F494632

General Info

Members Datasets Scaffolds Average Seq Length
1535 380 1535 375

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_104427_c1|nmdc:mga08y16_104427_c1_31_1326
Length 431
Sequence MNPPSYCPSLYRYQRRCSRVVNVGNVAVGGDHAIRVQSMITCDTMDTAASIQQTLDLVAVGCEIVRITAPTVKDAANLQHIVAGLRERGCDVPIVADIHFKPEAALEAAKWVEKVRINPGNYADSKKFKIVEYTDEQYAAELDRIRERFTPLVLFMKEHGRAMRIGTNHGSLSDRIMNRYGDTPLGMVESALEFARIARDLGYHDFMFSMKSSNPKVMIEAYRLLVARLAQEGPDWSYPIHLGVTEAGEGEDARIKSAIGIGSLLMDGIGDTIRVSLTADPVKEIEAAWDILKSLGLRERGPVMIACPSCGRDNVGVEQLAEAVGDRLKAYPEAFEVAVMGCAVNGPGEAGDADFGIAGGRDVGFIYAHGRVLKKVSSEILIDELFHEIDRWIAAGMERPKRLKLAKPAAALMAEAAQRPVAEQAPETATA

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
232 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
233 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
234 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
235 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
236 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
237 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
240 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
241 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
244 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
366 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
367 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
368 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 10.88
Rhizosphere 88.53
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000282 3300001991 Bacteria 5512
2 JGI24743J22301_10000603 3300001991 Bacteria 4363
3 JGI24738J21930_10003185 3300002075 Bacteria 4190
4 JGI24744J21845_10021881 3300002077 Bacteria 1256
5 JGI25407J50210_10000325 3300003373 Bacteria 8871
6 JGI25407J50210_10004391 3300003373 Bacteria 3426
7 JGI25407J50210_10030306 3300003373 Bacteria 1402
8 Ga0070658_10004240 3300005327 Bacteria 11724
9 Ga0070658_10008374 3300005327 Bacteria 8314
10 Ga0070658_10009784 3300005327 Bacteria 7700
11 Ga0070658_10063791 3300005327 Bacteria 3004
12 Ga0070658_10174988 3300005327 Bacteria 1804
13 Ga0070683_100005382 3300005329 Bacteria 10676
14 Ga0070683_100007989 3300005329 Bacteria 8977
15 Ga0070683_100010190 3300005329 Bacteria 8070
16 Ga0070683_100013514 3300005329 Bacteria 7122
17 Ga0070683_100054436 3300005329 Bacteria 3710
18 Ga0070683_100107444 3300005329 Bacteria 2631
19 Ga0070683_100144163 3300005329 Bacteria 2257
20 Ga0070683_100173752 3300005329 Bacteria 2045
21 Ga0070683_100255262 3300005329 Bacteria 1668
22 Ga0070690_100033675 3300005330 Bacteria 3209
23 Ga0068869_100072068 3300005334 Bacteria 2559
24 Ga0070680_100010461 3300005336 Bacteria 7154
25 Ga0070680_100010918 3300005336 Bacteria 7017
26 Ga0070680_100017682 3300005336 Bacteria 5624
27 Ga0070680_100034210 3300005336 Bacteria 4097
28 Ga0070680_100036185 3300005336 Bacteria 3988
29 Ga0070680_100100111 3300005336 Bacteria 2405
30 Ga0070680_100171656 3300005336 Bacteria 1825
31 Ga0070682_100008611 3300005337 Bacteria 5760
32 Ga0070682_100029441 3300005337 Bacteria 3306
33 Ga0070682_100054175 3300005337 Bacteria 2516
34 Ga0070682_100096408 3300005337 Bacteria 1944
35 Ga0068868_100009122 3300005338 Bacteria 7122
36 Ga0068868_100075991 3300005338 Bacteria 2685
37 Ga0068868_100076897 3300005338 Bacteria 2669
38 Ga0070660_100002662 3300005339 Bacteria 12268
39 Ga0070660_100016342 3300005339 Bacteria 5385
40 Ga0070660_100034825 3300005339 Bacteria 3807
41 Ga0070660_100041222 3300005339 Bacteria 3518
42 Ga0070660_100055442 3300005339 Bacteria 3063
43 Ga0070660_100057218 3300005339 Bacteria 3020
44 Ga0070660_100120191 3300005339 Bacteria 2096
45 Ga0070689_100038995 3300005340 Bacteria 3636
46 Ga0070689_100074746 3300005340 Bacteria 2651
47 Ga0070691_10008182 3300005341 Bacteria 4792
48 Ga0070661_100004032 3300005344 Bacteria 10101
49 Ga0070661_100004700 3300005344 Bacteria 9401
50 Ga0070692_10005879 3300005345 Bacteria 5279
51 Ga0070668_100099745 3300005347 Bacteria 2300
52 Ga0070669_100298142 3300005353 Bacteria 1296
53 Ga0070675_100069430 3300005354 Bacteria 2919
54 Ga0070671_100080880 3300005355 Bacteria 2717
55 Ga0070671_100122472 3300005355 Bacteria 2189
56 Ga0070671_100142998 3300005355 Bacteria 2019
57 Ga0070674_100003504 3300005356 Bacteria 8811
58 Ga0070674_100110107 3300005356 Bacteria 2021
59 Ga0070674_100119927 3300005356 Bacteria 1946
60 Ga0070674_100284437 3300005356 Bacteria 1312
61 Ga0070673_100018041 3300005364 Bacteria 5033
62 Ga0070688_100013337 3300005365 Bacteria 4630
63 Ga0070659_100014781 3300005366 Bacteria 5838
64 Ga0070659_100053320 3300005366 Bacteria 3183
65 Ga0070659_100079890 3300005366 Bacteria 2611
66 Ga0070659_100110972 3300005366 Bacteria 2214
67 Ga0070659_100164150 3300005366 Bacteria 1817
68 Ga0070659_100183694 3300005366 Bacteria 1717
69 Ga0070667_100169485 3300005367 Bacteria 1927
70 Ga0070709_10220140 3300005434 Bacteria 1353
71 Ga0070714_100002512 3300005435 Bacteria 13517
72 Ga0070714_100019562 3300005435 Bacteria 5519
73 Ga0070714_100146948 3300005435 Bacteria 2121
74 Ga0070714_100226034 3300005435 Bacteria 1722
75 Ga0070713_100012792 3300005436 Bacteria 6169
76 Ga0070713_100354738 3300005436 Bacteria 1361
77 Ga0070713_100470039 3300005436 Bacteria 1183
78 Ga0070710_10006337 3300005437 Bacteria 5678
79 Ga0070710_10030639 3300005437 Bacteria 2896
80 Ga0070710_10176624 3300005437 Bacteria 1334
81 Ga0070701_10085769 3300005438 Bacteria 1715
82 Ga0070711_100016230 3300005439 Bacteria 4726
83 Ga0070711_100034111 3300005439 Bacteria 3393
84 Ga0070711_100059864 3300005439 Bacteria 2645
85 Ga0070711_100330242 3300005439 Bacteria 1220
86 Ga0070705_100006400 3300005440 Bacteria 5772
87 Ga0070705_100032222 3300005440 Bacteria 2910
88 Ga0070705_100055792 3300005440 Bacteria 2324
89 Ga0070705_100060303 3300005440 Bacteria 2249
90 Ga0070700_100001864 3300005441 Bacteria 10643
91 Ga0070700_100021840 3300005441 Bacteria 3724
92 Ga0070700_100042476 3300005441 Bacteria 2792
93 Ga0070694_100035278 3300005444 Bacteria 3305
94 Ga0070694_100081072 3300005444 Bacteria 2257
95 Ga0070694_100168563 3300005444 Bacteria 1611
96 Ga0070708_100032256 3300005445 Bacteria 4542
97 Ga0070708_100267844 3300005445 Bacteria 1606
98 Ga0070678_100002333 3300005456 Bacteria 10356
99 Ga0070678_100005626 3300005456 Bacteria 7272
100 Ga0070678_100008752 3300005456 Bacteria 6081
101 Ga0070678_100078517 3300005456 Bacteria 2494
102 Ga0070662_100005800 3300005457 Bacteria 7916
103 Ga0070662_100037927 3300005457 Bacteria 3419
104 Ga0070681_10003469 3300005458 Bacteria 14773
105 Ga0070681_10010037 3300005458 Bacteria 9334
106 Ga0070681_10010617 3300005458 Bacteria 9101
107 Ga0070681_10018429 3300005458 Bacteria 6977
108 Ga0070681_10044643 3300005458 Bacteria 4437
109 Ga0070681_10054558 3300005458 Bacteria 3982
110 Ga0068867_100004862 3300005459 Bacteria 9455
111 Ga0068867_100162036 3300005459 Bacteria 1764
112 Ga0068867_100177377 3300005459 Bacteria 1692
113 Ga0070685_10004015 3300005466 Bacteria 7431
114 Ga0070685_10102893 3300005466 Bacteria 1747
115 Ga0070706_100036936 3300005467 Bacteria 4512
116 Ga0070706_100090237 3300005467 Bacteria 2842
117 Ga0070706_100113732 3300005467 Bacteria 2520
118 Ga0070706_100239936 3300005467 Bacteria 1692
119 Ga0070707_100001400 3300005468 Bacteria 23671
120 Ga0070707_100002546 3300005468 Bacteria 17332
121 Ga0070707_100010999 3300005468 Bacteria 8429
122 Ga0070707_100019072 3300005468 Bacteria 6459
123 Ga0070707_100023609 3300005468 Bacteria 5816
124 Ga0070707_100103090 3300005468 Bacteria 2764
125 Ga0070707_100203123 3300005468 Bacteria 1932
126 Ga0070707_100225025 3300005468 Bacteria 1826
127 Ga0070698_100002965 3300005471 Bacteria 18665
128 Ga0070698_100007341 3300005471 Bacteria 11934
129 Ga0070698_100029189 3300005471 Bacteria 5725
130 Ga0070698_100082288 3300005471 Bacteria 3212
131 Ga0070698_100096094 3300005471 Bacteria 2940
132 Ga0070698_100148836 3300005471 Bacteria 2290
133 Ga0070698_100160468 3300005471 Bacteria 2192
134 Ga0070699_100334413 3300005518 Bacteria 1363
135 Ga0070679_100015057 3300005530 Bacteria 7431
136 Ga0070679_100028843 3300005530 Bacteria 5474
137 Ga0070679_100030486 3300005530 Bacteria 5324
138 Ga0070679_100034518 3300005530 Bacteria 5014
139 Ga0070679_100050153 3300005530 Bacteria 4158
140 Ga0070679_100091056 3300005530 Bacteria 3038
141 Ga0070679_100092775 3300005530 Bacteria 3006
142 Ga0070684_100021719 3300005535 Bacteria 5347
143 Ga0070684_100021957 3300005535 Bacteria 5317
144 Ga0070684_100030298 3300005535 Bacteria 4595
145 Ga0070684_100043400 3300005535 Bacteria 3883
146 Ga0070684_100060387 3300005535 Bacteria 3316
147 Ga0070684_100085062 3300005535 Bacteria 2805
148 Ga0070684_100176895 3300005535 Bacteria 1939
149 Ga0070684_100181789 3300005535 Bacteria 1912
150 Ga0070697_100023373 3300005536 Bacteria 4914
151 Ga0070697_100070750 3300005536 Bacteria 2861
152 Ga0070697_100103182 3300005536 Bacteria 2370
153 Ga0068853_100005085 3300005539 Bacteria 10263
154 Ga0068853_100006638 3300005539 Bacteria 9217
155 Ga0068853_100087241 3300005539 Bacteria 2738
156 Ga0068853_100107962 3300005539 Bacteria 2468
157 Ga0070672_100006217 3300005543 Bacteria 8000
158 Ga0070672_100014580 3300005543 Bacteria 5574
159 Ga0070686_100002984 3300005544 Bacteria 9277
160 Ga0070686_100012478 3300005544 Bacteria 4842
161 Ga0070686_100014127 3300005544 Bacteria 4593
162 Ga0070695_100000062 3300005545 Bacteria 43594
163 Ga0070695_100065605 3300005545 Bacteria 2365
164 Ga0070696_100017716 3300005546 Bacteria 4810
165 Ga0070696_100047671 3300005546 Bacteria 2973
166 Ga0070696_100108198 3300005546 Bacteria 2000
167 Ga0070696_100115298 3300005546 Bacteria 1939
168 Ga0070693_100001220 3300005547 Bacteria 11587
169 Ga0070693_100006959 3300005547 Bacteria 5502
170 Ga0070693_100007298 3300005547 Bacteria 5398
171 Ga0070693_100104181 3300005547 Bacteria 1733
172 Ga0070665_100027593 3300005548 Bacteria 5718
173 Ga0070665_100029627 3300005548 Bacteria 5508
174 Ga0070665_100037505 3300005548 Bacteria 4875
175 Ga0070704_100017426 3300005549 Bacteria 4568
176 Ga0070704_100027047 3300005549 Bacteria 3798
177 Ga0068855_100025372 3300005563 Bacteria 7092
178 Ga0068855_100031262 3300005563 Bacteria 6359
179 Ga0068855_100034552 3300005563 Bacteria 6028
180 Ga0068855_100058680 3300005563 Bacteria 4505
181 Ga0068855_100088714 3300005563 Bacteria 3572
182 Ga0068855_100228473 3300005563 Bacteria 2085
183 Ga0068855_100247637 3300005563 Bacteria 1989
184 Ga0070664_100023185 3300005564 Bacteria 5126
185 Ga0068857_100004499 3300005577 Bacteria 11782
186 Ga0068857_100026013 3300005577 Bacteria 5154
187 Ga0068857_100424746 3300005577 Bacteria 1240
188 Ga0068857_100428855 3300005577 Bacteria 1234
189 Ga0068854_100002544 3300005578 Bacteria 11292
190 Ga0068856_100028153 3300005614 Bacteria 5484
191 Ga0068856_100038286 3300005614 Bacteria 4707
192 Ga0068856_100039042 3300005614 Bacteria 4661
193 Ga0068856_100067683 3300005614 Bacteria 3529
194 Ga0068856_100081000 3300005614 Bacteria 3220
195 Ga0068856_100220331 3300005614 Bacteria 1913
196 Ga0068856_100314880 3300005614 Bacteria 1582
197 Ga0068856_100329102 3300005614 Bacteria 1545
198 Ga0070702_100003932 3300005615 Bacteria 6736
199 Ga0070702_100022559 3300005615 Bacteria 3330
200 Ga0070702_100041311 3300005615 Bacteria 2586
201 Ga0070702_100074664 3300005615 Bacteria 2012
202 Ga0068852_100013243 3300005616 Bacteria 6305
203 Ga0068852_100018397 3300005616 Bacteria 5503
204 Ga0068852_100150187 3300005616 Bacteria 2166
205 Ga0068866_10001441 3300005718 Bacteria 10168
206 Ga0068866_10030513 3300005718 Bacteria 2589
207 Ga0068861_100020483 3300005719 Bacteria 4739
208 Ga0068861_100043745 3300005719 Bacteria 3364
209 Ga0068861_100139245 3300005719 Bacteria 1979
210 Ga0068851_10004369 3300005834 Bacteria 6364
211 Ga0068870_10000314 3300005840 Bacteria 18000
212 Ga0068870_10024674 3300005840 Bacteria 2977
213 Ga0068858_100143759 3300005842 Bacteria 2240
214 Ga0068858_100169895 3300005842 Bacteria 2056
215 Ga0068860_100029418 3300005843 Bacteria 5284
216 Ga0068862_100199902 3300005844 Bacteria 1802
217 Ga0068862_100210953 3300005844 Bacteria 1755
218 Ga0068862_100304245 3300005844 Bacteria 1468
219 Ga0081455_10001617 3300005937 Bacteria 27507
220 Ga0081455_10002950 3300005937 Bacteria 19909
221 Ga0081455_10005594 3300005937 Bacteria 13737
222 Ga0081455_10009708 3300005937 Bacteria 9868
223 Ga0081455_10021783 3300005937 Bacteria 6003
224 Ga0081455_10022098 3300005937 Bacteria 5954
225 Ga0081455_10030676 3300005937 Bacteria 4879
226 Ga0081455_10035488 3300005937 Bacteria 4455
227 Ga0081455_10037546 3300005937 Bacteria 4300
228 Ga0081455_10041537 3300005937 Bacteria 4043
229 Ga0081455_10052308 3300005937 Bacteria 3498
230 Ga0081455_10058850 3300005937 Bacteria 3248
231 Ga0081455_10067130 3300005937 Bacteria 2990
232 Ga0081455_10080598 3300005937 Bacteria 2668
233 Ga0081538_10000136 3300005981 Bacteria 76141
234 Ga0081538_10000231 3300005981 Bacteria 62826
235 Ga0081538_10000286 3300005981 Bacteria 57937
236 Ga0081538_10000667 3300005981 Bacteria 37780
237 Ga0081538_10002521 3300005981 Bacteria 17836
238 Ga0081538_10003973 3300005981 Bacteria 13776
239 Ga0081538_10013477 3300005981 Bacteria 6466
240 Ga0081538_10016315 3300005981 Bacteria 5702
241 Ga0081538_10020317 3300005981 Bacteria 4894
242 Ga0081538_10022124 3300005981 Bacteria 4618
243 Ga0081538_10027147 3300005981 Bacteria 3978
244 Ga0081538_10039146 3300005981 Bacteria 3045
245 Ga0081538_10042187 3300005981 Bacteria 2883
246 Ga0081540_1004855 3300005983 Bacteria 10134
247 Ga0081540_1008249 3300005983 Bacteria 7298
248 Ga0081540_1021636 3300005983 Bacteria 3821
249 Ga0081539_10000041 3300005985 Bacteria 292660
250 Ga0081539_10001773 3300005985 Bacteria 34339
251 Ga0081539_10003477 3300005985 Bacteria 19242
252 Ga0081539_10010651 3300005985 Bacteria 7422
253 Ga0070717_10011073 3300006028 Bacteria 6834
254 Ga0070717_10019235 3300006028 Bacteria 5353
255 Ga0070717_10129800 3300006028 Bacteria 2166
256 Ga0075365_10020226 3300006038 Bacteria 4122
257 Ga0075365_10146517 3300006038 Bacteria 1641
258 Ga0075364_10009439 3300006051 Bacteria 5854
259 Ga0075432_10000750 3300006058 Bacteria 10075
260 Ga0075432_10016608 3300006058 Bacteria 2513
261 Ga0075432_10040201 3300006058 Bacteria 1632
262 Ga0070715_10003421 3300006163 Bacteria 5045
263 Ga0070715_10023484 3300006163 Bacteria 2416
264 Ga0070716_100064102 3300006173 Bacteria 2135
265 Ga0070712_100001021 3300006175 Bacteria 16881
266 Ga0070712_100009625 3300006175 Bacteria 6093
267 Ga0097621_100002685 3300006237 Bacteria 12175
268 Ga0097621_100011885 3300006237 Bacteria 6438
269 Ga0068871_100043378 3300006358 Bacteria 3612
270 Ga0068871_100186576 3300006358 Bacteria 1785
271 Ga0075428_100001303 3300006844 Bacteria 26471
272 Ga0075428_100034856 3300006844 Bacteria 5550
273 Ga0075428_100043602 3300006844 Bacteria 4932
274 Ga0075428_100086954 3300006844 Bacteria 3410
275 Ga0075428_100135280 3300006844 Bacteria 2680
276 Ga0075430_100005098 3300006846 Bacteria 11054
277 Ga0075430_100012393 3300006846 Bacteria 7253
278 Ga0075430_100077846 3300006846 Bacteria 2779
279 Ga0075431_100002708 3300006847 Bacteria 17182
280 Ga0075431_100127379 3300006847 Bacteria 2627
281 Ga0075431_100361142 3300006847 Bacteria 1459
282 Ga0075433_10024417 3300006852 Bacteria 5101
283 Ga0075433_10038908 3300006852 Bacteria 4110
284 Ga0075433_10080607 3300006852 Bacteria 2870
285 Ga0075434_100004986 3300006871 Bacteria 12043
286 Ga0075434_100010946 3300006871 Bacteria 8531
287 Ga0075434_100017028 3300006871 Bacteria 6994
288 Ga0075434_100130232 3300006871 Bacteria 2534
289 Ga0075429_100036216 3300006880 Bacteria 4291
290 Ga0075429_100036778 3300006880 Bacteria 4260
291 Ga0075429_100071949 3300006880 Bacteria 3011
292 Ga0075429_100084138 3300006880 Bacteria 2773
293 Ga0068865_100025366 3300006881 Bacteria 3899
294 Ga0068865_100041819 3300006881 Bacteria 3121
295 Ga0068865_100054596 3300006881 Bacteria 2777
296 Ga0075436_100003785 3300006914 Bacteria 10372
297 Ga0075436_100006971 3300006914 Bacteria 7737
298 Ga0075436_100007157 3300006914 Bacteria 7632
299 Ga0097620_100094397 3300006931 Bacteria 3043
300 Ga0075435_100003008 3300007076 Bacteria 11350
301 Ga0075435_100003535 3300007076 Bacteria 10608
302 Ga0075435_100087028 3300007076 Bacteria 2574
303 Ga0075435_100097869 3300007076 Bacteria 2428
304 Ga0075435_100201896 3300007076 Bacteria 1685
305 Ga0105240_10010170 3300009093 Bacteria 13243
306 Ga0105240_10054502 3300009093 Bacteria 5011
307 Ga0105240_10066947 3300009093 Bacteria 4454
308 Ga0105240_10320495 3300009093 Bacteria 1767
309 Ga0111539_10003299 3300009094 Bacteria 21326
310 Ga0111539_10003971 3300009094 Bacteria 19436
311 Ga0111539_10004030 3300009094 Bacteria 19288
312 Ga0111539_10006384 3300009094 Bacteria 15204
313 Ga0111539_10017493 3300009094 Bacteria 8875
314 Ga0111539_10018513 3300009094 Bacteria 8627
315 Ga0111539_10061628 3300009094 Bacteria 4443
316 Ga0111539_10103159 3300009094 Bacteria 3347
317 Ga0111539_10248138 3300009094 Bacteria 2073
318 Ga0111539_10515022 3300009094 Bacteria 1393
319 Ga0105245_10012129 3300009098 Bacteria 7494
320 Ga0105245_10023427 3300009098 Bacteria 5419
321 Ga0105245_10029132 3300009098 Bacteria 4875
322 Ga0105245_10029446 3300009098 Bacteria 4851
323 Ga0105245_10056010 3300009098 Bacteria 3543
324 Ga0105245_10099401 3300009098 Bacteria 2690
325 Ga0105245_10103091 3300009098 Bacteria 2643
326 Ga0105245_10125892 3300009098 Bacteria 2399
327 Ga0105245_10156419 3300009098 Bacteria 2159
328 Ga0105245_10225946 3300009098 Bacteria 1808
329 Ga0105245_10379434 3300009098 Bacteria 1407
330 Ga0114129_10004297 3300009147 Bacteria 20136
331 Ga0114129_10022016 3300009147 Bacteria 9046
332 Ga0114129_10023134 3300009147 Bacteria 8814
333 Ga0114129_10034122 3300009147 Bacteria 7187
334 Ga0114129_10044815 3300009147 Bacteria 6221
335 Ga0114129_10086576 3300009147 Bacteria 4345
336 Ga0114129_10100032 3300009147 Bacteria 4012
337 Ga0114129_10235098 3300009147 Bacteria 2466
338 Ga0114129_10381992 3300009147 Bacteria 1860
339 Ga0105243_10006339 3300009148 Bacteria 9137
340 Ga0105243_10019281 3300009148 Bacteria 5170
341 Ga0105243_10028480 3300009148 Bacteria 4288
342 Ga0105243_10040034 3300009148 Bacteria 3657
343 Ga0105243_10048322 3300009148 Bacteria 3354
344 Ga0105243_10048448 3300009148 Bacteria 3349
345 Ga0105243_10114278 3300009148 Bacteria 2265
346 Ga0105243_10139786 3300009148 Bacteria 2065
347 Ga0105243_10404700 3300009148 Bacteria 1269
348 Ga0105241_10041562 3300009174 Bacteria 3474
349 Ga0105241_10268157 3300009174 Bacteria 1453
350 Ga0105242_10031376 3300009176 Bacteria 4243
351 Ga0105242_10167524 3300009176 Bacteria 1928
352 Ga0105248_10020815 3300009177 Bacteria 7266
353 Ga0105248_10082769 3300009177 Bacteria 3610
354 Ga0105248_10523474 3300009177 Bacteria 1337
355 Ga0105237_10105717 3300009545 Bacteria 2806
356 Ga0105249_10001447 3300009553 Bacteria 20786
357 Ga0105249_10021948 3300009553 Bacteria 5717
358 Ga0105249_10077274 3300009553 Bacteria 3087
359 Ga0105239_10109939 3300010375 Bacteria 3055
360 Ga0105239_10253809 3300010375 Bacteria 1975
361 Ga0105239_10322669 3300010375 Bacteria 1741
362 Ga0105239_10323084 3300010375 Bacteria 1740
363 Ga0105239_10364720 3300010375 Bacteria 1632
364 Ga0105246_10078382 3300011119 Bacteria 2346
365 Ga0157371_10005631 3300013102 Bacteria 10520
366 Ga0157371_10053530 3300013102 Bacteria 2866
