495639_0004781 3300046475 Bacteria 5822
981 Ga0495639_0005312 3300046475 Bacteria 5548
982 Ga0495639_0074363 3300046475 Bacteria 1574
983 Ga0495662_0003069 3300046476 Bacteria 8421
984 Ga0495662_0024079 3300046476 Bacteria 2937
985 Ga0495664_0000985 3300046477 Bacteria 14643
986 Ga0495664_0011771 3300046477 Bacteria 4938
987 Ga0495664_0116674 3300046477 Bacteria 1614
988 Ga0495584_0005357 3300046491 Bacteria 6798
989 Ga0495584_0026836 3300046491 Bacteria 2919
990 Ga0495584_0161522 3300046491 Bacteria 1139
991 Ga0495585_0003428 3300046492 Bacteria 10719
992 Ga0495585_0038564 3300046492 Bacteria 2689
993 Ga0495594_0005327 3300046499 Bacteria 6605
994 Ga0495607_0004302 3300046501 Bacteria 10510
995 Ga0495608_0020500 3300046511 Bacteria 4544
996 Ga0495608_0072303 3300046511 Bacteria 2250
997 Ga0495618_0030133 3300046514 Bacteria 3387
998 Ga0495618_0060862 3300046514 Bacteria 2394
999 Ga0495618_0093158 3300046514 Bacteria 1926
1000 Ga0495628_0000950 3300046516 Bacteria 26607
1001 Ga0495628_0045893 3300046516 Bacteria 3473
1002 Ga0495628_0109277 3300046516 Bacteria 2128
1003 Ga0495628_0215428 3300046516 Bacteria 1443
1004 Ga0495630_0022663 3300046517 Bacteria 4638
1005 Ga0495630_0030670 3300046517 Bacteria 4001
1006 Ga0495644_0002500 3300046523 Bacteria 7335
1007 Ga0495663_0006714 3300046525 Bacteria 3172
1008 Ga0495666_0011155 3300046526 Bacteria 4483
1009 Ga0495666_0055294 3300046526 Bacteria 1902
1010 Ga0495652_0002257 3300046529 Bacteria 20113
1011 Ga0495652_0011919 3300046529 Bacteria 7861
1012 Ga0495652_0264152 3300046529 Bacteria 1269
1013 Ga0495665_0004860 3300046531 Bacteria 7248
1014 Ga0495665_0012011 3300046531 Bacteria 4687
1015 Ga0495665_0014988 3300046531 Bacteria 4176
1016 Ga0495665_0039931 3300046531 Bacteria 2499
1017 Ga0495640_0003512 3300046533 Bacteria 12603
1018 Ga0495640_0015931 3300046533 Bacteria 5639
1019 Ga0495640_0045939 3300046533 Bacteria 3028
1020 Ga0495586_0009397 3300046535 Bacteria 5204
1021 Ga0495586_0038529 3300046535 Bacteria 2568
1022 Ga0495587_0018856 3300046536 Bacteria 4276
1023 Ga0495587_0035272 3300046536 Bacteria 3013
1024 Ga0495587_0064445 3300046536 Bacteria 2141
1025 Ga0495598_0000533 3300046537 Bacteria 7095
1026 Ga0495645_0001487 3300046543 Bacteria 15879
1027 Ga0495622_0017959 3300046557 Bacteria 3294
1028 Ga0495633_0005806 3300046558 Bacteria 7447
1029 Ga0495667_0029180 3300046559 Bacteria 3712
1030 Ga0495656_0000174 3300046615 Bacteria 22784
1031 Ga0495656_0004785 3300046615 Bacteria 4657
1032 Ga0495634_0023394 3300046642 Bacteria 4343
1033 Ga0495634_0062176 3300046642 Bacteria 2480
1034 Ga0495611_0007327 3300046648 Bacteria 4687
1035 Ga0495635_0027480 3300046663 Bacteria 3957
1036 Ga0495635_0039670 3300046663 Bacteria 3256
1037 Ga0495659_0005884 3300046664 Bacteria 3874
1038 Ga0495659_0021634 3300046664 Bacteria 2169
1039 Ga0495588_0004659 3300046674 Bacteria 6055
1040 Ga0495657_0013257 3300046675 Bacteria 6088
1041 Ga0495657_0130430 3300046675 Bacteria 1575
1042 Ga0495657_0228417 3300046675 Bacteria 1127
1043 Ga0495599_0004908 3300046678 Bacteria 7950
1044 Ga0495646_0021538 3300046680 Bacteria 4071
1045 Ga0495647_0022108 3300046681 Bacteria 2296
1046 Ga0495658_0000357 3300046683 Bacteria 25736
1047 Ga0495658_0009249 3300046683 Bacteria 4901
1048 Ga0495658_0052359 3300046683 Unclassified 2315
1049 Ga0495669_0008623 3300046684 Bacteria 4290
1050 Ga0495613_0009388 3300046689 Bacteria 7258
1051 Ga0495613_0022688 3300046689 Bacteria 4676
1052 Ga0495613_0035886 3300046689 Bacteria 3677
1053 Ga0495613_0087731 3300046689 Bacteria 2255
1054 Ga0495624_0009217 3300046690 Bacteria 6839
1055 Ga0495670_0000414 3300046691 Bacteria 20494
1056 Ga0495670_0067721 3300046691 Bacteria 1803
1057 Ga0495600_0025547 3300046809 Bacteria 3807
1058 Ga0495600_0112212 3300046809 Bacteria 1775
1059 Ga0495604_0007509 3300047317 Bacteria 8627
1060 Ga0495604_0011926 3300047317 Bacteria 6911
1061 Ga0495604_0145118 3300047317 Bacteria 1692
1062 Ga0495636_0081489 3300047318 Bacteria 1394
1063 Ga0495674_0012673 3300047319 Bacteria 7945
1064 Ga0495674_0033762 3300047319 Bacteria 4631
1065 Ga0495676_0026061 3300047321 Bacteria 5037
1066 Ga0495676_0026597 3300047321 Bacteria 4978
1067 Ga0495680_0005045 3300047322 Bacteria 12473
1068 Ga0495680_0005049 3300047322 Bacteria 12462
1069 Ga0495680_0016567 3300047322 Bacteria 6327
1070 Ga0495680_0017512 3300047322 Bacteria 6114
1071 Ga0495680_0042665 3300047322 Bacteria 3597
1072 Ga0495680_0160590 3300047322 Bacteria 1632
1073 Ga0495680_0222280 3300047322 Bacteria 1348
1074 Ga0495677_0064907 3300047445 Bacteria 1357
1075 Ga0495684_0007856 3300047471 Bacteria 8255
1076 Ga0495684_0039176 3300047471 Bacteria 3633
1077 Ga0495684_0094065 3300047471 Bacteria 2270
1078 Ga0495684_0171006 3300047471 Bacteria 1616
1079 Ga0495684_0388382 3300047471 Bacteria 983
1080 Ga0495593_0089866 3300047673 Bacteria 1582
1081 Ga0495593_0096419 3300047673 Bacteria 1520
1082 Ga0495602_0004084 3300048088 Bacteria 15203
1083 Ga0495602_0393214 3300048088 Bacteria 990
1084 Ga0495614_0004206 3300048089 Bacteria 6487
1085 Ga0496100_0002624 3300048903 Bacteria 9166
1086 Ga0496100_0031631 3300048903 Bacteria 3291
1087 Ga0496101_0003320 3300048904 Bacteria 10009
1088 Ga0496101_0021084 3300048904 Bacteria 4472
1089 Ga0496101_0121450 3300048904 Bacteria 1975
1090 Ga0496101_0334346 3300048904 Bacteria 1189
1091 Ga0496102_0004597 3300048905 Bacteria 11674
1092 Ga0496102_0024560 3300048905 Bacteria 5357
1093 Ga0496102_0024748 3300048905 Bacteria 5340
1094 Ga0496102_0053297 3300048905 Bacteria 3687
1095 Ga0496102_0057801 3300048905 Bacteria 3543
1096 Ga0496103_0059587 3300048906 Bacteria 2371
1097 Ga0496103_0117878 3300048906 Bacteria 1690
1098 Ga0496104_0001363 3300048907 Bacteria 21131
1099 Ga0496104_0003990 3300048907 Bacteria 12779
1100 Ga0496104_0041939 3300048907 Bacteria 4292
1101 Ga0496104_0070905 3300048907 Bacteria 3313
1102 Ga0496104_0092760 3300048907 Bacteria 2887
1103 Ga0496104_0118210 3300048907 Bacteria 2544
1104 Ga0496104_0469800 3300048907 Bacteria 1169
1105 Ga0496105_0002131 3300048908 Bacteria 14342
1106 Ga0496105_0054552 3300048908 Bacteria 3300
1107 Ga0496105_0057880 3300048908 Bacteria 3199
1108 Ga0496105_0062655 3300048908 Bacteria 3069
1109 Ga0496105_0273775 3300048908 Bacteria 1363
1110 Ga0496106_0004015 3300048909 Bacteria 10998
1111 Ga0496106_0030341 3300048909 Bacteria 4032
1112 Ga0496106_0069185 3300048909 Bacteria 2694
1113 Ga0496106_0133050 3300048909 Bacteria 1951
1114 Ga0496107_0005878 3300048910 Bacteria 8404
1115 Ga0496107_0018210 3300048910 Bacteria 4943
1116 Ga0496107_0142725 3300048910 Bacteria 1770
1117 Ga0496107_0318122 3300048910 Bacteria 1158
1118 Ga0496108_0002494 3300048911 Bacteria 14730
1119 Ga0496108_0002969 3300048911 Bacteria 13629
1120 Ga0496108_0012544 3300048911 Bacteria 6902
1121 Ga0496108_0032485 3300048911 Bacteria 4335
1122 Ga0496109_0000567 3300048912 Bacteria 30903
1123 Ga0496109_0000700 3300048912 Bacteria 27897
1124 Ga0496109_0030748 3300048912 Bacteria 4812
1125 Ga0496109_0060988 3300048912 Bacteria 3447
1126 Ga0496110_0018844 3300048913 Bacteria 5797
1127 Ga0496110_0132757 3300048913 Bacteria 2249
1128 Ga0496110_0168318 3300048913 Bacteria 1988
1129 Ga0496111_0038074 3300048914 Bacteria 3444
1130 Ga0496111_0051208 3300048914 Bacteria 2981
1131 Ga0496111_0192846 3300048914 Bacteria 1515
1132 Ga0496112_0059918 3300048915 Bacteria 3751
1133 Ga0496112_0075501 3300048915 Bacteria 3333
1134 Ga0496112_0106098 3300048915 Bacteria 2779
1135 Ga0496112_0126720 3300048915 Bacteria 2524
1136 Ga0496112_0130559 3300048915 Bacteria 2483
1137 Ga0496112_0137191 3300048915 Bacteria 2416
1138 Ga0496112_0466303 3300048915 Bacteria 1200
1139 Ga0496113_0020581 3300048916 Bacteria 4641
1140 Ga0496113_0026105 3300048916 Bacteria 4173
1141 Ga0496113_0044851 3300048916 Bacteria 3276
1142 Ga0496113_0066967 3300048916 Bacteria 2721
1143 Ga0496114_0003201 3300048917 Bacteria 12556
1144 Ga0496114_0011484 3300048917 Bacteria 7078
1145 Ga0496114_0249967 3300048917 Bacteria 1560
1146 Ga0496114_0353961 3300048917 Bacteria 1299
1147 Ga0496115_0001922 3300048918 Bacteria 14830
1148 Ga0496115_0211520 3300048918 Bacteria 1601
1149 Ga0501031_0121441 3300049568 Bacteria 1707
1150 Ga0501033_0101077 3300049570 Bacteria 2104
1151 Ga0501034_0198405 3300049571 Bacteria 1966
1152 Ga0501036_0044537 3300049572 Bacteria 3759
1153 Ga0501036_0085596 3300049572 Bacteria 2665
1154 Ga0501036_0152631 3300049572 Bacteria 1948
1155 Ga0501036_0193367 3300049572 Bacteria 1712
1156 Ga0501036_0321558 3300049572 Bacteria 1293
1157 Ga0501038_0049333 3300049574 Bacteria 3640
1158 Ga0501038_0096101 3300049574 Bacteria 2474
1159 Ga0501038_0164353 3300049574 Bacteria 1801
1160 Ga0501038_0287151 3300049574 Bacteria 1294
1161 Ga0501038_0324640 3300049574 Bacteria 1203
1162 Ga0501039_0085660 3300049575 Bacteria 2454
1163 Ga0501039_0113447 3300049575 Bacteria 2120
1164 Ga0501039_0226100 3300049575 Bacteria 1471
1165 Ga0501039_0333742 3300049575 Bacteria 1191
1166 Ga0501040_0002141 3300049576 Bacteria 12750
1167 Ga0501040_0030566 3300049576 Bacteria 3639
1168 Ga0501040_0054680 3300049576 Bacteria 2737
1169 Ga0501040_0073028 3300049576 Bacteria 2370
1170 Ga0501040_0073621 3300049576 Bacteria 2361
1171 Ga0501040_0074249 3300049576 Bacteria 2350
1172 Ga0501041_0007435 3300049577 Bacteria 6433
1173 Ga0501041_0018927 3300049577 Bacteria 4103
1174 Ga0501041_0022986 3300049577 Bacteria 3736
1175 Ga0501041_0081816 3300049577 Bacteria 1989
1176 Ga0501041_0159025 3300049577 Bacteria 1412
1177 Ga0501041_0170283 3300049577 Bacteria 1363
1178 Ga0501041_0192775 3300049577 Bacteria 1277
1179 Ga0501041_0221865 3300049577 Unclassified 1186
1180 Ga0501042_0008901 3300049578 Bacteria 6658
1181 Ga0501042_0088045 3300049578 Bacteria 2228
1182 Ga0501042_0217267 3300049578 Bacteria 1379
1183 Ga0501042_0298089 3300049578 Bacteria 1165
1184 Ga0501042_0381994 3300049578 Bacteria 1020
1185 Ga0501043_0207996 3300049579 Bacteria 1517
1186 Ga0501046_0000202 3300049580 Bacteria 61588
1187 Ga0501046_0005938 3300049580 Bacteria 10875
1188 Ga0501046_0153262 3300049580 Bacteria 1738
1189 Ga0501046_0171445 3300049580 Bacteria 1628
1190 Ga0501046_0234006 3300049580 Bacteria 1356
1191 Ga0501046_0241841 3300049580 Bacteria 1331
1192 Ga0501046_0288764 3300049580 Bacteria 1200
1193 Ga0501047_0011524 3300049581 Bacteria 8370
1194 Ga0501048_0010069 3300049582 Bacteria 7071
1195 Ga0501048_0038900 3300049582 Bacteria 3413
1196 Ga0501048_0044811 3300049582 Bacteria 3161
1197 Ga0501048_0050849 3300049582 Bacteria 2951
1198 Ga0501068_0058865 3300049584 Bacteria 2332
1199 Ga0501068_0091802 3300049584 Bacteria 1874
1200 Ga0501068_0190452 3300049584 Bacteria 1299
1201 Ga0501069_0022684 3300049585 Bacteria 3418
1202 Ga0501069_0030459 3300049585 Bacteria 2963
1203 Ga0501069_0048647 3300049585 Bacteria 2355
1204 Ga0501070_0004890 3300049586 Bacteria 11446
1205 Ga0501070_0011260 3300049586 Bacteria 7554
1206 Ga0501070_0236539 3300049586 Bacteria 1496
1207 Ga0501070_0428371 3300049586 Bacteria 1068
1208 Ga0501071_0034066 3300049587 Bacteria 3622
1209 Ga0501071_0065926 3300049587 Bacteria 2630
1210 Ga0501071_0192040 3300049587 Bacteria 1532
1211 Ga0501071_0375914 3300049587 Bacteria 1083
1212 Ga0501072_0003682 3300049588 Bacteria 11563
1213 Ga0501072_0007452 3300049588 Bacteria 8299
1214 Ga0501072_0007995 3300049588 Bacteria 8026
1215 Ga0501072_0012547 3300049588 Bacteria 6479
1216 Ga0501072_0022079 3300049588 Bacteria 4938
1217 Ga0501072_0034538 3300049588 Bacteria 3963
1218 Ga0501072_0065382 3300049588 Bacteria 2868
1219 Ga0501072_0067177 3300049588 Bacteria 2829
1220 Ga0501072_0086164 3300049588 Bacteria 2493
1221 Ga0501072_0151314 3300049588 Bacteria 1850
1222 Ga0501072_0280225 3300049588 Bacteria 1326
1223 Ga0501073_0214970 3300049589 Bacteria 1328
1224 Ga0501073_0254348 3300049589 Bacteria 1213
1225 Ga0501073_0362589 3300049589 Bacteria 1001
1226 Ga0501074_0003506 3300049590 Bacteria 11135
1227 Ga0501074_0080532 3300049590 Bacteria 2336
1228 Ga0501074_0127922 3300049590 Bacteria 1818
1229 Ga0501074_0305735 3300049590 Bacteria 1130
1230 Ga0501075_0000015 3300049591 Bacteria 73176
1231 Ga0501075_0013081 3300049591 Bacteria 5915
1232 Ga0501075_0021136 3300049591 Bacteria 4741
1233 Ga0501075_0031171 3300049591 Bacteria 3956
1234 Ga0501075_0035326 3300049591 Bacteria 3727
1235 Ga0501075_0084938 3300049591 Bacteria 2398
1236 Ga0501075_0087936 3300049591 Bacteria 2355
1237 Ga0501075_0093546 3300049591 Bacteria 2282
1238 Ga0501075_0130836 3300049591 Bacteria 1912
1239 Ga0501075_0131996 3300049591 Bacteria 1903
1240 Ga0501075_0148291 3300049591 Bacteria 1788
1241 Ga0501075_0177477 3300049591 Bacteria 1625
1242 Ga0501075_0288068 3300049591 Bacteria 1251
1243 Ga0501076_0000009 3300049592 Bacteria 117970
1244 Ga0501076_0004495 3300049592 Bacteria 9936
1245 Ga0501076_0012229 3300049592 Bacteria 6417
1246 Ga0501076_0026997 3300049592 Bacteria 4452
1247 Ga0501076_0031210 3300049592 Bacteria 4154
1248 Ga0501076_0033267 3300049592 Bacteria 4026
1249 Ga0501076_0043209 3300049592 Bacteria 3550
1250 Ga0501076_0088236 3300049592 Bacteria 2493
1251 Ga0501076_0107872 3300049592 Bacteria 2249
1252 Ga0501076_0185645 3300049592 Bacteria 1696
1253 Ga0501076_0223907 3300049592 Bacteria 1537
1254 Ga0501076_0273865 3300049592 Bacteria 1382
1255 Ga0501076_0347744 3300049592 Bacteria 1217
1256 Ga0501076_0367025 3300049592 Bacteria 1183
1257 Ga0501077_0003889 3300049593 Bacteria 8991
1258 Ga0501077_0004301 3300049593 Bacteria 8621
1259 Ga0501077_0009362 3300049593 Bacteria 6085
1260 Ga0501077_0010538 3300049593 Bacteria 5756
1261 Ga0501077_0016590 3300049593 Bacteria 4641
1262 Ga0501077_0017209 3300049593 Bacteria 4559
1263 Ga0501077_0044084 3300049593 Bacteria 2834
1264 Ga0501077_0044757 3300049593 Bacteria 2811
1265 Ga0501077_0051531 3300049593 Bacteria 2615
1266 Ga0501077_0062092 3300049593 Bacteria 2371
1267 Ga0501077_0117575 3300049593 Bacteria 1685
1268 Ga0501077_0123457 3300049593 Bacteria 1641
1269 Ga0501077_0131598 3300049593 Bacteria 1586
1270 Ga0501077_0159626 3300049593 Bacteria 1431
1271 Ga0501077_0369858 3300049593 Bacteria 915
1272 Ga0501079_0001591 3300049741 Bacteria 16135
1273 Ga0501079_0003432 3300049741 Bacteria 11636
1274 Ga0501079_0006275 3300049741 Bacteria 8916
1275 Ga0501079_0010724 3300049741 Bacteria 6979
1276 Ga0501079_0014788 3300049741 Bacteria 5950
1277 Ga0501079_0019477 3300049741 Bacteria 5183
1278 Ga0501079_0040193 3300049741 Bacteria 3607
1279 Ga0501079_0042564 3300049741 Bacteria 3506
1280 Ga0501079_0053552 3300049741 Bacteria 3113
1281 Ga0501079_0106662 3300049741 Bacteria 2174
1282 Ga0501079_0191202 3300049741 Bacteria 1597
1283 Ga0501079_0270565 3300049741 Bacteria 1328
1284 Ga0501080_0024856 3300049742 Bacteria 5555
1285 Ga0501080_0027475 3300049742 Bacteria 5291
1286 Ga0501080_0049950 3300049742 Bacteria 3893
1287 Ga0501080_0066436 3300049742 Bacteria 3354
1288 Ga0501080_0068032 3300049742 Bacteria 3313
1289 Ga0501080_0101462 3300049742 Bacteria 2670
1290 Ga0501080_0124687 3300049742 Bacteria 2386
1291 Ga0501080_0162517 3300049742 Bacteria 2062
1292 Ga0501081_0000638 3300049743 Bacteria 20012
1293 Ga0501081_0001332 3300049743 Bacteria 15068
1294 Ga0501081_0001545 3300049743 Bacteria 14161
1295 Ga0501081_0002541 3300049743 Bacteria 11498
1296 Ga0501081_0003211 3300049743 Bacteria 10388
1297 Ga0501081_0016150 3300049743 Bacteria 4931
1298 Ga0501081_0026352 3300049743 Bacteria 3919
1299 Ga0501081_0029162 3300049743 Bacteria 3727
1300 Ga0501081_0137164 3300049743 Bacteria 1752
1301 Ga0501081_0138221 3300049743 Bacteria 1745
1302 Ga0501081_0200519 3300049743 Bacteria 1447
1303 Ga0501081_0232172 3300049743 Bacteria 1344
1304 Ga0501081_0460240 3300049743 Unclassified 946
1305 Ga0501083_0003824 3300049744 Bacteria 10573
1306 Ga0501083_0068975 3300049744 Bacteria 2353
1307 Ga0501083_0277034 3300049744 Bacteria 1091
1308 Ga0501083_0299061 3300049744 Bacteria 1047
1309 Ga0501035_0001465 3300049822 Bacteria 24189
1310 Ga0501035_0049331 3300049822 Bacteria 3773
1311 Ga0501035_0099292 3300049822 Bacteria 2555
1312 Ga0501044_0424871 3300049823 Bacteria 1239
1313 Ga0501045_0002814 3300049824 Bacteria 11882
1314 Ga0501045_0017685 3300049824 Bacteria 5063
1315 Ga0501045_0018478 3300049824 Bacteria 4959
1316 Ga0501045_0021239 3300049824 Bacteria 4643
1317 Ga0501045_0075111 3300049824 Bacteria 2489
1318 Ga0501045_0102771 3300049824 Bacteria 2116
1319 Ga0501045_0106731 3300049824 Bacteria 2075
1320 Ga0501045_0124230 3300049824 Bacteria 1917
1321 Ga0501045_0134925 3300049824 Bacteria 1835
1322 Ga0501045_0168123 3300049824 Bacteria 1633
1323 Ga0501045_0222238 3300049824 Bacteria 1406
1324 nmdc:mga03683_136949_c1 3300050489 Bacteria 1098
1325 nmdc:mga03683_26975_c1 3300050489 Bacteria 2271
1326 nmdc:mga03n38_2661_c1 3300050490 Bacteria 5574
1327 nmdc:mga00v17_31547_c1 3300050491 Bacteria 3126
1328 nmdc:mga00v17_38630_c1 3300050491 Bacteria 2855
1329 nmdc:mga0yw44_144532_c1 3300050492 Bacteria 1548
1330 nmdc:mga0yw44_21453_c1 3300050492 Bacteria 3603
1331 nmdc:mga0yw44_72940_c1 3300050492 Bacteria 2135
1332 nmdc:mga0k408_38643_c1 3300050493 Bacteria 2740
1333 nmdc:mga06z11_121413_c1 3300050494 Bacteria 1458
1334 nmdc:mga06z11_1418_c1 3300050494 Bacteria 8905
1335 nmdc:mga06z11_216927_c1 3300050494 Bacteria 1117
1336 nmdc:mga06z11_920_c1 3300050494 Bacteria 10721
1337 nmdc:mga04h51_741_c1 3300050495 Bacteria 7534
1338 nmdc:mga07m45_32220_c1 3300050496 Bacteria 1856
1339 nmdc:mga07m45_88419_c1 3300050496 Bacteria 1773
1340 nmdc:mga05p37_164000_c1 3300050507 Bacteria 2713
1341 nmdc:mga05p37_168600_c1 3300050507 Bacteria 2671
1342 nmdc:mga05p37_202605_c1 3300050507 Bacteria 2402
1343 nmdc:mga05p37_2276_c1 3300050507 Bacteria 22378
1344 nmdc:mga05p37_243725_c1 3300050507 Bacteria 2159
1345 nmdc:mga05p37_245_c1 3300050507 Bacteria 55562
1346 nmdc:mga05p37_27321_c1 3300050507 Bacteria 6948
1347 nmdc:mga05p37_29250_c1 3300050507 Bacteria 6725
1348 nmdc:mga05p37_3626_c1 3300050507 Bacteria 18046
1349 nmdc:mga05p37_37199_c1 3300050507 Bacteria 5969
1350 nmdc:mga05p37_41494_c2 3300050507 Bacteria 4419
1351 nmdc:mga05p37_44322_c1 3300050507 Bacteria 5473
1352 nmdc:mga05p37_5774_c1 3300050507 Bacteria 14558
1353 nmdc:mga05p37_59608_c1 3300050507 Bacteria 4701
1354 nmdc:mga05p37_63431_c1 3300050507 Bacteria 4547
1355 nmdc:mga05p37_63918_c1 3300050507 Bacteria 4529
1356 nmdc:mga05p37_660_c1 3300050507 Bacteria 38072
1357 nmdc:mga05p37_74_c1 3300050507 Bacteria 87063
1358 nmdc:mga05p37_8121_c1 3300050507 Bacteria 12404
1359 nmdc:mga05p37_828_c1 3300050507 Bacteria 34679
1360 nmdc:mga05p37_9368_c2 3300050507 Bacteria 11175
1361 nmdc:mga05p37_959688_c1 3300050507 Bacteria 914
1362 nmdc:mga05p37_96329_c1 3300050507 Bacteria 3645
1363 nmdc:mga05p37_9811_c1 3300050507 Bacteria 11365
1364 nmdc:mga09592_12180_c1 3300050508 Bacteria 7001
1365 nmdc:mga09592_1333_c1 3300050508 Bacteria 19776
1366 nmdc:mga09592_199693_c1 3300050508 Bacteria 1732
1367 nmdc:mga09592_22332_c1 3300050508 Bacteria 5222
1368 nmdc:mga09592_25067_c1 3300050508 Bacteria 4934
1369 nmdc:mga09592_256041_c1 3300050508 Unclassified 1517
1370 nmdc:mga09592_409132_c1 3300050508 Bacteria 1172
1371 nmdc:mga09592_420_c1 3300050508 Bacteria 31188
1372 nmdc:mga09592_640_c1 3300050508 Bacteria 26615
1373 nmdc:mga09592_8944_c1 3300050508 Bacteria 8142
1374 nmdc:mga09592_913_c1 3300050508 Bacteria 23219
1375 nmdc:mga0qj67_102897_c1 3300050509 Bacteria 2303
1376 nmdc:mga0qj67_130738_c1 3300050509 Bacteria 2033
1377 nmdc:mga0qj67_14779_c1 3300050509 Bacteria 5901
1378 nmdc:mga0qj67_165_c1 3300050509 Bacteria 44307
1379 nmdc:mga0qj67_19555_c1 3300050509 Bacteria 5175
1380 nmdc:mga0qj67_31467_c1 3300050509 Bacteria 4133
1381 nmdc:mga0qj67_352807_c1 3300050509 Bacteria 1189
1382 nmdc:mga0qj67_527_c1 3300050509 Bacteria 26037
1383 nmdc:mga0qj67_97437_c1 3300050509 Bacteria 2368
1384 nmdc:mga06r32_108289_c1 3300050510 Bacteria 2732
1385 nmdc:mga06r32_1275_c1 3300050510 Bacteria 22674
1386 nmdc:mga06r32_142119_c1 3300050510 Bacteria 2377
1387 nmdc:mga06r32_146_c1 3300050510 Bacteria 53243
1388 nmdc:mga06r32_1539_c1 3300050510 Bacteria 20765
1389 nmdc:mga06r32_1804_c1 3300050510 Bacteria 19170
1390 nmdc:mga06r32_2051_c1 3300050510 Bacteria 18023
1391 nmdc:mga06r32_214349_c1 3300050510 Bacteria 1913
1392 nmdc:mga06r32_247425_c1 3300050510 Bacteria 1770
1393 nmdc:mga06r32_272488_c1 3300050510 Bacteria 1680
1394 nmdc:mga06r32_324052_c1 3300050510 Bacteria 1526
1395 nmdc:mga06r32_333793_c1 3300050510 Bacteria 1501
1396 nmdc:mga06r32_371370_c1 3300050510 Bacteria 1414
1397 nmdc:mga06r32_44726_c1 3300050510 Bacteria 4217
1398 nmdc:mga06r32_481662_c1 3300050510 Bacteria 1219
1399 nmdc:mga06r32_485623_c1 3300050510 Unclassified 1213
1400 nmdc:mga06r32_513_c1 3300050510 Bacteria 33328
1401 nmdc:mga06r32_62216_c1 3300050510 Bacteria 3596
1402 nmdc:mga06r32_65993_c1 3300050510 Bacteria 3492
1403 nmdc:mga06r32_7784_c1 3300050510 Bacteria 9633
1404 nmdc:mga08y16_146574_c1 3300050511 Bacteria 2454
1405 nmdc:mga08y16_19387_c1 3300050511 Bacteria 7172
1406 nmdc:mga08y16_252653_c1 3300050511 Bacteria 1822
1407 nmdc:mga08y16_255688_c1 3300050511 Bacteria 1810
1408 nmdc:mga08y16_29538_c1 3300050511 Bacteria 5775
1409 nmdc:mga08y16_373_c1 3300050511 Bacteria 40656
1410 nmdc:mga08y16_377897_c1 3300050511 Bacteria 1452
1411 nmdc:mga08y16_37893_c1 3300050511 Bacteria 5062
1412 nmdc:mga08y16_534_c1 3300050511 Bacteria 35243
1413 nmdc:mga08y16_54262_c1 3300050511 Bacteria 4188
1414 nmdc:mga08y16_5774_c1 3300050511 Bacteria 12961
1415 nmdc:mga0n895_104963_c1 3300050512 Bacteria 2838
1416 nmdc:mga0n895_10747_c1 3300050512 Bacteria 8115
1417 nmdc:mga0n895_1284_c1 3300050512 Bacteria 18562
1418 nmdc:mga0n895_1396_c1 3300050512 Bacteria 17996
1419 nmdc:mga0n895_165518_c1 3300050512 Bacteria 2243
1420 nmdc:mga0n895_21667_c1 3300050512 Bacteria 6015
1421 nmdc:mga0n895_22138_c1 3300050512 Bacteria 5957
1422 nmdc:mga0n895_23005_c1 3300050512 Bacteria 5851
1423 nmdc:mga0n895_264304_c1 3300050512 Bacteria 1746
1424 nmdc:mga0n895_2923_c1 3300050512 Bacteria 13544
1425 nmdc:mga0n895_316236_c1 3300050512 Bacteria 1582
1426 nmdc:mga0n895_318603_c1 3300050512 Bacteria 1576
1427 nmdc:mga0n895_3294_c1 3300050512 Bacteria 12964
1428 nmdc:mga0n895_3297_c1 3300050512 Bacteria 12959
1429 nmdc:mga0n895_344812_c1 3300050512 Bacteria 1509
1430 nmdc:mga0n895_37636_c1 3300050512 Bacteria 4682
1431 nmdc:mga0n895_504_c1 3300050512 Bacteria 26480
1432 nmdc:mga0n895_51170_c1 3300050512 Bacteria 4052
1433 nmdc:mga0n895_518509_c1 3300050512 Bacteria 1200
1434 nmdc:mga0n895_5819_c1 3300050512 Bacteria 10358
1435 nmdc:mga0n895_618373_c1 3300050512 Bacteria 1084
1436 nmdc:mga0n895_69804_c1 3300050512 Bacteria 3482
1437 nmdc:mga0n895_788782_c1 3300050512 Unclassified 941
1438 nmdc:mga0n895_82606_c1 3300050512 Bacteria 3203
1439 nmdc:mga0rr50_14131_c1 3300050513 Bacteria 5226
1440 nmdc:mga0rr50_177817_c1 3300050513 Bacteria 1738
1441 nmdc:mga0rr50_253138_c1 3300050513 Bacteria 1463
1442 nmdc:mga0rr50_25756_c1 3300050513 Bacteria 4094
1443 nmdc:mga0rr50_265302_c1 3300050513 Bacteria 1430
1444 nmdc:mga0rr50_27964_c1 3300050513 Bacteria 3957
1445 nmdc:mga0rr50_29071_c1 3300050513 Bacteria 3893
1446 nmdc:mga0rr50_3722_c1 3300050513 Bacteria 8834
1447 nmdc:mga0rr50_58552_c1 3300050513 Bacteria 2888
1448 nmdc:mga0rr50_761_c1 3300050513 Bacteria 17319
1449 nmdc:mga0rr50_79206_c1 3300050513 Bacteria 2530
1450 nmdc:mga0rr50_8690_c1 3300050513 Bacteria 6333
1451 nmdc:mga08x19_128216_c1 3300050514 Bacteria 1705
1452 nmdc:mga08x19_13749_c1 3300050514 Bacteria 4900
1453 nmdc:mga08x19_193042_c1 3300050514 Bacteria 1394
1454 nmdc:mga08x19_26393_c1 3300050514 Bacteria 3624
1455 nmdc:mga08x19_69086_c1 3300050514 Bacteria 2301
1456 nmdc:mga08x19_76896_c1 3300050514 Bacteria 2185
1457 nmdc:mga0a205_1140_c1 3300050515 Bacteria 22064
1458 nmdc:mga0a205_164947_c1 3300050515 Bacteria 2111
1459 nmdc:mga0a205_165594_c1 3300050515 Bacteria 2106
1460 nmdc:mga0a205_1727_c1 3300050515 Bacteria 18879
1461 nmdc:mga0a205_21067_c1 3300050515 Bacteria 6164
1462 nmdc:mga0a205_2320_c1 3300050515 Bacteria 16782
1463 nmdc:mga0a205_2547_c1 3300050515 Bacteria 16064
1464 nmdc:mga0a205_28222_c1 3300050515 Bacteria 5365
1465 nmdc:mga0a205_3096_c1 3300050515 Bacteria 14752
1466 nmdc:mga0a205_3097_c1 3300050515 Bacteria 14747
1467 nmdc:mga0a205_343860_c1 3300050515 Bacteria 1360
1468 nmdc:mga0a205_4618_c1 3300050515 Bacteria 12347
1469 nmdc:mga0a205_9900_c1 3300050515 Bacteria 8741
1470 Ga0495601_0000075 3300053077 Bacteria 54434
1471 Ga0495601_0001285 3300053077 Bacteria 13775
1472 Ga0495601_0004911 3300053077 Bacteria 7762
1473 Ga0495601_0008795 3300053077 Bacteria 5959
1474 Ga0495601_0055747 3300053077 Bacteria 2502
1475 Ga0495601_0078044 3300053077 Bacteria 2121
1476 Ga0495612_0000270 3300053078 Bacteria 21369
1477 Ga0495612_0009831 3300053078 Bacteria 3873
1478 Ga0495612_0021104 3300053078 Bacteria 2613
1479 Ga0495612_0066354 3300053078 Bacteria 1500
1480 Ga0495655_0007314 3300053083 Bacteria 2047
1481 Ga0495595_0000311 3300053084 Bacteria 18978
1482 Ga0495595_0000650 3300053084 Bacteria 13209
1483 Ga0495595_0046565 3300053084 Bacteria 1998
1484 Ga0495595_0166548 3300053084 Bacteria 1089
1485 Ga0495619_0000301 3300053085 Bacteria 34829
1486 Ga0495619_0000315 3300053085 Bacteria 33904
1487 Ga0495619_0000645 3300053085 Bacteria 22971
1488 Ga0495619_0007589 3300053085 Bacteria 6867
1489 Ga0495619_0020045 3300053085 Bacteria 4256
1490 Ga0495619_0024178 3300053085 Bacteria 3896
1491 Ga0495619_0029304 3300053085 Bacteria 3556
1492 Ga0495619_0062178 3300053085 Bacteria 2485
1493 Ga0495619_0074646 3300053085 Bacteria 2275
1494 Ga0495619_0112369 3300053085 Bacteria 1862
1495 Ga0495619_0115784 3300053085 Bacteria 1835
1496 Ga0501084_0001846 3300054114 Bacteria 16897
1497 Ga0501084_0003520 3300054114 Bacteria 12714
1498 Ga0501084_0017681 3300054114 Bacteria 5931
1499 Ga0501084_0019705 3300054114 Bacteria 5621
1500 Ga0501084_0072069 3300054114 Bacteria 2893
1501 Ga0501084_0080714 3300054114 Bacteria 2728
1502 Ga0501084_0101016 3300054114 Bacteria 2422
1503 Ga0501084_0123421 3300054114 Bacteria 2178
1504 Ga0501084_0147120 3300054114 Bacteria 1985
1505 Ga0501084_0174028 3300054114 Bacteria 1817
1506 Ga0501084_0409662 3300054114 Bacteria 1146
1507 Ga0501084_0514218 3300054114 Bacteria 1012
1508 Ga0590071_002984 3300059421 Bacteria 4203
1509 Ga0501082_0001816 3300060353 Bacteria 18794
1510 Ga0501082_0008032 3300060353 Bacteria 9109
1511 Ga0501082_0011213 3300060353 Bacteria 7702
1512 Ga0501082_0012412 3300060353 Bacteria 7322
1513 Ga0501082_0019322 3300060353 Bacteria 5873
1514 Ga0501082_0026339 3300060353 Bacteria 5010
1515 Ga0501082_0041926 3300060353 Bacteria 3946
1516 Ga0501082_0062257 3300060353 Bacteria 3212
1517 Ga0501082_0226455 3300060353 Bacteria 1627
1518 Ga0530510_0000035 3300061734 Bacteria 61298
1519 Ga0530510_0006400 3300061734 Bacteria 8199
1520 Ga0530510_0011109 3300061734 Bacteria 6318
1521 Ga0530510_0011626 3300061734 Bacteria 6177
1522 Ga0530510_0027329 3300061734 Bacteria 4087
1523 Ga0530510_0035040 3300061734 Bacteria 3617
1524 Ga0530510_0035956 3300061734 Bacteria 3570
1525 Ga0530510_0037011 3300061734 Bacteria 3516
1526 Ga0530510_0073777 3300061734 Bacteria 2477
1527 Ga0530510_0103376 3300061734 Bacteria 2083
1528 Ga0530510_0105387 3300061734 Bacteria 2063
1529 Ga0530510_0121312 3300061734 Bacteria 1919
1530 Ga0530510_0125522 3300061734 Bacteria 1886
1531 Ga0530510_0178764 3300061734 Bacteria 1573
1532 Ga0530510_0430018 3300061734 Bacteria 997

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0505213 Ga0373925_0505213_14_745 238
2 3300046454 Ga0495592_0087482 Ga0495592_0087482_1483_2214 243
3 3300006844 Ga0075428_100024377 Ga0075428_1000243778 247
4 3300006846 Ga0075430_100031977 Ga0075430_1000319772 247
5 3300006847 Ga0075431_100051429 Ga0075431_1000514293 247
6 3300009147 Ga0114129_10413311 Ga0114129_104133112 247
7 3300050507 nmdc:mga05p37_202605_c1 nmdc:mga05p37_202605_c1_1247_2122 247
8 3300050510 nmdc:mga06r32_272488_c1 nmdc:mga06r32_272488_c1_571_1446 247
9 3300048914 Ga0496111_0192846 Ga0496111_0192846_23_790 255
10 3300014325 Ga0163163_10156001 Ga0163163_101560012 260
11 3300048913 Ga0496110_0168318 Ga0496110_0168318_986_1852 260
12 3300048918 Ga0496115_0211520 Ga0496115_0211520_800_1582 260
13 3300005455 Ga0070663_100022198 Ga0070663_1000221983 262
14 3300005547 Ga0070693_100106327 Ga0070693_1001063272 262
15 3300025986 Ga0207658_10294652 Ga0207658_102946522 262
16 3300035091 Ga0373951_0009956 Ga0373951_0009956_245_1117 262
17 3300035115 Ga0373941_0015027 Ga0373941_0015027_396_1268 262
18 3300035121 Ga0373960_0004777 Ga0373960_0004777_2038_2910 262
19 3300035242 Ga0373962_0009516 Ga0373962_0009516_748_1620 262
20 3300035691 Ga0373931_0000378 Ga0373931_0000378_8957_9829 262
21 3300035692 Ga0373935_0019863 Ga0373935_0019863_332_1120 262
22 3300048904 Ga0496101_0334346 Ga0496101_0334346_14_802 262
23 3300049585 Ga0501069_0030459 Ga0501069_0030459_1543_2415 262
24 3300050507 nmdc:mga05p37_41494_c2 nmdc:mga05p37_41494_c2_471_1343 262
25 3300050511 nmdc:mga08y16_146574_c1 nmdc:mga08y16_146574_c1_649_1521 262
26 3300005981 Ga0081538_10024923 Ga0081538_100249234 263
27 3300006844 Ga0075428_100468986 Ga0075428_1004689862 263
28 3300006846 Ga0075430_100116978 Ga0075430_1001169782 263
29 3300006847 Ga0075431_100084216 Ga0075431_1000842164 263
30 3300006880 Ga0075429_100260011 Ga0075429_1002600112 263
31 3300014326 Ga0157380_10012253 Ga0157380_100122532 263
32 3300048907 Ga0496104_0003990 Ga0496104_0003990_2044_2922 263
33 3300048908 Ga0496105_0062655 Ga0496105_0062655_879_1757 263
34 3300048911 Ga0496108_0012544 Ga0496108_0012544_4508_5386 263
35 3300048912 Ga0496109_0060988 Ga0496109_0060988_1560_2438 263
36 3300048913 Ga0496110_0018844 Ga0496110_0018844_199_1077 263
37 3300048914 Ga0496111_0038074 Ga0496111_0038074_2532_3410 263
38 3300048915 Ga0496112_0059918 Ga0496112_0059918_1666_2544 263
39 3300049582 Ga0501048_0044811 Ga0501048_0044811_1056_1928 263
40 3300049741 Ga0501079_0106662 Ga0501079_0106662_607_1479 263
41 3300050510 nmdc:mga06r32_481662_c1 nmdc:mga06r32_481662_c1_149_1018 263
42 3300061734 Ga0530510_0011109 Ga0530510_0011109_5145_6017 263
43 3300006880 Ga0075429_100389106 Ga0075429_1003891061 264
44 3300050510 nmdc:mga06r32_142119_c1 nmdc:mga06r32_142119_c1_888_1760 264
45 3300005937 Ga0081455_10000371 Ga0081455_1000037136 265
46 3300005981 Ga0081538_10030288 Ga0081538_100302883 265
47 3300026116 Ga0207674_10161042 Ga0207674_101610422 265
48 3300007788 Ga0099795_10044559 Ga0099795_100445592 266
49 3300010159 Ga0099796_10063185 Ga0099796_100631852 266
50 3300032002 Ga0307416_100007124 Ga0307416_1000071245 266
51 3300049591 Ga0501075_0087936 Ga0501075_0087936_275_1138 266
52 3300049592 Ga0501076_0012229 Ga0501076_0012229_3165_4028 266
53 3300049593 Ga0501077_0009362 Ga0501077_0009362_3667_4530 266
54 3300049741 Ga0501079_0001591 Ga0501079_0001591_5469_6332 266
55 3300049742 Ga0501080_0068032 Ga0501080_0068032_751_1614 266
56 3300049743 Ga0501081_0000638 Ga0501081_0000638_18602_19465 266
57 3300049744 Ga0501083_0299061 Ga0501083_0299061_163_1026 266
58 3300050512 nmdc:mga0n895_788782_c1 nmdc:mga0n895_788782_c1_129_929 266
59 3300060353 Ga0501082_0062257 Ga0501082_0062257_762_1625 266
60 3300005436 Ga0070713_100079712 Ga0070713_1000797122 267
61 3300049592 Ga0501076_0367025 Ga0501076_0367025_100_975 267
62 3300049588 Ga0501072_0065382 Ga0501072_0065382_589_1449 268