367 Ga0157370_10019560 3300013104 Bacteria 6786
368 Ga0157369_10001204 3300013105 Bacteria 32229
369 Ga0157369_10001856 3300013105 Bacteria 25507
370 Ga0157369_10045301 3300013105 Bacteria 4785
371 Ga0157369_10165028 3300013105 Bacteria 2336
372 Ga0157369_10351019 3300013105 Bacteria 1532
373 Ga0157369_10406303 3300013105 Bacteria 1412
374 Ga0157369_10411017 3300013105 Bacteria 1403
375 Ga0157374_10025452 3300013296 Bacteria 5314
376 Ga0157374_10116856 3300013296 Bacteria 2571
377 Ga0157378_10001517 3300013297 Bacteria 21016
378 Ga0157378_10132945 3300013297 Bacteria 2305
379 Ga0163162_10013159 3300013306 Bacteria 8080
380 Ga0163162_10060630 3300013306 Bacteria 3819
381 Ga0163162_10253607 3300013306 Bacteria 1891
382 Ga0157372_10033081 3300013307 Bacteria 5676
383 Ga0157372_10037746 3300013307 Bacteria 5328
384 Ga0157372_10083344 3300013307 Bacteria 3622
385 Ga0157372_10103331 3300013307 Bacteria 3256
386 Ga0157372_10227424 3300013307 Bacteria 2162
387 Ga0157375_10010636 3300013308 Bacteria 8103
388 Ga0157375_10014138 3300013308 Bacteria 7117
389 Ga0157375_10029508 3300013308 Bacteria 5159
390 Ga0157375_10036992 3300013308 Bacteria 4673
391 Ga0157375_10054704 3300013308 Bacteria 3932
392 Ga0157375_10139096 3300013308 Bacteria 2554
393 Ga0157375_10215987 3300013308 Bacteria 2076
394 Ga0157375_10257845 3300013308 Bacteria 1905
395 Ga0163163_10373654 3300014325 Bacteria 1483
396 Ga0157380_10018684 3300014326 Bacteria 5150
397 Ga0157380_10019560 3300014326 Bacteria 5047
398 Ga0157380_10085534 3300014326 Bacteria 2588
399 Ga0182008_10008779 3300014497 Bacteria 5492
400 Ga0182008_10023658 3300014497 Bacteria 3134
401 Ga0157377_10004308 3300014745 Bacteria 6530
402 Ga0157377_10006271 3300014745 Bacteria 5659
403 Ga0157377_10111342 3300014745 Bacteria 1646
404 Ga0157379_10131858 3300014968 Bacteria 2250
405 Ga0157376_10019995 3300014969 Bacteria 5170
406 Ga0163161_10006893 3300017792 Bacteria 7859
407 Ga0197907_10426209 3300020069 Bacteria 2526
408 Ga0197907_10788432 3300020069 Bacteria 2271
409 Ga0206356_10687234 3300020070 Bacteria 2170
410 Ga0206356_11289279 3300020070 Bacteria 2587
411 Ga0206356_11871523 3300020070 Bacteria 3545
412 Ga0206353_10786943 3300020082 Bacteria 4820
413 Ga0206353_10882776 3300020082 Bacteria 3549
414 Ga0206353_11861470 3300020082 Bacteria 5765
415 Ga0224712_10006996 3300022467 Bacteria 3256
416 Ga0207656_10068963 3300025321 Bacteria 1568
417 Ga0207653_10004956 3300025885 Bacteria 4158
418 Ga0207682_10037857 3300025893 Bacteria 1955
419 Ga0207692_10012340 3300025898 Bacteria 3668
420 Ga0207692_10031688 3300025898 Bacteria 2534
421 Ga0207642_10006246 3300025899 Bacteria 3951
422 Ga0207688_10000576 3300025901 Bacteria 18035
423 Ga0207688_10014046 3300025901 Bacteria 4354
424 Ga0207685_10048406 3300025905 Bacteria 1628
425 Ga0207685_10083803 3300025905 Bacteria 1326
426 Ga0207699_10022724 3300025906 Bacteria 3403
427 Ga0207699_10076297 3300025906 Bacteria 2064
428 Ga0207645_10042230 3300025907 Bacteria 2918
429 Ga0207643_10002509 3300025908 Bacteria 9923
430 Ga0207643_10011653 3300025908 Bacteria 4748
431 Ga0207705_10010703 3300025909 Bacteria 6658
432 Ga0207705_10134791 3300025909 Bacteria 1840
433 Ga0207684_10081455 3300025910 Bacteria 2754
434 Ga0207684_10082809 3300025910 Bacteria 2732
435 Ga0207684_10186572 3300025910 Bacteria 1788
436 Ga0207684_10365356 3300025910 Bacteria 1242
437 Ga0207707_10024033 3300025912 Bacteria 5329
438 Ga0207707_10027479 3300025912 Bacteria 4975
439 Ga0207707_10045926 3300025912 Bacteria 3804
440 Ga0207707_10053890 3300025912 Bacteria 3501
441 Ga0207707_10066774 3300025912 Bacteria 3132
442 Ga0207707_10086183 3300025912 Bacteria 2745
443 Ga0207707_10279304 3300025912 Bacteria 1447
444 Ga0207695_10025866 3300025913 Bacteria 6559
445 Ga0207671_10121580 3300025914 Bacteria 1996
446 Ga0207671_10244520 3300025914 Bacteria 1410
447 Ga0207693_10000495 3300025915 Bacteria 35594
448 Ga0207693_10020755 3300025915 Bacteria 5224
449 Ga0207693_10071113 3300025915 Bacteria 2722
450 Ga0207663_10006239 3300025916 Bacteria 6081
451 Ga0207663_10021296 3300025916 Bacteria 3688
452 Ga0207663_10039854 3300025916 Bacteria 2850
453 Ga0207663_10092919 3300025916 Bacteria 2007
454 Ga0207663_10094116 3300025916 Bacteria 1996
455 Ga0207660_10009753 3300025917 Bacteria 6215
456 Ga0207660_10017835 3300025917 Bacteria 4724
457 Ga0207660_10042076 3300025917 Bacteria 3205
458 Ga0207660_10080618 3300025917 Bacteria 2390
459 Ga0207660_10084654 3300025917 Bacteria 2337
460 Ga0207660_10168532 3300025917 Bacteria 1694
461 Ga0207662_10043243 3300025918 Bacteria 2657
462 Ga0207662_10057617 3300025918 Bacteria 2322
463 Ga0207662_10170375 3300025918 Bacteria 1396
464 Ga0207657_10000054 3300025919 Bacteria 106767
465 Ga0207657_10001075 3300025919 Bacteria 28931
466 Ga0207657_10004160 3300025919 Bacteria 15336
467 Ga0207657_10021338 3300025919 Bacteria 6098
468 Ga0207657_10050423 3300025919 Bacteria 3623
469 Ga0207657_10064592 3300025919 Bacteria 3124
470 Ga0207657_10069183 3300025919 Bacteria 2996
471 Ga0207657_10096336 3300025919 Bacteria 2461
472 Ga0207649_10023880 3300025920 Bacteria 3546
473 Ga0207649_10046594 3300025920 Bacteria 2664
474 Ga0207652_10027760 3300025921 Bacteria 4720
475 Ga0207652_10057932 3300025921 Bacteria 3337
476 Ga0207652_10112513 3300025921 Bacteria 2416
477 Ga0207652_10124091 3300025921 Bacteria 2299
478 Ga0207652_10215052 3300025921 Bacteria 1731
479 Ga0207646_10004168 3300025922 Bacteria 15857
480 Ga0207646_10006489 3300025922 Bacteria 12075
481 Ga0207646_10034267 3300025922 Bacteria 4589
482 Ga0207646_10039846 3300025922 Bacteria 4227
483 Ga0207646_10095459 3300025922 Bacteria 2664
484 Ga0207646_10121244 3300025922 Bacteria 2349
485 Ga0207646_10151998 3300025922 Bacteria 2088
486 Ga0207646_10269629 3300025922 Bacteria 1539
487 Ga0207659_10003581 3300025926 Bacteria 9350
488 Ga0207687_10003379 3300025927 Bacteria 10780
489 Ga0207687_10014378 3300025927 Bacteria 5178
490 Ga0207687_10030978 3300025927 Bacteria 3612
491 Ga0207687_10053413 3300025927 Bacteria 2823
492 Ga0207687_10117575 3300025927 Bacteria 1983
493 Ga0207687_10272718 3300025927 Bacteria 1353
494 Ga0207700_10000006 3300025928 Bacteria 348187
495 Ga0207700_10040128 3300025928 Bacteria 3414
496 Ga0207700_10050286 3300025928 Bacteria 3106
497 Ga0207700_10188460 3300025928 Bacteria 1732
498 Ga0207664_10035875 3300025929 Bacteria 3829
499 Ga0207664_10088303 3300025929 Bacteria 2536
500 Ga0207664_10140930 3300025929 Bacteria 2039
501 Ga0207664_10178603 3300025929 Bacteria 1821
502 Ga0207644_10016741 3300025931 Bacteria 4937
503 Ga0207644_10047716 3300025931 Bacteria 3058
504 Ga0207690_10025866 3300025932 Bacteria 3691
505 Ga0207690_10033102 3300025932 Bacteria 3321
506 Ga0207690_10084791 3300025932 Bacteria 2222
507 Ga0207690_10123944 3300025932 Bacteria 1881
508 Ga0207706_10038957 3300025933 Bacteria 4216
509 Ga0207706_10055670 3300025933 Bacteria 3487
510 Ga0207686_10005890 3300025934 Bacteria 6580
511 Ga0207686_10022183 3300025934 Bacteria 3654
512 Ga0207686_10030082 3300025934 Bacteria 3211
513 Ga0207709_10002308 3300025935 Bacteria 12075
514 Ga0207709_10030118 3300025935 Bacteria 3155
515 Ga0207709_10034102 3300025935 Bacteria 2997
516 Ga0207709_10141932 3300025935 Bacteria 1652
517 Ga0207670_10157496 3300025936 Bacteria 1692
518 Ga0207669_10016551 3300025937 Bacteria 3750
519 Ga0207669_10023155 3300025937 Bacteria 3312
520 Ga0207669_10066449 3300025937 Bacteria 2242
521 Ga0207669_10138623 3300025937 Bacteria 1685
522 Ga0207704_10069106 3300025938 Bacteria 2230
523 Ga0207704_10113107 3300025938 Bacteria 1840
524 Ga0207665_10000344 3300025939 Bacteria 32292
525 Ga0207665_10022414 3300025939 Bacteria 4155
526 Ga0207691_10008282 3300025940 Bacteria 9982
527 Ga0207691_10031631 3300025940 Bacteria 4937
528 Ga0207691_10042101 3300025940 Bacteria 4212
529 Ga0207691_10081765 3300025940 Bacteria 2902
530 Ga0207691_10161330 3300025940 Bacteria 1967
531 Ga0207711_10032592 3300025941 Bacteria 4405
532 Ga0207689_10023381 3300025942 Bacteria 5188
533 Ga0207661_10019880 3300025944 Bacteria 5011
534 Ga0207661_10043058 3300025944 Bacteria 3562
535 Ga0207661_10049624 3300025944 Bacteria 3341
536 Ga0207661_10049766 3300025944 Bacteria 3337
537 Ga0207661_10166969 3300025944 Bacteria 1913
538 Ga0207661_10291437 3300025944 Bacteria 1461
539 Ga0207661_10351678 3300025944 Bacteria 1329
540 Ga0207679_10028164 3300025945 Bacteria 3895
541 Ga0207679_10080517 3300025945 Bacteria 2487
542 Ga0207667_10023730 3300025949 Bacteria 6753
543 Ga0207667_10068774 3300025949 Bacteria 3686
544 Ga0207667_10147190 3300025949 Bacteria 2424
545 Ga0207667_10189386 3300025949 Bacteria 2111
546 Ga0207667_10254510 3300025949 Bacteria 1796
547 Ga0207651_10009549 3300025960 Bacteria 5321
548 Ga0207651_10031507 3300025960 Bacteria 3391
549 Ga0207712_10025826 3300025961 Bacteria 3907
550 Ga0207712_10093076 3300025961 Bacteria 2223
551 Ga0207668_10016548 3300025972 Bacteria 4604
552 Ga0207668_10046704 3300025972 Bacteria 2960
553 Ga0207640_10005817 3300025981 Bacteria 6724
554 Ga0207677_10116531 3300026023 Bacteria 2000
555 Ga0207703_10026458 3300026035 Bacteria 4567
556 Ga0207703_10062061 3300026035 Bacteria 3061
557 Ga0207703_10120822 3300026035 Bacteria 2249
558 Ga0207639_10031208 3300026041 Bacteria 3914
559 Ga0207639_10067007 3300026041 Bacteria 2792
560 Ga0207678_10030037 3300026067 Bacteria 4744
561 Ga0207678_10054666 3300026067 Bacteria 3439
562 Ga0207678_10094919 3300026067 Bacteria 2549
563 Ga0207708_10000111 3300026075 Bacteria 62791
564 Ga0207708_10017741 3300026075 Bacteria 5358
565 Ga0207708_10048867 3300026075 Bacteria 3220
566 Ga0207708_10175320 3300026075 Bacteria 1700
567 Ga0207702_10002546 3300026078 Bacteria 17159
568 Ga0207702_10032030 3300026078 Bacteria 4386
569 Ga0207702_10039464 3300026078 Bacteria 3956
570 Ga0207702_10055844 3300026078 Bacteria 3350
571 Ga0207702_10058333 3300026078 Bacteria 3285
572 Ga0207702_10064741 3300026078 Bacteria 3129
573 Ga0207702_10134110 3300026078 Bacteria 2232
574 Ga0207702_10176573 3300026078 Bacteria 1963
575 Ga0207641_10162474 3300026088 Bacteria 2032
576 Ga0207648_10005139 3300026089 Bacteria 13248
577 Ga0207648_10005403 3300026089 Bacteria 12879
578 Ga0207648_10048774 3300026089 Bacteria 3707
579 Ga0207676_10032090 3300026095 Bacteria 3955
580 Ga0207674_10002093 3300026116 Bacteria 25273
581 Ga0207674_10018243 3300026116 Bacteria 7632
582 Ga0207674_10067128 3300026116 Bacteria 3611
583 Ga0207674_10095051 3300026116 Bacteria 2967
584 Ga0207674_10246999 3300026116 Bacteria 1731
585 Ga0207674_10279718 3300026116 Bacteria 1617
586 Ga0207675_100000541 3300026118 Bacteria 36871
587 Ga0207675_100015192 3300026118 Bacteria 7182
588 Ga0207675_100028132 3300026118 Bacteria 5234
589 Ga0207675_100071490 3300026118 Bacteria 3244
590 Ga0207675_100074404 3300026118 Bacteria 3178
591 Ga0207675_100289724 3300026118 Bacteria 1592
592 Ga0207683_10000549 3300026121 Bacteria 34716
593 Ga0207683_10002514 3300026121 Bacteria 16007
594 Ga0207683_10012548 3300026121 Bacteria 7227
595 Ga0207683_10021963 3300026121 Bacteria 5474
596 Ga0207683_10040649 3300026121 Bacteria 4059
597 Ga0207683_10049620 3300026121 Bacteria 3675
598 Ga0207683_10059011 3300026121 Bacteria 3369
599 Ga0207683_10169349 3300026121 Bacteria 1978
600 Ga0207683_10450167 3300026121 Bacteria 1187
601 Ga0207698_10018909 3300026142 Bacteria 4705
602 Ga0207698_10074175 3300026142 Bacteria 2713
603 Ga0207698_10091948 3300026142 Bacteria 2485
604 Ga0207698_10192534 3300026142 Bacteria 1818
605 Ga0207428_10000401 3300027907 Bacteria 53789
606 Ga0207428_10003755 3300027907 Bacteria 14580
607 Ga0207428_10009137 3300027907 Bacteria 8907
608 Ga0207428_10020562 3300027907 Bacteria 5606
609 Ga0207428_10034591 3300027907 Bacteria 4138
610 Ga0207428_10035364 3300027907 Bacteria 4083
611 Ga0207428_10042177 3300027907 Bacteria 3690
612 Ga0268266_10043075 3300028379 Bacteria 3857
613 Ga0268266_10134823 3300028379 Bacteria 2211
614 Ga0268266_10149262 3300028379 Bacteria 2105
615 Ga0265319_1001816 3300028563 Bacteria 12173
616 Ga0265318_10003094 3300028577 Bacteria 8544
617 Ga0265318_10005531 3300028577 Bacteria 5928
618 Ga0265322_10004487 3300028654 Bacteria 4153
619 Ga0265338_10013097 3300028800 Bacteria 9398
620 Ga0265338_10025999 3300028800 Bacteria 5918
621 Ga0265338_10033276 3300028800 Bacteria 5006
622 Ga0265338_10127004 3300028800 Bacteria 2021
623 Ga0265330_10009251 3300031235 Bacteria 4691
624 Ga0265332_10007519 3300031238 Bacteria 4924
625 Ga0265332_10056289 3300031238 Bacteria 1685
626 Ga0265320_10028495 3300031240 Bacteria 2899
627 Ga0265320_10045294 3300031240 Bacteria 2162
628 Ga0265325_10002727 3300031241 Bacteria 11802
629 Ga0265325_10004773 3300031241 Bacteria 8492
630 Ga0265329_10016061 3300031242 Bacteria 2601
631 Ga0265340_10012880 3300031247 Bacteria 4408
632 Ga0265340_10019809 3300031247 Bacteria 3462
633 Ga0265339_10005030 3300031249 Bacteria 8892
634 Ga0265327_10020600 3300031251 Bacteria 4009
635 Ga0265327_10031788 3300031251 Bacteria 2961
636 Ga0265316_10014896 3300031344 Bacteria 6820
637 Ga0265316_10025460 3300031344 Bacteria 4936
638 Ga0307408_100043242 3300031548 Bacteria 3205
639 Ga0307408_100120716 3300031548 Bacteria 2030
640 Ga0307408_100177398 3300031548 Bacteria 1706
641 Ga0265313_10020787 3300031595 Bacteria 3610
642 Ga0265313_10023998 3300031595 Bacteria 3269
643 Ga0265313_10042532 3300031595 Bacteria 2231
644 Ga0265314_10002229 3300031711 Bacteria 20166
645 Ga0265314_10010464 3300031711 Bacteria 7733
646 Ga0307410_10012458 3300031852 Bacteria 4920
647 Ga0307410_10043000 3300031852 Bacteria 2990
648 Ga0307407_10001948 3300031903 Bacteria 7819
649 Ga0307412_10071746 3300031911 Bacteria 2365
650 Ga0307409_100099556 3300031995 Bacteria 2407
651 Ga0307416_100042125 3300032002 Bacteria 3561
652 Ga0307416_100108480 3300032002 Bacteria 2439
653 Ga0307416_100152023 3300032002 Bacteria 2124
654 Ga0307411_10036119 3300032005 Bacteria 3093
655 Ga0307411_10042631 3300032005 Bacteria 2897
656 Ga0307415_100000048 3300032126 Bacteria 51694
657 Ga0307415_100110299 3300032126 Bacteria 2040
658 Ga0373926_0041573 3300035083 Bacteria 1643
659 Ga0373940_0019658 3300035088 Bacteria 1709
660 Ga0373944_0032803 3300035089 Bacteria 1571
661 Ga0373951_0033600 3300035091 Bacteria 1216
662 Ga0373932_0007782 3300035112 Bacteria 2557
663 Ga0373932_0016885 3300035112 Bacteria 1868
664 Ga0373936_0003678 3300035113 Bacteria 5758
665 Ga0373956_0052989 3300035119 Bacteria 1826
666 Ga0373957_0013834 3300035120 Bacteria 2747
667 Ga0373957_0047855 3300035120 Bacteria 1628
668 Ga0373943_0003688 3300035170 Bacteria 6964
669 Ga0373943_0022912 3300035170 Bacteria 2899
670 Ga0373955_0042659 3300035172 Bacteria 2437
671 Ga0373961_0017576 3300035241 Bacteria 1858
672 Ga0373961_0021799 3300035241 Bacteria 1707
673 Ga0373962_0003750 3300035242 Bacteria 3655
674 Ga0373962_0012082 3300035242 Bacteria 2172
675 Ga0373931_0060215 3300035691 Bacteria 2043
676 Ga0373935_0051007 3300035692 Bacteria 2627
677 Ga0373935_0156567 3300035692 Bacteria 1550
678 Ga0373927_0011854 3300035695 Bacteria 5807
679 Ga0373947_0000788 3300035725 Bacteria 19051
680 Ga0373947_0002320 3300035725 Bacteria 11504
681 Ga0373947_0003814 3300035725 Bacteria 8881
682 Ga0373947_0012420 3300035725 Bacteria 4880
683 Ga0373947_0173013 3300035725 Bacteria 1402
684 Ga0373925_0010642 3300037068 Bacteria 6672
685 Ga0373925_0011812 3300037068 Bacteria 6319
686 Ga0373925_0012604 3300037068 Bacteria 6126
687 Ga0373925_0014238 3300037068 Bacteria 5754
688 Ga0395899_0001267 3300037312 Bacteria 21969
689 Ga0395899_0003201 3300037312 Bacteria 12979
690 Ga0395899_0004394 3300037312 Bacteria 10991
691 Ga0395899_0005300 3300037312 Bacteria 10011
692 Ga0395899_0006552 3300037312 Bacteria 9025
693 Ga0395899_0006606 3300037312 Bacteria 8987
694 Ga0395899_0007849 3300037312 Bacteria 8223
695 Ga0395899_0008964 3300037312 Bacteria 7695
696 Ga0395899_0017276 3300037312 Bacteria 5498
697 Ga0395899_0033265 3300037312 Bacteria 3872
698 Ga0395899_0035788 3300037312 Bacteria 3726
699 Ga0395899_0045828 3300037312 Bacteria 3258
700 Ga0395899_0078433 3300037312 Bacteria 2407
701 Ga0395899_0089553 3300037312 Bacteria 2232
702 Ga0395900_0001024 3300037418 Bacteria 35866
703 Ga0395900_0002418 3300037418 Bacteria 20595
704 Ga0395900_0002489 3300037418 Bacteria 20243
705 Ga0395900_0003566 3300037418 Bacteria 16741
706 Ga0395900_0005710 3300037418 Bacteria 13005
707 Ga0395900_0006173 3300037418 Bacteria 12513
708 Ga0395900_0015689 3300037418 Bacteria 7722
709 Ga0395900_0017760 3300037418 Bacteria 7261
710 Ga0395900_0024441 3300037418 Bacteria 6187
711 Ga0395900_0033275 3300037418 Bacteria 5306
712 Ga0395900_0034837 3300037418 Bacteria 5186
713 Ga0395900_0036318 3300037418 Bacteria 5080
714 Ga0395900_0038069 3300037418 Bacteria 4958
715 Ga0395900_0060391 3300037418 Bacteria 3901
716 Ga0395900_0065948 3300037418 Bacteria 3720
717 Ga0395900_0067879 3300037418 Bacteria 3663
718 Ga0395900_0073341 3300037418 Bacteria 3519
719 Ga0395900_0089735 3300037418 Bacteria 3159
720 Ga0395900_0101312 3300037418 Bacteria 2958
721 Ga0395900_0109165 3300037418 Bacteria 2842
722 Ga0395900_0119351 3300037418 Bacteria 2707
723 Ga0395900_0128918 3300037418 Bacteria 2593
724 Ga0395900_0163099 3300037418 Bacteria 2272
725 Ga0395900_0216590 3300037418 Bacteria 1932
726 Ga0395900_0418813 3300037418 Bacteria 1300
727 Ga0395898_0001276 3300037466 Bacteria 37111
728 Ga0395898_0001509 3300037466 Bacteria 32076
729 Ga0395898_0002743 3300037466 Bacteria 20321
730 Ga0395898_0002982 3300037466 Bacteria 19225
731 Ga0395898_0003782 3300037466 Bacteria 16749
732 Ga0395898_0004411 3300037466 Bacteria 15397
733 Ga0395898_0005091 3300037466 Bacteria 14245
734 Ga0395898_0015220 3300037466 Bacteria 7896
735 Ga0395898_0017165 3300037466 Bacteria 7393
736 Ga0395898_0020035 3300037466 Bacteria 6799
737 Ga0395898_0020113 3300037466 Bacteria 6782
738 Ga0395898_0021217 3300037466 Bacteria 6589
739 Ga0395898_0025376 3300037466 Bacteria 5973
740 Ga0395898_0027338 3300037466 Bacteria 5729
741 Ga0395898_0038785 3300037466 Bacteria 4719
742 Ga0395898_0044759 3300037466 Bacteria 4354
743 Ga0395898_0055467 3300037466 Bacteria 3864
744 Ga0395898_0058643 3300037466 Bacteria 3747
745 Ga0395898_0110553 3300037466 Bacteria 2634
746 Ga0395898_0112757 3300037466 Bacteria 2606
747 Ga0395898_0135759 3300037466 Bacteria 2355
748 Ga0395898_0226508 3300037466 Bacteria 1783
749 Ga0395898_0234078 3300037466 Bacteria 1751
750 Ga0395898_0273054 3300037466 Bacteria 1612
751 Ga0395898_0305120 3300037466 Bacteria 1518
752 Ga0395898_0353895 3300037466 Bacteria 1400
753 Ga0395898_0434466 3300037466 Bacteria 1251
754 Ga0395898_0535696 3300037466 Bacteria 1113
755 Ga0395905_0001281 3300037471 Bacteria 31019
756 Ga0395905_0001349 3300037471 Bacteria 29890
757 Ga0395905_0002440 3300037471 Bacteria 20609
758 Ga0395905_0003692 3300037471 Bacteria 16207
759 Ga0395905_0004505 3300037471 Bacteria 14440
760 Ga0395905_0007392 3300037471 Bacteria 10922
761 Ga0395905_0007609 3300037471 Bacteria 10755
762 Ga0395905_0008109 3300037471 Bacteria 10376
763 Ga0395905_0012900 3300037471 Bacteria 8033
764 Ga0395905_0012928 3300037471 Bacteria 8025
765 Ga0395905_0018046 3300037471 Bacteria 6699
766 Ga0395905_0018402 3300037471 Bacteria 6630
767 Ga0395905_0019871 3300037471 Bacteria 6366
768 Ga0395905_0021022 3300037471 Bacteria 6180