63 3300050514 nmdc:mga08x19_26393_c1 nmdc:mga08x19_26393_c1_2137_3009 268
64 3300006852 Ga0075433_10096078 Ga0075433_100960783 270
65 3300037312 Ga0395899_0047620 Ga0395899_0047620_1921_2793 270
66 3300037418 Ga0395900_0028085 Ga0395900_0028085_2841_3713 270
67 3300037466 Ga0395898_0003646 Ga0395898_0003646_6626_7498 270
68 3300037471 Ga0395905_0347015 Ga0395905_0347015_451_1323 270
69 3300038443 Ga0395901_0006664 Ga0395901_0006664_5797_6669 270
70 3300049578 Ga0501042_0088045 Ga0501042_0088045_324_1199 270
71 3300049824 Ga0501045_0168123 Ga0501045_0168123_261_1136 270
72 3300050515 nmdc:mga0a205_9900_c1 nmdc:mga0a205_9900_c1_3753_4625 270
73 3300039453 Ga0436362_0171704 Ga0436362_0171704_663_1478 271
74 3300046462 Ga0495651_0006676 Ga0495651_0006676_2172_2987 271
75 3300046492 Ga0495585_0038564 Ga0495585_0038564_419_1315 271
76 3300046511 Ga0495608_0072303 Ga0495608_0072303_1421_2236 271
77 3300047317 Ga0495604_0145118 Ga0495604_0145118_11_826 271
78 3300049589 Ga0501073_0362589 Ga0501073_0362589_16_831 271
79 3300049593 Ga0501077_0369858 Ga0501077_0369858_14_829 271
80 3300050489 nmdc:mga03683_136949_c1 nmdc:mga03683_136949_c1_11_826 271
81 3300050509 nmdc:mga0qj67_130738_c1 nmdc:mga0qj67_130738_c1_1201_2016 271
82 3300053084 Ga0495595_0166548 Ga0495595_0166548_259_1074 271
83 3300054114 Ga0501084_0147120 Ga0501084_0147120_1157_1972 271
84 3300005549 Ga0070704_100043437 Ga0070704_1000434372 272
85 3300045051 Ga0451576_0007972 Ga0451576_0007972_9120_9992 272
86 3300049572 Ga0501036_0085596 Ga0501036_0085596_489_1349 272
87 3300049576 Ga0501040_0073621 Ga0501040_0073621_1083_1943 272
88 3300049593 Ga0501077_0117575 Ga0501077_0117575_271_1131 272
89 3300049743 Ga0501081_0460240 Ga0501081_0460240_48_908 272
90 3300049824 Ga0501045_0017685 Ga0501045_0017685_187_1047 272
91 3300050515 nmdc:mga0a205_28222_c1 nmdc:mga0a205_28222_c1_3371_4240 272
92 3300061734 Ga0530510_0035956 Ga0530510_0035956_248_1108 272
93 3300025908 Ga0207643_10067428 Ga0207643_100674282 273
94 3300049570 Ga0501033_0101077 Ga0501033_0101077_719_1579 273
95 3300049572 Ga0501036_0321558 Ga0501036_0321558_401_1273 273
96 3300049574 Ga0501038_0049333 Ga0501038_0049333_1791_2663 273
97 3300049575 Ga0501039_0085660 Ga0501039_0085660_409_1281 273
98 3300049576 Ga0501040_0002141 Ga0501040_0002141_11638_12510 273
99 3300049577 Ga0501041_0007435 Ga0501041_0007435_4599_5471 273
100 3300049578 Ga0501042_0008901 Ga0501042_0008901_1505_2377 273
101 3300049580 Ga0501046_0000202 Ga0501046_0000202_14853_15725 273
102 3300049581 Ga0501047_0011524 Ga0501047_0011524_1714_2586 273
103 3300049584 Ga0501068_0190452 Ga0501068_0190452_260_1132 273
104 3300049586 Ga0501070_0428371 Ga0501070_0428371_25_897 273
105 3300049590 Ga0501074_0003506 Ga0501074_0003506_1436_2308 273
106 3300049593 Ga0501077_0016590 Ga0501077_0016590_693_1565 273
107 3300049741 Ga0501079_0003432 Ga0501079_0003432_4122_4994 273
108 3300049742 Ga0501080_0162517 Ga0501080_0162517_841_1713 273
109 3300049743 Ga0501081_0003211 Ga0501081_0003211_1514_2386 273
110 3300049744 Ga0501083_0003824 Ga0501083_0003824_9215_10087 273
111 3300049824 Ga0501045_0002814 Ga0501045_0002814_2827_3699 273
112 3300054114 Ga0501084_0080714 Ga0501084_0080714_31_903 273
113 3300060353 Ga0501082_0001816 Ga0501082_0001816_1945_2817 273
114 3300061734 Ga0530510_0011626 Ga0530510_0011626_261_1133 273
115 3300005445 Ga0070708_100008649 Ga0070708_1000086498 274
116 3300005445 Ga0070708_100075567 Ga0070708_1000755673 274
117 3300005467 Ga0070706_100074704 Ga0070706_1000747041 274
118 3300005467 Ga0070706_100525303 Ga0070706_1005253031 274
119 3300005468 Ga0070707_100012992 Ga0070707_1000129921 274
120 3300005471 Ga0070698_100029279 Ga0070698_1000292797 274
121 3300005518 Ga0070699_100000671 Ga0070699_1000006717 274
122 3300005536 Ga0070697_100009626 Ga0070697_1000096262 274
123 3300005985 Ga0081539_10000210 Ga0081539_1000021023 274
124 3300006847 Ga0075431_100129633 Ga0075431_1001296331 274
125 3300006852 Ga0075433_10000237 Ga0075433_1000023713 274
126 3300007265 Ga0099794_10005574 Ga0099794_100055743 274
127 3300009147 Ga0114129_10000728 Ga0114129_1000072816 274
128 3300009147 Ga0114129_10003264 Ga0114129_100032649 274
129 3300009147 Ga0114129_10463205 Ga0114129_104632052 274
130 3300025910 Ga0207684_10000770 Ga0207684_1000077023 274
131 3300025910 Ga0207684_10270039 Ga0207684_102700392 274
132 3300025922 Ga0207646_10007372 Ga0207646_1000737212 274
133 3300025939 Ga0207665_10253441 Ga0207665_102534412 274
134 3300027671 Ga0209588_1003520 Ga0209588_10035204 274
135 3300049568 Ga0501031_0121441 Ga0501031_0121441_193_1068 274
136 3300049578 Ga0501042_0381994 Ga0501042_0381994_105_971 274
137 3300049587 Ga0501071_0065926 Ga0501071_0065926_20_895 274
138 3300049588 Ga0501072_0012547 Ga0501072_0012547_1244_2119 274
139 3300049589 Ga0501073_0254348 Ga0501073_0254348_198_1073 274
140 3300049590 Ga0501074_0080532 Ga0501074_0080532_1268_2143 274
141 3300049591 Ga0501075_0021136 Ga0501075_0021136_3796_4671 274
142 3300049592 Ga0501076_0033267 Ga0501076_0033267_75_950 274
143 3300049593 Ga0501077_0004301 Ga0501077_0004301_3653_4528 274
144 3300049741 Ga0501079_0019477 Ga0501079_0019477_4278_5153 274
145 3300049743 Ga0501081_0001332 Ga0501081_0001332_6041_6916 274
146 3300049823 Ga0501044_0424871 Ga0501044_0424871_40_915 274
147 3300049824 Ga0501045_0106731 Ga0501045_0106731_180_1055 274
148 3300050507 nmdc:mga05p37_3626_c1 nmdc:mga05p37_3626_c1_15301_16170 274
149 3300050512 nmdc:mga0n895_504_c1 nmdc:mga0n895_504_c1_568_1437 274
150 3300050513 nmdc:mga0rr50_761_c1 nmdc:mga0rr50_761_c1_11147_12016 274
151 3300050514 nmdc:mga08x19_69086_c1 nmdc:mga08x19_69086_c1_611_1480 274
152 3300050515 nmdc:mga0a205_165594_c1 nmdc:mga0a205_165594_c1_921_1790 274
153 3300050515 nmdc:mga0a205_4618_c1 nmdc:mga0a205_4618_c1_3634_4503 274
154 3300054114 Ga0501084_0003520 Ga0501084_0003520_1706_2581 274
155 3300060353 Ga0501082_0012412 Ga0501082_0012412_3974_4849 274
156 3300005843 Ga0068860_100240932 Ga0068860_1002409322 275
157 3300006844 Ga0075428_100056048 Ga0075428_1000560484 275
158 3300006847 Ga0075431_100000692 Ga0075431_10000069210 275
159 3300006871 Ga0075434_100166446 Ga0075434_1001664461 275
160 3300006880 Ga0075429_100064065 Ga0075429_1000640654 275
161 3300007076 Ga0075435_100189451 Ga0075435_1001894512 275
162 3300009147 Ga0114129_10003627 Ga0114129_1000362713 275
163 3300013306 Ga0163162_10800505 Ga0163162_108005052 275
164 3300028381 Ga0268264_10183108 Ga0268264_101831082 275
165 3300037418 Ga0395900_0101403 Ga0395900_0101403_1308_2177 275
166 3300037471 Ga0395905_0027008 Ga0395905_0027008_3658_4527 275
167 3300049742 Ga0501080_0124687 Ga0501080_0124687_345_1220 275
168 3300049824 Ga0501045_0021239 Ga0501045_0021239_3211_4086 275
169 3300050507 nmdc:mga05p37_168600_c1 nmdc:mga05p37_168600_c1_231_1100 275
170 3300050507 nmdc:mga05p37_2276_c1 nmdc:mga05p37_2276_c1_18213_19082 275
171 3300050508 nmdc:mga09592_1333_c1 nmdc:mga09592_1333_c1_4794_5663 275
172 3300050510 nmdc:mga06r32_1275_c1 nmdc:mga06r32_1275_c1_6451_7320 275
173 3300050512 nmdc:mga0n895_104963_c1 nmdc:mga0n895_104963_c1_643_1503 275
174 3300050512 nmdc:mga0n895_21667_c1 nmdc:mga0n895_21667_c1_1313_2182 275
175 3300050513 nmdc:mga0rr50_177817_c1 nmdc:mga0rr50_177817_c1_496_1365 275
176 3300050513 nmdc:mga0rr50_3722_c1 nmdc:mga0rr50_3722_c1_3440_4300 275
177 3300050514 nmdc:mga08x19_13749_c1 nmdc:mga08x19_13749_c1_3996_4865 275
178 3300005334 Ga0068869_100080432 Ga0068869_1000804323 276
179 3300005438 Ga0070701_10034402 Ga0070701_100344022 276
180 3300005441 Ga0070700_100023724 Ga0070700_1000237242 276
181 3300005444 Ga0070694_100121825 Ga0070694_1001218252 276
182 3300005518 Ga0070699_100079482 Ga0070699_1000794823 276
183 3300005545 Ga0070695_100016956 Ga0070695_1000169563 276
184 3300005546 Ga0070696_100031862 Ga0070696_1000318624 276
185 3300005549 Ga0070704_100057568 Ga0070704_1000575682 276
186 3300005577 Ga0068857_100027217 Ga0068857_1000272172 276
187 3300005718 Ga0068866_10089750 Ga0068866_100897503 276
188 3300005844 Ga0068862_100243534 Ga0068862_1002435342 276
189 3300006847 Ga0075431_100064131 Ga0075431_1000641312 276
190 3300007265 Ga0099794_10043801 Ga0099794_100438012 276
191 3300009148 Ga0105243_10042044 Ga0105243_100420442 276
192 3300009176 Ga0105242_10147831 Ga0105242_101478312 276
193 3300009553 Ga0105249_10140097 Ga0105249_101400973 276
194 3300014326 Ga0157380_10408638 Ga0157380_104086382 276
195 3300025922 Ga0207646_10603796 Ga0207646_106037961 276
196 3300025942 Ga0207689_10014179 Ga0207689_100141794 276
197 3300026075 Ga0207708_10039536 Ga0207708_100395362 276
198 3300026116 Ga0207674_10016568 Ga0207674_100165684 276
199 3300035170 Ga0373943_0222933 Ga0373943_0222933_123_989 276
200 3300036401 Ga0373937_0626001 Ga0373937_0626001_115_981 276
201 3300049577 Ga0501041_0170283 Ga0501041_0170283_102_971 276
202 3300050510 nmdc:mga06r32_214349_c1 nmdc:mga06r32_214349_c1_480_1352 276
203 3300053085 Ga0495619_0115784 Ga0495619_0115784_596_1462 276
204 3300054114 Ga0501084_0174028 Ga0501084_0174028_387_1256 276
205 3300005364 Ga0070673_100346336 Ga0070673_1003463362 277
206 3300006844 Ga0075428_100000498 Ga0075428_10000049820 277
207 3300006847 Ga0075431_100170206 Ga0075431_1001702061 277
208 3300009147 Ga0114129_10001993 Ga0114129_100019934 277
209 3300049575 Ga0501039_0226100 Ga0501039_0226100_123_995 277
210 3300049576 Ga0501040_0073028 Ga0501040_0073028_152_1024 277
211 3300049588 Ga0501072_0067177 Ga0501072_0067177_1739_2611 277
212 3300049592 Ga0501076_0273865 Ga0501076_0273865_79_951 277
213 3300049741 Ga0501079_0270565 Ga0501079_0270565_303_1175 277
214 3300050507 nmdc:mga05p37_660_c1 nmdc:mga05p37_660_c1_25970_26839 277
215 3300050508 nmdc:mga09592_22332_c1 nmdc:mga09592_22332_c1_1427_2296 277
216 3300050510 nmdc:mga06r32_1539_c1 nmdc:mga06r32_1539_c1_5153_6022 277
217 3300060353 Ga0501082_0019322 Ga0501082_0019322_3241_4113 277
218 3300061734 Ga0530510_0105387 Ga0530510_0105387_1091_1963 277
219 3300003371 JGI26145J50221_1004568 JGI26145J50221_10045682 278
220 3300003503 JGI26141J51220_1002987 JGI26141J51220_10029871 278
221 3300005341 Ga0070691_10046825 Ga0070691_100468252 278
222 3300005444 Ga0070694_100001870 Ga0070694_10000187010 278
223 3300005444 Ga0070694_100004146 Ga0070694_1000041463 278
224 3300005457 Ga0070662_100079907 Ga0070662_1000799072 278
225 3300005536 Ga0070697_100147820 Ga0070697_1001478202 278
226 3300005545 Ga0070695_100002332 Ga0070695_1000023328 278
227 3300005545 Ga0070695_100003402 Ga0070695_10000340210 278
228 3300006173 Ga0070716_100152395 Ga0070716_1001523952 278
229 3300013307 Ga0157372_10027038 Ga0157372_100270385 278
230 3300025933 Ga0207706_10088588 Ga0207706_100885883 278
231 3300025939 Ga0207665_10013888 Ga0207665_100138886 278
232 3300027252 Ga0209973_1004953 Ga0209973_10049532 278
233 3300027360 Ga0209969_1001687 Ga0209969_10016872 278
234 3300027378 Ga0209981_1000658 Ga0209981_10006584 278
235 3300027395 Ga0209996_1000275 Ga0209996_10002755 278
236 3300027424 Ga0209984_1004768 Ga0209984_10047682 278
237 3300027462 Ga0210000_1007839 Ga0210000_10078392 278
238 3300027471 Ga0209995_1000408 Ga0209995_10004082 278
239 3300027526 Ga0209968_1001134 Ga0209968_10011344 278
240 3300027543 Ga0209999_1000305 Ga0209999_10003054 278
241 3300027614 Ga0209970_1000685 Ga0209970_10006854 278
242 3300027617 Ga0210002_1002183 Ga0210002_10021833 278
243 3300027665 Ga0209983_1001147 Ga0209983_10011475 278
244 3300027682 Ga0209971_1000054 Ga0209971_100005427 278
245 3300027695 Ga0209966_1000059 Ga0209966_100005926 278
246 3300027717 Ga0209998_10000066 Ga0209998_1000006624 278
247 3300027876 Ga0209974_10004634 Ga0209974_100046344 278
248 3300050507 nmdc:mga05p37_959688_c1 nmdc:mga05p37_959688_c1_68_904 278
249 3300006847 Ga0075431_100005773 Ga0075431_10000577310 279
250 3300006880 Ga0075429_100009627 Ga0075429_10000962710 279
251 3300009147 Ga0114129_10008761 Ga0114129_1000876110 279
252 3300031903 Ga0307407_10123852 Ga0307407_101238521 279
253 3300031995 Ga0307409_100248250 Ga0307409_1002482502 279
254 3300032005 Ga0307411_10111327 Ga0307411_101113272 279
255 3300050507 nmdc:mga05p37_8121_c1 nmdc:mga05p37_8121_c1_9927_10793 279
256 3300050508 nmdc:mga09592_420_c1 nmdc:mga09592_420_c1_293_1159 279
257 3300050510 nmdc:mga06r32_7784_c1 nmdc:mga06r32_7784_c1_1001_1867 279
258 3300005336 Ga0070680_100033842 Ga0070680_1000338424 280
259 3300006844 Ga0075428_100030351 Ga0075428_1000303514 280
260 3300006852 Ga0075433_10008207 Ga0075433_100082073 280
261 3300006852 Ga0075433_10042277 Ga0075433_100422774 280
262 3300006871 Ga0075434_100174598 Ga0075434_1001745982 280
263 3300007076 Ga0075435_100051516 Ga0075435_1000515162 280
264 3300007788 Ga0099795_10022044 Ga0099795_100220442 280
265 3300009094 Ga0111539_10001936 Ga0111539_1000193618 280
266 3300025960 Ga0207651_10052565 Ga0207651_100525653 280
267 3300027512 Ga0209179_1008199 Ga0209179_10081992 280
268 3300027907 Ga0207428_10010349 Ga0207428_100103497 280
269 3300027907 Ga0207428_10338088 Ga0207428_103380882 280
270 3300028380 Ga0268265_10061066 Ga0268265_100610664 280
271 3300042876 Ga0451577_0002938 Ga0451577_0002938_12551_13423 280
272 3300044673 Ga0453683_0008017 Ga0453683_0008017_5265_6137 280
273 3300044673 Ga0453683_0030929 Ga0453683_0030929_289_1149 280
274 3300044712 Ga0453684_0010714 Ga0453684_0010714_10831_11703 280
275 3300045051 Ga0451576_0013391 Ga0451576_0013391_2714_3586 280
276 3300050511 nmdc:mga08y16_29538_c1 nmdc:mga08y16_29538_c1_554_1426 280
277 3300050512 nmdc:mga0n895_5819_c1 nmdc:mga0n895_5819_c1_1417_2289 280
278 3300050513 nmdc:mga0rr50_27964_c1 nmdc:mga0rr50_27964_c1_814_1686 280
279 3300050515 nmdc:mga0a205_3096_c1 nmdc:mga0a205_3096_c1_450_1322 280
280 3300005334 Ga0068869_100003812 Ga0068869_10000381210 281
281 3300005545 Ga0070695_100019745 Ga0070695_1000197453 281
282 3300005549 Ga0070704_100073400 Ga0070704_1000734002 281
283 3300009553 Ga0105249_10513598 Ga0105249_105135982 281
284 3300025917 Ga0207660_10096622 Ga0207660_100966222 281
285 3300025942 Ga0207689_10001241 Ga0207689_1000124117 281
286 3300025972 Ga0207668_10209841 Ga0207668_102098411 281
287 3300025981 Ga0207640_10216675 Ga0207640_102166752 281
288 3300028380 Ga0268265_10244335 Ga0268265_102443352 281
289 3300042012 Ga0439455_0018214 Ga0439455_0018214_145_1008 281
290 3300044673 Ga0453683_0008336 Ga0453683_0008336_2446_3309 281
291 3300046664 Ga0495659_0021634 Ga0495659_0021634_933_1793 281
292 3300047322 Ga0495680_0160590 Ga0495680_0160590_221_1087 281
293 3300049588 Ga0501072_0280225 Ga0501072_0280225_128_1024 281
294 3300049592 Ga0501076_0185645 Ga0501076_0185645_11_856 281
295 3300005444 Ga0070694_100291769 Ga0070694_1002917692 282
296 3300005445 Ga0070708_100034020 Ga0070708_1000340203 282
297 3300005468 Ga0070707_100091941 Ga0070707_1000919413 282
298 3300005471 Ga0070698_100081033 Ga0070698_1000810333 282
299 3300005518 Ga0070699_100061924 Ga0070699_1000619243 282
300 3300005536 Ga0070697_100089132 Ga0070697_1000891322 282
301 3300005545 Ga0070695_100134570 Ga0070695_1001345702 282
302 3300005549 Ga0070704_100161893 Ga0070704_1001618932 282
303 3300006178 Ga0075367_10144273 Ga0075367_101442732 282
304 3300006844 Ga0075428_100011732 Ga0075428_1000117322 282
305 3300006846 Ga0075430_100003716 Ga0075430_10000371611 282
306 3300006847 Ga0075431_100020999 Ga0075431_1000209997 282
307 3300006880 Ga0075429_100000042 Ga0075429_10000004248 282
308 3300007076 Ga0075435_100037410 Ga0075435_1000374104 282
309 3300009147 Ga0114129_10054353 Ga0114129_100543533 282
310 3300009148 Ga0105243_10408949 Ga0105243_104089492 282
311 3300025910 Ga0207684_10004661 Ga0207684_100046613 282
312 3300025917 Ga0207660_10076246 Ga0207660_100762462 282
313 3300025919 Ga0207657_10272144 Ga0207657_102721442 282
314 3300025921 Ga0207652_10100652 Ga0207652_101006523 282
315 3300025922 Ga0207646_10102883 Ga0207646_101028833 282
316 3300035115 Ga0373941_0010097 Ga0373941_0010097_589_1461 282
317 3300035691 Ga0373931_0000208 Ga0373931_0000208_19438_20310 282
318 3300048905 Ga0496102_0004597 Ga0496102_0004597_9378_10250 282
319 3300049592 Ga0501076_0026997 Ga0501076_0026997_492_1355 282
320 3300049593 Ga0501077_0051531 Ga0501077_0051531_785_1648 282
321 3300049741 Ga0501079_0042564 Ga0501079_0042564_1178_2041 282
322 3300049743 Ga0501081_0026352 Ga0501081_0026352_153_1016 282
323 3300049744 Ga0501083_0068975 Ga0501083_0068975_811_1674 282
324 3300049824 Ga0501045_0134925 Ga0501045_0134925_384_1247 282
325 3300050494 nmdc:mga06z11_121413_c1 nmdc:mga06z11_121413_c1_498_1397 282
326 3300054114 Ga0501084_0123421 Ga0501084_0123421_1142_2005 282
327 3300059421 Ga0590071_002984 Ga0590071_002984_1455_2303 282
328 3300060353 Ga0501082_0026339 Ga0501082_0026339_1292_2155 282
329 3300061734 Ga0530510_0037011 Ga0530510_0037011_1497_2360 282
330 3300005536 Ga0070697_100325586 Ga0070697_1003255861 283
331 3300050512 nmdc:mga0n895_51170_c1 nmdc:mga0n895_51170_c1_1073_1945 283
332 3300050513 nmdc:mga0rr50_29071_c1 nmdc:mga0rr50_29071_c1_662_1534 283
333 3300009147 Ga0114129_10003625 Ga0114129_1000362515 284
334 3300042876 Ga0451577_0147867 Ga0451577_0147867_218_1096 284
335 3300050507 nmdc:mga05p37_9368_c2 nmdc:mga05p37_9368_c2_4670_5548 284
336 3300050508 nmdc:mga09592_913_c1 nmdc:mga09592_913_c1_4254_5132 284
337 3300050509 nmdc:mga0qj67_527_c1 nmdc:mga0qj67_527_c1_3098_3976 284
338 3300050510 nmdc:mga06r32_371370_c1 nmdc:mga06r32_371370_c1_391_1269 284
339 3300049591 Ga0501075_0288068 Ga0501075_0288068_333_1217 285
340 3300049592 Ga0501076_0347744 Ga0501076_0347744_196_1080 285
341 3300049593 Ga0501077_0131598 Ga0501077_0131598_687_1571 285
342 3300061734 Ga0530510_0103376 Ga0530510_0103376_525_1409 285
343 3300005347 Ga0070668_100318330 Ga0070668_1003183301 286
344 3300005440 Ga0070705_100028819 Ga0070705_1000288193 286
345 3300005467 Ga0070706_100059211 Ga0070706_1000592113 286
346 3300005468 Ga0070707_100066728 Ga0070707_1000667283 286
347 3300005471 Ga0070698_100021691 Ga0070698_1000216915 286
348 3300005518 Ga0070699_100016028 Ga0070699_1000160284 286
349 3300005518 Ga0070699_100024663 Ga0070699_1000246633 286
350 3300005518 Ga0070699_100201519 Ga0070699_1002015192 286
351 3300005844 Ga0068862_100388753 Ga0068862_1003887531 286
352 3300006846 Ga0075430_100004765 Ga0075430_10000476511 286
353 3300006847 Ga0075431_100005578 Ga0075431_1000055787 286
354 3300006852 Ga0075433_10001149 Ga0075433_100011491 286
355 3300006852 Ga0075433_10013677 Ga0075433_100136777 286
356 3300006852 Ga0075433_10088710 Ga0075433_100887103 286
357 3300006852 Ga0075433_10112050 Ga0075433_101120502 286
358 3300006871 Ga0075434_100000381 Ga0075434_10000038130 286
359 3300006871 Ga0075434_100015470 Ga0075434_1000154704 286
360 3300006871 Ga0075434_100090290 Ga0075434_1000902906 286
361 3300006871 Ga0075434_100175136 Ga0075434_1001751362 286
362 3300006880 Ga0075429_100015762 Ga0075429_1000157626 286
363 3300006880 Ga0075429_100017672 Ga0075429_1000176727 286
364 3300006880 Ga0075429_100154494 Ga0075429_1001544942 286
365 3300006914 Ga0075436_100043885 Ga0075436_1000438854 286
366 3300007076 Ga0075435_100191643 Ga0075435_1001916432 286
367 3300007265 Ga0099794_10003296 Ga0099794_100032966 286
368 3300009094 Ga0111539_10004302 Ga0111539_1000430216 286
369 3300009094 Ga0111539_10042630 Ga0111539_100426304 286
370 3300009147 Ga0114129_10001292 Ga0114129_100012924 286
371 3300009147 Ga0114129_10027216 Ga0114129_100272169 286
372 3300009147 Ga0114129_10035010 Ga0114129_100350106 286
373 3300009147 Ga0114129_10678839 Ga0114129_106788391 286
374 3300009147 Ga0114129_10688134 Ga0114129_106881341 286
375 3300012476 Ga0157344_1003302 Ga0157344_10033021 286
376 3300014326 Ga0157380_10287350 Ga0157380_102873502 286
377 3300025910 Ga0207684_10017510 Ga0207684_100175104 286
378 3300025910 Ga0207684_10049940 Ga0207684_100499403 286
379 3300025910 Ga0207684_10053390 Ga0207684_100533902 286
380 3300025910 Ga0207684_10155122 Ga0207684_101551223 286
381 3300025915 Ga0207693_10076742 Ga0207693_100767422 286
382 3300025922 Ga0207646_10046454 Ga0207646_100464543 286
383 3300025933 Ga0207706_10334553 Ga0207706_103345532 286
384 3300026089 Ga0207648_10183962 Ga0207648_101839623 286
385 3300027671 Ga0209588_1028287 Ga0209588_10282872 286
386 3300027907 Ga0207428_10000095 Ga0207428_10000095123 286
387 3300027907 Ga0207428_10012572 Ga0207428_100125725 286
388 3300028381 Ga0268264_10211135 Ga0268264_102111352 286
389 3300032002 Ga0307416_100136026 Ga0307416_1001360262 286
390 3300035088 Ga0373940_0004161 Ga0373940_0004161_1898_2758 286
391 3300035090 Ga0373949_0038110 Ga0373949_0038110_168_1028 286
392 3300035112 Ga0373932_0071713 Ga0373932_0071713_186_1046 286
393 3300035114 Ga0373939_0001754 Ga0373939_0001754_2782_3642 286
394 3300035114 Ga0373939_0032056 Ga0373939_0032056_636_1496 286
395 3300035207 Ga0373942_0009403 Ga0373942_0009403_679_1539 286
396 3300035241 Ga0373961_0035017 Ga0373961_0035017_500_1360 286
397 3300035691 Ga0373931_0236585 Ga0373931_0236585_20_880 286
398 3300042876 Ga0451577_0291686 Ga0451577_0291686_170_1030 286
399 3300045051 Ga0451576_0041637 Ga0451576_0041637_1028_1888 286
400 3300045051 Ga0451576_0286310 Ga0451576_0286310_617_1477 286
401 3300045051 Ga0451576_0629281 Ga0451576_0629281_104_964 286
402 3300046472 Ga0495580_0002500 Ga0495580_0002500_3004_3864 286
403 3300046491 Ga0495584_0161522 Ga0495584_0161522_101_961 286
404 3300047318 Ga0495636_0081489 Ga0495636_0081489_505_1365 286
405 3300047445 Ga0495677_0064907 Ga0495677_0064907_53_913 286
406 3300049572 Ga0501036_0152631 Ga0501036_0152631_909_1769 286
407 3300049574 Ga0501038_0096101 Ga0501038_0096101_1423_2283 286
408 3300049574 Ga0501038_0324640 Ga0501038_0324640_129_989 286
409 3300049575 Ga0501039_0333742 Ga0501039_0333742_31_891 286
410 3300049576 Ga0501040_0074249 Ga0501040_0074249_128_988 286
411 3300049577 Ga0501041_0022986 Ga0501041_0022986_2222_3082 286
412 3300049577 Ga0501041_0192775 Ga0501041_0192775_242_1117 286
413 3300049579 Ga0501043_0207996 Ga0501043_0207996_275_1135 286
414 3300049580 Ga0501046_0005938 Ga0501046_0005938_4977_5837 286
415 3300049580 Ga0501046_0241841 Ga0501046_0241841_233_1108 286
416 3300049580 Ga0501046_0288764 Ga0501046_0288764_19_879 286
417 3300049582 Ga0501048_0050849 Ga0501048_0050849_449_1309 286
418 3300049588 Ga0501072_0007995 Ga0501072_0007995_2120_2980 286
419 3300049588 Ga0501072_0022079 Ga0501072_0022079_2907_3767 286
420 3300049590 Ga0501074_0127922 Ga0501074_0127922_198_1058 286
421 3300049590 Ga0501074_0305735 Ga0501074_0305735_57_917 286
422 3300049591 Ga0501075_0013081 Ga0501075_0013081_944_1819 286
423 3300049591 Ga0501075_0148291 Ga0501075_0148291_20_880 286
424 3300049592 Ga0501076_0004495 Ga0501076_0004495_333_1193 286
425 3300049592 Ga0501076_0031210 Ga0501076_0031210_2967_3827 286
426 3300049593 Ga0501077_0003889 Ga0501077_0003889_7462_8322 286
427 3300049593 Ga0501077_0010538 Ga0501077_0010538_2209_3069 286
428 3300049593 Ga0501077_0044084 Ga0501077_0044084_579_1454 286
429 3300049741 Ga0501079_0010724 Ga0501079_0010724_5619_6494 286
430 3300049741 Ga0501079_0014788 Ga0501079_0014788_2101_2961 286
431 3300049743 Ga0501081_0001545 Ga0501081_0001545_13051_13911 286
432 3300049743 Ga0501081_0002541 Ga0501081_0002541_2862_3737 286
433 3300049743 Ga0501081_0138221 Ga0501081_0138221_254_1114 286
434 3300049822 Ga0501035_0049331 Ga0501035_0049331_1363_2223 286
435 3300049824 Ga0501045_0018478 Ga0501045_0018478_4003_4863 286
436 3300050507 nmdc:mga05p37_27321_c1 nmdc:mga05p37_27321_c1_2569_3429 286
437 3300050507 nmdc:mga05p37_44322_c1 nmdc:mga05p37_44322_c1_170_1030 286
438 3300050507 nmdc:mga05p37_59608_c1 nmdc:mga05p37_59608_c1_2913_3773 286
439 3300050507 nmdc:mga05p37_63431_c1 nmdc:mga05p37_63431_c1_3624_4484 286
440 3300050508 nmdc:mga09592_640_c1 nmdc:mga09592_640_c1_23908_24768 286
441 3300050509 nmdc:mga0qj67_19555_c1 nmdc:mga0qj67_19555_c1_1921_2781 286
442 3300050510 nmdc:mga06r32_1804_c1 nmdc:mga06r32_1804_c1_4735_5595 286
443 3300050510 nmdc:mga06r32_44726_c1 nmdc:mga06r32_44726_c1_179_1039 286
444 3300050511 nmdc:mga08y16_534_c1 nmdc:mga08y16_534_c1_3318_4178 286
445 3300050512 nmdc:mga0n895_23005_c1 nmdc:mga0n895_23005_c1_2204_3064 286
446 3300050512 nmdc:mga0n895_2923_c1 nmdc:mga0n895_2923_c1_877_1737 286
447 3300050512 nmdc:mga0n895_3294_c1 nmdc:mga0n895_3294_c1_9668_10528 286
448 3300050512 nmdc:mga0n895_344812_c1 nmdc:mga0n895_344812_c1_623_1483 286
449 3300050513 nmdc:mga0rr50_265302_c1 nmdc:mga0rr50_265302_c1_287_1147 286
450 3300050513 nmdc:mga0rr50_8690_c1 nmdc:mga0rr50_8690_c1_276_1136 286
451 3300050515 nmdc:mga0a205_1727_c1 nmdc:mga0a205_1727_c1_10299_11159 286
452 3300050515 nmdc:mga0a205_21067_c1 nmdc:mga0a205_21067_c1_3622_4482 286
453 3300054114 Ga0501084_0001846 Ga0501084_0001846_7051_7926 286
454 3300054114 Ga0501084_0101016 Ga0501084_0101016_129_989 286
455 3300054114 Ga0501084_0409662 Ga0501084_0409662_247_1107 286
456 3300060353 Ga0501082_0011213 Ga0501082_0011213_6538_7413 286
457 3300060353 Ga0501082_0041926 Ga0501082_0041926_2585_3445 286
458 3300061734 Ga0530510_0006400 Ga0530510_0006400_6434_7294 286
459 3300061734 Ga0530510_0027329 Ga0530510_0027329_1329_2189 286
460 3300061734 Ga0530510_0035040 Ga0530510_0035040_1176_2051 286
461 3300061734 Ga0530510_0121312 Ga0530510_0121312_774_1634 286
462 3300005435 Ga0070714_100316891 Ga0070714_1003168912 287
463 3300005437 Ga0070710_10019293 Ga0070710_100192933 287
464 3300005445 Ga0070708_100026754 Ga0070708_1000267544 287
465 3300005467 Ga0070706_100053102 Ga0070706_1000531022 287
466 3300005468 Ga0070707_100030799 Ga0070707_1000307993 287
467 3300005471 Ga0070698_100028399 Ga0070698_1000283997 287
468 3300005518 Ga0070699_100010925 Ga0070699_1000109257 287
469 3300005518 Ga0070699_100021332 Ga0070699_1000213322 287
470 3300005549 Ga0070704_100087760 Ga0070704_1000877602 287
471 3300006028 Ga0070717_10131111 Ga0070717_101311113 287
472 3300007265 Ga0099794_10001274 Ga0099794_100012747 287
473 3300009147 Ga0114129_10760356 Ga0114129_107603562 287
474 3300014745 Ga0157377_10075546 Ga0157377_100755462 287
475 3300021388 Ga0213875_10000089 Ga0213875_1000008970 287
476 3300021388 Ga0213875_10112145 Ga0213875_101121452 287
477 3300025898 Ga0207692_10010637 Ga0207692_100106373 287
478 3300025905 Ga0207685_10017622 Ga0207685_100176222 287
479 3300025910 Ga0207684_10002456 Ga0207684_100024565 287
480 3300025910 Ga0207684_10008401 Ga0207684_100084014 287
481 3300025922 Ga0207646_10007643 Ga0207646_1000764311 287
482 3300025922 Ga0207646_10081180 Ga0207646_100811803 287
483 3300025929 Ga0207664_10095864 Ga0207664_100958642 287
484 3300025931 Ga0207644_10043334 Ga0207644_100433343 287
485 3300025939 Ga0207665_10117699 Ga0207665_101176992 287
486 3300027671 Ga0209588_1006390 Ga0209588_10063903 287
487 3300037853 Ga0436364_0547572 Ga0436364_0547572_15722_16585 287
488 3300037853 Ga0436364_0602945 Ga0436364_0602945_203_1066 287
489 3300037853 Ga0436364_1157451 Ga0436364_1157451_355_1218 287
490 3300042876 Ga0451577_0047989 Ga0451577_0047989_1852_2730 287
491 3300044673 Ga0453683_0014702 Ga0453683_0014702_2173_3051 287
492 3300049572 Ga0501036_0044537 Ga0501036_0044537_1503_2366 287
493 3300049575 Ga0501039_0113447 Ga0501039_0113447_695_1558 287
494 3300049576 Ga0501040_0054680 Ga0501040_0054680_826_1689 287
495 3300049580 Ga0501046_0171445 Ga0501046_0171445_277_1140 287
496 3300049588 Ga0501072_0151314 Ga0501072_0151314_14_877 287
497 3300049591 Ga0501075_0035326 Ga0501075_0035326_2172_3035 287
498 3300049591 Ga0501075_0131996 Ga0501075_0131996_998_1861 287
499 3300049592 Ga0501076_0223907 Ga0501076_0223907_333_1196 287
500 3300049593 Ga0501077_0062092 Ga0501077_0062092_26_889 287
501 3300049741 Ga0501079_0191202 Ga0501079_0191202_313_1176 287
502 3300049742 Ga0501080_0101462 Ga0501080_0101462_443_1306 287
503 3300049743 Ga0501081_0200519 Ga0501081_0200519_27_890 287
504 3300049744 Ga0501083_0277034 Ga0501083_0277034_165_1028 287
505 3300061734 Ga0530510_0178764 Ga0530510_0178764_75_938 287
506 3300005330 Ga0070690_100229719 Ga0070690_1002297192 288
507 3300005437 Ga0070710_10076413 Ga0070710_100764132 288
508 3300006846 Ga0075430_100192472 Ga0075430_1001924722 288
509 3300006847 Ga0075431_100006673 Ga0075431_1000066732 288
510 3300006852 Ga0075433_10099537 Ga0075433_100995373 288
511 3300006880 Ga0075429_100067487 Ga0075429_1000674874 288
512 3300009147 Ga0114129_10002647 Ga0114129_100026474 288
513 3300009147 Ga0114129_10081183 Ga0114129_100811832 288
514 3300037466 Ga0395898_0360203 Ga0395898_0360203_366_1259 288
515 3300037853 Ga0436364_0394206 Ga0436364_0394206_598_1494 288
516 3300049577 Ga0501041_0159025 Ga0501041_0159025_284_1180 288
517 3300049824 Ga0501045_0124230 Ga0501045_0124230_187_1083 288
518 3300050507 nmdc:mga05p37_63918_c1 nmdc:mga05p37_63918_c1_3138_4004 288
519 3300050507 nmdc:mga05p37_9811_c1 nmdc:mga05p37_9811_c1_2153_3019 288
520 3300050508 nmdc:mga09592_199693_c1 nmdc:mga09592_199693_c1_280_1146 288
521 3300050509 nmdc:mga0qj67_14779_c1 nmdc:mga0qj67_14779_c1_4916_5782 288
522 3300050510 nmdc:mga06r32_65993_c1 nmdc:mga06r32_65993_c1_1623_2489 288
523 3300050515 nmdc:mga0a205_164947_c1 nmdc:mga0a205_164947_c1_377_1243 288
524 3300054114 Ga0501084_0514218 Ga0501084_0514218_35_931 288
525 3300005459 Ga0068867_100160086 Ga0068867_1001600862 289
526 3300005546 Ga0070696_100018166 Ga0070696_1000181662 289
527 3300005718 Ga0068866_10126607 Ga0068866_101266072 289
528 3300013297 Ga0157378_10116190 Ga0157378_101161902 289
529 3300025899 Ga0207642_10056486 Ga0207642_100564862 289
530 3300026089 Ga0207648_10048730 Ga0207648_100487304 289
531 3300026118 Ga0207675_100352555 Ga0207675_1003525551 289
532 3300049741 Ga0501079_0053552 Ga0501079_0053552_537_1406 289
533 3300005365 Ga0070688_100151260 Ga0070688_1001512602 290
534 3300005434 Ga0070709_10019643 Ga0070709_100196434 290
535 3300005434 Ga0070709_10049135 Ga0070709_100491352 290
536 3300005436 Ga0070713_100042795 Ga0070713_1000427953 290
537 3300005436 Ga0070713_100126428 Ga0070713_1001264282 290
538 3300005437 Ga0070710_10018841 Ga0070710_100188412 290
539 3300005439 Ga0070711_100070782 Ga0070711_1000707822 290
540 3300005439 Ga0070711_100082465 Ga0070711_1000824652 290
541 3300005445 Ga0070708_100035567 Ga0070708_1000355674 290
542 3300005445 Ga0070708_100467856 Ga0070708_1004678561 290
543 3300005457 Ga0070662_100201947 Ga0070662_1002019472 290
544 3300005467 Ga0070706_100070789 Ga0070706_1000707892 290
545 3300005467 Ga0070706_100154303 Ga0070706_1001543032 290
546 3300005468 Ga0070707_100001802 Ga0070707_10000180218 290
547 3300005468 Ga0070707_100020130 Ga0070707_1000201301 290
548 3300005468 Ga0070707_100072739 Ga0070707_1000727394 290
549 3300005471 Ga0070698_100030758 Ga0070698_1000307585 290
550 3300005471 Ga0070698_100068558 Ga0070698_1000685582 290
551 3300005471 Ga0070698_100083294 Ga0070698_1000832944 290
552 3300005518 Ga0070699_100010386 Ga0070699_1000103864 290
553 3300005518 Ga0070699_100110173 Ga0070699_1001101732 290
554 3300005536 Ga0070697_100023006 Ga0070697_1000230062 290
555 3300005536 Ga0070697_100065399 Ga0070697_1000653994 290
556 3300005718 Ga0068866_10149963 Ga0068866_101499632 290
557 3300005719 Ga0068861_100034303 Ga0068861_1000343034 290
558 3300005719 Ga0068861_100401335 Ga0068861_1004013352 290
559 3300005841 Ga0068863_100074755 Ga0068863_1000747552 290
560 3300005841 Ga0068863_100180337 Ga0068863_1001803373 290