769 Ga0395905_0038303 3300037471 Bacteria 4498
770 Ga0395905_0054064 3300037471 Bacteria 3758
771 Ga0395905_0057564 3300037471 Bacteria 3636
772 Ga0395905_0074344 3300037471 Bacteria 3185
773 Ga0395905_0134339 3300037471 Bacteria 2327
774 Ga0395905_0146389 3300037471 Bacteria 2222
775 Ga0395905_0153969 3300037471 Bacteria 2162
776 Ga0395905_0199946 3300037471 Bacteria 1874
777 Ga0395905_0218962 3300037471 Bacteria 1782
778 Ga0395905_0236738 3300037471 Bacteria 1706
779 Ga0395901_0001334 3300038443 Bacteria 25911
780 Ga0395901_0001957 3300038443 Bacteria 21190
781 Ga0395901_0002253 3300038443 Bacteria 19675
782 Ga0395901_0005629 3300038443 Bacteria 12676
783 Ga0395901_0013978 3300038443 Bacteria 8169
784 Ga0395901_0015974 3300038443 Bacteria 7648
785 Ga0395901_0020142 3300038443 Bacteria 6826
786 Ga0395901_0023112 3300038443 Bacteria 6372
787 Ga0395901_0023993 3300038443 Bacteria 6257
788 Ga0395901_0025056 3300038443 Bacteria 6123
789 Ga0395901_0025193 3300038443 Bacteria 6107
790 Ga0395901_0030219 3300038443 Bacteria 5582
791 Ga0395901_0031270 3300038443 Bacteria 5488
792 Ga0395901_0036033 3300038443 Bacteria 5112
793 Ga0395901_0037992 3300038443 Bacteria 4980
794 Ga0395901_0049114 3300038443 Bacteria 4383
795 Ga0395901_0050608 3300038443 Bacteria 4315
796 Ga0395901_0067776 3300038443 Bacteria 3717
797 Ga0395901_0075091 3300038443 Bacteria 3526
798 Ga0395901_0081563 3300038443 Bacteria 3378
799 Ga0395901_0093107 3300038443 Bacteria 3155
800 Ga0395901_0095955 3300038443 Bacteria 3107
801 Ga0395901_0127921 3300038443 Bacteria 2670
802 Ga0395901_0171590 3300038443 Bacteria 2276
803 Ga0395901_0208794 3300038443 Bacteria 2045
804 Ga0395901_0318376 3300038443 Bacteria 1610
805 Ga0395901_0400462 3300038443 Bacteria 1410
806 Ga0395901_0421977 3300038443 Bacteria 1368
807 Ga0395901_0437092 3300038443 Bacteria 1340
808 Ga0436360_0619128 3300039438 Bacteria 13472
809 Ga0439453_0011950 3300041408 Bacteria 1455
810 Ga0439461_0003402 3300041410 Bacteria 2618
811 Ga0451789_0859302 3300041443 Bacteria 2245
812 Ga0451791_0558386 3300041451 Bacteria 1339
813 Ga0451795_0282681 3300041456 Bacteria 2274
814 Ga0451800_1208011 3300041459 Bacteria 1532
815 Ga0451802_1514280 3300041460 Bacteria 1244
816 Ga0451807_0425442 3300041486 Bacteria 2951
817 Ga0451837_1761312 3300041494 Bacteria 1665
818 Ga0451847_0357101 3300041503 Bacteria 1982
819 Ga0439433_0000148 3300041999 Bacteria 10791
820 Ga0439445_0009915 3300042004 Bacteria 2249
821 Ga0439454_000329 3300042011 Bacteria 3565
822 Ga0450911_006739 3300042115 Bacteria 1695
823 Ga0439446_0017835 3300042156 Bacteria 1985
824 Ga0439434_0027372 3300042435 Bacteria 1723
825 Ga0466969_0002720 3300044656 Bacteria 9452
826 Ga0466969_0028659 3300044656 Bacteria 2846
827 Ga0466969_0081587 3300044656 Bacteria 1543
828 Ga0466972_0088252 3300044658 Bacteria 1472
829 Ga0466965_0005134 3300044683 Bacteria 5875
830 Ga0466966_0011939 3300044684 Bacteria 5757
831 Ga0466961_0016450 3300044693 Bacteria 4753
832 Ga0466961_0077466 3300044693 Bacteria 2106
833 Ga0466963_0000776 3300044694 Bacteria 15852
834 Ga0466963_0009072 3300044694 Bacteria 5978
835 Ga0466963_0009464 3300044694 Bacteria 5867
836 Ga0466963_0014868 3300044694 Bacteria 4807
837 Ga0466963_0037025 3300044694 Bacteria 3184
838 Ga0466963_0102454 3300044694 Bacteria 1960
839 Ga0466963_0111674 3300044694 Bacteria 1876
840 Ga0466963_0195759 3300044694 Bacteria 1413
841 Ga0466964_0002134 3300044706 Bacteria 6974
842 Ga0466964_0004036 3300044706 Bacteria 5395
843 Ga0466964_0032139 3300044706 Bacteria 2084
844 Ga0466964_0046013 3300044706 Bacteria 1778
845 Ga0466971_0000146 3300044719 Bacteria 26422
846 Ga0466971_0002654 3300044719 Bacteria 7552
847 Ga0466968_0001944 3300044735 Bacteria 7492
848 Ga0466968_0006063 3300044735 Bacteria 4538
849 Ga0466968_0025671 3300044735 Bacteria 2414
850 Ga0466968_0029013 3300044735 Bacteria 2286
851 Ga0466957_0002420 3300044842 Bacteria 10019
852 Ga0466957_0003727 3300044842 Bacteria 8423
853 Ga0466957_0004490 3300044842 Bacteria 7784
854 Ga0466957_0024880 3300044842 Bacteria 3546
855 Ga0466957_0044092 3300044842 Bacteria 2703
856 Ga0466960_0005041 3300044901 Bacteria 5214
857 Ga0466960_0009045 3300044901 Bacteria 4097
858 Ga0466960_0071658 3300044901 Bacteria 1726
859 Ga0466959_0001728 3300045049 Bacteria 13579
860 Ga0466959_0013001 3300045049 Bacteria 6027
861 Ga0466959_0018823 3300045049 Bacteria 5073
862 Ga0466959_0071000 3300045049 Bacteria 2522
863 Ga0451576_0007984 3300045051 Bacteria 12517
864 Ga0451576_0152926 3300045051 Bacteria 2406
865 Ga0451576_0174240 3300045051 Bacteria 2246
866 Ga0466958_0000726 3300045836 Bacteria 14404
867 Ga0466958_0004202 3300045836 Bacteria 7571
868 Ga0466958_0023057 3300045836 Bacteria 3650
869 Ga0466967_0000305 3300045976 Bacteria 22092
870 Ga0466967_0003528 3300045976 Bacteria 10232
871 Ga0466967_0004340 3300045976 Bacteria 9538
872 Ga0466967_0006003 3300045976 Bacteria 8532
873 Ga0466967_0022829 3300045976 Bacteria 5115
874 Ga0466967_0032578 3300045976 Bacteria 4402
875 Ga0466967_0041989 3300045976 Bacteria 3948
876 Ga0466967_0046284 3300045976 Bacteria 3787
877 Ga0466967_0052145 3300045976 Bacteria 3589
878 Ga0466967_0054671 3300045976 Bacteria 3515
879 Ga0466967_0082438 3300045976 Bacteria 2906
880 Ga0466967_0103840 3300045976 Bacteria 2601
881 Ga0466967_0116228 3300045976 Bacteria 2464
882 Ga0466967_0198384 3300045976 Bacteria 1900
883 Ga0466967_0275335 3300045976 Bacteria 1614
884 Ga0495603_0013529 3300046455 Bacteria 4935
885 Ga0495603_0025920 3300046455 Bacteria 3544
886 Ga0495603_0041286 3300046455 Bacteria 2759
887 Ga0495603_0056218 3300046455 Bacteria 2330
888 Ga0495629_0000667 3300046459 Bacteria 27761
889 Ga0495629_0005062 3300046459 Bacteria 9864
890 Ga0495629_0042086 3300046459 Bacteria 3211
891 Ga0495641_0003180 3300046461 Bacteria 12491
892 Ga0495641_0005898 3300046461 Bacteria 8087
893 Ga0495641_0082666 3300046461 Bacteria 1438
894 Ga0495641_0098566 3300046461 Bacteria 1304
895 Ga0495651_0034559 3300046462 Bacteria 3940
896 Ga0495651_0090894 3300046462 Bacteria 2289
897 Ga0495651_0101882 3300046462 Bacteria 2136
898 Ga0495651_0121198 3300046462 Bacteria 1921
899 Ga0495653_0015246 3300046463 Bacteria 6263
900 Ga0495653_0017412 3300046463 Bacteria 5845
901 Ga0495653_0052187 3300046463 Bacteria 3135
902 Ga0495653_0060441 3300046463 Bacteria 2871
903 Ga0495653_0097697 3300046463 Bacteria 2133
904 Ga0495653_0098825 3300046463 Bacteria 2118
905 Ga0495582_0000092 3300046473 Bacteria 46401
906 Ga0495582_0026180 3300046473 Bacteria 3197
907 Ga0495582_0042231 3300046473 Bacteria 2512
908 Ga0495582_0044419 3300046473 Bacteria 2447
909 Ga0495582_0076740 3300046473 Bacteria 1853
910 Ga0495605_0050725 3300046474 Bacteria 2023
911 Ga0495605_0068941 3300046474 Bacteria 1675
912 Ga0495639_0002676 3300046475 Bacteria 7741
913 Ga0495639_0009401 3300046475 Bacteria 4192
914 Ga0495662_0044954 3300046476 Bacteria 2132
915 Ga0495662_0069879 3300046476 Bacteria 1701
916 Ga0495664_0208241 3300046477 Bacteria 1184
917 Ga0495584_0047032 3300046491 Bacteria 2176
918 Ga0495594_0074781 3300046499 Bacteria 1888
919 Ga0495596_0010418 3300046500 Bacteria 4050
920 Ga0495596_0109641 3300046500 Bacteria 1072
921 Ga0495618_0052913 3300046514 Bacteria 2567
922 Ga0495618_0113942 3300046514 Bacteria 1731
923 Ga0495618_0199826 3300046514 Bacteria 1265
924 Ga0495628_0044004 3300046516 Bacteria 3554
925 Ga0495628_0062049 3300046516 Bacteria 2930
926 Ga0495630_0001255 3300046517 Bacteria 17499
927 Ga0495630_0004222 3300046517 Bacteria 10066
928 Ga0495630_0070119 3300046517 Bacteria 2637
929 Ga0495630_0096549 3300046517 Bacteria 2234
930 Ga0495630_0122656 3300046517 Bacteria 1971
931 Ga0495663_0004637 3300046525 Bacteria 3852
932 Ga0495663_0004676 3300046525 Bacteria 3835
933 Ga0495666_0029339 3300046526 Bacteria 2706
934 Ga0495642_0028737 3300046528 Bacteria 2216
935 Ga0495642_0030874 3300046528 Bacteria 2146
936 Ga0495652_0122075 3300046529 Bacteria 2076
937 Ga0495652_0134750 3300046529 Bacteria 1950
938 Ga0495652_0274772 3300046529 Bacteria 1237
939 Ga0495665_0000240 3300046531 Bacteria 27586
940 Ga0495640_0007331 3300046533 Bacteria 8681
941 Ga0495586_0010133 3300046535 Bacteria 5016
942 Ga0495586_0073234 3300046535 Bacteria 1874
943 Ga0495587_0078189 3300046536 Bacteria 1920
944 Ga0495598_0027229 3300046537 Bacteria 1575
945 Ga0495645_0249933 3300046543 Bacteria 1179
946 Ga0495667_0020399 3300046559 Bacteria 4473
947 Ga0495667_0027749 3300046559 Bacteria 3812
948 Ga0495667_0086952 3300046559 Bacteria 2027
949 Ga0495656_0060612 3300046615 Bacteria 1650
950 Ga0495668_0155641 3300046616 Bacteria 1252
951 Ga0495634_0085372 3300046642 Bacteria 2057
952 Ga0495634_0099324 3300046642 Bacteria 1882
953 Ga0495634_0106915 3300046642 Bacteria 1803
954 Ga0495634_0161419 3300046642 Bacteria 1413
955 Ga0495634_0186407 3300046642 Bacteria 1296
956 Ga0495635_0012488 3300046663 Bacteria 5950
957 Ga0495659_0002324 3300046664 Bacteria 6149
958 Ga0495659_0026466 3300046664 Bacteria 1994
959 Ga0495588_0104500 3300046674 Bacteria 1490
960 Ga0495657_0044234 3300046675 Bacteria 3030
961 Ga0495657_0080312 3300046675 Bacteria 2111
962 Ga0495657_0206866 3300046675 Bacteria 1194
963 Ga0495599_0081239 3300046678 Bacteria 2024
964 Ga0495623_0072202 3300046679 Bacteria 2146
965 Ga0495658_0015686 3300046683 Bacteria 3889
966 Ga0495669_0025825 3300046684 Bacteria 2565
967 Ga0495613_0037745 3300046689 Bacteria 3581
968 Ga0495613_0058534 3300046689 Bacteria 2827
969 Ga0495613_0153233 3300046689 Bacteria 1643
970 Ga0495613_0260207 3300046689 Bacteria 1209
971 Ga0495624_0006810 3300046690 Bacteria 8069
972 Ga0495670_0029056 3300046691 Bacteria 2743
973 Ga0495670_0076775 3300046691 Bacteria 1698
974 Ga0495589_0012843 3300046794 Bacteria 4329
975 Ga0495589_0119307 3300046794 Bacteria 1271
976 Ga0495600_0050268 3300046809 Bacteria 2720
977 Ga0495581_0000519 3300047315 Bacteria 19732
978 Ga0495581_0003773 3300047315 Bacteria 8725
979 Ga0495581_0135942 3300047315 Bacteria 1433
980 Ga0495604_0052583 3300047317 Bacteria 3153
981 Ga0495604_0096542 3300047317 Bacteria 2181
982 Ga0495604_0166927 3300047317 Bacteria 1551
983 Ga0495636_0050080 3300047318 Bacteria 1748
984 Ga0495636_0052003 3300047318 Bacteria 1718
985 Ga0495674_0001135 3300047319 Bacteria 25640
986 Ga0495674_0217738 3300047319 Bacteria 1579
987 Ga0495676_0000654 3300047321 Bacteria 28845
988 Ga0495676_0054101 3300047321 Bacteria 3193
989 Ga0495676_0124287 3300047321 Bacteria 1872
990 Ga0495680_0004067 3300047322 Bacteria 14091
991 Ga0495680_0022087 3300047322 Bacteria 5314
992 Ga0495680_0039217 3300047322 Bacteria 3780
993 Ga0495680_0075211 3300047322 Bacteria 2563
994 Ga0495680_0079785 3300047322 Bacteria 2474
995 Ga0495680_0217777 3300047322 Bacteria 1364
996 Ga0495677_0038918 3300047445 Bacteria 1738
997 Ga0495684_0013297 3300047471 Bacteria 6345
998 Ga0495684_0032055 3300047471 Bacteria 4033
999 Ga0495684_0048770 3300047471 Bacteria 3237
1000 Ga0495684_0082142 3300047471 Bacteria 2445
1001 Ga0495684_0285437 3300047471 Bacteria 1189
1002 Ga0495614_0028987 3300048089 Bacteria 2383
1003 Ga0496100_0004620 3300048903 Bacteria 7321
1004 Ga0496100_0020151 3300048903 Bacteria 3993
1005 Ga0496100_0033386 3300048903 Bacteria 3220
1006 Ga0496100_0033708 3300048903 Bacteria 3206
1007 Ga0496100_0038685 3300048903 Bacteria 3024
1008 Ga0496100_0074991 3300048903 Bacteria 2267
1009 Ga0496100_0104827 3300048903 Bacteria 1955
1010 Ga0496100_0170551 3300048903 Bacteria 1567
1011 Ga0496100_0317160 3300048903 Bacteria 1170
1012 Ga0496101_0002185 3300048904 Bacteria 11945
1013 Ga0496101_0011238 3300048904 Bacteria 5931
1014 Ga0496101_0024288 3300048904 Bacteria 4193
1015 Ga0496101_0027736 3300048904 Bacteria 3948
1016 Ga0496101_0057688 3300048904 Bacteria 2809
1017 Ga0496101_0070017 3300048904 Bacteria 2568
1018 Ga0496101_0072476 3300048904 Bacteria 2528
1019 Ga0496101_0100857 3300048904 Bacteria 2160
1020 Ga0496101_0128378 3300048904 Bacteria 1923
1021 Ga0496101_0175641 3300048904 Bacteria 1647
1022 Ga0496101_0230121 3300048904 Bacteria 1440
1023 Ga0496102_0005424 3300048905 Bacteria 10820
1024 Ga0496102_0008881 3300048905 Bacteria 8626
1025 Ga0496102_0028791 3300048905 Bacteria 4966
1026 Ga0496102_0079770 3300048905 Bacteria 3014
1027 Ga0496102_0147405 3300048905 Bacteria 2209
1028 Ga0496102_0189023 3300048905 Bacteria 1940
1029 Ga0496102_0200405 3300048905 Bacteria 1881
1030 Ga0496102_0275789 3300048905 Bacteria 1585
1031 Ga0496103_0000883 3300048906 Bacteria 21718
1032 Ga0496103_0003699 3300048906 Bacteria 9295
1033 Ga0496103_0009928 3300048906 Bacteria 5631
1034 Ga0496103_0011051 3300048906 Bacteria 5345
1035 Ga0496104_0000606 3300048907 Bacteria 30748
1036 Ga0496104_0001048 3300048907 Bacteria 23633
1037 Ga0496104_0010706 3300048907 Bacteria 8201
1038 Ga0496104_0015356 3300048907 Bacteria 6934
1039 Ga0496104_0033050 3300048907 Bacteria 4816
1040 Ga0496104_0038659 3300048907 Bacteria 4465
1041 Ga0496104_0120837 3300048907 Bacteria 2515
1042 Ga0496104_0134435 3300048907 Bacteria 2376
1043 Ga0496104_0143878 3300048907 Bacteria 2290
1044 Ga0496104_0202102 3300048907 Bacteria 1899
1045 Ga0496104_0405955 3300048907 Bacteria 1275
1046 Ga0496105_0000182 3300048908 Bacteria 41923
1047 Ga0496105_0000923 3300048908 Bacteria 20034
1048 Ga0496105_0006507 3300048908 Bacteria 8983
1049 Ga0496105_0012111 3300048908 Bacteria 6829
1050 Ga0496105_0024617 3300048908 Bacteria 4892
1051 Ga0496105_0086583 3300048908 Bacteria 2589
1052 Ga0496105_0099261 3300048908 Bacteria 2404
1053 Ga0496105_0204154 3300048908 Bacteria 1613
1054 Ga0496106_0002243 3300048909 Bacteria 14405
1055 Ga0496106_0017179 3300048909 Bacteria 5357
1056 Ga0496106_0019785 3300048909 Bacteria 4992
1057 Ga0496106_0029410 3300048909 Bacteria 4094
1058 Ga0496106_0046861 3300048909 Bacteria 3251
1059 Ga0496106_0074682 3300048909 Bacteria 2595
1060 Ga0496106_0165013 3300048909 Bacteria 1753
1061 Ga0496106_0182158 3300048909 Bacteria 1668
1062 Ga0496106_0302961 3300048909 Bacteria 1282
1063 Ga0496107_0003821 3300048910 Bacteria 10116
1064 Ga0496107_0009010 3300048910 Bacteria 6918
1065 Ga0496107_0039021 3300048910 Bacteria 3406
1066 Ga0496107_0039267 3300048910 Bacteria 3395
1067 Ga0496107_0115878 3300048910 Bacteria 1972
1068 Ga0496107_0248793 3300048910 Bacteria 1323
1069 Ga0496108_0000777 3300048911 Bacteria 24915
1070 Ga0496108_0001935 3300048911 Bacteria 16596
1071 Ga0496108_0003193 3300048911 Bacteria 13192
1072 Ga0496108_0004699 3300048911 Bacteria 11014
1073 Ga0496108_0009755 3300048911 Bacteria 7777
1074 Ga0496108_0010475 3300048911 Bacteria 7530
1075 Ga0496108_0012265 3300048911 Bacteria 6971
1076 Ga0496108_0029111 3300048911 Bacteria 4572
1077 Ga0496108_0100119 3300048911 Bacteria 2471
1078 Ga0496108_0138613 3300048911 Bacteria 2095
1079 Ga0496108_0152191 3300048911 Bacteria 1996
1080 Ga0496108_0165304 3300048911 Bacteria 1913
1081 Ga0496108_0299108 3300048911 Bacteria 1402
1082 Ga0496108_0306534 3300048911 Bacteria 1383
1083 Ga0496109_0000403 3300048912 Bacteria 39012
1084 Ga0496109_0000463 3300048912 Bacteria 34599
1085 Ga0496109_0000991 3300048912 Bacteria 23430
1086 Ga0496109_0001786 3300048912 Bacteria 17882
1087 Ga0496109_0012091 3300048912 Bacteria 7440
1088 Ga0496109_0015633 3300048912 Bacteria 6620
1089 Ga0496109_0019493 3300048912 Bacteria 5985
1090 Ga0496109_0028581 3300048912 Bacteria 4988
1091 Ga0496109_0036783 3300048912 Bacteria 4420
1092 Ga0496109_0068339 3300048912 Bacteria 3257
1093 Ga0496109_0084006 3300048912 Bacteria 2936
1094 Ga0496109_0087846 3300048912 Bacteria 2872
1095 Ga0496109_0112950 3300048912 Bacteria 2526
1096 Ga0496109_0170686 3300048912 Bacteria 2040
1097 Ga0496109_0179306 3300048912 Bacteria 1989
1098 Ga0496109_0320670 3300048912 Bacteria 1462
1099 Ga0496109_0347771 3300048912 Bacteria 1400
1100 Ga0496110_0000261 3300048913 Bacteria 34222
1101 Ga0496110_0000563 3300048913 Bacteria 25359
1102 Ga0496110_0001407 3300048913 Bacteria 17382
1103 Ga0496110_0005340 3300048913 Bacteria 10064
1104 Ga0496110_0017835 3300048913 Bacteria 5942
1105 Ga0496110_0061968 3300048913 Bacteria 3302
1106 Ga0496110_0122847 3300048913 Bacteria 2341
1107 Ga0496110_0125945 3300048913 Bacteria 2311
1108 Ga0496110_0146314 3300048913 Bacteria 2137
1109 Ga0496110_0160071 3300048913 Bacteria 2040
1110 Ga0496110_0174158 3300048913 Bacteria 1953
1111 Ga0496110_0190478 3300048913 Bacteria 1863
1112 Ga0496110_0269960 3300048913 Bacteria 1549
1113 Ga0496110_0277595 3300048913 Bacteria 1526
1114 Ga0496110_0280551 3300048913 Bacteria 1517
1115 Ga0496111_0000076 3300048914 Bacteria 40931
1116 Ga0496111_0000086 3300048914 Bacteria 39141
1117 Ga0496111_0000429 3300048914 Bacteria 21251
1118 Ga0496111_0006195 3300048914 Bacteria 7747
1119 Ga0496111_0007275 3300048914 Bacteria 7245
1120 Ga0496111_0009336 3300048914 Bacteria 6540
1121 Ga0496111_0015513 3300048914 Bacteria 5232
1122 Ga0496111_0015566 3300048914 Bacteria 5225
1123 Ga0496111_0037091 3300048914 Bacteria 3488
1124 Ga0496111_0057292 3300048914 Bacteria 2821
1125 Ga0496111_0084877 3300048914 Bacteria 2315
1126 Ga0496112_0001342 3300048915 Bacteria 18712
1127 Ga0496112_0005626 3300048915 Bacteria 10872
1128 Ga0496112_0014515 3300048915 Bacteria 7315
1129 Ga0496112_0033281 3300048915 Bacteria 5009
1130 Ga0496112_0043299 3300048915 Bacteria 4408
1131 Ga0496112_0050479 3300048915 Bacteria 4080
1132 Ga0496112_0064112 3300048915 Bacteria 3625
1133 Ga0496112_0075631 3300048915 Bacteria 3330
1134 Ga0496112_0081946 3300048915 Bacteria 3191
1135 Ga0496112_0138629 3300048915 Bacteria 2402
1136 Ga0496112_0145310 3300048915 Bacteria 2340
1137 Ga0496112_0181955 3300048915 Bacteria 2065
1138 Ga0496112_0182178 3300048915 Bacteria 2064
1139 Ga0496112_0391256 3300048915 Bacteria 1330
1140 Ga0496113_0000424 3300048916 Bacteria 20576
1141 Ga0496113_0026249 3300048916 Bacteria 4162
1142 Ga0496113_0155744 3300048916 Bacteria 1804
1143 Ga0496113_0233814 3300048916 Bacteria 1466
1144 Ga0496113_0319766 3300048916 Bacteria 1244
1145 Ga0496114_0005038 3300048917 Bacteria 10305
1146 Ga0496114_0006596 3300048917 Bacteria 9149
1147 Ga0496114_0007053 3300048917 Bacteria 8867
1148 Ga0496114_0012754 3300048917 Bacteria 6730
1149 Ga0496114_0013075 3300048917 Bacteria 6650
1150 Ga0496114_0014544 3300048917 Bacteria 6321
1151 Ga0496114_0030722 3300048917 Bacteria 4420
1152 Ga0496114_0042837 3300048917 Bacteria 3752
1153 Ga0496114_0043772 3300048917 Bacteria 3713
1154 Ga0496114_0051774 3300048917 Bacteria 3419
1155 Ga0496114_0076397 3300048917 Bacteria 2822
1156 Ga0496114_0095204 3300048917 Bacteria 2534
1157 Ga0496114_0319707 3300048917 Bacteria 1371
1158 Ga0496115_0001178 3300048918 Bacteria 18760
1159 Ga0496115_0001444 3300048918 Bacteria 17029
1160 Ga0496115_0019290 3300048918 Bacteria 5248
1161 Ga0496115_0022164 3300048918 Bacteria 4916
1162 Ga0496115_0025146 3300048918 Bacteria 4634
1163 Ga0496115_0142314 3300048918 Bacteria 1979
1164 Ga0501031_0001099 3300049568 Bacteria 16485
1165 Ga0501031_0004912 3300049568 Bacteria 8688
1166 Ga0501031_0006308 3300049568 Bacteria 7731
1167 Ga0501031_0006562 3300049568 Bacteria 7590
1168 Ga0501031_0017743 3300049568 Bacteria 4628
1169 Ga0501031_0022738 3300049568 Bacteria 4087
1170 Ga0501031_0090482 3300049568 Bacteria 1996
1171 Ga0501031_0097335 3300049568 Bacteria 1920
1172 Ga0501031_0139370 3300049568 Bacteria 1585