561 3300005843 Ga0068860_100027403 Ga0068860_1000274036 290
562 3300005983 Ga0081540_1000604 Ga0081540_100060421 290
563 3300005983 Ga0081540_1038400 Ga0081540_10384003 290
564 3300006028 Ga0070717_10079448 Ga0070717_100794483 290
565 3300006038 Ga0075365_10004953 Ga0075365_100049536 290
566 3300006048 Ga0075363_100005500 Ga0075363_1000055005 290
567 3300006051 Ga0075364_10014387 Ga0075364_100143875 290
568 3300006163 Ga0070715_10070962 Ga0070715_100709622 290
569 3300006175 Ga0070712_100031582 Ga0070712_1000315824 290
570 3300006175 Ga0070712_100104562 Ga0070712_1001045623 290
571 3300006175 Ga0070712_100195467 Ga0070712_1001954672 290
572 3300006178 Ga0075367_10004355 Ga0075367_100043554 290
573 3300006844 Ga0075428_100021035 Ga0075428_1000210355 290
574 3300006844 Ga0075428_100629486 Ga0075428_1006294861 290
575 3300006847 Ga0075431_100003907 Ga0075431_1000039073 290
576 3300006847 Ga0075431_100563976 Ga0075431_1005639762 290
577 3300006852 Ga0075433_10003530 Ga0075433_1000353010 290
578 3300006871 Ga0075434_100000906 Ga0075434_10000090612 290
579 3300006871 Ga0075434_100117309 Ga0075434_1001173094 290
580 3300006871 Ga0075434_100343802 Ga0075434_1003438022 290
581 3300006880 Ga0075429_100393225 Ga0075429_1003932251 290
582 3300009094 Ga0111539_10017112 Ga0111539_100171126 290
583 3300009147 Ga0114129_10076569 Ga0114129_100765692 290
584 3300021441 Ga0213871_10058937 Ga0213871_100589371 290
585 3300025898 Ga0207692_10188648 Ga0207692_101886482 290
586 3300025906 Ga0207699_10242016 Ga0207699_102420162 290
587 3300025907 Ga0207645_10156494 Ga0207645_101564942 290
588 3300025910 Ga0207684_10142307 Ga0207684_101423072 290
589 3300025915 Ga0207693_10002927 Ga0207693_100029272 290
590 3300025915 Ga0207693_10006981 Ga0207693_1000698111 290
591 3300025915 Ga0207693_10012939 Ga0207693_100129392 290
592 3300025916 Ga0207663_10076310 Ga0207663_100763102 290
593 3300025916 Ga0207663_10082297 Ga0207663_100822972 290
594 3300025922 Ga0207646_10009737 Ga0207646_100097374 290
595 3300025922 Ga0207646_10017807 Ga0207646_100178072 290
596 3300025922 Ga0207646_10077061 Ga0207646_100770612 290
597 3300025928 Ga0207700_10035400 Ga0207700_100354004 290
598 3300025931 Ga0207644_10494605 Ga0207644_104946051 290
599 3300025933 Ga0207706_10015026 Ga0207706_100150262 290
600 3300025936 Ga0207670_10162379 Ga0207670_101623792 290
601 3300025937 Ga0207669_10121244 Ga0207669_101212442 290
602 3300025972 Ga0207668_10124124 Ga0207668_101241242 290
603 3300026088 Ga0207641_10034139 Ga0207641_100341392 290
604 3300026095 Ga0207676_10247250 Ga0207676_102472501 290
605 3300026118 Ga0207675_100013355 Ga0207675_1000133554 290
606 3300026118 Ga0207675_100060950 Ga0207675_1000609504 290
607 3300027907 Ga0207428_10110089 Ga0207428_101100893 290
608 3300027907 Ga0207428_10318732 Ga0207428_103187322 290
609 3300035090 Ga0373949_0016741 Ga0373949_0016741_94_966 290
610 3300035092 Ga0373952_0026976 Ga0373952_0026976_238_1110 290
611 3300035119 Ga0373956_0105548 Ga0373956_0105548_322_1194 290
612 3300035172 Ga0373955_0030028 Ga0373955_0030028_1884_2756 290
613 3300035242 Ga0373962_0020497 Ga0373962_0020497_771_1643 290
614 3300035695 Ga0373927_0132494 Ga0373927_0132494_714_1586 290
615 3300035724 Ga0373933_0017896 Ga0373933_0017896_1856_2728 290
616 3300036401 Ga0373937_0018534 Ga0373937_0018534_29_901 290
617 3300037312 Ga0395899_0059863 Ga0395899_0059863_1446_2318 290
618 3300037418 Ga0395900_0118889 Ga0395900_0118889_587_1459 290
619 3300037466 Ga0395898_0019646 Ga0395898_0019646_2625_3497 290
620 3300038443 Ga0395901_0071224 Ga0395901_0071224_2106_2978 290
621 3300039438 Ga0436360_0059562 Ga0436360_0059562_584_1456 290
622 3300039438 Ga0436360_0839106 Ga0436360_0839106_492_1364 290
623 3300039447 Ga0436361_0303893 Ga0436361_0303893_256_1128 290
624 3300039450 Ga0436363_0574967 Ga0436363_0574967_71_943 290
625 3300039453 Ga0436362_0676786 Ga0436362_0676786_1004_1876 290
626 3300039453 Ga0436362_1170800 Ga0436362_1170800_328_1200 290
627 3300046684 Ga0495669_0008623 Ga0495669_0008623_880_1752 290
628 3300047471 Ga0495684_0388382 Ga0495684_0388382_94_966 290
629 3300049574 Ga0501038_0287151 Ga0501038_0287151_278_1150 290
630 3300049577 Ga0501041_0081816 Ga0501041_0081816_281_1153 290
631 3300049577 Ga0501041_0221865 Ga0501041_0221865_223_1095 290
632 3300049580 Ga0501046_0234006 Ga0501046_0234006_155_1027 290
633 3300049582 Ga0501048_0010069 Ga0501048_0010069_212_1084 290
634 3300049586 Ga0501070_0236539 Ga0501070_0236539_508_1380 290
635 3300049587 Ga0501071_0375914 Ga0501071_0375914_29_901 290
636 3300049588 Ga0501072_0003682 Ga0501072_0003682_9822_10694 290
637 3300049588 Ga0501072_0034538 Ga0501072_0034538_1469_2341 290
638 3300049588 Ga0501072_0086164 Ga0501072_0086164_567_1439 290
639 3300049591 Ga0501075_0031171 Ga0501075_0031171_1457_2329 290
640 3300049591 Ga0501075_0130836 Ga0501075_0130836_159_1031 290
641 3300049591 Ga0501075_0177477 Ga0501075_0177477_82_984 290
642 3300049592 Ga0501076_0043209 Ga0501076_0043209_363_1235 290
643 3300049592 Ga0501076_0107872 Ga0501076_0107872_988_1860 290
644 3300049593 Ga0501077_0017209 Ga0501077_0017209_1404_2276 290
645 3300049593 Ga0501077_0159626 Ga0501077_0159626_404_1306 290
646 3300049741 Ga0501079_0040193 Ga0501079_0040193_2492_3364 290
647 3300049742 Ga0501080_0049950 Ga0501080_0049950_2160_3032 290
648 3300049743 Ga0501081_0016150 Ga0501081_0016150_2877_3749 290
649 3300049743 Ga0501081_0232172 Ga0501081_0232172_140_1012 290
650 3300049822 Ga0501035_0099292 Ga0501035_0099292_124_996 290
651 3300049824 Ga0501045_0222238 Ga0501045_0222238_359_1231 290
652 3300050491 nmdc:mga00v17_31547_c1 nmdc:mga00v17_31547_c1_1116_1988 290
653 3300050492 nmdc:mga0yw44_72940_c1 nmdc:mga0yw44_72940_c1_653_1525 290
654 3300050494 nmdc:mga06z11_1418_c1 nmdc:mga06z11_1418_c1_1615_2487 290
655 3300050494 nmdc:mga06z11_216927_c1 nmdc:mga06z11_216927_c1_231_1103 290
656 3300050507 nmdc:mga05p37_245_c1 nmdc:mga05p37_245_c1_34099_34971 290
657 3300050507 nmdc:mga05p37_96329_c1 nmdc:mga05p37_96329_c1_329_1201 290
658 3300050508 nmdc:mga09592_256041_c1 nmdc:mga09592_256041_c1_277_1149 290
659 3300050508 nmdc:mga09592_8944_c1 nmdc:mga09592_8944_c1_5158_6054 290
660 3300050510 nmdc:mga06r32_2051_c1 nmdc:mga06r32_2051_c1_5283_6179 290
661 3300050510 nmdc:mga06r32_485623_c1 nmdc:mga06r32_485623_c1_91_963 290
662 3300050511 nmdc:mga08y16_252653_c1 nmdc:mga08y16_252653_c1_458_1330 290
663 3300050511 nmdc:mga08y16_255688_c1 nmdc:mga08y16_255688_c1_870_1742 290
664 3300050511 nmdc:mga08y16_377897_c1 nmdc:mga08y16_377897_c1_120_992 290
665 3300050512 nmdc:mga0n895_316236_c1 nmdc:mga0n895_316236_c1_226_1098 290
666 3300050512 nmdc:mga0n895_3297_c1 nmdc:mga0n895_3297_c1_8502_9374 290
667 3300050512 nmdc:mga0n895_518509_c1 nmdc:mga0n895_518509_c1_73_945 290
668 3300050512 nmdc:mga0n895_618373_c1 nmdc:mga0n895_618373_c1_192_1064 290
669 3300050512 nmdc:mga0n895_82606_c1 nmdc:mga0n895_82606_c1_2010_2882 290
670 3300050515 nmdc:mga0a205_2320_c1 nmdc:mga0a205_2320_c1_5264_6136 290
671 3300050515 nmdc:mga0a205_3097_c1 nmdc:mga0a205_3097_c1_2037_2909 290
672 3300053085 Ga0495619_0062178 Ga0495619_0062178_1414_2286 290
673 3300054114 Ga0501084_0019705 Ga0501084_0019705_2471_3343 290
674 3300054114 Ga0501084_0072069 Ga0501084_0072069_138_1010 290
675 3300060353 Ga0501082_0008032 Ga0501082_0008032_147_1019 290
676 3300060353 Ga0501082_0226455 Ga0501082_0226455_21_893 290
677 3300061734 Ga0530510_0073777 Ga0530510_0073777_188_1060 290
678 3300006175 Ga0070712_100023832 Ga0070712_1000238324 291
679 3300025915 Ga0207693_10031005 Ga0207693_100310052 291
680 3300045049 Ga0466959_0428557 Ga0466959_0428557_12_887 291
681 3300046473 Ga0495582_0001121 Ga0495582_0001121_16_891 291
682 3300050509 nmdc:mga0qj67_97437_c1 nmdc:mga0qj67_97437_c1_657_1532 291
683 3300050510 nmdc:mga06r32_62216_c1 nmdc:mga06r32_62216_c1_93_968 291
684 3300005842 Ga0068858_100285965 Ga0068858_1002859652 292
685 3300006038 Ga0075365_10079598 Ga0075365_100795982 292
686 3300006042 Ga0075368_10000940 Ga0075368_100009405 292
687 3300006048 Ga0075363_100009758 Ga0075363_1000097584 292
688 3300006178 Ga0075367_10000844 Ga0075367_100008442 292
689 3300007076 Ga0075435_100007819 Ga0075435_1000078192 292
690 3300009094 Ga0111539_10046377 Ga0111539_100463773 292
691 3300009101 Ga0105247_10071690 Ga0105247_100716902 292
692 3300009147 Ga0114129_10116521 Ga0114129_101165213 292
693 3300013105 Ga0157369_10434083 Ga0157369_104340831 292
694 3300013297 Ga0157378_10260833 Ga0157378_102608332 292
695 3300013306 Ga0163162_10005621 Ga0163162_100056219 292
696 3300013306 Ga0163162_10018107 Ga0163162_100181076 292
697 3300014325 Ga0163163_10525612 Ga0163163_105256121 292
698 3300026088 Ga0207641_10023725 Ga0207641_100237254 292
699 3300027866 Ga0209813_10000776 Ga0209813_100007767 292
700 3300027907 Ga0207428_10099667 Ga0207428_100996672 292
701 3300046455 Ga0495603_0089296 Ga0495603_0089296_174_1052 292
702 3300046691 Ga0495670_0067721 Ga0495670_0067721_473_1369 292
703 3300048910 Ga0496107_0318122 Ga0496107_0318122_68_946 292
704 3300048917 Ga0496114_0249967 Ga0496114_0249967_335_1213 292
705 3300049824 Ga0501045_0102771 Ga0501045_0102771_666_1544 292
706 3300050490 nmdc:mga03n38_2661_c1 nmdc:mga03n38_2661_c1_3369_4247 292
707 3300050494 nmdc:mga06z11_920_c1 nmdc:mga06z11_920_c1_2662_3540 292
708 3300050495 nmdc:mga04h51_741_c1 nmdc:mga04h51_741_c1_2811_3689 292
709 3300050507 nmdc:mga05p37_29250_c1 nmdc:mga05p37_29250_c1_1544_2422 292
710 3300050511 nmdc:mga08y16_37893_c1 nmdc:mga08y16_37893_c1_3316_4194 292
711 3300050512 nmdc:mga0n895_10747_c1 nmdc:mga0n895_10747_c1_2216_3121 292
712 3300050513 nmdc:mga0rr50_79206_c1 nmdc:mga0rr50_79206_c1_210_1115 292
713 3300050507 nmdc:mga05p37_243725_c1 nmdc:mga05p37_243725_c1_298_1200 293
714 3300005334 Ga0068869_100268236 Ga0068869_1002682362 294
715 3300005439 Ga0070711_100227224 Ga0070711_1002272241 294
716 3300005981 Ga0081538_10026168 Ga0081538_100261683 294
717 3300006844 Ga0075428_100288827 Ga0075428_1002888272 294
718 3300006880 Ga0075429_100016285 Ga0075429_1000162855 294
719 3300006914 Ga0075436_100126538 Ga0075436_1001265382 294
720 3300007788 Ga0099795_10031237 Ga0099795_100312372 294
721 3300009147 Ga0114129_10042614 Ga0114129_100426142 294
722 3300010159 Ga0099796_10074070 Ga0099796_100740702 294
723 3300021358 Ga0213873_10004074 Ga0213873_100040743 294
724 3300025915 Ga0207693_10061970 Ga0207693_100619703 294
725 3300025916 Ga0207663_10227543 Ga0207663_102275432 294
726 3300025928 Ga0207700_10003921 Ga0207700_100039213 294
727 3300025929 Ga0207664_10088470 Ga0207664_100884702 294
728 3300025939 Ga0207665_10065456 Ga0207665_100654562 294
729 3300026078 Ga0207702_10066149 Ga0207702_100661494 294
730 3300035111 Ga0373923_0058356 Ga0373923_0058356_235_1119 294
731 3300035695 Ga0373927_0045572 Ga0373927_0045572_1581_2465 294
732 3300035725 Ga0373947_0039226 Ga0373947_0039226_87_971 294
733 3300039437 Ga0436365_0927538 Ga0436365_0927538_567_1451 294
734 3300039453 Ga0436362_0527587 Ga0436362_0527587_4300_5184 294
735 3300046491 Ga0495584_0026836 Ga0495584_0026836_1319_2203 294
736 3300046615 Ga0495656_0004785 Ga0495656_0004785_1481_2365 294
737 3300048915 Ga0496112_0106098 Ga0496112_0106098_1711_2595 294
738 3300048916 Ga0496113_0026105 Ga0496113_0026105_1649_2533 294
739 3300050507 nmdc:mga05p37_37199_c1 nmdc:mga05p37_37199_c1_2977_3861 294
740 3300050508 nmdc:mga09592_25067_c1 nmdc:mga09592_25067_c1_3634_4518 294
741 3300050509 nmdc:mga0qj67_31467_c1 nmdc:mga0qj67_31467_c1_872_1756 294
742 3300050510 nmdc:mga06r32_108289_c1 nmdc:mga06r32_108289_c1_1300_2184 294
743 3300050514 nmdc:mga08x19_128216_c1 nmdc:mga08x19_128216_c1_171_1055 294
744 iso_pu_bacteria 2513237098 2513674026 294
745 3300005436 Ga0070713_100014908 Ga0070713_1000149086 295
746 3300006028 Ga0070717_10241289 Ga0070717_102412892 295
747 3300006844 Ga0075428_100001793 Ga0075428_10000179321 295
748 3300006847 Ga0075431_100000136 Ga0075431_10000013639 295
749 3300009094 Ga0111539_10000405 Ga0111539_1000040527 295
750 3300009147 Ga0114129_10002465 Ga0114129_1000246510 295
751 3300025898 Ga0207692_10011719 Ga0207692_100117192 295
752 3300025928 Ga0207700_10046114 Ga0207700_100461144 295
753 3300026075 Ga0207708_10256681 Ga0207708_102566811 295
754 3300027717 Ga0209998_10005041 Ga0209998_100050412 295
755 3300027876 Ga0209974_10037708 Ga0209974_100377082 295
756 3300027907 Ga0207428_10000994 Ga0207428_1000099421 295
757 3300035117 Ga0373953_0145289 Ga0373953_0145289_64_951 295
758 3300035120 Ga0373957_0034628 Ga0373957_0034628_279_1166 295
759 3300035172 Ga0373955_0001161 Ga0373955_0001161_1686_2573 295
760 3300035724 Ga0373933_0093509 Ga0373933_0093509_250_1137 295
761 3300037068 Ga0373925_0025094 Ga0373925_0025094_15_902 295
762 3300042461 Ga0439460_0006679 Ga0439460_0006679_969_1856 295
763 3300042993 Ga0439440_0023425 Ga0439440_0023425_152_1039 295
764 3300046462 Ga0495651_0018701 Ga0495651_0018701_1390_2277 295
765 3300046516 Ga0495628_0000950 Ga0495628_0000950_12759_13646 295
766 3300046529 Ga0495652_0002257 Ga0495652_0002257_9793_10680 295
767 3300046536 Ga0495587_0018856 Ga0495587_0018856_3103_3990 295
768 3300046543 Ga0495645_0001487 Ga0495645_0001487_9001_9888 295
769 3300046678 Ga0495599_0004908 Ga0495599_0004908_2493_3380 295
770 3300046809 Ga0495600_0025547 Ga0495600_0025547_607_1494 295
771 3300047322 Ga0495680_0222280 Ga0495680_0222280_40_927 295
772 3300047471 Ga0495684_0094065 Ga0495684_0094065_192_1079 295
773 3300048088 Ga0495602_0004084 Ga0495602_0004084_4091_4978 295
774 3300048907 Ga0496104_0001363 Ga0496104_0001363_11742_12629 295
775 3300048908 Ga0496105_0002131 Ga0496105_0002131_10124_11011 295
776 3300049592 Ga0501076_0088236 Ga0501076_0088236_1592_2479 295
777 3300049593 Ga0501077_0123457 Ga0501077_0123457_270_1157 295
778 3300050507 nmdc:mga05p37_74_c1 nmdc:mga05p37_74_c1_46274_47161 295
779 3300050509 nmdc:mga0qj67_352807_c1 nmdc:mga0qj67_352807_c1_261_1148 295
780 3300050510 nmdc:mga06r32_146_c1 nmdc:mga06r32_146_c1_46154_47041 295
781 3300050511 nmdc:mga08y16_373_c1 nmdc:mga08y16_373_c1_17066_17953 295
782 3300053077 Ga0495601_0000075 Ga0495601_0000075_22983_23870 295
783 3300053084 Ga0495595_0000311 Ga0495595_0000311_10890_11777 295
784 3300053085 Ga0495619_0000645 Ga0495619_0000645_10714_11601 295
785 3300035119 Ga0373956_0033736 Ga0373956_0033736_423_1313 296
786 3300035120 Ga0373957_0030354 Ga0373957_0030354_448_1338 296
787 3300036401 Ga0373937_0021905 Ga0373937_0021905_2194_3084 296
788 3300046642 Ga0495634_0062176 Ga0495634_0062176_1517_2407 296
789 3300046809 Ga0495600_0112212 Ga0495600_0112212_159_1049 296
790 3300047322 Ga0495680_0016567 Ga0495680_0016567_4741_5631 296
791 3300049591 Ga0501075_0084938 Ga0501075_0084938_1050_1940 296
792 3300050509 nmdc:mga0qj67_102897_c1 nmdc:mga0qj67_102897_c1_1368_2264 296
793 3300053077 Ga0495601_0055747 Ga0495601_0055747_1090_1980 296
794 3300053085 Ga0495619_0007589 Ga0495619_0007589_2136_3026 296
795 3300005329 Ga0070683_100288265 Ga0070683_1002882651 297
796 3300005331 Ga0070670_100255607 Ga0070670_1002556072 297
797 3300005335 Ga0070666_10164933 Ga0070666_101649332 297
798 3300005338 Ga0068868_100062551 Ga0068868_1000625512 297
799 3300005340 Ga0070689_100033685 Ga0070689_1000336854 297
800 3300005356 Ga0070674_100147943 Ga0070674_1001479432 297
801 3300005365 Ga0070688_100018496 Ga0070688_1000184964 297
802 3300005366 Ga0070659_100263755 Ga0070659_1002637552 297
803 3300005367 Ga0070667_100059407 Ga0070667_1000594072 297
804 3300005434 Ga0070709_10051670 Ga0070709_100516702 297
805 3300005435 Ga0070714_100024062 Ga0070714_1000240622 297
806 3300005437 Ga0070710_10109167 Ga0070710_101091672 297
807 3300005439 Ga0070711_100130271 Ga0070711_1001302712 297
808 3300005456 Ga0070678_100010321 Ga0070678_1000103213 297
809 3300005535 Ga0070684_100152560 Ga0070684_1001525602 297
810 3300005547 Ga0070693_100141954 Ga0070693_1001419542 297
811 3300005548 Ga0070665_100223317 Ga0070665_1002233172 297
812 3300005841 Ga0068863_100318066 Ga0068863_1003180662 297
813 3300005842 Ga0068858_100048335 Ga0068858_1000483352 297
814 3300005844 Ga0068862_100061701 Ga0068862_1000617014 297
815 3300005937 Ga0081455_10000007 Ga0081455_10000007180 297
816 3300005937 Ga0081455_10012285 Ga0081455_100122859 297
817 3300005937 Ga0081455_10230896 Ga0081455_102308962 297
818 3300005983 Ga0081540_1006112 Ga0081540_10061123 297
819 3300005983 Ga0081540_1038399 Ga0081540_10383991 297
820 3300006028 Ga0070717_10229340 Ga0070717_102293402 297
821 3300006173 Ga0070716_100007236 Ga0070716_1000072363 297
822 3300006194 Ga0075427_10000264 Ga0075427_100002644 297
823 3300006237 Ga0097621_100159470 Ga0097621_1001594702 297
824 3300006358 Ga0068871_100153883 Ga0068871_1001538832 297
825 3300006844 Ga0075428_100001723 Ga0075428_1000017239 297
826 3300006844 Ga0075428_100293401 Ga0075428_1002934012 297
827 3300006846 Ga0075430_100000201 Ga0075430_1000002019 297
828 3300006847 Ga0075431_100000260 Ga0075431_1000002609 297
829 3300006852 Ga0075433_10000007 Ga0075433_1000000770 297
830 3300006871 Ga0075434_100000091 Ga0075434_10000009138 297
831 3300006871 Ga0075434_100018407 Ga0075434_1000184072 297
832 3300006871 Ga0075434_100190438 Ga0075434_1001904382 297
833 3300006871 Ga0075434_100298472 Ga0075434_1002984722 297
834 3300006880 Ga0075429_100001265 Ga0075429_1000012658 297
835 3300007076 Ga0075435_100019064 Ga0075435_1000190644 297
836 3300007076 Ga0075435_100096477 Ga0075435_1000964772 297
837 3300007265 Ga0099794_10015829 Ga0099794_100158291 297
838 3300009011 Ga0105251_10033916 Ga0105251_100339164 297
839 3300009094 Ga0111539_10001412 Ga0111539_1000141212 297
840 3300009094 Ga0111539_10584661 Ga0111539_105846612 297
841 3300009101 Ga0105247_10059134 Ga0105247_100591343 297
842 3300009147 Ga0114129_10005016 Ga0114129_1000501610 297
843 3300009147 Ga0114129_10017987 Ga0114129_100179874 297
844 3300009174 Ga0105241_10013233 Ga0105241_100132333 297
845 3300009177 Ga0105248_10185600 Ga0105248_101856002 297
846 3300009551 Ga0105238_10087827 Ga0105238_100878273 297
847 3300011119 Ga0105246_10204338 Ga0105246_102043382 297
848 3300012502 Ga0157347_1003554 Ga0157347_10035542 297
849 3300025898 Ga0207692_10015380 Ga0207692_100153804 297
850 3300025900 Ga0207710_10010654 Ga0207710_100106543 297
851 3300025901 Ga0207688_10068753 Ga0207688_100687532 297
852 3300025906 Ga0207699_10001769 Ga0207699_100017698 297
853 3300025915 Ga0207693_10023031 Ga0207693_100230312 297
854 3300025916 Ga0207663_10151795 Ga0207663_101517952 297
855 3300025928 Ga0207700_10000389 Ga0207700_100003899 297
856 3300025931 Ga0207644_10017054 Ga0207644_100170544 297
857 3300025932 Ga0207690_10097585 Ga0207690_100975851 297
858 3300025934 Ga0207686_10012067 Ga0207686_100120674 297
859 3300025936 Ga0207670_10123770 Ga0207670_101237702 297
860 3300025938 Ga0207704_10117400 Ga0207704_101174002 297
861 3300025939 Ga0207665_10001576 Ga0207665_100015764 297
862 3300025941 Ga0207711_10055850 Ga0207711_100558503 297
863 3300025960 Ga0207651_10028919 Ga0207651_100289192 297
864 3300025961 Ga0207712_10093870 Ga0207712_100938702 297
865 3300025986 Ga0207658_10057511 Ga0207658_100575112 297
866 3300026023 Ga0207677_10011475 Ga0207677_100114751 297
867 3300026067 Ga0207678_10090327 Ga0207678_100903272 297
868 3300026078 Ga0207702_10451662 Ga0207702_104516622 297
869 3300026118 Ga0207675_100512378 Ga0207675_1005123782 297
870 3300026121 Ga0207683_10050970 Ga0207683_100509704 297
871 3300027671 Ga0209588_1097739 Ga0209588_10977391 297
872 3300027907 Ga0207428_10000115 Ga0207428_1000011512 297
873 3300028800 Ga0265338_10026253 Ga0265338_100262535 297
874 3300028800 Ga0265338_10323267 Ga0265338_103232671 297
875 3300031241 Ga0265325_10001871 Ga0265325_100018717 297
876 3300031241 Ga0265325_10027955 Ga0265325_100279552 297
877 3300031247 Ga0265340_10113878 Ga0265340_101138782 297
878 3300031249 Ga0265339_10000128 Ga0265339_1000012846 297
879 3300031595 Ga0265313_10008004 Ga0265313_100080044 297
880 3300031595 Ga0265313_10016824 Ga0265313_100168243 297
881 3300035084 Ga0373928_0000963 Ga0373928_0000963_1587_2480 297
882 3300035086 Ga0373934_0130763 Ga0373934_0130763_28_921 297
883 3300035088 Ga0373940_0007021 Ga0373940_0007021_1142_2035 297
884 3300035089 Ga0373944_0000671 Ga0373944_0000671_3600_4493 297
885 3300035111 Ga0373923_0022613 Ga0373923_0022613_1227_2120 297
886 3300035112 Ga0373932_0001744 Ga0373932_0001744_3094_3987 297
887 3300035113 Ga0373936_0003453 Ga0373936_0003453_1913_2806 297
888 3300035115 Ga0373941_0116338 Ga0373941_0116338_14_907 297
889 3300035116 Ga0373945_0004819 Ga0373945_0004819_2397_3290 297
890 3300035117 Ga0373953_0023257 Ga0373953_0023257_1100_1993 297
891 3300035119 Ga0373956_0007852 Ga0373956_0007852_1281_2174 297
892 3300035170 Ga0373943_0010807 Ga0373943_0010807_1327_2220 297
893 3300035171 Ga0373946_0012694 Ga0373946_0012694_921_1814 297
894 3300035172 Ga0373955_0010246 Ga0373955_0010246_3361_4254 297
895 3300035172 Ga0373955_0156070 Ga0373955_0156070_59_952 297
896 3300035207 Ga0373942_0001181 Ga0373942_0001181_1666_2559 297
897 3300035242 Ga0373962_0003444 Ga0373962_0003444_2651_3544 297
898 3300035410 Ga0373924_0004747 Ga0373924_0004747_2520_3413 297
899 3300035691 Ga0373931_0002834 Ga0373931_0002834_5220_6113 297
900 3300035692 Ga0373935_0179900 Ga0373935_0179900_238_1131 297
901 3300035695 Ga0373927_0102437 Ga0373927_0102437_860_1753 297
902 3300035725 Ga0373947_0028401 Ga0373947_0028401_934_1827 297
903 3300036401 Ga0373937_0009801 Ga0373937_0009801_2245_3138 297
904 3300037068 Ga0373925_0030749 Ga0373925_0030749_147_1040 297
905 3300037068 Ga0373925_0054744 Ga0373925_0054744_1176_2069 297
906 3300044694 Ga0466963_0149356 Ga0466963_0149356_435_1328 297
907 3300044842 Ga0466957_0077050 Ga0466957_0077050_246_1139 297
908 3300045836 Ga0466958_0002114 Ga0466958_0002114_5796_6689 297
909 3300045976 Ga0466967_0348141 Ga0466967_0348141_416_1315 297
910 3300046454 Ga0495592_0009003 Ga0495592_0009003_2503_3396 297
911 3300046455 Ga0495603_0113697 Ga0495603_0113697_237_1130 297
912 3300046458 Ga0495591_013259 Ga0495591_013259_1220_2113 297
913 3300046459 Ga0495629_0000183 Ga0495629_0000183_17527_18420 297
914 3300046459 Ga0495629_0039835 Ga0495629_0039835_2197_3090 297
915 3300046461 Ga0495641_0020362 Ga0495641_0020362_595_1488 297
916 3300046463 Ga0495653_0008179 Ga0495653_0008179_3024_3917 297
917 3300046472 Ga0495580_0016429 Ga0495580_0016429_2473_3366 297
918 3300046473 Ga0495582_0005330 Ga0495582_0005330_1509_2402 297
919 3300046475 Ga0495639_0004781 Ga0495639_0004781_2466_3359 297
920 3300046476 Ga0495662_0024079 Ga0495662_0024079_2005_2898 297
921 3300046477 Ga0495664_0011771 Ga0495664_0011771_2925_3818 297
922 3300046491 Ga0495584_0005357 Ga0495584_0005357_1010_1903 297
923 3300046492 Ga0495585_0003428 Ga0495585_0003428_8384_9277 297
924 3300046499 Ga0495594_0005327 Ga0495594_0005327_581_1474 297
925 3300046501 Ga0495607_0004302 Ga0495607_0004302_1065_1958 297
926 3300046511 Ga0495608_0020500 Ga0495608_0020500_1453_2346 297
927 3300046514 Ga0495618_0060862 Ga0495618_0060862_581_1474 297
928 3300046516 Ga0495628_0045893 Ga0495628_0045893_1478_2371 297
929 3300046516 Ga0495628_0109277 Ga0495628_0109277_414_1307 297
930 3300046523 Ga0495644_0002500 Ga0495644_0002500_3256_4149 297
931 3300046525 Ga0495663_0006714 Ga0495663_0006714_822_1715 297
932 3300046526 Ga0495666_0011155 Ga0495666_0011155_3010_3903 297
933 3300046529 Ga0495652_0011919 Ga0495652_0011919_4118_5011 297
934 3300046531 Ga0495665_0004860 Ga0495665_0004860_5679_6572 297
935 3300046533 Ga0495640_0045939 Ga0495640_0045939_1279_2172 297
936 3300046535 Ga0495586_0038529 Ga0495586_0038529_56_949 297
937 3300046536 Ga0495587_0035272 Ga0495587_0035272_978_1871 297
938 3300046537 Ga0495598_0000533 Ga0495598_0000533_2765_3658 297
939 3300046557 Ga0495622_0017959 Ga0495622_0017959_1043_1936 297
940 3300046558 Ga0495633_0005806 Ga0495633_0005806_5240_6133 297
941 3300046559 Ga0495667_0029180 Ga0495667_0029180_1542_2435 297
942 3300046615 Ga0495656_0000174 Ga0495656_0000174_7704_8597 297
943 3300046648 Ga0495611_0007327 Ga0495611_0007327_653_1546 297
944 3300046663 Ga0495635_0027480 Ga0495635_0027480_2466_3359 297
945 3300046664 Ga0495659_0005884 Ga0495659_0005884_2709_3602 297
946 3300046674 Ga0495588_0004659 Ga0495588_0004659_4582_5475 297
947 3300046675 Ga0495657_0130430 Ga0495657_0130430_513_1406 297
948 3300046680 Ga0495646_0021538 Ga0495646_0021538_1202_2095 297
949 3300046681 Ga0495647_0022108 Ga0495647_0022108_321_1214 297
950 3300046683 Ga0495658_0000357 Ga0495658_0000357_16076_16969 297
951 3300046683 Ga0495658_0009249 Ga0495658_0009249_2961_3854 297
952 3300046689 Ga0495613_0009388 Ga0495613_0009388_3179_4072 297
953 3300046689 Ga0495613_0035886 Ga0495613_0035886_167_1060 297
954 3300046691 Ga0495670_0000414 Ga0495670_0000414_9764_10657 297
955 3300047317 Ga0495604_0007509 Ga0495604_0007509_2930_3823 297
956 3300047317 Ga0495604_0011926 Ga0495604_0011926_4232_5125 297
957 3300047319 Ga0495674_0033762 Ga0495674_0033762_1524_2417 297
958 3300047321 Ga0495676_0026061 Ga0495676_0026061_1363_2256 297
959 3300047322 Ga0495680_0005049 Ga0495680_0005049_3258_4151 297
960 3300047322 Ga0495680_0017512 Ga0495680_0017512_675_1568 297
961 3300047322 Ga0495680_0042665 Ga0495680_0042665_1752_2645 297
962 3300047673 Ga0495593_0089866 Ga0495593_0089866_31_924 297
963 3300048089 Ga0495614_0004206 Ga0495614_0004206_2564_3457 297
964 3300048903 Ga0496100_0031631 Ga0496100_0031631_832_1725 297
965 3300048904 Ga0496101_0121450 Ga0496101_0121450_283_1176 297
966 3300048905 Ga0496102_0024560 Ga0496102_0024560_2548_3441 297
967 3300048906 Ga0496103_0059587 Ga0496103_0059587_800_1693 297
968 3300048907 Ga0496104_0070905 Ga0496104_0070905_222_1115 297
969 3300048907 Ga0496104_0118210 Ga0496104_0118210_659_1552 297
970 3300048908 Ga0496105_0057880 Ga0496105_0057880_1499_2392 297
971 3300048909 Ga0496106_0030341 Ga0496106_0030341_1449_2342 297
972 3300048910 Ga0496107_0018210 Ga0496107_0018210_2366_3259 297
973 3300048912 Ga0496109_0030748 Ga0496109_0030748_1553_2446 297
974 3300048916 Ga0496113_0044851 Ga0496113_0044851_885_1778 297
975 3300049574 Ga0501038_0164353 Ga0501038_0164353_610_1551 297
976 3300049576 Ga0501040_0030566 Ga0501040_0030566_748_1689 297
977 3300049577 Ga0501041_0018927 Ga0501041_0018927_1521_2462 297
978 3300049582 Ga0501048_0038900 Ga0501048_0038900_2428_3369 297
979 3300049584 Ga0501068_0058865 Ga0501068_0058865_444_1385 297
980 3300049587 Ga0501071_0034066 Ga0501071_0034066_1485_2426 297
981 3300049588 Ga0501072_0007452 Ga0501072_0007452_6452_7393 297
982 3300049591 Ga0501075_0000015 Ga0501075_0000015_31798_32739 297
983 3300049592 Ga0501076_0000009 Ga0501076_0000009_101003_101944 297
984 3300049593 Ga0501077_0044757 Ga0501077_0044757_678_1619 297
985 3300049741 Ga0501079_0006275 Ga0501079_0006275_6351_7292 297
986 3300049742 Ga0501080_0024856 Ga0501080_0024856_3605_4546 297
987 3300049743 Ga0501081_0029162 Ga0501081_0029162_732_1673 297
988 3300049824 Ga0501045_0075111 Ga0501045_0075111_74_1015 297
989 3300050507 nmdc:mga05p37_5774_c1 nmdc:mga05p37_5774_c1_6237_7130 297
990 3300050507 nmdc:mga05p37_828_c1 nmdc:mga05p37_828_c1_17796_18689 297
991 3300050508 nmdc:mga09592_12180_c1 nmdc:mga09592_12180_c1_3420_4313 297
992 3300050508 nmdc:mga09592_409132_c1 nmdc:mga09592_409132_c1_19_912 297
993 3300050509 nmdc:mga0qj67_165_c1 nmdc:mga0qj67_165_c1_7828_8721 297
994 3300050510 nmdc:mga06r32_513_c1 nmdc:mga06r32_513_c1_7755_8648 297
995 3300050511 nmdc:mga08y16_19387_c1 nmdc:mga08y16_19387_c1_5454_6347 297
996 3300050512 nmdc:mga0n895_165518_c1 nmdc:mga0n895_165518_c1_536_1429 297
997 3300050512 nmdc:mga0n895_22138_c1 nmdc:mga0n895_22138_c1_1254_2147 297
998 3300050512 nmdc:mga0n895_318603_c1 nmdc:mga0n895_318603_c1_211_1104 297
999 3300050512 nmdc:mga0n895_37636_c1 nmdc:mga0n895_37636_c1_2964_3857 297
1000 3300050512 nmdc:mga0n895_69804_c1 nmdc:mga0n895_69804_c1_395_1288 297
1001 3300050513 nmdc:mga0rr50_14131_c1 nmdc:mga0rr50_14131_c1_3502_4395 297
1002 3300050513 nmdc:mga0rr50_58552_c1 nmdc:mga0rr50_58552_c1_1046_1939 297
1003 3300050515 nmdc:mga0a205_2547_c1 nmdc:mga0a205_2547_c1_3077_3970 297
1004 3300053077 Ga0495601_0004911 Ga0495601_0004911_1874_2767 297
1005 3300053078 Ga0495612_0009831 Ga0495612_0009831_709_1602 297
1006 3300053078 Ga0495612_0021104 Ga0495612_0021104_436_1329 297
1007 3300053084 Ga0495595_0046565 Ga0495595_0046565_167_1060 297
1008 3300053085 Ga0495619_0000301 Ga0495619_0000301_16752_17645 297
1009 3300053085 Ga0495619_0000315 Ga0495619_0000315_32915_33808 297
1010 3300053085 Ga0495619_0112369 Ga0495619_0112369_860_1753 297
1011 3300054114 Ga0501084_0017681 Ga0501084_0017681_1014_1955 297
1012 3300061734 Ga0530510_0000035 Ga0530510_0000035_28543_29484 297
1013 3300000041 ARcpr5oldR_c000049 ARcpr5oldR_00004924 298
1014 3300000042 ARSoilYngRDRAFT_c00160 ARSoilYngRDRAFT_0016012 298
1015 3300000043 ARcpr5yngRDRAFT_c000030 ARcpr5yngRDRAFT_00003013 298
1016 3300000044 ARSoilOldRDRAFT_c000033 ARSoilOldRDRAFT_00003313 298
1017 3300000045 ARCol0oldRDRAFT_c01542 ARCol0oldRDRAFT_015421 298
1018 3300000652 ARCol0yngRDRAFT_1000078 ARCol0yngRDRAFT_10000787 298
1019 3300001989 JGI24739J22299_10002387 JGI24739J22299_100023874 298
1020 3300001990 JGI24737J22298_10019750 JGI24737J22298_100197502 298
1021 3300002070 JGI24750J21931_1000579 JGI24750J21931_10005797 298
1022 3300002073 JGI24745J21846_1000593 JGI24745J21846_10005932 298
1023 3300002075 JGI24738J21930_10000453 JGI24738J21930_1000045310 298
1024 3300002126 JGI24035J26624_1000356 JGI24035J26624_10003563 298
1025 3300002155 JGI24033J26618_1002015 JGI24033J26618_10020152 298
1026 3300002244 JGI24742J22300_10000426 JGI24742J22300_100004267 298
1027 3300005277 Ga0065716_1002581 Ga0065716_10025812 298
1028 3300005290 Ga0065712_10002685 Ga0065712_100026856 298
1029 3300005290 Ga0065712_10083652 Ga0065712_100836522 298
1030 3300005293 Ga0065715_10005190 Ga0065715_100051909 298
1031 3300005293 Ga0065715_10239077 Ga0065715_102390771 298
1032 3300005328 Ga0070676_10002407 Ga0070676_100024078 298
1033 3300005328 Ga0070676_10154057 Ga0070676_101540572 298
1034 3300005329 Ga0070683_100004780 Ga0070683_1000047804 298
1035 3300005330 Ga0070690_100000577 Ga0070690_10000057720 298
1036 3300005330 Ga0070690_100018789 Ga0070690_1000187893 298
1037 3300005331 Ga0070670_100026119 Ga0070670_1000261195 298
1038 3300005333 Ga0070677_10000943 Ga0070677_100009435 298
1039 3300005335 Ga0070666_10030069 Ga0070666_100300692 298
1040 3300005336 Ga0070680_100062248 Ga0070680_1000622483 298
1041 3300005337 Ga0070682_100002906 Ga0070682_1000029064 298
1042 3300005337 Ga0070682_100047308 Ga0070682_1000473082 298
1043 3300005338 Ga0068868_100000892 Ga0068868_10000089211 298
1044 3300005339 Ga0070660_100003390 Ga0070660_1000033908 298
1045 3300005339 Ga0070660_100130908 Ga0070660_1001309082 298
1046 3300005340 Ga0070689_100002855 Ga0070689_1000028557 298
1047 3300005341 Ga0070691_10001992 Ga0070691_100019924 298
1048 3300005343 Ga0070687_100000895 Ga0070687_1000008955 298
1049 3300005343 Ga0070687_100032929 Ga0070687_1000329292 298
1050 3300005344 Ga0070661_100000804 Ga0070661_1000008047 298
1051 3300005345 Ga0070692_10000830 Ga0070692_100008305 298
1052 3300005347 Ga0070668_100005596 Ga0070668_1000055964 298
1053 3300005347 Ga0070668_100142910 Ga0070668_1001429101 298
1054 3300005353 Ga0070669_100010788 Ga0070669_1000107884 298