1173 Ga0501032_0002668 3300049569 Bacteria 13926
1174 Ga0501032_0007154 3300049569 Bacteria 8175
1175 Ga0501032_0048700 3300049569 Bacteria 2861
1176 Ga0501032_0086959 3300049569 Bacteria 2076
1177 Ga0501033_0001359 3300049570 Bacteria 21806
1178 Ga0501033_0001524 3300049570 Bacteria 20470
1179 Ga0501033_0009471 3300049570 Bacteria 7501
1180 Ga0501034_0007242 3300049571 Bacteria 11840
1181 Ga0501034_0187831 3300049571 Bacteria 2029
1182 Ga0501034_0337326 3300049571 Bacteria 1438
1183 Ga0501036_0000470 3300049572 Bacteria 28784
1184 Ga0501036_0003780 3300049572 Bacteria 12135
1185 Ga0501036_0007319 3300049572 Bacteria 8990
1186 Ga0501036_0020507 3300049572 Bacteria 5551
1187 Ga0501036_0036686 3300049572 Bacteria 4148
1188 Ga0501036_0038558 3300049572 Bacteria 4044
1189 Ga0501036_0074317 3300049572 Bacteria 2874
1190 Ga0501036_0074584 3300049572 Bacteria 2869
1191 Ga0501036_0092830 3300049572 Bacteria 2550
1192 Ga0501036_0098519 3300049572 Bacteria 2471
1193 Ga0501036_0113958 3300049572 Bacteria 2285
1194 Ga0501036_0139634 3300049572 Bacteria 2045
1195 Ga0501036_0171460 3300049572 Bacteria 1828
1196 Ga0501037_0000275 3300049573 Bacteria 43921
1197 Ga0501037_0018639 3300049573 Bacteria 5114
1198 Ga0501037_0031646 3300049573 Bacteria 3906
1199 Ga0501038_0000548 3300049574 Bacteria 33027
1200 Ga0501038_0005147 3300049574 Bacteria 12149
1201 Ga0501038_0011276 3300049574 Bacteria 8161
1202 Ga0501038_0016668 3300049574 Bacteria 6659
1203 Ga0501038_0060084 3300049574 Bacteria 3254
1204 Ga0501038_0071711 3300049574 Bacteria 2937
1205 Ga0501038_0255645 3300049574 Bacteria 1386
1206 Ga0501039_0000176 3300049575 Bacteria 45277
1207 Ga0501039_0002342 3300049575 Bacteria 14088
1208 Ga0501039_0004489 3300049575 Bacteria 10535
1209 Ga0501039_0018759 3300049575 Bacteria 5309
1210 Ga0501039_0028627 3300049575 Bacteria 4289
1211 Ga0501039_0044588 3300049575 Bacteria 3426
1212 Ga0501039_0102951 3300049575 Bacteria 2228
1213 Ga0501039_0150403 3300049575 Bacteria 1829
1214 Ga0501039_0184775 3300049575 Bacteria 1639
1215 Ga0501039_0220123 3300049575 Bacteria 1492
1216 Ga0501040_0000992 3300049576 Bacteria 17948
1217 Ga0501040_0001441 3300049576 Bacteria 15069
1218 Ga0501040_0006022 3300049576 Bacteria 7848
1219 Ga0501040_0007687 3300049576 Bacteria 6975
1220 Ga0501040_0009765 3300049576 Bacteria 6265
1221 Ga0501040_0029548 3300049576 Bacteria 3701
1222 Ga0501040_0047682 3300049576 Bacteria 2925
1223 Ga0501040_0048145 3300049576 Bacteria 2913
1224 Ga0501040_0069460 3300049576 Bacteria 2430
1225 Ga0501040_0069870 3300049576 Bacteria 2423
1226 Ga0501040_0094474 3300049576 Bacteria 2080
1227 Ga0501041_0003729 3300049577 Bacteria 8760
1228 Ga0501041_0004037 3300049577 Bacteria 8477
1229 Ga0501041_0009588 3300049577 Bacteria 5708
1230 Ga0501041_0011138 3300049577 Bacteria 5310
1231 Ga0501041_0040000 3300049577 Bacteria 2845
1232 Ga0501041_0099808 3300049577 Bacteria 1796
1233 Ga0501041_0123910 3300049577 Bacteria 1607
1234 Ga0501042_0000092 3300049578 Bacteria 35165
1235 Ga0501042_0000116 3300049578 Bacteria 33871
1236 Ga0501042_0002063 3300049578 Bacteria 12186
1237 Ga0501042_0003743 3300049578 Bacteria 9613
1238 Ga0501042_0006234 3300049578 Bacteria 7741
1239 Ga0501042_0008327 3300049578 Bacteria 6837
1240 Ga0501042_0008403 3300049578 Bacteria 6811
1241 Ga0501042_0013685 3300049578 Bacteria 5525
1242 Ga0501042_0060847 3300049578 Bacteria 2697
1243 Ga0501042_0104594 3300049578 Bacteria 2037
1244 Ga0501042_0135235 3300049578 Bacteria 1777
1245 Ga0501043_0000891 3300049579 Bacteria 26496
1246 Ga0501043_0001469 3300049579 Bacteria 20613
1247 Ga0501043_0008387 3300049579 Bacteria 8137
1248 Ga0501043_0021319 3300049579 Bacteria 5079
1249 Ga0501043_0255351 3300049579 Bacteria 1349
1250 Ga0501046_0002474 3300049580 Bacteria 17319
1251 Ga0501046_0007575 3300049580 Bacteria 9521
1252 Ga0501046_0024547 3300049580 Bacteria 4943
1253 Ga0501046_0069321 3300049580 Bacteria 2743
1254 Ga0501046_0102098 3300049580 Bacteria 2199
1255 Ga0501046_0121329 3300049580 Bacteria 1988
1256 Ga0501046_0255782 3300049580 Bacteria 1288
1257 Ga0501047_0001408 3300049581 Bacteria 23584
1258 Ga0501047_0001498 3300049581 Bacteria 22765
1259 Ga0501047_0006299 3300049581 Bacteria 11161
1260 Ga0501048_0001223 3300049582 Bacteria 19432
1261 Ga0501048_0002836 3300049582 Bacteria 13235
1262 Ga0501048_0003112 3300049582 Bacteria 12666
1263 Ga0501048_0004195 3300049582 Bacteria 10986
1264 Ga0501048_0004940 3300049582 Bacteria 10171
1265 Ga0501048_0005096 3300049582 Bacteria 10010
1266 Ga0501048_0031166 3300049582 Bacteria 3857
1267 Ga0501048_0044833 3300049582 Bacteria 3159
1268 Ga0501048_0133044 3300049582 Bacteria 1757
1269 Ga0501048_0175130 3300049582 Bacteria 1520
1270 Ga0501048_0176845 3300049582 Bacteria 1512
1271 Ga0501067_0000352 3300049583 Bacteria 25098
1272 Ga0501067_0000684 3300049583 Bacteria 18236
1273 Ga0501067_0001847 3300049583 Bacteria 11644
1274 Ga0501067_0007671 3300049583 Bacteria 6000
1275 Ga0501067_0010737 3300049583 Bacteria 5066
1276 Ga0501067_0013971 3300049583 Bacteria 4447
1277 Ga0501067_0021119 3300049583 Bacteria 3603
1278 Ga0501067_0027764 3300049583 Bacteria 3136
1279 Ga0501067_0037726 3300049583 Bacteria 2683
1280 Ga0501067_0043082 3300049583 Bacteria 2506
1281 Ga0501067_0054901 3300049583 Bacteria 2207
1282 Ga0501067_0092549 3300049583 Bacteria 1679
1283 Ga0501068_0000135 3300049584 Bacteria 33527
1284 Ga0501068_0000554 3300049584 Bacteria 18987
1285 Ga0501068_0002912 3300049584 Bacteria 9106
1286 Ga0501068_0004593 3300049584 Bacteria 7513
1287 Ga0501068_0013671 3300049584 Bacteria 4622
1288 Ga0501068_0023831 3300049584 Bacteria 3589
1289 Ga0501068_0025466 3300049584 Bacteria 3479
1290 Ga0501068_0051755 3300049584 Bacteria 2485
1291 Ga0501069_0000129 3300049585 Bacteria 32875
1292 Ga0501069_0000690 3300049585 Bacteria 15734
1293 Ga0501069_0007796 3300049585 Bacteria 5622
1294 Ga0501069_0022668 3300049585 Bacteria 3419
1295 Ga0501069_0038956 3300049585 Bacteria 2624
1296 Ga0501069_0057883 3300049585 Bacteria 2161
1297 Ga0501069_0072604 3300049585 Bacteria 1929
1298 Ga0501069_0100757 3300049585 Bacteria 1639
1299 Ga0501069_0144746 3300049585 Bacteria 1364
1300 Ga0501070_0007370 3300049586 Bacteria 9341
1301 Ga0501070_0014203 3300049586 Bacteria 6700
1302 Ga0501070_0017683 3300049586 Bacteria 5986
1303 Ga0501070_0017999 3300049586 Bacteria 5929
1304 Ga0501070_0048928 3300049586 Bacteria 3510
1305 Ga0501070_0065195 3300049586 Bacteria 3015
1306 Ga0501070_0164183 3300049586 Bacteria 1830
1307 Ga0501071_0017987 3300049587 Bacteria 4887
1308 Ga0501071_0022278 3300049587 Bacteria 4416
1309 Ga0501071_0028681 3300049587 Bacteria 3924
1310 Ga0501071_0031806 3300049587 Bacteria 3743
1311 Ga0501071_0033835 3300049587 Bacteria 3633
1312 Ga0501071_0034511 3300049587 Bacteria 3601
1313 Ga0501071_0045905 3300049587 Bacteria 3137
1314 Ga0501071_0047455 3300049587 Bacteria 3085
1315 Ga0501071_0115863 3300049587 Bacteria 1983
1316 Ga0501071_0122820 3300049587 Bacteria 1925
1317 Ga0501071_0150202 3300049587 Bacteria 1737
1318 Ga0501072_0000318 3300049588 Bacteria 34284
1319 Ga0501072_0005951 3300049588 Bacteria 9293
1320 Ga0501072_0006359 3300049588 Bacteria 8993
1321 Ga0501072_0006650 3300049588 Bacteria 8795
1322 Ga0501072_0008547 3300049588 Bacteria 7765
1323 Ga0501072_0011062 3300049588 Bacteria 6885
1324 Ga0501072_0012707 3300049588 Bacteria 6438
1325 Ga0501072_0014756 3300049588 Bacteria 5989
1326 Ga0501072_0033625 3300049588 Bacteria 4018
1327 Ga0501072_0089920 3300049588 Bacteria 2437
1328 Ga0501072_0111062 3300049588 Bacteria 2182
1329 Ga0501072_0112384 3300049588 Bacteria 2169
1330 Ga0501072_0137638 3300049588 Bacteria 1947
1331 Ga0501072_0255574 3300049588 Bacteria 1395
1332 Ga0501073_0004072 3300049589 Bacteria 10973
1333 Ga0501073_0012723 3300049589 Bacteria 6138
1334 Ga0501073_0021438 3300049589 Bacteria 4659
1335 Ga0501073_0023569 3300049589 Bacteria 4418
1336 Ga0501073_0222466 3300049589 Bacteria 1304
1337 Ga0501074_0002118 3300049590 Bacteria 13705
1338 Ga0501074_0002797 3300049590 Bacteria 12213
1339 Ga0501074_0004639 3300049590 Bacteria 9842
1340 Ga0501074_0006115 3300049590 Bacteria 8694
1341 Ga0501074_0017279 3300049590 Bacteria 5233
1342 Ga0501074_0035843 3300049590 Bacteria 3594
1343 Ga0501074_0050772 3300049590 Bacteria 2994
1344 Ga0501074_0146332 3300049590 Bacteria 1690
1345 Ga0501074_0253926 3300049590 Bacteria 1250
1346 Ga0501075_0000040 3300049591 Bacteria 52221
1347 Ga0501075_0003487 3300049591 Bacteria 10517
1348 Ga0501075_0006994 3300049591 Bacteria 7795
1349 Ga0501075_0007704 3300049591 Bacteria 7475
1350 Ga0501075_0059731 3300049591 Bacteria 2872
1351 Ga0501075_0072389 3300049591 Bacteria 2605
1352 Ga0501075_0111065 3300049591 Bacteria 2084
1353 Ga0501075_0140606 3300049591 Bacteria 1839
1354 Ga0501076_0000389 3300049592 Bacteria 27457
1355 Ga0501076_0001058 3300049592 Bacteria 18074
1356 Ga0501076_0005282 3300049592 Bacteria 9259
1357 Ga0501076_0005825 3300049592 Bacteria 8889
1358 Ga0501076_0013380 3300049592 Bacteria 6152
1359 Ga0501076_0015191 3300049592 Bacteria 5816
1360 Ga0501076_0020365 3300049592 Bacteria 5077
1361 Ga0501076_0229032 3300049592 Bacteria 1519
1362 Ga0501076_0245939 3300049592 Bacteria 1463
1363 Ga0501077_0001230 3300049593 Bacteria 15458
1364 Ga0501077_0002796 3300049593 Bacteria 10472
1365 Ga0501077_0003592 3300049593 Bacteria 9320
1366 Ga0501077_0004285 3300049593 Bacteria 8629
1367 Ga0501077_0006692 3300049593 Bacteria 7085
1368 Ga0501077_0027290 3300049593 Bacteria 3626
1369 Ga0501077_0056019 3300049593 Bacteria 2502
1370 Ga0501077_0060290 3300049593 Bacteria 2408
1371 Ga0501077_0063205 3300049593 Bacteria 2348
1372 Ga0501079_0000221 3300049741 Bacteria 33871
1373 Ga0501079_0003063 3300049741 Bacteria 12236
1374 Ga0501079_0010228 3300049741 Bacteria 7122
1375 Ga0501079_0010605 3300049741 Bacteria 7012
1376 Ga0501079_0014181 3300049741 Bacteria 6076
1377 Ga0501079_0025440 3300049741 Bacteria 4539
1378 Ga0501079_0028516 3300049741 Bacteria 4284
1379 Ga0501079_0045659 3300049741 Bacteria 3381
1380 Ga0501079_0088112 3300049741 Bacteria 2403
1381 Ga0501079_0122299 3300049741 Bacteria 2024
1382 Ga0501079_0145813 3300049741 Bacteria 1844
1383 Ga0501080_0002349 3300049742 Bacteria 16515
1384 Ga0501080_0002972 3300049742 Bacteria 14917
1385 Ga0501080_0003472 3300049742 Bacteria 13888
1386 Ga0501080_0077486 3300049742 Bacteria 3091
1387 Ga0501080_0084494 3300049742 Bacteria 2949
1388 Ga0501080_0106565 3300049742 Bacteria 2597
1389 Ga0501080_0120549 3300049742 Bacteria 2431
1390 Ga0501080_0127457 3300049742 Bacteria 2356
1391 Ga0501080_0239054 3300049742 Bacteria 1658
1392 Ga0501081_0000040 3300049743 Bacteria 48110
1393 Ga0501081_0005311 3300049743 Bacteria 8308
1394 Ga0501081_0006499 3300049743 Bacteria 7590
1395 Ga0501081_0006503 3300049743 Bacteria 7588
1396 Ga0501081_0018968 3300049743 Bacteria 4574
1397 Ga0501081_0047958 3300049743 Bacteria 2939
1398 Ga0501081_0054276 3300049743 Bacteria 2769
1399 Ga0501081_0067258 3300049743 Bacteria 2493
1400 Ga0501081_0082561 3300049743 Bacteria 2251
1401 Ga0501081_0208753 3300049743 Bacteria 1418
1402 Ga0501081_0215186 3300049743 Bacteria 1396
1403 Ga0501081_0302428 3300049743 Bacteria 1173
1404 Ga0501083_0000131 3300049744 Bacteria 51265
1405 Ga0501083_0000928 3300049744 Bacteria 19450
1406 Ga0501083_0002782 3300049744 Bacteria 12094
1407 Ga0501083_0010159 3300049744 Bacteria 6633
1408 Ga0501083_0015301 3300049744 Bacteria 5372
1409 Ga0501083_0119940 3300049744 Bacteria 1725
1410 Ga0501083_0163872 3300049744 Bacteria 1454
1411 Ga0501083_0169664 3300049744 Bacteria 1427
1412 Ga0501035_0012410 3300049822 Bacteria 7875
1413 Ga0501035_0014052 3300049822 Bacteria 7387
1414 Ga0501035_0014109 3300049822 Bacteria 7369
1415 Ga0501035_0065225 3300049822 Bacteria 3234
1416 Ga0501035_0077104 3300049822 Bacteria 2946
1417 Ga0501035_0134410 3300049822 Bacteria 2154
1418 Ga0501044_0088784 3300049823 Bacteria 3120
1419 Ga0501045_0000098 3300049824 Bacteria 42917
1420 Ga0501045_0001678 3300049824 Bacteria 14899
1421 Ga0501045_0002356 3300049824 Bacteria 12832
1422 Ga0501045_0003625 3300049824 Bacteria 10616
1423 Ga0501045_0003655 3300049824 Bacteria 10576
1424 Ga0501045_0007918 3300049824 Bacteria 7400
1425 Ga0501045_0044673 3300049824 Bacteria 3227
1426 Ga0501045_0046189 3300049824 Bacteria 3171
1427 nmdc:mga03n38_105198_c1 3300050490 Bacteria 1366
1428 nmdc:mga00v17_122428_c1 3300050491 Bacteria 1657
1429 nmdc:mga00v17_126818_c1 3300050491 Bacteria 1629
1430 nmdc:mga00v17_33219_c1 3300050491 Bacteria 3055
1431 nmdc:mga05p37_15032_c2 3300050507 Bacteria 8788
1432 nmdc:mga05p37_184176_c1 3300050507 Bacteria 2539
1433 nmdc:mga05p37_19483_c1 3300050507 Bacteria 8206
1434 nmdc:mga05p37_205152_c1 3300050507 Bacteria 2385
1435 nmdc:mga05p37_24671_c1 3300050507 Bacteria 7309
1436 nmdc:mga05p37_247601_c1 3300050507 Bacteria 2139
1437 nmdc:mga05p37_35371_c1 3300050507 Bacteria 6124
1438 nmdc:mga05p37_36077_c1 3300050507 Bacteria 6066
1439 nmdc:mga05p37_3733_c1 3300050507 Bacteria 4123
1440 nmdc:mga05p37_3875_c1 3300050507 Bacteria 17497
1441 nmdc:mga05p37_404477_c1 3300050507 Bacteria 1593
1442 nmdc:mga05p37_438331_c1 3300050507 Bacteria 1516
1443 nmdc:mga05p37_566911_c1 3300050507 Bacteria 1289
1444 nmdc:mga05p37_81115_c1 3300050507 Bacteria 3996
1445 nmdc:mga09592_101605_c1 3300050508 Bacteria 2463
1446 nmdc:mga09592_12059_c1 3300050508 Bacteria 7032
1447 nmdc:mga09592_247905_c1 3300050508 Bacteria 1544
1448 nmdc:mga09592_48544_c1 3300050508 Bacteria 3578
1449 nmdc:mga09592_80395_c1 3300050508 Bacteria 2776
1450 nmdc:mga0qj67_124743_c1 3300050509 Bacteria 2084
1451 nmdc:mga06r32_43576_c2 3300050510 Bacteria 3967
1452 nmdc:mga06r32_48476_c2 3300050510 Bacteria 2817
1453 nmdc:mga06r32_61799_c1 3300050510 Bacteria 3607
1454 nmdc:mga08y16_104427_c1 3300050511 Bacteria 2949
1455 nmdc:mga08y16_18269_c1 3300050511 Bacteria 7388
1456 nmdc:mga08y16_23428_c1 3300050511 Bacteria 6522
1457 nmdc:mga08y16_251445_c1 3300050511 Bacteria 1827
1458 nmdc:mga08y16_39123_c1 3300050511 Bacteria 4977
1459 nmdc:mga08y16_3967_c1 3300050511 Bacteria 15416
1460 nmdc:mga08y16_53933_c1 3300050511 Bacteria 4202
1461 nmdc:mga08y16_59921_c1 3300050511 Bacteria 3976
1462 nmdc:mga08y16_62848_c1 3300050511 Bacteria 3878
1463 nmdc:mga08y16_68650_c1 3300050511 Bacteria 3696
1464 nmdc:mga0n895_12009_c1 3300050512 Bacteria 7752
1465 nmdc:mga0n895_1290_c1 3300050512 Bacteria 18537
1466 nmdc:mga0n895_131706_c1 3300050512 Bacteria 2526
1467 nmdc:mga0n895_23557_c1 3300050512 Bacteria 5788
1468 nmdc:mga0n895_271983_c1 3300050512 Bacteria 1719
1469 nmdc:mga0n895_370555_c1 3300050512 Bacteria 1450
1470 nmdc:mga0rr50_10266_c1 3300050513 Bacteria 5934
1471 nmdc:mga0rr50_108516_c1 3300050513 Bacteria 2193
1472 nmdc:mga0rr50_153278_c1 3300050513 Bacteria 1865
1473 nmdc:mga0rr50_20463_c1 3300050513 Bacteria 4495
1474 nmdc:mga0rr50_251288_c1 3300050513 Bacteria 1469
1475 nmdc:mga0rr50_37927_c1 3300050513 Bacteria 3483
1476 nmdc:mga0rr50_40155_c1 3300050513 Bacteria 3401
1477 nmdc:mga08x19_12127_c1 3300050514 Bacteria 5188
1478 nmdc:mga08x19_21220_c1 3300050514 Bacteria 4006
1479 nmdc:mga08x19_2697_c1 3300050514 Bacteria 10735
1480 nmdc:mga08x19_30543_c1 3300050514 Bacteria 3386
1481 nmdc:mga08x19_50569_c1 3300050514 Bacteria 2667
1482 nmdc:mga0a205_25950_c1 3300050515 Bacteria 5583
1483 nmdc:mga0a205_312739_c1 3300050515 Bacteria 1443
1484 nmdc:mga0a205_4243_c1 3300050515 Bacteria 12854
1485 nmdc:mga0a205_53094_c1 3300050515 Bacteria 3912
1486 nmdc:mga0a205_5955_c1 3300050515 Bacteria 10989
1487 nmdc:mga0a205_66304_c1 3300050515 Bacteria 3488
1488 Ga0495612_0047681 3300053078 Bacteria 1756
1489 Ga0495595_0004965 3300053084 Bacteria 5367
1490 Ga0495595_0029914 3300053084 Bacteria 2440
1491 Ga0495595_0033685 3300053084 Bacteria 2313
1492 Ga0495619_0003045 3300053085 Bacteria 10889
1493 Ga0495619_0006747 3300053085 Bacteria 7262
1494 Ga0495619_0032595 3300053085 Bacteria 3382
1495 Ga0501084_0000228 3300054114 Bacteria 42475
1496 Ga0501084_0000955 3300054114 Bacteria 22375
1497 Ga0501084_0001046 3300054114 Bacteria 21522
1498 Ga0501084_0015159 3300054114 Bacteria 6391
1499 Ga0501084_0017510 3300054114 Bacteria 5958
1500 Ga0501084_0021299 3300054114 Bacteria 5403
1501 Ga0501084_0035168 3300054114 Bacteria 4187
1502 Ga0501084_0043475 3300054114 Bacteria 3758
1503 Ga0501084_0072193 3300054114 Bacteria 2890
1504 Ga0501084_0075151 3300054114 Bacteria 2831
1505 Ga0501084_0085023 3300054114 Bacteria 2656
1506 Ga0501084_0150720 3300054114 Bacteria 1960
1507 Ga0501084_0255200 3300054114 Bacteria 1480
1508 Ga0501084_0366633 3300054114 Bacteria 1217
1509 Ga0501082_0000313 3300060353 Bacteria 43217
1510 Ga0501082_0001301 3300060353 Bacteria 21897
1511 Ga0501082_0001912 3300060353 Bacteria 18307
1512 Ga0501082_0008629 3300060353 Bacteria 8787
1513 Ga0501082_0011995 3300060353 Bacteria 7452
1514 Ga0501082_0017681 3300060353 Bacteria 6138
1515 Ga0501082_0021980 3300060353 Bacteria 5500
1516 Ga0501082_0074805 3300060353 Bacteria 2918
1517 Ga0501082_0086736 3300060353 Bacteria 2700
1518 Ga0501082_0093473 3300060353 Bacteria 2598
1519 Ga0501082_0153597 3300060353 Bacteria 2000
1520 Ga0501082_0238202 3300060353 Bacteria 1583
1521 Ga0466962_0000350 3300061719 Bacteria 19782
1522 Ga0466962_0040617 3300061719 Bacteria 2226
1523 Ga0530510_0000233 3300061734 Bacteria 34858
1524 Ga0530510_0001704 3300061734 Bacteria 14925
1525 Ga0530510_0004716 3300061734 Bacteria 9432
1526 Ga0530510_0016516 3300061734 Bacteria 5227
1527 Ga0530510_0017135 3300061734 Bacteria 5131
1528 Ga0530510_0027300 3300061734 Bacteria 4091
1529 Ga0530510_0029343 3300061734 Bacteria 3948
1530 Ga0530510_0032144 3300061734 Bacteria 3773
1531 Ga0530510_0040288 3300061734 Bacteria 3371
1532 Ga0530510_0122169 3300061734 Bacteria 1912
1533 Ga0530510_0140585 3300061734 Bacteria 1778
1534 Ga0530510_0156470 3300061734 Bacteria 1685
1535 Ga0530510_0215536 3300061734 Bacteria 1426

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0535696 Ga0395898_0535696_10_981 323
2 3300049585 Ga0501069_0144746 Ga0501069_0144746_346_1323 325
3 3300041459 Ga0451800_1208011 Ga0451800_1208011_18_1013 330
4 3300046678 Ga0495599_0081239 Ga0495599_0081239_22_1023 330
5 3300035120 Ga0373957_0047855 Ga0373957_0047855_71_1171 333
6 3300005563 Ga0068855_100247637 Ga0068855_1002476372 339
7 3300046689 Ga0495613_0260207 Ga0495613_0260207_113_1174 339
8 3300046500 Ga0495596_0109641 Ga0495596_0109641_25_1047 340
9 3300050510 nmdc:mga06r32_48476_c2 nmdc:mga06r32_48476_c2_15_1037 340
10 3300037466 Ga0395898_0021217 Ga0395898_0021217_1229_2293 341
11 3300038443 Ga0395901_0437092 Ga0395901_0437092_231_1295 342
12 3300048911 Ga0496108_0138613 Ga0496108_0138613_711_1745 342
13 3300005468 Ga0070707_100019072 Ga0070707_1000190721 343
14 3300049583 Ga0501067_0054901 Ga0501067_0054901_11_1048 343
15 3300050512 nmdc:mga0n895_23557_c1 nmdc:mga0n895_23557_c1_1068_2132 343
16 3300050515 nmdc:mga0a205_66304_c1 nmdc:mga0a205_66304_c1_2376_3440 343
17 3300005336 Ga0070680_100034210 Ga0070680_1000342102 344
18 3300005458 Ga0070681_10010037 Ga0070681_100100379 344
19 3300005530 Ga0070679_100015057 Ga0070679_1000150573 344
20 3300031247 Ga0265340_10012880 Ga0265340_100128802 344
21 3300031595 Ga0265313_10042532 Ga0265313_100425322 344
22 3300054114 Ga0501084_0015159 Ga0501084_0015159_26_1087 344
23 3300045976 Ga0466967_0052145 Ga0466967_0052145_220_1284 345
24 3300005435 Ga0070714_100002512 Ga0070714_1000025126 346
25 3300020070 Ga0206356_11289279 Ga0206356_112892792 347
26 3300025912 Ga0207707_10053890 Ga0207707_100538902 347
27 3300025914 Ga0207671_10121580 Ga0207671_101215802 347
28 3300025949 Ga0207667_10147190 Ga0207667_101471902 347
29 3300044694 Ga0466963_0195759 Ga0466963_0195759_38_1099 347
30 3300044735 Ga0466968_0001944 Ga0466968_0001944_649_1710 347
31 3300049575 Ga0501039_0150403 Ga0501039_0150403_698_1774 347
32 3300044656 Ga0466969_0081587 Ga0466969_0081587_383_1447 348
33 3300048907 Ga0496104_0405955 Ga0496104_0405955_196_1257 348
34 3300048915 Ga0496112_0391256 Ga0496112_0391256_103_1164 348
35 3300025885 Ga0207653_10004956 Ga0207653_100049563 350
36 3300047471 Ga0495684_0013297 Ga0495684_0013297_5257_6315 352
37 3300048903 Ga0496100_0033708 Ga0496100_0033708_1638_2696 352
38 3300050508 nmdc:mga09592_12059_c1 nmdc:mga09592_12059_c1_5957_7015 352
39 3300005329 Ga0070683_100013514 Ga0070683_1000135145 353
40 3300005356 Ga0070674_100110107 Ga0070674_1001101071 353
41 3300005439 Ga0070711_100059864 Ga0070711_1000598643 353
42 3300005536 Ga0070697_100103182 Ga0070697_1001031822 353
43 3300005577 Ga0068857_100428855 Ga0068857_1004288551 353
44 3300026089 Ga0207648_10048774 Ga0207648_100487742 353
45 3300026118 Ga0207675_100028132 Ga0207675_1000281322 353
46 3300031240 Ga0265320_10045294 Ga0265320_100452944 353
47 3300035088 Ga0373940_0019658 Ga0373940_0019658_17_1078 353
48 3300044694 Ga0466963_0037025 Ga0466963_0037025_2109_3170 353
49 3300046674 Ga0495588_0104500 Ga0495588_0104500_10_1071 353
50 3300047315 Ga0495581_0135942 Ga0495581_0135942_272_1333 353
51 3300047322 Ga0495680_0075211 Ga0495680_0075211_32_1093 353
52 3300048903 Ga0496100_0170551 Ga0496100_0170551_487_1548 353
53 3300048904 Ga0496101_0230121 Ga0496101_0230121_54_1115 353
54 3300048908 Ga0496105_0012111 Ga0496105_0012111_2998_4059 353
55 3300048908 Ga0496105_0024617 Ga0496105_0024617_2930_3991 353
56 3300048910 Ga0496107_0248793 Ga0496107_0248793_18_1079 353
57 3300048911 Ga0496108_0010475 Ga0496108_0010475_5205_6266 353
58 3300048911 Ga0496108_0299108 Ga0496108_0299108_22_1083 353
59 3300048912 Ga0496109_0028581 Ga0496109_0028581_11_1072 353
60 3300048912 Ga0496109_0036783 Ga0496109_0036783_3156_4217 353
61 3300048912 Ga0496109_0084006 Ga0496109_0084006_1101_2162 353
62 3300048913 Ga0496110_0174158 Ga0496110_0174158_13_1074 353
63 3300048914 Ga0496111_0006195 Ga0496111_0006195_6135_7196 353
64 3300048917 Ga0496114_0076397 Ga0496114_0076397_1015_2076 353
65 3300049575 Ga0501039_0184775 Ga0501039_0184775_17_1078 353
66 3300049576 Ga0501040_0069870 Ga0501040_0069870_1345_2406 353
67 3300049743 Ga0501081_0302428 Ga0501081_0302428_12_1073 353
68 3300050507 nmdc:mga05p37_566911_c1 nmdc:mga05p37_566911_c1_211_1272 353
69 3300054114 Ga0501084_0366633 Ga0501084_0366633_144_1205 353
70 3300005577 Ga0068857_100424746 Ga0068857_1004247461 354
71 3300006881 Ga0068865_100054596 Ga0068865_1000545962 354
72 3300025936 Ga0207670_10157496 Ga0207670_101574962 354
73 3300025937 Ga0207669_10066449 Ga0207669_100664492 354
74 3300025960 Ga0207651_10031507 Ga0207651_100315072 354
75 3300026075 Ga0207708_10175320 Ga0207708_101753202 354
76 3300046642 Ga0495634_0161419 Ga0495634_0161419_321_1385 354
77 3300048903 Ga0496100_0317160 Ga0496100_0317160_87_1151 354
78 3300048904 Ga0496101_0100857 Ga0496101_0100857_29_1093 354
79 3300048911 Ga0496108_0100119 Ga0496108_0100119_66_1130 354
80 3300048916 Ga0496113_0319766 Ga0496113_0319766_18_1082 354
81 3300049577 Ga0501041_0099808 Ga0501041_0099808_707_1771 354
82 3300049591 Ga0501075_0111065 Ga0501075_0111065_22_1092 355
83 3300005445 Ga0070708_100032256 Ga0070708_1000322562 356
84 3300005518 Ga0070699_100334413 Ga0070699_1003344131 356
85 3300025910 Ga0207684_10186572 Ga0207684_101865721 356
86 3300037466 Ga0395898_0110553 Ga0395898_0110553_1484_2605 356
87 3300041460 Ga0451802_1514280 Ga0451802_1514280_146_1219 356
88 3300048913 Ga0496110_0146314 Ga0496110_0146314_678_1790 356
89 3300005468 Ga0070707_100103090 Ga0070707_1001030902 358
90 3300005536 Ga0070697_100070750 Ga0070697_1000707502 358
91 3300005844 Ga0068862_100210953 Ga0068862_1002109532 358
92 3300013105 Ga0157369_10045301 Ga0157369_100453014 358
93 3300013308 Ga0157375_10014138 Ga0157375_100141383 358
94 3300025922 Ga0207646_10121244 Ga0207646_101212442 358
95 3300037418 Ga0395900_0418813 Ga0395900_0418813_18_1100 358
96 3300048912 Ga0496109_0019493 Ga0496109_0019493_4246_5325 358
97 3300049582 Ga0501048_0175130 Ga0501048_0175130_396_1475 358
98 3300005471 Ga0070698_100160468 Ga0070698_1001604682 359
99 3300005366 Ga0070659_100014781 Ga0070659_1000147813 361
100 3300006028 Ga0070717_10129800 Ga0070717_101298002 361
101 3300013307 Ga0157372_10037746 Ga0157372_100377463 361
102 3300046528 Ga0495642_0028737 Ga0495642_0028737_246_1382 361
103 3300046664 Ga0495659_0002324 Ga0495659_0002324_2000_3136 361
104 3300048909 Ga0496106_0182158 Ga0496106_0182158_463_1599 361
105 3300048913 Ga0496110_0160071 Ga0496110_0160071_92_1252 361
106 3300005471 Ga0070698_100148836 Ga0070698_1001488362 362
107 3300028800 Ga0265338_10025999 Ga0265338_100259994 362
108 3300031249 Ga0265339_10005030 Ga0265339_100050304 362
109 3300031711 Ga0265314_10010464 Ga0265314_100104641 362
110 3300032126 Ga0307415_100110299 Ga0307415_1001102992 362
111 3300005327 Ga0070658_10063791 Ga0070658_100637912 363
112 3300005337 Ga0070682_100029441 Ga0070682_1000294412 363
113 3300005339 Ga0070660_100120191 Ga0070660_1001201912 363
114 3300005344 Ga0070661_100004032 Ga0070661_1000040326 363
115 3300005530 Ga0070679_100092775 Ga0070679_1000927751 363
116 3300005539 Ga0068853_100087241 Ga0068853_1000872412 363
117 3300005548 Ga0070665_100037505 Ga0070665_1000375054 363
118 3300005577 Ga0068857_100026013 Ga0068857_1000260133 363
119 3300005614 Ga0068856_100028153 Ga0068856_1000281532 363
120 3300025922 Ga0207646_10095459 Ga0207646_100954592 363
121 3300038443 Ga0395901_0421977 Ga0395901_0421977_141_1292 363
122 3300048911 Ga0496108_0009755 Ga0496108_0009755_5819_6973 363
123 3300048912 Ga0496109_0087846 Ga0496109_0087846_883_2037 363
124 3300048913 Ga0496110_0280551 Ga0496110_0280551_136_1290 363
125 3300020070 Ga0206356_10687234 Ga0206356_106872342 364
126 3300025919 Ga0207657_10001075 Ga0207657_1000107517 364
127 3300025920 Ga0207649_10046594 Ga0207649_100465943 364
128 3300025921 Ga0207652_10124091 Ga0207652_101240911 364
129 3300025944 Ga0207661_10049624 Ga0207661_100496242 364
130 3300025949 Ga0207667_10068774 Ga0207667_100687741 364
131 3300005356 Ga0070674_100119927 Ga0070674_1001199272 365
132 3300037418 Ga0395900_0065948 Ga0395900_0065948_11_1108 365
133 3300044693 Ga0466961_0077466 Ga0466961_0077466_508_1641 365
134 3300044706 Ga0466964_0046013 Ga0466964_0046013_609_1745 365
135 3300046516 Ga0495628_0044004 Ga0495628_0044004_1986_3119 365
136 3300049586 Ga0501070_0065195 Ga0501070_0065195_16_1113 365
137 3300005338 Ga0068868_100075991 Ga0068868_1000759912 366
138 3300005435 Ga0070714_100019562 Ga0070714_1000195623 366
139 3300005436 Ga0070713_100012792 Ga0070713_1000127924 366
140 3300005614 Ga0068856_100038286 Ga0068856_1000382863 366
141 3300005937 Ga0081455_10009708 Ga0081455_100097086 366
142 3300025928 Ga0207700_10000006 Ga0207700_10000006150 366
143 3300025939 Ga0207665_10022414 Ga0207665_100224143 366
144 3300026078 Ga0207702_10002546 Ga0207702_100025468 366
145 3300026121 Ga0207683_10450167 Ga0207683_104501671 366
146 3300028800 Ga0265338_10127004 Ga0265338_101270042 366
147 3300037312 Ga0395899_0003201 Ga0395899_0003201_8735_9868 366
148 3300037418 Ga0395900_0024441 Ga0395900_0024441_3865_4998 366
149 3300037466 Ga0395898_0020113 Ga0395898_0020113_4746_5879 366
150 3300037471 Ga0395905_0012900 Ga0395905_0012900_6432_7565 366
151 3300037471 Ga0395905_0236738 Ga0395905_0236738_380_1531 366
152 3300038443 Ga0395901_0081563 Ga0395901_0081563_1335_2468 366
153 3300038443 Ga0395901_0093107 Ga0395901_0093107_174_1325 366
154 3300045051 Ga0451576_0007984 Ga0451576_0007984_3435_4535 366
155 3300046462 Ga0495651_0101882 Ga0495651_0101882_39_1175 366
156 3300046675 Ga0495657_0080312 Ga0495657_0080312_868_2004 366
157 3300049581 Ga0501047_0006299 Ga0501047_0006299_4610_5725 366
158 3300049586 Ga0501070_0164183 Ga0501070_0164183_612_1727 366
159 3300049589 Ga0501073_0222466 Ga0501073_0222466_56_1171 366
160 3300049590 Ga0501074_0146332 Ga0501074_0146332_187_1302 366
161 3300005327 Ga0070658_10008374 Ga0070658_100083749 367
162 3300005339 Ga0070660_100016342 Ga0070660_1000163424 367
163 3300005339 Ga0070660_100034825 Ga0070660_1000348252 367
164 3300005366 Ga0070659_100110972 Ga0070659_1001109722 367
165 3300005366 Ga0070659_100164150 Ga0070659_1001641501 367
166 3300005440 Ga0070705_100055792 Ga0070705_1000557921 367
167 3300005458 Ga0070681_10018429 Ga0070681_100184293 367
168 3300005530 Ga0070679_100028843 Ga0070679_1000288437 367
169 3300005530 Ga0070679_100034518 Ga0070679_1000345182 367
170 3300005535 Ga0070684_100043400 Ga0070684_1000434002 367
171 3300005548 Ga0070665_100027593 Ga0070665_1000275937 367
172 3300005563 Ga0068855_100031262 Ga0068855_1000312622 367
173 3300005563 Ga0068855_100034552 Ga0068855_1000345522 367
174 3300005615 Ga0070702_100074664 Ga0070702_1000746642 367
175 3300005844 Ga0068862_100304245 Ga0068862_1003042452 367
176 3300006852 Ga0075433_10038908 Ga0075433_100389084 367
177 3300006871 Ga0075434_100010946 Ga0075434_1000109465 367
178 3300007076 Ga0075435_100003008 Ga0075435_1000030086 367
179 3300010375 Ga0105239_10323084 Ga0105239_103230842 367
180 3300013105 Ga0157369_10001856 Ga0157369_100018569 367
181 3300025908 Ga0207643_10011653 Ga0207643_100116535 367
182 3300025915 Ga0207693_10071113 Ga0207693_100711132 367
183 3300028379 Ga0268266_10043075 Ga0268266_100430753 367
184 3300037471 Ga0395905_0012928 Ga0395905_0012928_2906_4060 367
185 3300038443 Ga0395901_0015974 Ga0395901_0015974_3033_4187 367
186 3300049583 Ga0501067_0000352 Ga0501067_0000352_22719_23828 367
187 3300049584 Ga0501068_0000135 Ga0501068_0000135_621_1730 367
188 3300049585 Ga0501069_0000129 Ga0501069_0000129_4362_5471 367
189 3300049585 Ga0501069_0100757 Ga0501069_0100757_101_1210 367
190 3300061734 Ga0530510_0001704 Ga0530510_0001704_3688_4797 367
191 3300005327 Ga0070658_10174988 Ga0070658_101749882 368
192 3300005329 Ga0070683_100107444 Ga0070683_1001074442 368
193 3300005339 Ga0070660_100057218 Ga0070660_1000572182 368
194 3300005355 Ga0070671_100142998 Ga0070671_1001429982 368
195 3300005468 Ga0070707_100225025 Ga0070707_1002250251 368
196 3300005471 Ga0070698_100082288 Ga0070698_1000822883 368
197 3300005530 Ga0070679_100091056 Ga0070679_1000910562 368
198 3300005563 Ga0068855_100025372 Ga0068855_1000253725 368
199 3300005614 Ga0068856_100220331 Ga0068856_1002203312 368
200 3300005614 Ga0068856_100314880 Ga0068856_1003148802 368
201 3300005616 Ga0068852_100013243 Ga0068852_1000132438 368
202 3300009093 Ga0105240_10066947 Ga0105240_100669474 368
203 3300013104 Ga0157370_10019560 Ga0157370_100195607 368
204 3300013296 Ga0157374_10116856 Ga0157374_101168562 368
205 3300013307 Ga0157372_10033081 Ga0157372_100330814 368
206 3300013307 Ga0157372_10103331 Ga0157372_101033312 368
207 3300020070 Ga0206356_11871523 Ga0206356_118715233 368
208 3300020082 Ga0206353_10786943 Ga0206353_107869431 368
209 3300025909 Ga0207705_10010703 Ga0207705_100107035 368
210 3300025912 Ga0207707_10024033 Ga0207707_100240336 368
211 3300025919 Ga0207657_10000054 Ga0207657_1000005458 368
212 3300025919 Ga0207657_10004160 Ga0207657_100041606 368
213 3300025921 Ga0207652_10215052 Ga0207652_102150522 368
214 3300025932 Ga0207690_10025866 Ga0207690_100258662 368
215 3300025932 Ga0207690_10084791 Ga0207690_100847912 368
216 3300025949 Ga0207667_10023730 Ga0207667_100237303 368
217 3300026116 Ga0207674_10246999 Ga0207674_102469992 368
218 3300037312 Ga0395899_0089553 Ga0395899_0089553_736_1869 368
219 3300037418 Ga0395900_0038069 Ga0395900_0038069_3528_4664 368
220 3300037418 Ga0395900_0216590 Ga0395900_0216590_83_1216 368
221 3300037466 Ga0395898_0004411 Ga0395898_0004411_2585_3721 368
222 3300037466 Ga0395898_0112757 Ga0395898_0112757_574_1707 368
223 3300037471 Ga0395905_0021022 Ga0395905_0021022_2946_4082 368
224 3300038443 Ga0395901_0025056 Ga0395901_0025056_2341_3477 368
225 3300038443 Ga0395901_0127921 Ga0395901_0127921_413_1546 368
226 3300038443 Ga0395901_0318376 Ga0395901_0318376_154_1308 368
227 3300044693 Ga0466961_0016450 Ga0466961_0016450_3497_4630 368
228 3300044694 Ga0466963_0009072 Ga0466963_0009072_4722_5855 368
229 3300044719 Ga0466971_0000146 Ga0466971_0000146_1589_2722 368
230 3300044842 Ga0466957_0003727 Ga0466957_0003727_5294_6427 368
231 3300045051 Ga0451576_0174240 Ga0451576_0174240_251_1384 368
232 3300045836 Ga0466958_0000726 Ga0466958_0000726_8468_9601 368
233 3300045976 Ga0466967_0198384 Ga0466967_0198384_651_1784 368
234 3300048917 Ga0496114_0006596 Ga0496114_0006596_6326_7459 368
235 3300048918 Ga0496115_0001178 Ga0496115_0001178_8366_9499 368
236 3300049586 Ga0501070_0017999 Ga0501070_0017999_2767_3900 368
237 3300049588 Ga0501072_0011062 Ga0501072_0011062_524_1657 368
238 3300049741 Ga0501079_0025440 Ga0501079_0025440_381_1514 368
239 3300049742 Ga0501080_0077486 Ga0501080_0077486_1601_2734 368
240 3300049744 Ga0501083_0000131 Ga0501083_0000131_22115_23248 368
241 3300061719 Ga0466962_0000350 Ga0466962_0000350_7062_8195 368
242 3300003373 JGI25407J50210_10030306 JGI25407J50210_100303062 369
243 3300006028 Ga0070717_10019235 Ga0070717_100192353 369
244 3300006844 Ga0075428_100043602 Ga0075428_1000436023 369
245 3300006846 Ga0075430_100077846 Ga0075430_1000778462 369
246 3300006847 Ga0075431_100127379 Ga0075431_1001273791 369
247 3300006880 Ga0075429_100036216 Ga0075429_1000362164 369
248 3300037312 Ga0395899_0017276 Ga0395899_0017276_1667_2779 369
249 3300037418 Ga0395900_0003566 Ga0395900_0003566_4251_5363 369
250 3300037466 Ga0395898_0003782 Ga0395898_0003782_2974_4086 369
251 3300037471 Ga0395905_0008109 Ga0395905_0008109_4251_5363 369
252 3300038443 Ga0395901_0005629 Ga0395901_0005629_4423_5535 369
253 3300044684 Ga0466966_0011939 Ga0466966_0011939_2641_3774 369
254 3300044694 Ga0466963_0102454 Ga0466963_0102454_386_1519 369
255 3300045049 Ga0466959_0018823 Ga0466959_0018823_1767_2900 369
256 3300046461 Ga0495641_0082666 Ga0495641_0082666_174_1283 369
257 3300046536 Ga0495587_0078189 Ga0495587_0078189_449_1564 369
258 3300048903 Ga0496100_0004620 Ga0496100_0004620_2786_3919 369
259 3300048904 Ga0496101_0002185 Ga0496101_0002185_5734_6867 369
260 3300048905 Ga0496102_0005424 Ga0496102_0005424_1179_2312 369
261 3300048906 Ga0496103_0009928 Ga0496103_0009928_2128_3261 369
262 3300048907 Ga0496104_0038659 Ga0496104_0038659_1286_2419 369
263 3300048908 Ga0496105_0000923 Ga0496105_0000923_8922_10055 369
264 3300048909 Ga0496106_0017179 Ga0496106_0017179_1054_2187 369
265 3300048910 Ga0496107_0009010 Ga0496107_0009010_4899_6032 369
266 3300048911 Ga0496108_0001935 Ga0496108_0001935_11751_12884 369
267 3300048912 Ga0496109_0015633 Ga0496109_0015633_1955_3088 369
268 3300048913 Ga0496110_0005340 Ga0496110_0005340_8320_9453 369
269 3300048914 Ga0496111_0007275 Ga0496111_0007275_2623_3756 369
270 3300049583 Ga0501067_0043082 Ga0501067_0043082_1054_2163 369
271 3300049592 Ga0501076_0245939 Ga0501076_0245939_233_1342 369
272 3300049743 Ga0501081_0018968 Ga0501081_0018968_1973_3082 369
273 3300005435 Ga0070714_100226034 Ga0070714_1002260342 370
274 3300005535 Ga0070684_100176895 Ga0070684_1001768952 370
275 3300005535 Ga0070684_100181789 Ga0070684_1001817892 370
276 3300005546 Ga0070696_100108198 Ga0070696_1001081981 370
277 3300005614 Ga0068856_100329102 Ga0068856_1003291022 370
278 3300006871 Ga0075434_100004986 Ga0075434_10000498616 370
279 3300006914 Ga0075436_100007157 Ga0075436_1000071573 370
280 3300007076 Ga0075435_100097869 Ga0075435_1000978692 370
281 3300009098 Ga0105245_10125892 Ga0105245_101258922 370
282 3300009147 Ga0114129_10235098 Ga0114129_102350982 370
283 3300009545 Ga0105237_10105717 Ga0105237_101057174 370
284 3300013105 Ga0157369_10406303 Ga0157369_104063032 370
285 3300014745 Ga0157377_10111342 Ga0157377_101113422 370
286 3300020069 Ga0197907_10426209 Ga0197907_104262092 370
287 3300020069 Ga0197907_10788432 Ga0197907_107884321 370
288 3300025906 Ga0207699_10076297 Ga0207699_100762972 370
289 3300025927 Ga0207687_10053413 Ga0207687_100534133 370
290 3300025944 Ga0207661_10291437 Ga0207661_102914372 370
291 3300025949 Ga0207667_10189386 Ga0207667_101893862 370
292 3300026023 Ga0207677_10116531 Ga0207677_101165312 370
293 3300026078 Ga0207702_10055844 Ga0207702_100558441 370
294 3300035089 Ga0373944_0032803 Ga0373944_0032803_110_1243 370
295 3300035113 Ga0373936_0003678 Ga0373936_0003678_829_1962 370
296 3300035120 Ga0373957_0013834 Ga0373957_0013834_1570_2703 370
297 3300035725 Ga0373947_0012420 Ga0373947_0012420_2971_4104 370
298 3300037068 Ga0373925_0010642 Ga0373925_0010642_3951_5084 370
299 3300037418 Ga0395900_0036318 Ga0395900_0036318_2128_3261 370
300 3300038443 Ga0395901_0037992 Ga0395901_0037992_2100_3233 370
301 3300044842 Ga0466957_0004490 Ga0466957_0004490_4438_5571 370
302 3300045976 Ga0466967_0003528 Ga0466967_0003528_3049_4182 370
303 3300045976 Ga0466967_0046284 Ga0466967_0046284_472_1605 370
304 3300045976 Ga0466967_0054671 Ga0466967_0054671_2023_3156 370
305 3300046463 Ga0495653_0052187 Ga0495653_0052187_22_1155 370
306 3300046514 Ga0495618_0113942 Ga0495618_0113942_521_1654 370
307 3300046517 Ga0495630_0070119 Ga0495630_0070119_1010_2143 370
308 3300046529 Ga0495652_0134750 Ga0495652_0134750_753_1886 370
309 3300046675 Ga0495657_0044234 Ga0495657_0044234_1177_2310 370
310 3300046679 Ga0495623_0072202 Ga0495623_0072202_697_1830 370
311 3300046689 Ga0495613_0153233 Ga0495613_0153233_380_1513 370
312 3300047317 Ga0495604_0166927 Ga0495604_0166927_335_1468 370
313 3300047321 Ga0495676_0124287 Ga0495676_0124287_520_1653 370
314 3300048903 Ga0496100_0038685 Ga0496100_0038685_1258_2376 370
315 3300048905 Ga0496102_0200405 Ga0496102_0200405_707_1825 370
316 3300048907 Ga0496104_0143878 Ga0496104_0143878_940_2058 370
317 3300048907 Ga0496104_0202102 Ga0496104_0202102_261_1379 370
318 3300048908 Ga0496105_0086583 Ga0496105_0086583_1455_2573 370
319 3300048909 Ga0496106_0019785 Ga0496106_0019785_1745_2863 370
320 3300048910 Ga0496107_0039021 Ga0496107_0039021_2154_3266 370
321 3300048911 Ga0496108_0003193 Ga0496108_0003193_3788_4906 370
322 3300048911 Ga0496108_0165304 Ga0496108_0165304_642_1754 370
323 3300048912 Ga0496109_0170686 Ga0496109_0170686_674_1792 370
324 3300048915 Ga0496112_0075631 Ga0496112_0075631_509_1627 370
325 3300048917 Ga0496114_0014544 Ga0496114_0014544_1377_2489 370
326 3300048917 Ga0496114_0042837 Ga0496114_0042837_2402_3520 370
327 3300048917 Ga0496114_0319707 Ga0496114_0319707_235_1353 370
328 3300048918 Ga0496115_0022164 Ga0496115_0022164_3600_4718 370
329 3300049583 Ga0501067_0001847 Ga0501067_0001847_1586_2704 370
330 3300049585 Ga0501069_0072604 Ga0501069_0072604_125_1243 370
331 3300049586 Ga0501070_0017683 Ga0501070_0017683_1266_2399 370
332 3300049590 Ga0501074_0035843 Ga0501074_0035843_989_2122 370
333 3300049593 Ga0501077_0063205 Ga0501077_0063205_435_1547 370
334 3300049741 Ga0501079_0122299 Ga0501079_0122299_789_1901 370