1055 3300005354 Ga0070675_100007817 Ga0070675_1000078174 298
1056 3300005354 Ga0070675_100007876 Ga0070675_1000078764 298
1057 3300005355 Ga0070671_100000144 Ga0070671_1000001444 298
1058 3300005355 Ga0070671_100317343 Ga0070671_1003173432 298
1059 3300005356 Ga0070674_100003771 Ga0070674_1000037715 298
1060 3300005356 Ga0070674_100070743 Ga0070674_1000707432 298
1061 3300005364 Ga0070673_100007016 Ga0070673_1000070162 298
1062 3300005365 Ga0070688_100028335 Ga0070688_1000283353 298
1063 3300005365 Ga0070688_100031244 Ga0070688_1000312442 298
1064 3300005366 Ga0070659_100005098 Ga0070659_1000050988 298
1065 3300005366 Ga0070659_100104616 Ga0070659_1001046162 298
1066 3300005367 Ga0070667_100003448 Ga0070667_1000034484 298
1067 3300005367 Ga0070667_100100919 Ga0070667_1001009193 298
1068 3300005406 Ga0070703_10030769 Ga0070703_100307692 298
1069 3300005436 Ga0070713_100559201 Ga0070713_1005592011 298
1070 3300005437 Ga0070710_10071882 Ga0070710_100718822 298
1071 3300005437 Ga0070710_10196238 Ga0070710_101962382 298
1072 3300005438 Ga0070701_10000951 Ga0070701_100009518 298
1073 3300005438 Ga0070701_10146738 Ga0070701_101467381 298
1074 3300005440 Ga0070705_100003034 Ga0070705_1000030344 298
1075 3300005441 Ga0070700_100001925 Ga0070700_1000019255 298
1076 3300005444 Ga0070694_100006591 Ga0070694_1000065917 298
1077 3300005445 Ga0070708_100108366 Ga0070708_1001083663 298
1078 3300005445 Ga0070708_100546278 Ga0070708_1005462781 298
1079 3300005455 Ga0070663_100008331 Ga0070663_1000083314 298
1080 3300005455 Ga0070663_100105614 Ga0070663_1001056142 298
1081 3300005456 Ga0070678_100082297 Ga0070678_1000822972 298
1082 3300005457 Ga0070662_100009476 Ga0070662_1000094764 298
1083 3300005457 Ga0070662_100011706 Ga0070662_1000117065 298
1084 3300005457 Ga0070662_100318344 Ga0070662_1003183441 298
1085 3300005458 Ga0070681_10012385 Ga0070681_100123853 298
1086 3300005458 Ga0070681_10049870 Ga0070681_100498703 298
1087 3300005459 Ga0068867_100011042 Ga0068867_1000110424 298
1088 3300005466 Ga0070685_10011928 Ga0070685_100119282 298
1089 3300005467 Ga0070706_100041402 Ga0070706_1000414024 298
1090 3300005467 Ga0070706_100190704 Ga0070706_1001907042 298
1091 3300005468 Ga0070707_100034910 Ga0070707_1000349102 298
1092 3300005468 Ga0070707_100431130 Ga0070707_1004311302 298
1093 3300005468 Ga0070707_100446141 Ga0070707_1004461412 298
1094 3300005518 Ga0070699_100007440 Ga0070699_1000074403 298
1095 3300005518 Ga0070699_100099117 Ga0070699_1000991171 298
1096 3300005530 Ga0070679_100019238 Ga0070679_1000192384 298
1097 3300005530 Ga0070679_100207286 Ga0070679_1002072862 298
1098 3300005535 Ga0070684_100001753 Ga0070684_10000175317 298
1099 3300005536 Ga0070697_100024096 Ga0070697_1000240962 298
1100 3300005536 Ga0070697_100174791 Ga0070697_1001747912 298
1101 3300005539 Ga0068853_100005853 Ga0068853_1000058535 298
1102 3300005539 Ga0068853_100016265 Ga0068853_1000162655 298
1103 3300005544 Ga0070686_100000086 Ga0070686_10000008652 298
1104 3300005544 Ga0070686_100005092 Ga0070686_1000050926 298
1105 3300005544 Ga0070686_100056253 Ga0070686_1000562532 298
1106 3300005545 Ga0070695_100004686 Ga0070695_1000046862 298
1107 3300005545 Ga0070695_100007717 Ga0070695_1000077174 298
1108 3300005546 Ga0070696_100004489 Ga0070696_1000044894 298
1109 3300005547 Ga0070693_100002732 Ga0070693_1000027322 298
1110 3300005547 Ga0070693_100044727 Ga0070693_1000447273 298
1111 3300005549 Ga0070704_100000280 Ga0070704_1000002805 298
1112 3300005563 Ga0068855_100027435 Ga0068855_1000274355 298
1113 3300005564 Ga0070664_100008530 Ga0070664_1000085307 298
1114 3300005577 Ga0068857_100068077 Ga0068857_1000680772 298
1115 3300005578 Ga0068854_100003207 Ga0068854_1000032074 298
1116 3300005614 Ga0068856_100010687 Ga0068856_1000106874 298
1117 3300005615 Ga0070702_100014862 Ga0070702_1000148622 298
1118 3300005616 Ga0068852_100002326 Ga0068852_1000023262 298
1119 3300005617 Ga0068859_100009076 Ga0068859_1000090768 298
1120 3300005617 Ga0068859_100018036 Ga0068859_1000180363 298
1121 3300005617 Ga0068859_100149718 Ga0068859_1001497183 298
1122 3300005618 Ga0068864_100001754 Ga0068864_10000175412 298
1123 3300005718 Ga0068866_10001865 Ga0068866_100018657 298
1124 3300005834 Ga0068851_10162154 Ga0068851_101621542 298
1125 3300005840 Ga0068870_10000419 Ga0068870_1000041919 298
1126 3300005841 Ga0068863_100000340 Ga0068863_10000034048 298
1127 3300005842 Ga0068858_100009413 Ga0068858_1000094134 298
1128 3300005842 Ga0068858_100057064 Ga0068858_1000570642 298
1129 3300005843 Ga0068860_100176586 Ga0068860_1001765862 298
1130 3300005844 Ga0068862_100006116 Ga0068862_1000061168 298
1131 3300005844 Ga0068862_100056602 Ga0068862_1000566022 298
1132 3300005937 Ga0081455_10004553 Ga0081455_1000455311 298
1133 3300005937 Ga0081455_10028693 Ga0081455_100286934 298
1134 3300005981 Ga0081538_10014227 Ga0081538_100142275 298
1135 3300005983 Ga0081540_1107129 Ga0081540_11071292 298
1136 3300005985 Ga0081539_10078214 Ga0081539_100782142 298
1137 3300006028 Ga0070717_10050726 Ga0070717_100507262 298
1138 3300006028 Ga0070717_10142621 Ga0070717_101426212 298
1139 3300006028 Ga0070717_10147315 Ga0070717_101473152 298
1140 3300006038 Ga0075365_10062017 Ga0075365_100620172 298
1141 3300006058 Ga0075432_10008949 Ga0075432_100089493 298
1142 3300006175 Ga0070712_100000165 Ga0070712_10000016514 298
1143 3300006175 Ga0070712_100089000 Ga0070712_1000890002 298
1144 3300006175 Ga0070712_100239963 Ga0070712_1002399631 298
1145 3300006175 Ga0070712_100369413 Ga0070712_1003694132 298
1146 3300006237 Ga0097621_100000880 Ga0097621_10000088022 298
1147 3300006353 Ga0075370_10192227 Ga0075370_101922272 298
1148 3300006358 Ga0068871_100006040 Ga0068871_1000060407 298
1149 3300006844 Ga0075428_100207998 Ga0075428_1002079983 298
1150 3300006844 Ga0075428_100660435 Ga0075428_1006604352 298
1151 3300006847 Ga0075431_100286372 Ga0075431_1002863722 298
1152 3300006852 Ga0075433_10377036 Ga0075433_103770362 298
1153 3300006871 Ga0075434_100005057 Ga0075434_1000050572 298
1154 3300006871 Ga0075434_100057453 Ga0075434_1000574533 298
1155 3300006871 Ga0075434_100084804 Ga0075434_1000848043 298
1156 3300006881 Ga0068865_100000615 Ga0068865_1000006154 298
1157 3300006881 Ga0068865_100028289 Ga0068865_1000282893 298
1158 3300006914 Ga0075436_100034161 Ga0075436_1000341614 298
1159 3300006931 Ga0097620_100009075 Ga0097620_1000090755 298
1160 3300006931 Ga0097620_100018036 Ga0097620_1000180363 298
1161 3300006931 Ga0097620_100149712 Ga0097620_1001497122 298
1162 3300007076 Ga0075435_100249559 Ga0075435_1002495592 298
1163 3300007265 Ga0099794_10054015 Ga0099794_100540152 298
1164 3300009092 Ga0105250_10059418 Ga0105250_100594182 298
1165 3300009093 Ga0105240_10282154 Ga0105240_102821542 298
1166 3300009094 Ga0111539_10006123 Ga0111539_100061236 298
1167 3300009094 Ga0111539_10024531 Ga0111539_100245313 298
1168 3300009094 Ga0111539_10534417 Ga0111539_105344171 298
1169 3300009098 Ga0105245_10041176 Ga0105245_100411762 298
1170 3300009101 Ga0105247_10026019 Ga0105247_100260192 298
1171 3300009147 Ga0114129_10056719 Ga0114129_100567193 298
1172 3300009147 Ga0114129_10464857 Ga0114129_104648572 298
1173 3300009147 Ga0114129_10756636 Ga0114129_107566362 298
1174 3300009148 Ga0105243_10006356 Ga0105243_100063566 298
1175 3300009148 Ga0105243_10007677 Ga0105243_100076777 298
1176 3300009174 Ga0105241_10021798 Ga0105241_100217984 298
1177 3300009174 Ga0105241_10172931 Ga0105241_101729312 298
1178 3300009174 Ga0105241_10257723 Ga0105241_102577232 298
1179 3300009176 Ga0105242_10007702 Ga0105242_100077027 298
1180 3300009176 Ga0105242_10344473 Ga0105242_103444732 298
1181 3300009177 Ga0105248_10004655 Ga0105248_100046555 298
1182 3300009177 Ga0105248_10020286 Ga0105248_100202867 298
1183 3300009177 Ga0105248_10720478 Ga0105248_107204782 298
1184 3300009177 Ga0105248_10767515 Ga0105248_107675152 298
1185 3300009177 Ga0105248_10802681 Ga0105248_108026812 298
1186 3300009545 Ga0105237_10042077 Ga0105237_100420775 298
1187 3300009545 Ga0105237_10252931 Ga0105237_102529312 298
1188 3300009553 Ga0105249_10010100 Ga0105249_100101007 298
1189 3300009553 Ga0105249_10258684 Ga0105249_102586842 298
1190 3300010159 Ga0099796_10001221 Ga0099796_100012215 298
1191 3300010375 Ga0105239_10233362 Ga0105239_102333622 298
1192 3300010375 Ga0105239_10322102 Ga0105239_103221022 298
1193 3300011119 Ga0105246_10001908 Ga0105246_1000190810 298
1194 3300012507 Ga0157342_1000599 Ga0157342_10005992 298
1195 3300013100 Ga0157373_10081190 Ga0157373_100811902 298
1196 3300013102 Ga0157371_10143088 Ga0157371_101430882 298
1197 3300013296 Ga0157374_10010364 Ga0157374_100103647 298
1198 3300013297 Ga0157378_10009964 Ga0157378_100099647 298
1199 3300013306 Ga0163162_10014215 Ga0163162_100142152 298
1200 3300013306 Ga0163162_10054423 Ga0163162_100544235 298
1201 3300013306 Ga0163162_10489251 Ga0163162_104892512 298
1202 3300013307 Ga0157372_10359520 Ga0157372_103595202 298
1203 3300013307 Ga0157372_10488928 Ga0157372_104889282 298
1204 3300013308 Ga0157375_10007981 Ga0157375_100079816 298
1205 3300013308 Ga0157375_10270745 Ga0157375_102707452 298
1206 3300013308 Ga0157375_10419868 Ga0157375_104198682 298
1207 3300013308 Ga0157375_10674707 Ga0157375_106747072 298
1208 3300014325 Ga0163163_10002823 Ga0163163_100028238 298
1209 3300014326 Ga0157380_10004902 Ga0157380_100049028 298
1210 3300014497 Ga0182008_10100343 Ga0182008_101003432 298
1211 3300014745 Ga0157377_10002529 Ga0157377_100025295 298
1212 3300014968 Ga0157379_10000036 Ga0157379_1000003667 298
1213 3300014969 Ga0157376_10027787 Ga0157376_100277873 298
1214 3300014969 Ga0157376_10307023 Ga0157376_103070232 298
1215 3300017792 Ga0163161_10006198 Ga0163161_100061987 298
1216 3300025271 Ga0207666_1000147 Ga0207666_10001476 298
1217 3300025271 Ga0207666_1002036 Ga0207666_10020362 298
1218 3300025290 Ga0207673_1000767 Ga0207673_10007672 298
1219 3300025297 Ga0209758_1000158 Ga0209758_1000158137 298
1220 3300025315 Ga0207697_10004223 Ga0207697_100042237 298
1221 3300025315 Ga0207697_10011422 Ga0207697_100114222 298
1222 3300025321 Ga0207656_10134785 Ga0207656_101347852 298
1223 3300025885 Ga0207653_10001409 Ga0207653_100014092 298
1224 3300025885 Ga0207653_10003233 Ga0207653_100032336 298
1225 3300025893 Ga0207682_10001723 Ga0207682_100017236 298
1226 3300025898 Ga0207692_10083257 Ga0207692_100832571 298
1227 3300025898 Ga0207692_10119437 Ga0207692_101194371 298
1228 3300025899 Ga0207642_10001921 Ga0207642_100019213 298
1229 3300025900 Ga0207710_10097248 Ga0207710_100972482 298
1230 3300025901 Ga0207688_10000167 Ga0207688_100001677 298
1231 3300025905 Ga0207685_10029858 Ga0207685_100298581 298
1232 3300025906 Ga0207699_10057442 Ga0207699_100574422 298
1233 3300025907 Ga0207645_10005140 Ga0207645_100051408 298
1234 3300025907 Ga0207645_10070515 Ga0207645_100705152 298
1235 3300025908 Ga0207643_10004063 Ga0207643_100040634 298
1236 3300025910 Ga0207684_10011632 Ga0207684_100116323 298
1237 3300025911 Ga0207654_10003427 Ga0207654_100034278 298
1238 3300025912 Ga0207707_10016807 Ga0207707_100168074 298
1239 3300025913 Ga0207695_10191240 Ga0207695_101912402 298
1240 3300025914 Ga0207671_10035659 Ga0207671_100356593 298
1241 3300025914 Ga0207671_10251610 Ga0207671_102516102 298
1242 3300025915 Ga0207693_10001566 Ga0207693_1000156615 298
1243 3300025915 Ga0207693_10024826 Ga0207693_100248264 298
1244 3300025915 Ga0207693_10051273 Ga0207693_100512734 298
1245 3300025915 Ga0207693_10097296 Ga0207693_100972962 298
1246 3300025916 Ga0207663_10025337 Ga0207663_100253373 298
1247 3300025917 Ga0207660_10001661 Ga0207660_100016612 298
1248 3300025917 Ga0207660_10086755 Ga0207660_100867552 298
1249 3300025917 Ga0207660_10106745 Ga0207660_101067452 298
1250 3300025918 Ga0207662_10000195 Ga0207662_100001958 298
1251 3300025918 Ga0207662_10004491 Ga0207662_100044916 298
1252 3300025919 Ga0207657_10012031 Ga0207657_100120317 298
1253 3300025919 Ga0207657_10085483 Ga0207657_100854833 298
1254 3300025920 Ga0207649_10000944 Ga0207649_1000094421 298
1255 3300025921 Ga0207652_10028891 Ga0207652_100288916 298
1256 3300025921 Ga0207652_10191196 Ga0207652_101911962 298
1257 3300025922 Ga0207646_10082521 Ga0207646_100825213 298
1258 3300025922 Ga0207646_10190243 Ga0207646_101902433 298
1259 3300025923 Ga0207681_10004024 Ga0207681_100040247 298
1260 3300025923 Ga0207681_10015699 Ga0207681_100156995 298
1261 3300025923 Ga0207681_10205354 Ga0207681_102053542 298
1262 3300025924 Ga0207694_10343993 Ga0207694_103439931 298
1263 3300025925 Ga0207650_10011209 Ga0207650_100112094 298
1264 3300025925 Ga0207650_10118783 Ga0207650_101187832 298
1265 3300025926 Ga0207659_10001128 Ga0207659_1000112812 298
1266 3300025926 Ga0207659_10020864 Ga0207659_100208644 298
1267 3300025927 Ga0207687_10006293 Ga0207687_100062938 298
1268 3300025928 Ga0207700_10038715 Ga0207700_100387153 298
1269 3300025928 Ga0207700_10049750 Ga0207700_100497503 298
1270 3300025928 Ga0207700_10338534 Ga0207700_103385341 298
1271 3300025931 Ga0207644_10016379 Ga0207644_100163796 298
1272 3300025931 Ga0207644_10326406 Ga0207644_103264062 298
1273 3300025932 Ga0207690_10010455 Ga0207690_100104557 298
1274 3300025932 Ga0207690_10130390 Ga0207690_101303902 298
1275 3300025933 Ga0207706_10010273 Ga0207706_100102737 298
1276 3300025933 Ga0207706_10018959 Ga0207706_100189592 298
1277 3300025933 Ga0207706_10294632 Ga0207706_102946322 298
1278 3300025934 Ga0207686_10002278 Ga0207686_100022789 298
1279 3300025935 Ga0207709_10093443 Ga0207709_100934432 298
1280 3300025936 Ga0207670_10000792 Ga0207670_100007922 298
1281 3300025936 Ga0207670_10017940 Ga0207670_100179402 298
1282 3300025936 Ga0207670_10114236 Ga0207670_101142362 298
1283 3300025937 Ga0207669_10001389 Ga0207669_100013896 298
1284 3300025937 Ga0207669_10044242 Ga0207669_100442422 298
1285 3300025938 Ga0207704_10001138 Ga0207704_100011383 298
1286 3300025939 Ga0207665_10050547 Ga0207665_100505473 298
1287 3300025939 Ga0207665_10077764 Ga0207665_100777642 298
1288 3300025940 Ga0207691_10009001 Ga0207691_100090015 298
1289 3300025941 Ga0207711_10011627 Ga0207711_100116274 298
1290 3300025941 Ga0207711_10068308 Ga0207711_100683083 298
1291 3300025941 Ga0207711_10564255 Ga0207711_105642552 298
1292 3300025942 Ga0207689_10000008 Ga0207689_10000008116 298
1293 3300025942 Ga0207689_10378309 Ga0207689_103783092 298
1294 3300025944 Ga0207661_10002577 Ga0207661_1000257711 298
1295 3300025945 Ga0207679_10004919 Ga0207679_100049197 298
1296 3300025949 Ga0207667_10008690 Ga0207667_100086906 298
1297 3300025960 Ga0207651_10000292 Ga0207651_1000029211 298
1298 3300025960 Ga0207651_10107323 Ga0207651_101073232 298
1299 3300025961 Ga0207712_10007532 Ga0207712_100075323 298
1300 3300025961 Ga0207712_10177802 Ga0207712_101778022 298
1301 3300025972 Ga0207668_10001329 Ga0207668_100013298 298
1302 3300025972 Ga0207668_10066414 Ga0207668_100664142 298
1303 3300025972 Ga0207668_10081971 Ga0207668_100819712 298
1304 3300025981 Ga0207640_10001339 Ga0207640_1000133911 298
1305 3300025986 Ga0207658_10014450 Ga0207658_100144505 298
1306 3300025986 Ga0207658_10087334 Ga0207658_100873342 298
1307 3300026035 Ga0207703_10006686 Ga0207703_100066866 298
1308 3300026035 Ga0207703_10044383 Ga0207703_100443834 298
1309 3300026035 Ga0207703_10047471 Ga0207703_100474712 298
1310 3300026035 Ga0207703_10085108 Ga0207703_100851082 298
1311 3300026041 Ga0207639_10011886 Ga0207639_100118867 298
1312 3300026041 Ga0207639_10085826 Ga0207639_100858262 298
1313 3300026067 Ga0207678_10009486 Ga0207678_100094865 298
1314 3300026067 Ga0207678_10045570 Ga0207678_100455704 298
1315 3300026067 Ga0207678_10059491 Ga0207678_100594913 298
1316 3300026075 Ga0207708_10006642 Ga0207708_100066427 298