335 3300049743 Ga0501081_0047958 Ga0501081_0047958_1665_2777 370
336 3300050507 nmdc:mga05p37_247601_c1 nmdc:mga05p37_247601_c1_125_1258 370
337 3300050512 nmdc:mga0n895_1290_c1 nmdc:mga0n895_1290_c1_12221_13339 370
338 3300050513 nmdc:mga0rr50_10266_c1 nmdc:mga0rr50_10266_c1_2119_3237 370
339 3300050514 nmdc:mga08x19_2697_c1 nmdc:mga08x19_2697_c1_812_1930 370
340 3300053078 Ga0495612_0047681 Ga0495612_0047681_95_1228 370
341 3300053084 Ga0495595_0029914 Ga0495595_0029914_1019_2152 370
342 3300054114 Ga0501084_0075151 Ga0501084_0075151_480_1592 370
343 3300060353 Ga0501082_0086736 Ga0501082_0086736_1470_2582 370
344 3300005441 Ga0070700_100042476 Ga0070700_1000424761 371
345 3300005535 Ga0070684_100021719 Ga0070684_1000217195 371
346 3300005616 Ga0068852_100150187 Ga0068852_1001501873 371
347 3300009093 Ga0105240_10010170 Ga0105240_100101707 371
348 3300010375 Ga0105239_10364720 Ga0105239_103647203 371
349 3300013307 Ga0157372_10227424 Ga0157372_102274242 371
350 3300020082 Ga0206353_11861470 Ga0206353_118614705 371
351 3300025919 Ga0207657_10096336 Ga0207657_100963362 371
352 3300025921 Ga0207652_10112513 Ga0207652_101125132 371
353 3300025932 Ga0207690_10123944 Ga0207690_101239442 371
354 3300025935 Ga0207709_10141932 Ga0207709_101419322 371
355 3300025949 Ga0207667_10254510 Ga0207667_102545102 371
356 3300026142 Ga0207698_10018909 Ga0207698_100189093 371
357 3300026142 Ga0207698_10192534 Ga0207698_101925342 371
358 3300031235 Ga0265330_10009251 Ga0265330_100092511 371
359 3300031241 Ga0265325_10004773 Ga0265325_100047733 371
360 3300031242 Ga0265329_10016061 Ga0265329_100160612 371
361 3300031251 Ga0265327_10020600 Ga0265327_100206002 371
362 3300031344 Ga0265316_10025460 Ga0265316_100254604 371
363 3300031711 Ga0265314_10002229 Ga0265314_1000222915 371
364 3300037466 Ga0395898_0226508 Ga0395898_0226508_106_1239 371
365 3300037471 Ga0395905_0057564 Ga0395905_0057564_74_1228 371
366 3300038443 Ga0395901_0031270 Ga0395901_0031270_3183_4337 371
367 3300044694 Ga0466963_0014868 Ga0466963_0014868_2993_4126 371
368 3300045976 Ga0466967_0022829 Ga0466967_0022829_1639_2772 371
369 3300049568 Ga0501031_0090482 Ga0501031_0090482_837_1985 371
370 3300049576 Ga0501040_0029548 Ga0501040_0029548_2294_3442 371
371 3300049583 Ga0501067_0000684 Ga0501067_0000684_1095_2228 371
372 3300049585 Ga0501069_0000690 Ga0501069_0000690_2458_3591 371
373 3300049592 Ga0501076_0020365 Ga0501076_0020365_1119_2267 371
374 3300061734 Ga0530510_0029343 Ga0530510_0029343_1489_2622 371
375 3300025919 Ga0207657_10021338 Ga0207657_100213386 372
376 3300035119 Ga0373956_0052989 Ga0373956_0052989_392_1522 372
377 3300046463 Ga0495653_0015246 Ga0495653_0015246_3159_4292 372
378 3300046514 Ga0495618_0052913 Ga0495618_0052913_890_2023 372
379 3300046517 Ga0495630_0004222 Ga0495630_0004222_7377_8510 372
380 3300046533 Ga0495640_0007331 Ga0495640_0007331_6201_7334 372
381 3300046559 Ga0495667_0020399 Ga0495667_0020399_2250_3383 372
382 3300047319 Ga0495674_0001135 Ga0495674_0001135_15658_16791 372
383 3300047322 Ga0495680_0004067 Ga0495680_0004067_9470_10603 372
384 3300047471 Ga0495684_0285437 Ga0495684_0285437_42_1175 372
385 3300048905 Ga0496102_0275789 Ga0496102_0275789_412_1548 372
386 3300048915 Ga0496112_0005626 Ga0496112_0005626_7887_9020 372
387 3300048915 Ga0496112_0014515 Ga0496112_0014515_4241_5374 372
388 3300048915 Ga0496112_0064112 Ga0496112_0064112_2330_3463 372
389 3300005329 Ga0070683_100144163 Ga0070683_1001441632 373
390 3300025935 Ga0207709_10030118 Ga0207709_100301182 373
391 3300025938 Ga0207704_10113107 Ga0207704_101131071 373
392 3300025940 Ga0207691_10031631 Ga0207691_100316313 373
393 3300026121 Ga0207683_10169349 Ga0207683_101693491 373
394 3300031548 Ga0307408_100177398 Ga0307408_1001773982 373
395 3300005468 Ga0070707_100023609 Ga0070707_1000236093 374
396 3300025922 Ga0207646_10039846 Ga0207646_100398465 374
397 3300049574 Ga0501038_0255645 Ga0501038_0255645_13_1137 374
398 3300049576 Ga0501040_0048145 Ga0501040_0048145_1173_2297 374
399 3300049588 Ga0501072_0111062 Ga0501072_0111062_87_1211 374
400 3300049590 Ga0501074_0253926 Ga0501074_0253926_31_1155 374
401 3300049741 Ga0501079_0088112 Ga0501079_0088112_798_1922 374
402 3300049744 Ga0501083_0169664 Ga0501083_0169664_16_1140 374
403 3300060353 Ga0501082_0074805 Ga0501082_0074805_1638_2762 374
404 3300005981 Ga0081538_10003973 Ga0081538_100039736 375
405 3300005981 Ga0081538_10039146 Ga0081538_100391462 375
406 3300049592 Ga0501076_0229032 Ga0501076_0229032_178_1305 375
407 3300049743 Ga0501081_0082561 Ga0501081_0082561_1034_2161 375
408 3300049824 Ga0501045_0046189 Ga0501045_0046189_1005_2132 375
409 3300005334 Ga0068869_100072068 Ga0068869_1000720682 376
410 3300005340 Ga0070689_100074746 Ga0070689_1000747462 376
411 3300005535 Ga0070684_100085062 Ga0070684_1000850622 376
412 3300005546 Ga0070696_100115298 Ga0070696_1001152982 376
413 3300005577 Ga0068857_100004499 Ga0068857_10000449913 376
414 3300005844 Ga0068862_100199902 Ga0068862_1001999022 376
415 3300005937 Ga0081455_10030676 Ga0081455_100306763 376
416 3300005937 Ga0081455_10035488 Ga0081455_100354883 376
417 3300005937 Ga0081455_10037546 Ga0081455_100375464 376
418 3300005937 Ga0081455_10058850 Ga0081455_100588501 376
419 3300005937 Ga0081455_10067130 Ga0081455_100671302 376
420 3300005981 Ga0081538_10000136 Ga0081538_1000013670 376
421 3300005981 Ga0081538_10002521 Ga0081538_1000252115 376
422 3300005981 Ga0081538_10013477 Ga0081538_100134773 376
423 3300005981 Ga0081538_10016315 Ga0081538_100163154 376
424 3300005981 Ga0081538_10020317 Ga0081538_100203175 376
425 3300005981 Ga0081538_10022124 Ga0081538_100221242 376
426 3300005985 Ga0081539_10000041 Ga0081539_1000004192 376
427 3300005985 Ga0081539_10010651 Ga0081539_100106514 376
428 3300009094 Ga0111539_10004030 Ga0111539_1000403011 376
429 3300009094 Ga0111539_10006384 Ga0111539_100063845 376
430 3300009098 Ga0105245_10029132 Ga0105245_100291325 376
431 3300009098 Ga0105245_10379434 Ga0105245_103794342 376
432 3300009147 Ga0114129_10022016 Ga0114129_1002201610 376
433 3300009148 Ga0105243_10114278 Ga0105243_101142782 376
434 3300010375 Ga0105239_10322669 Ga0105239_103226692 376
435 3300013306 Ga0163162_10253607 Ga0163162_102536072 376
436 3300014325 Ga0163163_10373654 Ga0163163_103736542 376
437 3300014968 Ga0157379_10131858 Ga0157379_101318582 376
438 3300025914 Ga0207671_10244520 Ga0207671_102445202 376
439 3300025916 Ga0207663_10094116 Ga0207663_100941162 376
440 3300025927 Ga0207687_10030978 Ga0207687_100309783 376
441 3300025933 Ga0207706_10038957 Ga0207706_100389572 376
442 3300025942 Ga0207689_10023381 Ga0207689_100233812 376
443 3300025945 Ga0207679_10080517 Ga0207679_100805172 376
444 3300026035 Ga0207703_10120822 Ga0207703_101208222 376
445 3300026067 Ga0207678_10094919 Ga0207678_100949192 376
446 3300026116 Ga0207674_10002093 Ga0207674_1000209313 376
447 3300026121 Ga0207683_10059011 Ga0207683_100590112 376
448 3300026142 Ga0207698_10074175 Ga0207698_100741752 376
449 3300027907 Ga0207428_10009137 Ga0207428_100091374 376
450 3300027907 Ga0207428_10020562 Ga0207428_100205624 376
451 3300031548 Ga0307408_100043242 Ga0307408_1000432423 376
452 3300031548 Ga0307408_100120716 Ga0307408_1001207162 376
453 3300031852 Ga0307410_10012458 Ga0307410_100124584 376
454 3300031852 Ga0307410_10043000 Ga0307410_100430002 376
455 3300031903 Ga0307407_10001948 Ga0307407_100019484 376
456 3300031911 Ga0307412_10071746 Ga0307412_100717462 376
457 3300032002 Ga0307416_100042125 Ga0307416_1000421253 376
458 3300032002 Ga0307416_100108480 Ga0307416_1001084802 376
459 3300032002 Ga0307416_100152023 Ga0307416_1001520232 376
460 3300032005 Ga0307411_10036119 Ga0307411_100361192 376
461 3300032126 Ga0307415_100000048 Ga0307415_1000000487 376
462 3300035170 Ga0373943_0003688 Ga0373943_0003688_242_1372 376
463 3300035692 Ga0373935_0051007 Ga0373935_0051007_55_1185 376
464 3300035695 Ga0373927_0011854 Ga0373927_0011854_1278_2408 376
465 3300035725 Ga0373947_0002320 Ga0373947_0002320_6805_7935 376
466 3300037068 Ga0373925_0011812 Ga0373925_0011812_460_1590 376
467 3300037312 Ga0395899_0001267 Ga0395899_0001267_4659_5789 376
468 3300037312 Ga0395899_0007849 Ga0395899_0007849_6112_7242 376
469 3300037418 Ga0395900_0119351 Ga0395900_0119351_253_1383 376
470 3300037466 Ga0395898_0001276 Ga0395898_0001276_14580_15710 376
471 3300037466 Ga0395898_0027338 Ga0395898_0027338_4029_5159 376
472 3300037466 Ga0395898_0058643 Ga0395898_0058643_820_1950 376
473 3300037466 Ga0395898_0434466 Ga0395898_0434466_55_1185 376
474 3300037471 Ga0395905_0001281 Ga0395905_0001281_16919_18049 376
475 3300037471 Ga0395905_0018402 Ga0395905_0018402_4060_5190 376
476 3300038443 Ga0395901_0001957 Ga0395901_0001957_4499_5629 376
477 3300038443 Ga0395901_0067776 Ga0395901_0067776_683_1813 376
478 3300038443 Ga0395901_0171590 Ga0395901_0171590_497_1627 376
479 3300045051 Ga0451576_0152926 Ga0451576_0152926_1185_2315 376
480 3300046455 Ga0495603_0041286 Ga0495603_0041286_1104_2234 376
481 3300046459 Ga0495629_0000667 Ga0495629_0000667_12652_13782 376
482 3300046461 Ga0495641_0003180 Ga0495641_0003180_2173_3303 376
483 3300046462 Ga0495651_0121198 Ga0495651_0121198_147_1277 376
484 3300046473 Ga0495582_0000092 Ga0495582_0000092_33054_34184 376
485 3300046474 Ga0495605_0068941 Ga0495605_0068941_384_1514 376
486 3300046475 Ga0495639_0002676 Ga0495639_0002676_345_1475 376
487 3300046477 Ga0495664_0208241 Ga0495664_0208241_15_1145 376
488 3300046499 Ga0495594_0074781 Ga0495594_0074781_409_1539 376
489 3300046517 Ga0495630_0001255 Ga0495630_0001255_8414_9544 376
490 3300046517 Ga0495630_0096549 Ga0495630_0096549_758_1888 376
491 3300046529 Ga0495652_0274772 Ga0495652_0274772_43_1173 376
492 3300046531 Ga0495665_0000240 Ga0495665_0000240_23640_24770 376
493 3300046543 Ga0495645_0249933 Ga0495645_0249933_13_1143 376
494 3300046642 Ga0495634_0186407 Ga0495634_0186407_39_1169 376
495 3300046663 Ga0495635_0012488 Ga0495635_0012488_4289_5419 376
496 3300046675 Ga0495657_0206866 Ga0495657_0206866_21_1151 376
497 3300046683 Ga0495658_0015686 Ga0495658_0015686_699_1829 376
498 3300046690 Ga0495624_0006810 Ga0495624_0006810_4391_5521 376
499 3300046691 Ga0495670_0076775 Ga0495670_0076775_555_1685 376
500 3300046794 Ga0495589_0119307 Ga0495589_0119307_101_1231 376
501 3300047315 Ga0495581_0000519 Ga0495581_0000519_10900_12030 376
502 3300047317 Ga0495604_0052583 Ga0495604_0052583_523_1653 376
503 3300047318 Ga0495636_0052003 Ga0495636_0052003_507_1637 376
504 3300047319 Ga0495674_0217738 Ga0495674_0217738_321_1451 376
505 3300047321 Ga0495676_0000654 Ga0495676_0000654_9370_10500 376
506 3300048089 Ga0495614_0028987 Ga0495614_0028987_128_1258 376
507 3300048904 Ga0496101_0024288 Ga0496101_0024288_2594_3724 376
508 3300048904 Ga0496101_0070017 Ga0496101_0070017_825_1955 376
509 3300048905 Ga0496102_0028791 Ga0496102_0028791_3506_4636 376
510 3300048909 Ga0496106_0029410 Ga0496106_0029410_89_1219 376
511 3300048909 Ga0496106_0302961 Ga0496106_0302961_112_1242 376
512 3300048912 Ga0496109_0000991 Ga0496109_0000991_21413_22543 376
513 3300048913 Ga0496110_0001407 Ga0496110_0001407_9901_11031 376
514 3300048914 Ga0496111_0000429 Ga0496111_0000429_16592_17722 376
515 3300048917 Ga0496114_0030722 Ga0496114_0030722_2611_3741 376
516 3300048918 Ga0496115_0025146 Ga0496115_0025146_3373_4503 376
517 3300048918 Ga0496115_0142314 Ga0496115_0142314_753_1883 376
518 3300049568 Ga0501031_0001099 Ga0501031_0001099_11640_12770 376
519 3300049568 Ga0501031_0004912 Ga0501031_0004912_1686_2816 376
520 3300049568 Ga0501031_0006562 Ga0501031_0006562_3766_4896 376
521 3300049569 Ga0501032_0002668 Ga0501032_0002668_5799_6929 376
522 3300049569 Ga0501032_0086959 Ga0501032_0086959_202_1332 376
523 3300049570 Ga0501033_0001359 Ga0501033_0001359_2777_3907 376
524 3300049570 Ga0501033_0009471 Ga0501033_0009471_6275_7405 376
525 3300049571 Ga0501034_0007242 Ga0501034_0007242_1775_2905 376
526 3300049571 Ga0501034_0187831 Ga0501034_0187831_195_1325 376
527 3300049572 Ga0501036_0000470 Ga0501036_0000470_23939_25069 376
528 3300049572 Ga0501036_0007319 Ga0501036_0007319_3592_4722 376
529 3300049572 Ga0501036_0092830 Ga0501036_0092830_280_1410 376
530 3300049572 Ga0501036_0098519 Ga0501036_0098519_874_2004 376
531 3300049573 Ga0501037_0000275 Ga0501037_0000275_3287_4417 376
532 3300049573 Ga0501037_0031646 Ga0501037_0031646_1002_2132 376
533 3300049574 Ga0501038_0000548 Ga0501038_0000548_11670_12800 376
534 3300049574 Ga0501038_0016668 Ga0501038_0016668_209_1339 376
535 3300049574 Ga0501038_0071711 Ga0501038_0071711_33_1163 376
536 3300049575 Ga0501039_0000176 Ga0501039_0000176_20937_22067 376
537 3300049575 Ga0501039_0004489 Ga0501039_0004489_3986_5116 376
538 3300049575 Ga0501039_0028627 Ga0501039_0028627_2482_3612 376
539 3300049575 Ga0501039_0220123 Ga0501039_0220123_255_1385 376
540 3300049576 Ga0501040_0000992 Ga0501040_0000992_12832_13962 376
541 3300049576 Ga0501040_0009765 Ga0501040_0009765_4536_5666 376
542 3300049576 Ga0501040_0069460 Ga0501040_0069460_372_1502 376
543 3300049577 Ga0501041_0004037 Ga0501041_0004037_1541_2671 376
544 3300049577 Ga0501041_0009588 Ga0501041_0009588_3805_4935 376
545 3300049577 Ga0501041_0011138 Ga0501041_0011138_3986_5116 376
546 3300049577 Ga0501041_0123910 Ga0501041_0123910_175_1305 376
547 3300049578 Ga0501042_0000092 Ga0501042_0000092_22366_23496 376
548 3300049578 Ga0501042_0000116 Ga0501042_0000116_28756_29886 376
549 3300049578 Ga0501042_0003743 Ga0501042_0003743_4914_6044 376
550 3300049578 Ga0501042_0104594 Ga0501042_0104594_831_1961 376
551 3300049579 Ga0501043_0000891 Ga0501043_0000891_4520_5650 376
552 3300049579 Ga0501043_0008387 Ga0501043_0008387_3719_4849 376
553 3300049580 Ga0501046_0002474 Ga0501046_0002474_4520_5650 376
554 3300049580 Ga0501046_0007575 Ga0501046_0007575_3775_4905 376
555 3300049580 Ga0501046_0024547 Ga0501046_0024547_280_1410 376
556 3300049581 Ga0501047_0001408 Ga0501047_0001408_16539_17669 376
557 3300049581 Ga0501047_0001498 Ga0501047_0001498_3716_4846 376
558 3300049582 Ga0501048_0001223 Ga0501048_0001223_5831_6961 376
559 3300049582 Ga0501048_0002836 Ga0501048_0002836_8119_9249 376
560 3300049582 Ga0501048_0004195 Ga0501048_0004195_6129_7259 376
561 3300049582 Ga0501048_0133044 Ga0501048_0133044_518_1648 376
562 3300049582 Ga0501048_0176845 Ga0501048_0176845_168_1298 376
563 3300049583 Ga0501067_0021119 Ga0501067_0021119_1412_2542 376
564 3300049583 Ga0501067_0027764 Ga0501067_0027764_902_2032 376
565 3300049584 Ga0501068_0000554 Ga0501068_0000554_5821_6951 376
566 3300049584 Ga0501068_0013671 Ga0501068_0013671_1718_2848 376
567 3300049584 Ga0501068_0025466 Ga0501068_0025466_2016_3146 376
568 3300049585 Ga0501069_0007796 Ga0501069_0007796_1814_2944 376
569 3300049585 Ga0501069_0057883 Ga0501069_0057883_837_1967 376
570 3300049586 Ga0501070_0007370 Ga0501070_0007370_2409_3539 376
571 3300049587 Ga0501071_0017987 Ga0501071_0017987_1289_2419 376
572 3300049587 Ga0501071_0033835 Ga0501071_0033835_85_1215 376
573 3300049587 Ga0501071_0034511 Ga0501071_0034511_535_1665 376
574 3300049587 Ga0501071_0122820 Ga0501071_0122820_594_1724 376
575 3300049588 Ga0501072_0008547 Ga0501072_0008547_805_1935 376
576 3300049588 Ga0501072_0012707 Ga0501072_0012707_1491_2621 376
577 3300049588 Ga0501072_0014756 Ga0501072_0014756_874_2004 376
578 3300049588 Ga0501072_0089920 Ga0501072_0089920_1259_2389 376
579 3300049589 Ga0501073_0012723 Ga0501073_0012723_298_1428 376
580 3300049589 Ga0501073_0023569 Ga0501073_0023569_2695_3825 376
581 3300049590 Ga0501074_0002118 Ga0501074_0002118_5809_6939 376
582 3300049590 Ga0501074_0004639 Ga0501074_0004639_594_1724 376
583 3300049590 Ga0501074_0050772 Ga0501074_0050772_1806_2936 376
584 3300049591 Ga0501075_0000040 Ga0501075_0000040_38533_39663 376
585 3300049591 Ga0501075_0003487 Ga0501075_0003487_5402_6532 376
586 3300049591 Ga0501075_0140606 Ga0501075_0140606_265_1395 376
587 3300049592 Ga0501076_0000389 Ga0501076_0000389_6272_7402 376
588 3300049592 Ga0501076_0005282 Ga0501076_0005282_3417_4547 376
589 3300049592 Ga0501076_0013380 Ga0501076_0013380_603_1733 376
590 3300049593 Ga0501077_0002796 Ga0501077_0002796_3763_4893 376
591 3300049593 Ga0501077_0004285 Ga0501077_0004285_1669_2799 376
592 3300049593 Ga0501077_0056019 Ga0501077_0056019_67_1197 376
593 3300049593 Ga0501077_0060290 Ga0501077_0060290_540_1670 376
594 3300049741 Ga0501079_0000221 Ga0501079_0000221_28756_29886 376
595 3300049741 Ga0501079_0045659 Ga0501079_0045659_530_1660 376
596 3300049742 Ga0501080_0002349 Ga0501080_0002349_3716_4846 376
597 3300049742 Ga0501080_0084494 Ga0501080_0084494_1754_2884 376
598 3300049742 Ga0501080_0106565 Ga0501080_0106565_594_1724 376
599 3300049743 Ga0501081_0000040 Ga0501081_0000040_27914_29044 376
600 3300049743 Ga0501081_0005311 Ga0501081_0005311_3388_4518 376
601 3300049743 Ga0501081_0006499 Ga0501081_0006499_2695_3825 376
602 3300049743 Ga0501081_0067258 Ga0501081_0067258_348_1478 376
603 3300049744 Ga0501083_0000928 Ga0501083_0000928_12490_13620 376
604 3300049744 Ga0501083_0015301 Ga0501083_0015301_2330_3460 376
605 3300049744 Ga0501083_0163872 Ga0501083_0163872_242_1372 376
606 3300049822 Ga0501035_0012410 Ga0501035_0012410_5803_6933 376
607 3300049822 Ga0501035_0065225 Ga0501035_0065225_1903_3033 376
608 3300049822 Ga0501035_0077104 Ga0501035_0077104_50_1180 376
609 3300049823 Ga0501044_0088784 Ga0501044_0088784_1661_2791 376
610 3300049824 Ga0501045_0000098 Ga0501045_0000098_12474_13604 376
611 3300049824 Ga0501045_0002356 Ga0501045_0002356_6980_8110 376
612 3300049824 Ga0501045_0003655 Ga0501045_0003655_5548_6678 376
613 3300050507 nmdc:mga05p37_3875_c1 nmdc:mga05p37_3875_c1_7589_8719 376
614 3300050507 nmdc:mga05p37_438331_c1 nmdc:mga05p37_438331_c1_197_1327 376
615 3300050509 nmdc:mga0qj67_124743_c1 nmdc:mga0qj67_124743_c1_544_1674 376
616 3300050511 nmdc:mga08y16_39123_c1 nmdc:mga08y16_39123_c1_2214_3344 376
617 3300053084 Ga0495595_0004965 Ga0495595_0004965_1710_2840 376
618 3300053085 Ga0495619_0003045 Ga0495619_0003045_9154_10284 376
619 3300053085 Ga0495619_0006747 Ga0495619_0006747_3557_4687 376
620 3300054114 Ga0501084_0000228 Ga0501084_0000228_5831_6961 376
621 3300054114 Ga0501084_0000955 Ga0501084_0000955_6286_7416 376
622 3300054114 Ga0501084_0021299 Ga0501084_0021299_478_1608 376
623 3300060353 Ga0501082_0000313 Ga0501082_0000313_24199_25329 376
624 3300060353 Ga0501082_0001912 Ga0501082_0001912_13192_14322 376
625 3300060353 Ga0501082_0011995 Ga0501082_0011995_3680_4810 376
626 3300060353 Ga0501082_0093473 Ga0501082_0093473_673_1803 376
627 3300061734 Ga0530510_0000233 Ga0530510_0000233_27914_29044 376
628 3300061734 Ga0530510_0004716 Ga0530510_0004716_4499_5629 376
629 3300061734 Ga0530510_0016516 Ga0530510_0016516_111_1241 376
630 3300061734 Ga0530510_0027300 Ga0530510_0027300_2193_3323 376
631 3300061734 Ga0530510_0156470 Ga0530510_0156470_261_1391 376
632 3300003373 JGI25407J50210_10000325 JGI25407J50210_100003256 377
633 3300003373 JGI25407J50210_10004391 JGI25407J50210_100043913 377
634 3300005327 Ga0070658_10009784 Ga0070658_1000978411 377
635 3300005329 Ga0070683_100010190 Ga0070683_1000101902 377
636 3300005329 Ga0070683_100173752 Ga0070683_1001737522 377
637 3300005329 Ga0070683_100255262 Ga0070683_1002552622 377
638 3300005336 Ga0070680_100010461 Ga0070680_1000104612 377
639 3300005336 Ga0070680_100010918 Ga0070680_1000109184 377
640 3300005336 Ga0070680_100036185 Ga0070680_1000361852 377
641 3300005336 Ga0070680_100171656 Ga0070680_1001716562 377
642 3300005337 Ga0070682_100054175 Ga0070682_1000541752 377
643 3300005337 Ga0070682_100096408 Ga0070682_1000964082 377
644 3300005338 Ga0068868_100076897 Ga0068868_1000768972 377
645 3300005339 Ga0070660_100055442 Ga0070660_1000554423 377
646 3300005353 Ga0070669_100298142 Ga0070669_1002981421 377
647 3300005355 Ga0070671_100080880 Ga0070671_1000808802 377
648 3300005356 Ga0070674_100284437 Ga0070674_1002844371 377
649 3300005434 Ga0070709_10220140 Ga0070709_102201402 377
650 3300005435 Ga0070714_100146948 Ga0070714_1001469482 377
651 3300005436 Ga0070713_100354738 Ga0070713_1003547382 377
652 3300005436 Ga0070713_100470039 Ga0070713_1004700391 377
653 3300005437 Ga0070710_10030639 Ga0070710_100306392 377
654 3300005437 Ga0070710_10176624 Ga0070710_101766241 377
655 3300005438 Ga0070701_10085769 Ga0070701_100857692 377
656 3300005439 Ga0070711_100034111 Ga0070711_1000341113 377
657 3300005439 Ga0070711_100330242 Ga0070711_1003302421 377
658 3300005440 Ga0070705_100006400 Ga0070705_1000064003 377
659 3300005440 Ga0070705_100032222 Ga0070705_1000322222 377
660 3300005440 Ga0070705_100060303 Ga0070705_1000603032 377
661 3300005441 Ga0070700_100021840 Ga0070700_1000218401 377
662 3300005444 Ga0070694_100035278 Ga0070694_1000352782 377
663 3300005444 Ga0070694_100168563 Ga0070694_1001685631 377
664 3300005445 Ga0070708_100267844 Ga0070708_1002678442 377
665 3300005456 Ga0070678_100008752 Ga0070678_1000087523 377
666 3300005456 Ga0070678_100078517 Ga0070678_1000785172 377
667 3300005457 Ga0070662_100037927 Ga0070662_1000379272 377
668 3300005458 Ga0070681_10010617 Ga0070681_100106172 377
669 3300005458 Ga0070681_10054558 Ga0070681_100545582 377
670 3300005467 Ga0070706_100036936 Ga0070706_1000369365 377
671 3300005468 Ga0070707_100001400 Ga0070707_10000140021 377
672 3300005471 Ga0070698_100002965 Ga0070698_10000296515 377
673 3300005471 Ga0070698_100029189 Ga0070698_1000291892 377
674 3300005535 Ga0070684_100021957 Ga0070684_1000219572 377
675 3300005535 Ga0070684_100030298 Ga0070684_1000302982 377
676 3300005535 Ga0070684_100060387 Ga0070684_1000603873 377
677 3300005536 Ga0070697_100023373 Ga0070697_1000233732 377
678 3300005544 Ga0070686_100014127 Ga0070686_1000141273 377
679 3300005545 Ga0070695_100000062 Ga0070695_10000006214 377
680 3300005547 Ga0070693_100006959 Ga0070693_1000069594 377
681 3300005547 Ga0070693_100007298 Ga0070693_1000072982 377
682 3300005549 Ga0070704_100027047 Ga0070704_1000270472 377
683 3300005563 Ga0068855_100058680 Ga0068855_1000586804 377
684 3300005563 Ga0068855_100088714 Ga0068855_1000887143 377
685 3300005563 Ga0068855_100228473 Ga0068855_1002284732 377
686 3300005615 Ga0070702_100003932 Ga0070702_1000039323 377
687 3300005615 Ga0070702_100041311 Ga0070702_1000413112 377
688 3300005719 Ga0068861_100020483 Ga0068861_1000204835 377
689 3300005719 Ga0068861_100043745 Ga0068861_1000437452 377
690 3300005719 Ga0068861_100139245 Ga0068861_1001392452 377
691 3300005840 Ga0068870_10000314 Ga0068870_1000031423 377
692 3300005843 Ga0068860_100029418 Ga0068860_1000294183 377
693 3300005937 Ga0081455_10002950 Ga0081455_1000295017 377
694 3300005937 Ga0081455_10005594 Ga0081455_1000559417 377
695 3300005937 Ga0081455_10021783 Ga0081455_100217834 377
696 3300005937 Ga0081455_10041537 Ga0081455_100415374 377
697 3300005937 Ga0081455_10052308 Ga0081455_100523083 377
698 3300005937 Ga0081455_10080598 Ga0081455_100805981 377
699 3300005981 Ga0081538_10000231 Ga0081538_1000023145 377
700 3300005981 Ga0081538_10000286 Ga0081538_1000028623 377
701 3300005981 Ga0081538_10000667 Ga0081538_1000066729 377
702 3300005981 Ga0081538_10042187 Ga0081538_100421871 377
703 3300005983 Ga0081540_1004855 Ga0081540_100485510 377
704 3300005983 Ga0081540_1021636 Ga0081540_10216364 377
705 3300005985 Ga0081539_10001773 Ga0081539_1000177311 377
706 3300005985 Ga0081539_10003477 Ga0081539_100034772 377
707 3300006038 Ga0075365_10020226 Ga0075365_100202262 377
708 3300006038 Ga0075365_10146517 Ga0075365_101465171 377
709 3300006051 Ga0075364_10009439 Ga0075364_100094395 377
710 3300006058 Ga0075432_10016608 Ga0075432_100166082 377
711 3300006058 Ga0075432_10040201 Ga0075432_100402011 377
712 3300006163 Ga0070715_10003421 Ga0070715_100034214 377
713 3300006163 Ga0070715_10023484 Ga0070715_100234842 377
714 3300006173 Ga0070716_100064102 Ga0070716_1000641022 377
715 3300006175 Ga0070712_100009625 Ga0070712_1000096255 377
716 3300006237 Ga0097621_100011885 Ga0097621_1000118854 377
717 3300006358 Ga0068871_100043378 Ga0068871_1000433784 377
718 3300006844 Ga0075428_100034856 Ga0075428_1000348564 377
719 3300006844 Ga0075428_100086954 Ga0075428_1000869541 377
720 3300006844 Ga0075428_100135280 Ga0075428_1001352802 377
721 3300006846 Ga0075430_100005098 Ga0075430_10000509810 377
722 3300006846 Ga0075430_100012393 Ga0075430_1000123933 377
723 3300006847 Ga0075431_100002708 Ga0075431_10000270815 377
724 3300006847 Ga0075431_100361142 Ga0075431_1003611422 377
725 3300006852 Ga0075433_10024417 Ga0075433_100244175 377
726 3300006852 Ga0075433_10080607 Ga0075433_100806073 377
727 3300006871 Ga0075434_100017028 Ga0075434_1000170282 377
728 3300006871 Ga0075434_100130232 Ga0075434_1001302322 377
729 3300006880 Ga0075429_100071949 Ga0075429_1000719493 377
730 3300006914 Ga0075436_100006971 Ga0075436_1000069717 377
731 3300007076 Ga0075435_100003535 Ga0075435_1000035356 377
732 3300007076 Ga0075435_100087028 Ga0075435_1000870282 377
733 3300007076 Ga0075435_100201896 Ga0075435_1002018962 377
734 3300009093 Ga0105240_10054502 Ga0105240_100545026 377
735 3300009093 Ga0105240_10320495 Ga0105240_103204951 377
736 3300009094 Ga0111539_10017493 Ga0111539_1001749310 377
737 3300009094 Ga0111539_10018513 Ga0111539_100185138 377
738 3300009094 Ga0111539_10061628 Ga0111539_100616282 377
739 3300009094 Ga0111539_10103159 Ga0111539_101031591 377
740 3300009094 Ga0111539_10515022 Ga0111539_105150222 377
741 3300009098 Ga0105245_10029446 Ga0105245_100294464 377
742 3300009098 Ga0105245_10225946 Ga0105245_102259462 377
743 3300009147 Ga0114129_10023134 Ga0114129_1002313410 377
744 3300009147 Ga0114129_10034122 Ga0114129_100341223 377
745 3300009147 Ga0114129_10086576 Ga0114129_100865761 377
746 3300009147 Ga0114129_10100032 Ga0114129_101000322 377
747 3300009147 Ga0114129_10381992 Ga0114129_103819922 377
748 3300009148 Ga0105243_10040034 Ga0105243_100400342 377
749 3300009148 Ga0105243_10048322 Ga0105243_100483223 377
750 3300009148 Ga0105243_10404700 Ga0105243_104047001 377
751 3300009174 Ga0105241_10041562 Ga0105241_100415622 377
752 3300009553 Ga0105249_10021948 Ga0105249_100219483 377
753 3300011119 Ga0105246_10078382 Ga0105246_100783822 377
754 3300013102 Ga0157371_10053530 Ga0157371_100535302 377
755 3300013105 Ga0157369_10001204 Ga0157369_1000120428 377
756 3300013105 Ga0157369_10165028 Ga0157369_101650281 377
757 3300013105 Ga0157369_10351019 Ga0157369_103510192 377
758 3300013105 Ga0157369_10411017 Ga0157369_104110171 377
759 3300013297 Ga0157378_10132945 Ga0157378_101329452 377
760 3300013306 Ga0163162_10060630 Ga0163162_100606304 377
761 3300013307 Ga0157372_10083344 Ga0157372_100833443 377
762 3300013308 Ga0157375_10036992 Ga0157375_100369922 377
763 3300013308 Ga0157375_10054704 Ga0157375_100547042 377
764 3300014326 Ga0157380_10019560 Ga0157380_100195603 377
765 3300014326 Ga0157380_10085534 Ga0157380_100855342 377
766 3300014497 Ga0182008_10008779 Ga0182008_100087794 377
767 3300014497 Ga0182008_10023658 Ga0182008_100236583 377
768 3300017792 Ga0163161_10006893 Ga0163161_100068935 377
769 3300020082 Ga0206353_10882776 Ga0206353_108827762 377
770 3300022467 Ga0224712_10006996 Ga0224712_100069962 377
771 3300025893 Ga0207682_10037857 Ga0207682_100378571 377
772 3300025898 Ga0207692_10031688 Ga0207692_100316882 377
773 3300025905 Ga0207685_10083803 Ga0207685_100838031 377
774 3300025908 Ga0207643_10002509 Ga0207643_100025095 377
775 3300025910 Ga0207684_10082809 Ga0207684_100828092 377
776 3300025910 Ga0207684_10365356 Ga0207684_103653561 377
777 3300025912 Ga0207707_10027479 Ga0207707_100274794 377
778 3300025915 Ga0207693_10000495 Ga0207693_1000049539 377
779 3300025916 Ga0207663_10006239 Ga0207663_100062392 377
780 3300025916 Ga0207663_10021296 Ga0207663_100212962 377
781 3300025916 Ga0207663_10039854 Ga0207663_100398543 377
782 3300025917 Ga0207660_10009753 Ga0207660_100097532 377
783 3300025917 Ga0207660_10042076 Ga0207660_100420762 377
784 3300025917 Ga0207660_10080618 Ga0207660_100806182 377
785 3300025918 Ga0207662_10057617 Ga0207662_100576172 377
786 3300025918 Ga0207662_10170375 Ga0207662_101703751 377
787 3300025919 Ga0207657_10064592 Ga0207657_100645922 377
788 3300025920 Ga0207649_10023880 Ga0207649_100238802 377
789 3300025921 Ga0207652_10057932 Ga0207652_100579322 377
790 3300025922 Ga0207646_10006489 Ga0207646_1000648916 377
791 3300025922 Ga0207646_10269629 Ga0207646_102696292 377
792 3300025927 Ga0207687_10117575 Ga0207687_101175752 377
793 3300025928 Ga0207700_10188460 Ga0207700_101884602 377
794 3300025929 Ga0207664_10035875 Ga0207664_100358752 377
795 3300025929 Ga0207664_10088303 Ga0207664_100883032 377
796 3300025929 Ga0207664_10140930 Ga0207664_101409302 377
797 3300025929 Ga0207664_10178603 Ga0207664_101786032 377
798 3300025931 Ga0207644_10047716 Ga0207644_100477162 377
799 3300025933 Ga0207706_10055670 Ga0207706_100556703 377
800 3300025934 Ga0207686_10022183 Ga0207686_100221832 377
801 3300025939 Ga0207665_10000344 Ga0207665_1000034433 377
802 3300025944 Ga0207661_10043058 Ga0207661_100430583 377
803 3300025944 Ga0207661_10166969 Ga0207661_101669692 377
804 3300025961 Ga0207712_10025826 Ga0207712_100258265 377
805 3300025972 Ga0207668_10046704 Ga0207668_100467041 377
806 3300026075 Ga0207708_10017741 Ga0207708_100177412 377
807 3300026075 Ga0207708_10048867 Ga0207708_100488672 377
808 3300026078 Ga0207702_10058333 Ga0207702_100583332 377
809 3300026078 Ga0207702_10134110 Ga0207702_101341102 377
810 3300026095 Ga0207676_10032090 Ga0207676_100320902 377
811 3300026116 Ga0207674_10018243 Ga0207674_100182436 377
812 3300026116 Ga0207674_10067128 Ga0207674_100671283 377
813 3300026118 Ga0207675_100000541 Ga0207675_10000054111 377
814 3300026118 Ga0207675_100071490 Ga0207675_1000714903 377
815 3300026118 Ga0207675_100289724 Ga0207675_1002897242 377
816 3300026121 Ga0207683_10002514 Ga0207683_100025145 377
817 3300026121 Ga0207683_10021963 Ga0207683_100219634 377
818 3300026121 Ga0207683_10049620 Ga0207683_100496203 377
819 3300027907 Ga0207428_10003755 Ga0207428_1000375518 377
820 3300027907 Ga0207428_10034591 Ga0207428_100345912 377
821 3300027907 Ga0207428_10035364 Ga0207428_100353644 377
822 3300027907 Ga0207428_10042177 Ga0207428_100421772 377
823 3300028563 Ga0265319_1001816 Ga0265319_100181610 377
824 3300028577 Ga0265318_10003094 Ga0265318_100030949 377
825 3300028577 Ga0265318_10005531 Ga0265318_100055314 377
826 3300028654 Ga0265322_10004487 Ga0265322_100044872 377
827 3300028800 Ga0265338_10013097 Ga0265338_100130973 377
828 3300028800 Ga0265338_10033276 Ga0265338_100332762 377
829 3300031238 Ga0265332_10007519 Ga0265332_100075193 377
830 3300031238 Ga0265332_10056289 Ga0265332_100562892 377
831 3300031240 Ga0265320_10028495 Ga0265320_100284951 377
832 3300031241 Ga0265325_10002727 Ga0265325_100027273 377
833 3300031247 Ga0265340_10019809 Ga0265340_100198093 377
834 3300031251 Ga0265327_10031788 Ga0265327_100317882 377
835 3300031344 Ga0265316_10014896 Ga0265316_100148962 377
836 3300031595 Ga0265313_10020787 Ga0265313_100207872 377
837 3300031595 Ga0265313_10023998 Ga0265313_100239982 377
838 3300031995 Ga0307409_100099556 Ga0307409_1000995563 377
839 3300032005 Ga0307411_10042631 Ga0307411_100426312 377
840 3300035083 Ga0373926_0041573 Ga0373926_0041573_324_1457 377
841 3300035091 Ga0373951_0033600 Ga0373951_0033600_71_1204 377
842 3300035112 Ga0373932_0007782 Ga0373932_0007782_764_1897 377
843 3300035170 Ga0373943_0022912 Ga0373943_0022912_1488_2621 377
844 3300035172 Ga0373955_0042659 Ga0373955_0042659_872_2005 377
845 3300035241 Ga0373961_0017576 Ga0373961_0017576_48_1181 377
846 3300035241 Ga0373961_0021799 Ga0373961_0021799_370_1503 377
847 3300035242 Ga0373962_0003750 Ga0373962_0003750_433_1566 377
848 3300035242 Ga0373962_0012082 Ga0373962_0012082_399_1532 377
849 3300035691 Ga0373931_0060215 Ga0373931_0060215_756_1889 377
850 3300035692 Ga0373935_0156567 Ga0373935_0156567_224_1357 377
851 3300035725 Ga0373947_0000788 Ga0373947_0000788_400_1533 377
852 3300035725 Ga0373947_0003814 Ga0373947_0003814_6678_7811 377
853 3300037068 Ga0373925_0012604 Ga0373925_0012604_4018_5151 377
854 3300037068 Ga0373925_0014238 Ga0373925_0014238_385_1518 377
855 3300037312 Ga0395899_0004394 Ga0395899_0004394_4915_6048 377
856 3300037312 Ga0395899_0006552 Ga0395899_0006552_5876_7009 377
857 3300037312 Ga0395899_0006606 Ga0395899_0006606_3358_4491 377
858 3300037312 Ga0395899_0008964 Ga0395899_0008964_1726_2859 377
859 3300037312 Ga0395899_0033265 Ga0395899_0033265_511_1644 377
860 3300037312 Ga0395899_0035788 Ga0395899_0035788_1810_2943 377
861 3300037418 Ga0395900_0001024 Ga0395900_0001024_31890_33023 377
862 3300037418 Ga0395900_0002418 Ga0395900_0002418_2906_4039 377
863 3300037418 Ga0395900_0015689 Ga0395900_0015689_3741_4874 377
864 3300037418 Ga0395900_0033275 Ga0395900_0033275_888_2021 377
865 3300037418 Ga0395900_0034837 Ga0395900_0034837_3674_4807 377
866 3300037418 Ga0395900_0060391 Ga0395900_0060391_2686_3819 377
867 3300037418 Ga0395900_0067879 Ga0395900_0067879_397_1530 377
868 3300037418 Ga0395900_0101312 Ga0395900_0101312_1741_2874 377
869 3300037418 Ga0395900_0109165 Ga0395900_0109165_259_1392 377
870 3300037418 Ga0395900_0163099 Ga0395900_0163099_344_1477 377
871 3300037466 Ga0395898_0001509 Ga0395898_0001509_6470_7603 377
872 3300037466 Ga0395898_0002743 Ga0395898_0002743_12177_13310 377
873 3300037466 Ga0395898_0015220 Ga0395898_0015220_1095_2228 377
874 3300037466 Ga0395898_0017165 Ga0395898_0017165_3259_4392 377
875 3300037466 Ga0395898_0038785 Ga0395898_0038785_1137_2270 377
876 3300037466 Ga0395898_0044759 Ga0395898_0044759_2624_3757 377
877 3300037466 Ga0395898_0055467 Ga0395898_0055467_1074_2207 377
878 3300037466 Ga0395898_0135759 Ga0395898_0135759_500_1633 377
879 3300037466 Ga0395898_0305120 Ga0395898_0305120_222_1355 377
880 3300037466 Ga0395898_0353895 Ga0395898_0353895_136_1269 377
881 3300037471 Ga0395905_0001349 Ga0395905_0001349_25503_26636 377
882 3300037471 Ga0395905_0007392 Ga0395905_0007392_5162_6295 377
883 3300037471 Ga0395905_0007609 Ga0395905_0007609_3955_5088 377
884 3300037471 Ga0395905_0018046 Ga0395905_0018046_505_1638 377
885 3300037471 Ga0395905_0019871 Ga0395905_0019871_880_2013 377
886 3300037471 Ga0395905_0038303 Ga0395905_0038303_751_1884 377
887 3300037471 Ga0395905_0054064 Ga0395905_0054064_2232_3365 377
888 3300037471 Ga0395905_0199946 Ga0395905_0199946_538_1671 377
889 3300037471 Ga0395905_0218962 Ga0395905_0218962_562_1695 377
890 3300038443 Ga0395901_0002253 Ga0395901_0002253_3252_4385 377
891 3300038443 Ga0395901_0013978 Ga0395901_0013978_6219_7352 377
892 3300038443 Ga0395901_0020142 Ga0395901_0020142_2580_3713 377
893 3300038443 Ga0395901_0023112 Ga0395901_0023112_1889_3022 377
894 3300038443 Ga0395901_0023993 Ga0395901_0023993_3017_4150 377
895 3300038443 Ga0395901_0036033 Ga0395901_0036033_266_1399 377
896 3300038443 Ga0395901_0049114 Ga0395901_0049114_2343_3476 377
897 3300038443 Ga0395901_0050608 Ga0395901_0050608_1268_2401 377
898 3300038443 Ga0395901_0075091 Ga0395901_0075091_2171_3304 377
899 3300038443 Ga0395901_0095955 Ga0395901_0095955_249_1382 377
900 3300038443 Ga0395901_0208794 Ga0395901_0208794_629_1762 377
901 3300039438 Ga0436360_0619128 Ga0436360_0619128_6390_7526 377
902 3300041408 Ga0439453_0011950 Ga0439453_0011950_76_1209 377
903 3300041410 Ga0439461_0003402 Ga0439461_0003402_208_1341 377
904 3300041456 Ga0451795_0282681 Ga0451795_0282681_1082_2215 377
905 3300041999 Ga0439433_0000148 Ga0439433_0000148_6079_7212 377
906 3300042004 Ga0439445_0009915 Ga0439445_0009915_493_1626 377
907 3300042011 Ga0439454_000329 Ga0439454_000329_983_2116 377
908 3300042156 Ga0439446_0017835 Ga0439446_0017835_722_1855 377
909 3300042435 Ga0439434_0027372 Ga0439434_0027372_192_1325 377
910 3300044656 Ga0466969_0002720 Ga0466969_0002720_3991_5124 377
911 3300044656 Ga0466969_0028659 Ga0466969_0028659_1692_2825 377
912 3300044658 Ga0466972_0088252 Ga0466972_0088252_177_1310 377
913 3300044683 Ga0466965_0005134 Ga0466965_0005134_2684_3817 377
914 3300044694 Ga0466963_0000776 Ga0466963_0000776_1372_2505 377
915 3300044694 Ga0466963_0009464 Ga0466963_0009464_1800_2933 377
916 3300044694 Ga0466963_0111674 Ga0466963_0111674_203_1336 377
917 3300044706 Ga0466964_0004036 Ga0466964_0004036_2232_3365 377
918 3300044706 Ga0466964_0032139 Ga0466964_0032139_200_1333 377
919 3300044719 Ga0466971_0002654 Ga0466971_0002654_669_1802 377
920 3300044735 Ga0466968_0006063 Ga0466968_0006063_1808_2941 377
921 3300044735 Ga0466968_0025671 Ga0466968_0025671_877_2010 377
922 3300044735 Ga0466968_0029013 Ga0466968_0029013_138_1271 377
923 3300044842 Ga0466957_0002420 Ga0466957_0002420_7949_9082 377
924 3300044842 Ga0466957_0024880 Ga0466957_0024880_2282_3415 377
925 3300044842 Ga0466957_0044092 Ga0466957_0044092_1029_2162 377
926 3300044901 Ga0466960_0005041 Ga0466960_0005041_3330_4463 377
927 3300044901 Ga0466960_0071658 Ga0466960_0071658_405_1538 377
928 3300045049 Ga0466959_0001728 Ga0466959_0001728_11754_12887 377
929 3300045049 Ga0466959_0013001 Ga0466959_0013001_3991_5124 377
930 3300045049 Ga0466959_0071000 Ga0466959_0071000_1373_2506 377
931 3300045836 Ga0466958_0004202 Ga0466958_0004202_4630_5763 377
932 3300045836 Ga0466958_0023057 Ga0466958_0023057_990_2123 377
933 3300045976 Ga0466967_0000305 Ga0466967_0000305_17659_18792 377
934 3300045976 Ga0466967_0004340 Ga0466967_0004340_3943_5076 377
935 3300045976 Ga0466967_0006003 Ga0466967_0006003_1514_2647 377
936 3300045976 Ga0466967_0032578 Ga0466967_0032578_2857_3990 377
937 3300045976 Ga0466967_0082438 Ga0466967_0082438_571_1704 377
938 3300045976 Ga0466967_0116228 Ga0466967_0116228_35_1168 377
939 3300046455 Ga0495603_0013529 Ga0495603_0013529_1237_2370 377
940 3300046459 Ga0495629_0005062 Ga0495629_0005062_3366_4499 377
941 3300046459 Ga0495629_0042086 Ga0495629_0042086_584_1717 377
942 3300046461 Ga0495641_0005898 Ga0495641_0005898_400_1533 377
943 3300046461 Ga0495641_0098566 Ga0495641_0098566_18_1151 377
944 3300046462 Ga0495651_0090894 Ga0495651_0090894_1040_2173 377
945 3300046463 Ga0495653_0017412 Ga0495653_0017412_1268_2401 377
946 3300046463 Ga0495653_0097697 Ga0495653_0097697_517_1650 377
947 3300046463 Ga0495653_0098825 Ga0495653_0098825_147_1280 377
948 3300046473 Ga0495582_0042231 Ga0495582_0042231_1276_2409 377
949 3300046473 Ga0495582_0044419 Ga0495582_0044419_208_1341 377
950 3300046473 Ga0495582_0076740 Ga0495582_0076740_592_1725 377
951 3300046476 Ga0495662_0069879 Ga0495662_0069879_508_1641 377
952 3300046514 Ga0495618_0199826 Ga0495618_0199826_25_1158 377
953 3300046517 Ga0495630_0122656 Ga0495630_0122656_437_1570 377
954 3300046525 Ga0495663_0004676 Ga0495663_0004676_423_1556 377