1317 3300026075 Ga0207708_10053317 Ga0207708_100533173 298
1318 3300026078 Ga0207702_10025513 Ga0207702_100255133 298
1319 3300026088 Ga0207641_10013154 Ga0207641_100131547 298
1320 3300026089 Ga0207648_10009518 Ga0207648_100095187 298
1321 3300026095 Ga0207676_10000182 Ga0207676_1000018218 298
1322 3300026095 Ga0207676_10026757 Ga0207676_100267572 298
1323 3300026116 Ga0207674_10012281 Ga0207674_100122815 298
1324 3300026116 Ga0207674_10165578 Ga0207674_101655782 298
1325 3300026118 Ga0207675_100009202 Ga0207675_1000092026 298
1326 3300026118 Ga0207675_100015613 Ga0207675_1000156133 298
1327 3300026118 Ga0207675_100142481 Ga0207675_1001424812 298
1328 3300026121 Ga0207683_10008899 Ga0207683_100088995 298
1329 3300026142 Ga0207698_10029219 Ga0207698_100292192 298
1330 3300027671 Ga0209588_1002131 Ga0209588_10021315 298
1331 3300027695 Ga0209966_1001377 Ga0209966_10013772 298
1332 3300027717 Ga0209998_10001521 Ga0209998_100015214 298
1333 3300027717 Ga0209998_10005227 Ga0209998_100052272 298
1334 3300027876 Ga0209974_10001584 Ga0209974_100015844 298
1335 3300027907 Ga0207428_10001793 Ga0207428_1000179320 298
1336 3300027907 Ga0207428_10004461 Ga0207428_100044616 298
1337 3300028379 Ga0268266_10096012 Ga0268266_100960121 298
1338 3300028379 Ga0268266_10396255 Ga0268266_103962552 298
1339 3300028380 Ga0268265_10006061 Ga0268265_100060614 298
1340 3300028380 Ga0268265_10046547 Ga0268265_100465472 298
1341 3300028381 Ga0268264_10015470 Ga0268264_100154706 298
1342 3300028381 Ga0268264_10244001 Ga0268264_102440012 298
1343 3300028556 Ga0265337_1000403 Ga0265337_10004034 298
1344 3300030763 Ga0265763_1000087 Ga0265763_10000872 298
1345 3300031018 Ga0265773_1002184 Ga0265773_10021841 298
1346 3300031090 Ga0265760_10011007 Ga0265760_100110072 298
1347 3300031241 Ga0265325_10000026 Ga0265325_100000267 298
1348 3300031241 Ga0265325_10001121 Ga0265325_100011213 298
1349 3300031249 Ga0265339_10061153 Ga0265339_100611532 298
1350 3300031595 Ga0265313_10000223 Ga0265313_1000022331 298
1351 3300031595 Ga0265313_10090130 Ga0265313_100901302 298
1352 3300031691 Ga0316579_10005606 Ga0316579_100056065 298
1353 3300034817 Ga0373948_0000329 Ga0373948_0000329_444_1340 298
1354 3300034817 Ga0373948_0003500 Ga0373948_0003500_1261_2157 298
1355 3300034818 Ga0373950_0001205 Ga0373950_0001205_445_1341 298
1356 3300034819 Ga0373958_0000094 Ga0373958_0000094_2613_3509 298
1357 3300034819 Ga0373958_0006140 Ga0373958_0006140_730_1626 298
1358 3300034820 Ga0373959_0000480 Ga0373959_0000480_152_1048 298
1359 3300034957 Ga0373938_0000194 Ga0373938_0000194_4160_5056 298
1360 3300034957 Ga0373938_0002338 Ga0373938_0002338_1729_2625 298
1361 3300035084 Ga0373928_0000247 Ga0373928_0000247_3823_4719 298
1362 3300035085 Ga0373929_0000208 Ga0373929_0000208_4761_5657 298
1363 3300035088 Ga0373940_0000026 Ga0373940_0000026_6363_7259 298
1364 3300035090 Ga0373949_0001813 Ga0373949_0001813_1245_2141 298
1365 3300035090 Ga0373949_0003387 Ga0373949_0003387_2327_3223 298
1366 3300035091 Ga0373951_0000727 Ga0373951_0000727_7782_8678 298
1367 3300035091 Ga0373951_0015179 Ga0373951_0015179_156_1052 298
1368 3300035092 Ga0373952_0000997 Ga0373952_0000997_423_1319 298
1369 3300035111 Ga0373923_0028252 Ga0373923_0028252_892_1788 298
1370 3300035112 Ga0373932_0000407 Ga0373932_0000407_4449_5345 298
1371 3300035112 Ga0373932_0003491 Ga0373932_0003491_1261_2157 298
1372 3300035114 Ga0373939_0000587 Ga0373939_0000587_2361_3257 298
1373 3300035115 Ga0373941_0007006 Ga0373941_0007006_153_1049 298
1374 3300035115 Ga0373941_0035246 Ga0373941_0035246_599_1495 298
1375 3300035116 Ga0373945_0012078 Ga0373945_0012078_1199_2095 298
1376 3300035118 Ga0373954_0001647 Ga0373954_0001647_3888_4784 298
1377 3300035120 Ga0373957_0032910 Ga0373957_0032910_336_1232 298
1378 3300035121 Ga0373960_0000582 Ga0373960_0000582_907_1803 298
1379 3300035121 Ga0373960_0025997 Ga0373960_0025997_504_1400 298
1380 3300035170 Ga0373943_0004095 Ga0373943_0004095_3656_4552 298
1381 3300035171 Ga0373946_0003226 Ga0373946_0003226_3236_4132 298
1382 3300035171 Ga0373946_0010987 Ga0373946_0010987_2379_3275 298
1383 3300035172 Ga0373955_0006219 Ga0373955_0006219_1455_2351 298
1384 3300035207 Ga0373942_0000429 Ga0373942_0000429_4329_5225 298
1385 3300035241 Ga0373961_0001623 Ga0373961_0001623_3602_4498 298
1386 3300035241 Ga0373961_0007174 Ga0373961_0007174_323_1219 298
1387 3300035242 Ga0373962_0000098 Ga0373962_0000098_17621_18517 298
1388 3300035410 Ga0373924_0039137 Ga0373924_0039137_683_1579 298
1389 3300035691 Ga0373931_0002812 Ga0373931_0002812_129_1025 298
1390 3300035691 Ga0373931_0045072 Ga0373931_0045072_1191_2087 298
1391 3300035691 Ga0373931_0067852 Ga0373931_0067852_148_1044 298
1392 3300035692 Ga0373935_0081297 Ga0373935_0081297_384_1280 298
1393 3300035692 Ga0373935_0126598 Ga0373935_0126598_502_1398 298
1394 3300035692 Ga0373935_0204751 Ga0373935_0204751_188_1084 298
1395 3300035695 Ga0373927_0003203 Ga0373927_0003203_874_1770 298
1396 3300035695 Ga0373927_0028014 Ga0373927_0028014_1569_2465 298
1397 3300035695 Ga0373927_0035441 Ga0373927_0035441_2033_2929 298
1398 3300035724 Ga0373933_0000862 Ga0373933_0000862_8286_9182 298
1399 3300035725 Ga0373947_0000063 Ga0373947_0000063_30609_31505 298
1400 3300036401 Ga0373937_0004708 Ga0373937_0004708_8012_8908 298
1401 3300036401 Ga0373937_0016752 Ga0373937_0016752_5479_6375 298
1402 3300036401 Ga0373937_0170380 Ga0373937_0170380_970_1866 298
1403 3300037068 Ga0373925_0000456 Ga0373925_0000456_34836_35732 298
1404 3300037068 Ga0373925_0244329 Ga0373925_0244329_158_1054 298
1405 3300037068 Ga0373925_0246133 Ga0373925_0246133_201_1097 298
1406 3300038443 Ga0395901_0560527 Ga0395901_0560527_54_950 298
1407 3300039447 Ga0436361_0952666 Ga0436361_0952666_1138_2034 298
1408 3300042876 Ga0451577_0010773 Ga0451577_0010773_5391_6287 298
1409 3300045051 Ga0451576_0028084 Ga0451576_0028084_725_1621 298
1410 3300046463 Ga0495653_0017231 Ga0495653_0017231_2738_3634 298
1411 3300046472 Ga0495580_0015636 Ga0495580_0015636_2503_3399 298
1412 3300046475 Ga0495639_0005312 Ga0495639_0005312_2754_3650 298
1413 3300046475 Ga0495639_0074363 Ga0495639_0074363_357_1253 298
1414 3300046476 Ga0495662_0003069 Ga0495662_0003069_5749_6645 298
1415 3300046477 Ga0495664_0000985 Ga0495664_0000985_11963_12859 298
1416 3300046477 Ga0495664_0116674 Ga0495664_0116674_497_1393 298
1417 3300046514 Ga0495618_0030133 Ga0495618_0030133_1807_2703 298
1418 3300046514 Ga0495618_0093158 Ga0495618_0093158_352_1248 298
1419 3300046516 Ga0495628_0215428 Ga0495628_0215428_245_1141 298
1420 3300046517 Ga0495630_0022663 Ga0495630_0022663_1596_2492 298
1421 3300046517 Ga0495630_0030670 Ga0495630_0030670_2791_3687 298
1422 3300046526 Ga0495666_0055294 Ga0495666_0055294_925_1821 298
1423 3300046529 Ga0495652_0264152 Ga0495652_0264152_148_1044 298
1424 3300046531 Ga0495665_0012011 Ga0495665_0012011_1778_2674 298
1425 3300046531 Ga0495665_0014988 Ga0495665_0014988_1529_2425 298
1426 3300046531 Ga0495665_0039931 Ga0495665_0039931_1387_2283 298
1427 3300046533 Ga0495640_0003512 Ga0495640_0003512_4108_5004 298
1428 3300046533 Ga0495640_0015931 Ga0495640_0015931_1607_2503 298
1429 3300046535 Ga0495586_0009397 Ga0495586_0009397_904_1800 298
1430 3300046536 Ga0495587_0064445 Ga0495587_0064445_1085_1981 298
1431 3300046642 Ga0495634_0023394 Ga0495634_0023394_504_1400 298
1432 3300046663 Ga0495635_0039670 Ga0495635_0039670_2258_3154 298
1433 3300046675 Ga0495657_0013257 Ga0495657_0013257_3464_4360 298
1434 3300046675 Ga0495657_0228417 Ga0495657_0228417_154_1050 298
1435 3300046683 Ga0495658_0052359 Ga0495658_0052359_195_1091 298
1436 3300046689 Ga0495613_0022688 Ga0495613_0022688_175_1071 298
1437 3300046689 Ga0495613_0087731 Ga0495613_0087731_134_1030 298
1438 3300046690 Ga0495624_0009217 Ga0495624_0009217_2288_3184 298
1439 3300047319 Ga0495674_0012673 Ga0495674_0012673_3878_4774 298
1440 3300047321 Ga0495676_0026597 Ga0495676_0026597_2039_2935 298
1441 3300047322 Ga0495680_0005045 Ga0495680_0005045_8834_9730 298
1442 3300047471 Ga0495684_0007856 Ga0495684_0007856_5304_6200 298
1443 3300047471 Ga0495684_0039176 Ga0495684_0039176_2053_2949 298
1444 3300047471 Ga0495684_0171006 Ga0495684_0171006_247_1143 298
1445 3300047673 Ga0495593_0096419 Ga0495593_0096419_61_957 298
1446 3300048088 Ga0495602_0393214 Ga0495602_0393214_51_947 298
1447 3300048903 Ga0496100_0002624 Ga0496100_0002624_3780_4676 298
1448 3300048904 Ga0496101_0003320 Ga0496101_0003320_5471_6367 298
1449 3300048904 Ga0496101_0021084 Ga0496101_0021084_1590_2486 298
1450 3300048905 Ga0496102_0024748 Ga0496102_0024748_1333_2229 298
1451 3300048905 Ga0496102_0053297 Ga0496102_0053297_1063_1959 298
1452 3300048905 Ga0496102_0057801 Ga0496102_0057801_1937_2833 298
1453 3300048906 Ga0496103_0117878 Ga0496103_0117878_152_1048 298
1454 3300048907 Ga0496104_0041939 Ga0496104_0041939_182_1078 298
1455 3300048907 Ga0496104_0092760 Ga0496104_0092760_573_1469 298
1456 3300048907 Ga0496104_0469800 Ga0496104_0469800_184_1080 298
1457 3300048908 Ga0496105_0054552 Ga0496105_0054552_1145_2041 298
1458 3300048908 Ga0496105_0273775 Ga0496105_0273775_107_1003 298
1459 3300048909 Ga0496106_0004015 Ga0496106_0004015_3396_4292 298
1460 3300048909 Ga0496106_0069185 Ga0496106_0069185_552_1448 298
1461 3300048909 Ga0496106_0133050 Ga0496106_0133050_103_999 298
1462 3300048910 Ga0496107_0005878 Ga0496107_0005878_5220_6116 298
1463 3300048910 Ga0496107_0142725 Ga0496107_0142725_530_1426 298
1464 3300048911 Ga0496108_0002494 Ga0496108_0002494_5101_5997 298
1465 3300048911 Ga0496108_0002969 Ga0496108_0002969_6160_7056 298
1466 3300048911 Ga0496108_0032485 Ga0496108_0032485_1070_1966 298
1467 3300048912 Ga0496109_0000567 Ga0496109_0000567_2884_3780 298
1468 3300048912 Ga0496109_0000700 Ga0496109_0000700_11713_12609 298
1469 3300048913 Ga0496110_0132757 Ga0496110_0132757_519_1415 298
1470 3300048914 Ga0496111_0051208 Ga0496111_0051208_271_1167 298
1471 3300048915 Ga0496112_0075501 Ga0496112_0075501_271_1167 298
1472 3300048915 Ga0496112_0126720 Ga0496112_0126720_677_1573 298
1473 3300048915 Ga0496112_0130559 Ga0496112_0130559_916_1812 298
1474 3300048915 Ga0496112_0137191 Ga0496112_0137191_119_1015 298
1475 3300048915 Ga0496112_0466303 Ga0496112_0466303_131_1027 298
1476 3300048916 Ga0496113_0020581 Ga0496113_0020581_3031_3927 298
1477 3300048916 Ga0496113_0066967 Ga0496113_0066967_916_1812 298
1478 3300048917 Ga0496114_0003201 Ga0496114_0003201_278_1174 298
1479 3300048917 Ga0496114_0011484 Ga0496114_0011484_1833_2729 298
1480 3300048917 Ga0496114_0353961 Ga0496114_0353961_255_1151 298
1481 3300048918 Ga0496115_0001922 Ga0496115_0001922_10657_11553 298
1482 3300049571 Ga0501034_0198405 Ga0501034_0198405_829_1725 298
1483 3300049572 Ga0501036_0193367 Ga0501036_0193367_743_1639 298
1484 3300049578 Ga0501042_0217267 Ga0501042_0217267_451_1347 298
1485 3300049578 Ga0501042_0298089 Ga0501042_0298089_168_1064 298
1486 3300049580 Ga0501046_0153262 Ga0501046_0153262_375_1271 298
1487 3300049584 Ga0501068_0091802 Ga0501068_0091802_664_1560 298
1488 3300049585 Ga0501069_0022684 Ga0501069_0022684_1278_2174 298
1489 3300049585 Ga0501069_0048647 Ga0501069_0048647_933_1829 298
1490 3300049586 Ga0501070_0004890 Ga0501070_0004890_6859_7755 298
1491 3300049586 Ga0501070_0011260 Ga0501070_0011260_1994_2890 298
1492 3300049587 Ga0501071_0192040 Ga0501071_0192040_314_1210 298
1493 3300049589 Ga0501073_0214970 Ga0501073_0214970_223_1119 298
1494 3300049591 Ga0501075_0093546 Ga0501075_0093546_389_1285 298
1495 3300049742 Ga0501080_0027475 Ga0501080_0027475_3845_4741 298
1496 3300049742 Ga0501080_0066436 Ga0501080_0066436_926_1822 298
1497 3300049743 Ga0501081_0137164 Ga0501081_0137164_735_1631 298
1498 3300049822 Ga0501035_0001465 Ga0501035_0001465_480_1376 298
1499 3300050489 nmdc:mga03683_26975_c1 nmdc:mga03683_26975_c1_407_1303 298
1500 3300050491 nmdc:mga00v17_38630_c1 nmdc:mga00v17_38630_c1_1478_2374 298
1501 3300050492 nmdc:mga0yw44_144532_c1 nmdc:mga0yw44_144532_c1_314_1210 298
1502 3300050492 nmdc:mga0yw44_21453_c1 nmdc:mga0yw44_21453_c1_321_1217 298
1503 3300050493 nmdc:mga0k408_38643_c1 nmdc:mga0k408_38643_c1_294_1190 298
1504 3300050496 nmdc:mga07m45_32220_c1 nmdc:mga07m45_32220_c1_796_1692 298
1505 3300050496 nmdc:mga07m45_88419_c1 nmdc:mga07m45_88419_c1_34_930 298
1506 3300050507 nmdc:mga05p37_164000_c1 nmdc:mga05p37_164000_c1_1403_2299 298
1507 3300050510 nmdc:mga06r32_247425_c1 nmdc:mga06r32_247425_c1_387_1283 298
1508 3300050510 nmdc:mga06r32_324052_c1 nmdc:mga06r32_324052_c1_207_1103 298
1509 3300050510 nmdc:mga06r32_333793_c1 nmdc:mga06r32_333793_c1_563_1459 298
1510 3300050511 nmdc:mga08y16_54262_c1 nmdc:mga08y16_54262_c1_876_1772 298
1511 3300050511 nmdc:mga08y16_5774_c1 nmdc:mga08y16_5774_c1_6597_7493 298
1512 3300050512 nmdc:mga0n895_1284_c1 nmdc:mga0n895_1284_c1_15828_16724 298
1513 3300050512 nmdc:mga0n895_1396_c1 nmdc:mga0n895_1396_c1_10143_11039 298
1514 3300050512 nmdc:mga0n895_264304_c1 nmdc:mga0n895_264304_c1_607_1503 298
1515 3300050513 nmdc:mga0rr50_253138_c1 nmdc:mga0rr50_253138_c1_499_1395 298
1516 3300050513 nmdc:mga0rr50_25756_c1 nmdc:mga0rr50_25756_c1_2028_2924 298
1517 3300050514 nmdc:mga08x19_193042_c1 nmdc:mga08x19_193042_c1_87_983 298
1518 3300050514 nmdc:mga08x19_76896_c1 nmdc:mga08x19_76896_c1_263_1159 298
1519 3300050515 nmdc:mga0a205_1140_c1 nmdc:mga0a205_1140_c1_7532_8428 298
1520 3300050515 nmdc:mga0a205_343860_c1 nmdc:mga0a205_343860_c1_310_1206 298
1521 3300053077 Ga0495601_0001285 Ga0495601_0001285_11124_12020 298
1522 3300053077 Ga0495601_0008795 Ga0495601_0008795_1779_2675 298
1523 3300053077 Ga0495601_0078044 Ga0495601_0078044_176_1072 298
1524 3300053078 Ga0495612_0000270 Ga0495612_0000270_16034_16930 298
1525 3300053078 Ga0495612_0066354 Ga0495612_0066354_37_933 298
1526 3300053083 Ga0495655_0007314 Ga0495655_0007314_743_1639 298
1527 3300053084 Ga0495595_0000650 Ga0495595_0000650_10103_10999 298
1528 3300053085 Ga0495619_0020045 Ga0495619_0020045_481_1377 298
1529 3300053085 Ga0495619_0024178 Ga0495619_0024178_1728_2624 298
1530 3300053085 Ga0495619_0029304 Ga0495619_0029304_373_1269 298
1531 3300053085 Ga0495619_0074646 Ga0495619_0074646_177_1073 298
1532 3300061734 Ga0530510_0125522 Ga0530510_0125522_666_1562 298
1533 3300061734 Ga0530510_0430018 Ga0530510_0430018_19_915 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

45

311

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.592 22 289
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5799 22 289
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5794 22 293
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.571 19 287
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5528 19 284
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9283 20 283 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8688 20 283 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8476 22 286 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7974 22 286 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7925 23 283 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1F7NSL0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.987 49 253 GO:0005886
GO:0006865
GO:0022857
AF-A0A2V6NUY5-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9782 17 230 GO:0005886
GO:0006865
GO:0022857
AF-A0A1F7NSL0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9729 49 253 GO:0005886
GO:0006865
GO:0022857
AF-A0A2R6H9A2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9692 12 294 GO:0005886
GO:0006865
GO:0022857
AF-A0A0Q6Z0L2-F1-model_v4 ABC transporter permease 0.9677 14 298 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.61 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map