955 3300046526 Ga0495666_0029339 Ga0495666_0029339_406_1539 377
956 3300046529 Ga0495652_0122075 Ga0495652_0122075_707_1840 377
957 3300046535 Ga0495586_0010133 Ga0495586_0010133_2469_3602 377
958 3300046559 Ga0495667_0027749 Ga0495667_0027749_2427_3560 377
959 3300046616 Ga0495668_0155641 Ga0495668_0155641_57_1190 377
960 3300046642 Ga0495634_0085372 Ga0495634_0085372_719_1852 377
961 3300046642 Ga0495634_0106915 Ga0495634_0106915_317_1450 377
962 3300046664 Ga0495659_0026466 Ga0495659_0026466_85_1218 377
963 3300046684 Ga0495669_0025825 Ga0495669_0025825_52_1185 377
964 3300046689 Ga0495613_0058534 Ga0495613_0058534_131_1264 377
965 3300046691 Ga0495670_0029056 Ga0495670_0029056_634_1767 377
966 3300046809 Ga0495600_0050268 Ga0495600_0050268_1056_2189 377
967 3300047321 Ga0495676_0054101 Ga0495676_0054101_557_1690 377
968 3300047322 Ga0495680_0022087 Ga0495680_0022087_625_1758 377
969 3300047322 Ga0495680_0039217 Ga0495680_0039217_1104_2237 377
970 3300047322 Ga0495680_0079785 Ga0495680_0079785_63_1196 377
971 3300047322 Ga0495680_0217777 Ga0495680_0217777_143_1276 377
972 3300047471 Ga0495684_0032055 Ga0495684_0032055_1883_3016 377
973 3300047471 Ga0495684_0082142 Ga0495684_0082142_296_1429 377
974 3300048903 Ga0496100_0074991 Ga0496100_0074991_28_1161 377
975 3300048904 Ga0496101_0057688 Ga0496101_0057688_476_1609 377
976 3300048904 Ga0496101_0072476 Ga0496101_0072476_287_1420 377
977 3300048905 Ga0496102_0079770 Ga0496102_0079770_901_2034 377
978 3300048905 Ga0496102_0147405 Ga0496102_0147405_192_1325 377
979 3300048906 Ga0496103_0000883 Ga0496103_0000883_19871_21004 377
980 3300048906 Ga0496103_0011051 Ga0496103_0011051_3170_4303 377
981 3300048907 Ga0496104_0000606 Ga0496104_0000606_26866_27999 377
982 3300048907 Ga0496104_0134435 Ga0496104_0134435_555_1688 377
983 3300048908 Ga0496105_0000182 Ga0496105_0000182_2778_3911 377
984 3300048908 Ga0496105_0099261 Ga0496105_0099261_1255_2388 377
985 3300048909 Ga0496106_0046861 Ga0496106_0046861_2007_3140 377
986 3300048909 Ga0496106_0074682 Ga0496106_0074682_1359_2492 377
987 3300048910 Ga0496107_0115878 Ga0496107_0115878_314_1447 377
988 3300048911 Ga0496108_0000777 Ga0496108_0000777_22046_23179 377
989 3300048911 Ga0496108_0152191 Ga0496108_0152191_74_1207 377
990 3300048912 Ga0496109_0000403 Ga0496109_0000403_34473_35606 377
991 3300048912 Ga0496109_0068339 Ga0496109_0068339_1448_2581 377
992 3300048912 Ga0496109_0112950 Ga0496109_0112950_399_1532 377
993 3300048912 Ga0496109_0347771 Ga0496109_0347771_56_1189 377
994 3300048913 Ga0496110_0017835 Ga0496110_0017835_1944_3077 377
995 3300048913 Ga0496110_0061968 Ga0496110_0061968_1428_2561 377
996 3300048913 Ga0496110_0125945 Ga0496110_0125945_1023_2156 377
997 3300048913 Ga0496110_0277595 Ga0496110_0277595_145_1278 377
998 3300048914 Ga0496111_0000076 Ga0496111_0000076_1737_2870 377
999 3300048914 Ga0496111_0057292 Ga0496111_0057292_1345_2478 377
1000 3300048915 Ga0496112_0033281 Ga0496112_0033281_345_1478 377
1001 3300048915 Ga0496112_0043299 Ga0496112_0043299_602_1735 377
1002 3300048915 Ga0496112_0050479 Ga0496112_0050479_2922_4055 377
1003 3300048915 Ga0496112_0145310 Ga0496112_0145310_995_2128 377
1004 3300048915 Ga0496112_0182178 Ga0496112_0182178_781_1914 377
1005 3300048916 Ga0496113_0000424 Ga0496113_0000424_16357_17490 377
1006 3300048916 Ga0496113_0026249 Ga0496113_0026249_453_1586 377
1007 3300048916 Ga0496113_0155744 Ga0496113_0155744_503_1636 377
1008 3300048916 Ga0496113_0233814 Ga0496113_0233814_212_1345 377
1009 3300048917 Ga0496114_0012754 Ga0496114_0012754_901_2034 377
1010 3300048917 Ga0496114_0095204 Ga0496114_0095204_1085_2218 377
1011 3300048918 Ga0496115_0019290 Ga0496115_0019290_4049_5182 377
1012 3300049568 Ga0501031_0006308 Ga0501031_0006308_4434_5567 377
1013 3300049568 Ga0501031_0017743 Ga0501031_0017743_2817_3950 377
1014 3300049568 Ga0501031_0022738 Ga0501031_0022738_1285_2418 377
1015 3300049568 Ga0501031_0139370 Ga0501031_0139370_204_1337 377
1016 3300049569 Ga0501032_0007154 Ga0501032_0007154_390_1523 377
1017 3300049570 Ga0501033_0001524 Ga0501033_0001524_4240_5373 377
1018 3300049571 Ga0501034_0337326 Ga0501034_0337326_14_1147 377
1019 3300049572 Ga0501036_0003780 Ga0501036_0003780_3182_4315 377
1020 3300049572 Ga0501036_0020507 Ga0501036_0020507_1354_2487 377
1021 3300049572 Ga0501036_0036686 Ga0501036_0036686_303_1436 377
1022 3300049572 Ga0501036_0074317 Ga0501036_0074317_1610_2743 377
1023 3300049572 Ga0501036_0171460 Ga0501036_0171460_460_1593 377
1024 3300049574 Ga0501038_0005147 Ga0501038_0005147_7022_8155 377
1025 3300049574 Ga0501038_0060084 Ga0501038_0060084_1607_2740 377
1026 3300049575 Ga0501039_0002342 Ga0501039_0002342_6339_7472 377
1027 3300049575 Ga0501039_0018759 Ga0501039_0018759_1153_2286 377
1028 3300049575 Ga0501039_0102951 Ga0501039_0102951_591_1724 377
1029 3300049576 Ga0501040_0001441 Ga0501040_0001441_3369_4502 377
1030 3300049576 Ga0501040_0006022 Ga0501040_0006022_3785_4918 377
1031 3300049576 Ga0501040_0094474 Ga0501040_0094474_773_1906 377
1032 3300049577 Ga0501041_0003729 Ga0501041_0003729_3996_5129 377
1033 3300049578 Ga0501042_0002063 Ga0501042_0002063_10455_11588 377
1034 3300049578 Ga0501042_0006234 Ga0501042_0006234_5191_6324 377
1035 3300049578 Ga0501042_0008327 Ga0501042_0008327_967_2100 377
1036 3300049578 Ga0501042_0013685 Ga0501042_0013685_2239_3372 377
1037 3300049579 Ga0501043_0001469 Ga0501043_0001469_15069_16202 377
1038 3300049579 Ga0501043_0255351 Ga0501043_0255351_88_1221 377
1039 3300049580 Ga0501046_0069321 Ga0501046_0069321_757_1890 377
1040 3300049580 Ga0501046_0102098 Ga0501046_0102098_531_1664 377
1041 3300049580 Ga0501046_0255782 Ga0501046_0255782_141_1274 377
1042 3300049582 Ga0501048_0003112 Ga0501048_0003112_4695_5828 377
1043 3300049582 Ga0501048_0004940 Ga0501048_0004940_6289_7422 377
1044 3300049582 Ga0501048_0031166 Ga0501048_0031166_377_1510 377
1045 3300049582 Ga0501048_0044833 Ga0501048_0044833_1946_3079 377
1046 3300049583 Ga0501067_0010737 Ga0501067_0010737_3328_4461 377
1047 3300049583 Ga0501067_0013971 Ga0501067_0013971_1593_2726 377
1048 3300049583 Ga0501067_0037726 Ga0501067_0037726_1191_2324 377
1049 3300049583 Ga0501067_0092549 Ga0501067_0092549_306_1439 377
1050 3300049584 Ga0501068_0004593 Ga0501068_0004593_757_1890 377
1051 3300049585 Ga0501069_0022668 Ga0501069_0022668_1214_2347 377
1052 3300049585 Ga0501069_0038956 Ga0501069_0038956_773_1906 377
1053 3300049586 Ga0501070_0048928 Ga0501070_0048928_917_2050 377
1054 3300049587 Ga0501071_0028681 Ga0501071_0028681_496_1629 377
1055 3300049587 Ga0501071_0031806 Ga0501071_0031806_2348_3481 377
1056 3300049587 Ga0501071_0045905 Ga0501071_0045905_1528_2661 377
1057 3300049587 Ga0501071_0115863 Ga0501071_0115863_800_1933 377
1058 3300049588 Ga0501072_0000318 Ga0501072_0000318_24253_25386 377
1059 3300049588 Ga0501072_0006359 Ga0501072_0006359_1275_2408 377
1060 3300049588 Ga0501072_0112384 Ga0501072_0112384_507_1640 377
1061 3300049588 Ga0501072_0137638 Ga0501072_0137638_583_1716 377
1062 3300049589 Ga0501073_0004072 Ga0501073_0004072_8519_9652 377
1063 3300049590 Ga0501074_0002797 Ga0501074_0002797_10324_11457 377
1064 3300049590 Ga0501074_0006115 Ga0501074_0006115_3246_4379 377
1065 3300049590 Ga0501074_0017279 Ga0501074_0017279_2907_4040 377
1066 3300049591 Ga0501075_0006994 Ga0501075_0006994_2880_4013 377
1067 3300049591 Ga0501075_0007704 Ga0501075_0007704_4912_6045 377
1068 3300049591 Ga0501075_0059731 Ga0501075_0059731_409_1542 377
1069 3300049592 Ga0501076_0001058 Ga0501076_0001058_8929_10062 377
1070 3300049593 Ga0501077_0001230 Ga0501077_0001230_1411_2544 377
1071 3300049741 Ga0501079_0003063 Ga0501079_0003063_3377_4510 377
1072 3300049741 Ga0501079_0010605 Ga0501079_0010605_3096_4229 377
1073 3300049741 Ga0501079_0014181 Ga0501079_0014181_4353_5486 377
1074 3300049741 Ga0501079_0028516 Ga0501079_0028516_1083_2216 377
1075 3300049742 Ga0501080_0003472 Ga0501080_0003472_12379_13512 377
1076 3300049742 Ga0501080_0127457 Ga0501080_0127457_700_1833 377
1077 3300049742 Ga0501080_0239054 Ga0501080_0239054_283_1416 377
1078 3300049743 Ga0501081_0006503 Ga0501081_0006503_1550_2683 377
1079 3300049743 Ga0501081_0208753 Ga0501081_0208753_153_1286 377
1080 3300049743 Ga0501081_0215186 Ga0501081_0215186_164_1297 377
1081 3300049744 Ga0501083_0010159 Ga0501083_0010159_4706_5839 377
1082 3300049744 Ga0501083_0119940 Ga0501083_0119940_91_1224 377
1083 3300049822 Ga0501035_0014052 Ga0501035_0014052_4366_5499 377
1084 3300049822 Ga0501035_0014109 Ga0501035_0014109_3174_4307 377
1085 3300049824 Ga0501045_0001678 Ga0501045_0001678_4855_5988 377
1086 3300049824 Ga0501045_0003625 Ga0501045_0003625_6637_7770 377
1087 3300050491 nmdc:mga00v17_126818_c1 nmdc:mga00v17_126818_c1_432_1565 377
1088 3300050507 nmdc:mga05p37_15032_c2 nmdc:mga05p37_15032_c2_7453_8586 377
1089 3300050507 nmdc:mga05p37_184176_c1 nmdc:mga05p37_184176_c1_1334_2467 377
1090 3300050507 nmdc:mga05p37_205152_c1 nmdc:mga05p37_205152_c1_977_2110 377
1091 3300050507 nmdc:mga05p37_24671_c1 nmdc:mga05p37_24671_c1_4023_5156 377
1092 3300050507 nmdc:mga05p37_404477_c1 nmdc:mga05p37_404477_c1_60_1193 377
1093 3300050507 nmdc:mga05p37_81115_c1 nmdc:mga05p37_81115_c1_1999_3132 377
1094 3300050508 nmdc:mga09592_101605_c1 nmdc:mga09592_101605_c1_66_1199 377
1095 3300050508 nmdc:mga09592_247905_c1 nmdc:mga09592_247905_c1_119_1252 377
1096 3300050510 nmdc:mga06r32_61799_c1 nmdc:mga06r32_61799_c1_1004_2137 377
1097 3300050511 nmdc:mga08y16_251445_c1 nmdc:mga08y16_251445_c1_572_1705 377
1098 3300050511 nmdc:mga08y16_3967_c1 nmdc:mga08y16_3967_c1_12932_14065 377
1099 3300050511 nmdc:mga08y16_53933_c1 nmdc:mga08y16_53933_c1_2481_3614 377
1100 3300050511 nmdc:mga08y16_59921_c1 nmdc:mga08y16_59921_c1_486_1619 377
1101 3300050511 nmdc:mga08y16_68650_c1 nmdc:mga08y16_68650_c1_374_1507 377
1102 3300050512 nmdc:mga0n895_12009_c1 nmdc:mga0n895_12009_c1_1026_2159 377
1103 3300050512 nmdc:mga0n895_131706_c1 nmdc:mga0n895_131706_c1_38_1171 377
1104 3300050512 nmdc:mga0n895_271983_c1 nmdc:mga0n895_271983_c1_70_1203 377
1105 3300050512 nmdc:mga0n895_370555_c1 nmdc:mga0n895_370555_c1_280_1413 377
1106 3300050513 nmdc:mga0rr50_108516_c1 nmdc:mga0rr50_108516_c1_832_1965 377
1107 3300050513 nmdc:mga0rr50_153278_c1 nmdc:mga0rr50_153278_c1_135_1268 377
1108 3300050513 nmdc:mga0rr50_20463_c1 nmdc:mga0rr50_20463_c1_940_2073 377
1109 3300050513 nmdc:mga0rr50_251288_c1 nmdc:mga0rr50_251288_c1_299_1432 377
1110 3300050513 nmdc:mga0rr50_40155_c1 nmdc:mga0rr50_40155_c1_1790_2923 377
1111 3300050514 nmdc:mga08x19_12127_c1 nmdc:mga08x19_12127_c1_3511_4644 377
1112 3300050514 nmdc:mga08x19_21220_c1 nmdc:mga08x19_21220_c1_242_1375 377
1113 3300050514 nmdc:mga08x19_50569_c1 nmdc:mga08x19_50569_c1_772_1905 377
1114 3300050515 nmdc:mga0a205_312739_c1 nmdc:mga0a205_312739_c1_135_1268 377
1115 3300050515 nmdc:mga0a205_53094_c1 nmdc:mga0a205_53094_c1_485_1618 377
1116 3300050515 nmdc:mga0a205_5955_c1 nmdc:mga0a205_5955_c1_1225_2358 377
1117 3300053084 Ga0495595_0033685 Ga0495595_0033685_467_1600 377
1118 3300054114 Ga0501084_0001046 Ga0501084_0001046_8795_9928 377
1119 3300054114 Ga0501084_0035168 Ga0501084_0035168_1020_2153 377
1120 3300054114 Ga0501084_0043475 Ga0501084_0043475_263_1396 377
1121 3300054114 Ga0501084_0085023 Ga0501084_0085023_1083_2216 377
1122 3300054114 Ga0501084_0150720 Ga0501084_0150720_743_1876 377
1123 3300060353 Ga0501082_0008629 Ga0501082_0008629_5201_6334 377
1124 3300060353 Ga0501082_0017681 Ga0501082_0017681_2165_3298 377
1125 3300060353 Ga0501082_0021980 Ga0501082_0021980_1287_2420 377
1126 3300060353 Ga0501082_0153597 Ga0501082_0153597_504_1637 377
1127 3300061719 Ga0466962_0040617 Ga0466962_0040617_795_1928 377
1128 3300061734 Ga0530510_0017135 Ga0530510_0017135_2480_3613 377
1129 3300061734 Ga0530510_0032144 Ga0530510_0032144_1162_2295 377
1130 3300061734 Ga0530510_0040288 Ga0530510_0040288_2143_3276 377
1131 3300061734 Ga0530510_0122169 Ga0530510_0122169_377_1510 377
1132 3300002077 JGI24744J21845_10021881 JGI24744J21845_100218811 378
1133 3300005330 Ga0070690_100033675 Ga0070690_1000336752 378
1134 3300005336 Ga0070680_100100111 Ga0070680_1001001112 378
1135 3300005339 Ga0070660_100041222 Ga0070660_1000412223 378
1136 3300005340 Ga0070689_100038995 Ga0070689_1000389952 378
1137 3300005345 Ga0070692_10005879 Ga0070692_100058793 378
1138 3300005355 Ga0070671_100122472 Ga0070671_1001224722 378
1139 3300005356 Ga0070674_100003504 Ga0070674_1000035044 378
1140 3300005365 Ga0070688_100013337 Ga0070688_1000133373 378
1141 3300005366 Ga0070659_100053320 Ga0070659_1000533202 378
1142 3300005367 Ga0070667_100169485 Ga0070667_1001694852 378
1143 3300005437 Ga0070710_10006337 Ga0070710_100063373 378
1144 3300005439 Ga0070711_100016230 Ga0070711_1000162302 378
1145 3300005441 Ga0070700_100001864 Ga0070700_1000018648 378
1146 3300005444 Ga0070694_100081072 Ga0070694_1000810722 378
1147 3300005456 Ga0070678_100002333 Ga0070678_1000023335 378
1148 3300005459 Ga0068867_100004862 Ga0068867_10000486213 378
1149 3300005459 Ga0068867_100177377 Ga0068867_1001773772 378
1150 3300005466 Ga0070685_10004015 Ga0070685_100040155 378
1151 3300005467 Ga0070706_100090237 Ga0070706_1000902373 378
1152 3300005467 Ga0070706_100113732 Ga0070706_1001137322 378
1153 3300005468 Ga0070707_100002546 Ga0070707_10000254613 378
1154 3300005471 Ga0070698_100007341 Ga0070698_10000734110 378
1155 3300005471 Ga0070698_100096094 Ga0070698_1000960942 378
1156 3300005539 Ga0068853_100006638 Ga0068853_1000066385 378
1157 3300005543 Ga0070672_100006217 Ga0070672_10000621711 378
1158 3300005544 Ga0070686_100002984 Ga0070686_10000298410 378
1159 3300005545 Ga0070695_100065605 Ga0070695_1000656052 378
1160 3300005546 Ga0070696_100017716 Ga0070696_1000177163 378
1161 3300005546 Ga0070696_100047671 Ga0070696_1000476712 378
1162 3300005548 Ga0070665_100029627 Ga0070665_1000296274 378
1163 3300005549 Ga0070704_100017426 Ga0070704_1000174262 378
1164 3300005614 Ga0068856_100039042 Ga0068856_1000390425 378
1165 3300005615 Ga0070702_100022559 Ga0070702_1000225591 378
1166 3300005616 Ga0068852_100018397 Ga0068852_1000183973 378
1167 3300005718 Ga0068866_10001441 Ga0068866_100014417 378
1168 3300005840 Ga0068870_10024674 Ga0068870_100246743 378
1169 3300005842 Ga0068858_100143759 Ga0068858_1001437592 378
1170 3300005937 Ga0081455_10022098 Ga0081455_100220983 378
1171 3300005981 Ga0081538_10027147 Ga0081538_100271474 378
1172 3300006175 Ga0070712_100001021 Ga0070712_1000010218 378
1173 3300006237 Ga0097621_100002685 Ga0097621_1000026854 378
1174 3300006358 Ga0068871_100186576 Ga0068871_1001865762 378
1175 3300006880 Ga0075429_100036778 Ga0075429_1000367782 378
1176 3300006881 Ga0068865_100041819 Ga0068865_1000418191 378
1177 3300009098 Ga0105245_10012129 Ga0105245_100121297 378
1178 3300009098 Ga0105245_10103091 Ga0105245_101030912 378
1179 3300009148 Ga0105243_10019281 Ga0105243_100192812 378
1180 3300009148 Ga0105243_10028480 Ga0105243_100284802 378
1181 3300009148 Ga0105243_10048448 Ga0105243_100484483 378
1182 3300009176 Ga0105242_10031376 Ga0105242_100313763 378
1183 3300009176 Ga0105242_10167524 Ga0105242_101675242 378
1184 3300009177 Ga0105248_10020815 Ga0105248_100208152 378
1185 3300009553 Ga0105249_10001447 Ga0105249_100014474 378
1186 3300010375 Ga0105239_10109939 Ga0105239_101099392 378
1187 3300013296 Ga0157374_10025452 Ga0157374_100254523 378
1188 3300013297 Ga0157378_10001517 Ga0157378_1000151718 378
1189 3300013306 Ga0163162_10013159 Ga0163162_100131592 378
1190 3300013308 Ga0157375_10029508 Ga0157375_100295085 378
1191 3300013308 Ga0157375_10139096 Ga0157375_101390961 378
1192 3300014326 Ga0157380_10018684 Ga0157380_100186844 378
1193 3300014745 Ga0157377_10004308 Ga0157377_100043086 378
1194 3300014969 Ga0157376_10019995 Ga0157376_100199953 378
1195 3300025898 Ga0207692_10012340 Ga0207692_100123404 378
1196 3300025899 Ga0207642_10006246 Ga0207642_100062462 378
1197 3300025905 Ga0207685_10048406 Ga0207685_100484061 378
1198 3300025906 Ga0207699_10022724 Ga0207699_100227242 378
1199 3300025907 Ga0207645_10042230 Ga0207645_100422302 378
1200 3300025910 Ga0207684_10081455 Ga0207684_100814552 378
1201 3300025912 Ga0207707_10279304 Ga0207707_102793042 378
1202 3300025913 Ga0207695_10025866 Ga0207695_100258664 378
1203 3300025915 Ga0207693_10020755 Ga0207693_100207555 378
1204 3300025916 Ga0207663_10092919 Ga0207663_100929192 378
1205 3300025917 Ga0207660_10084654 Ga0207660_100846542 378
1206 3300025919 Ga0207657_10050423 Ga0207657_100504232 378
1207 3300025922 Ga0207646_10004168 Ga0207646_100041687 378
1208 3300025927 Ga0207687_10003379 Ga0207687_100033794 378
1209 3300025928 Ga0207700_10040128 Ga0207700_100401283 378
1210 3300025931 Ga0207644_10016741 Ga0207644_100167413 378
1211 3300025934 Ga0207686_10005890 Ga0207686_100058902 378
1212 3300025934 Ga0207686_10030082 Ga0207686_100300822 378
1213 3300025935 Ga0207709_10002308 Ga0207709_100023085 378
1214 3300025937 Ga0207669_10023155 Ga0207669_100231552 378
1215 3300025937 Ga0207669_10138623 Ga0207669_101386232 378
1216 3300025938 Ga0207704_10069106 Ga0207704_100691061 378
1217 3300025940 Ga0207691_10042101 Ga0207691_100421012 378
1218 3300025941 Ga0207711_10032592 Ga0207711_100325924 378
1219 3300025972 Ga0207668_10016548 Ga0207668_100165484 378
1220 3300026035 Ga0207703_10026458 Ga0207703_100264585 378
1221 3300026041 Ga0207639_10067007 Ga0207639_100670072 378
1222 3300026067 Ga0207678_10030037 Ga0207678_100300374 378
1223 3300026075 Ga0207708_10000111 Ga0207708_100001117 378
1224 3300026078 Ga0207702_10032030 Ga0207702_100320304 378
1225 3300026089 Ga0207648_10005139 Ga0207648_100051397 378
1226 3300026116 Ga0207674_10095051 Ga0207674_100950512 378
1227 3300026118 Ga0207675_100015192 Ga0207675_1000151928 378
1228 3300026121 Ga0207683_10000549 Ga0207683_1000054929 378
1229 3300026142 Ga0207698_10091948 Ga0207698_100919482 378
1230 3300028379 Ga0268266_10149262 Ga0268266_101492622 378
1231 3300035725 Ga0373947_0173013 Ga0373947_0173013_58_1194 378
1232 3300037312 Ga0395899_0005300 Ga0395899_0005300_6711_7847 378
1233 3300037312 Ga0395899_0078433 Ga0395899_0078433_918_2054 378
1234 3300037418 Ga0395900_0005710 Ga0395900_0005710_9043_10179 378
1235 3300037418 Ga0395900_0006173 Ga0395900_0006173_2248_3384 378
1236 3300037418 Ga0395900_0089735 Ga0395900_0089735_1124_2260 378
1237 3300037418 Ga0395900_0128918 Ga0395900_0128918_311_1447 378
1238 3300037466 Ga0395898_0002982 Ga0395898_0002982_7446_8582 378
1239 3300037466 Ga0395898_0005091 Ga0395898_0005091_9670_10806 378
1240 3300037466 Ga0395898_0020035 Ga0395898_0020035_3846_4982 378
1241 3300037466 Ga0395898_0273054 Ga0395898_0273054_214_1350 378
1242 3300037471 Ga0395905_0003692 Ga0395905_0003692_11006_12142 378
1243 3300037471 Ga0395905_0004505 Ga0395905_0004505_9625_10761 378
1244 3300037471 Ga0395905_0134339 Ga0395905_0134339_248_1384 378
1245 3300037471 Ga0395905_0146389 Ga0395905_0146389_739_1875 378
1246 3300038443 Ga0395901_0030219 Ga0395901_0030219_2937_4073 378
1247 3300045976 Ga0466967_0103840 Ga0466967_0103840_836_1972 378
1248 3300045976 Ga0466967_0275335 Ga0466967_0275335_297_1433 378
1249 3300046455 Ga0495603_0025920 Ga0495603_0025920_1699_2835 378
1250 3300046455 Ga0495603_0056218 Ga0495603_0056218_299_1435 378
1251 3300046473 Ga0495582_0026180 Ga0495582_0026180_1486_2622 378
1252 3300046474 Ga0495605_0050725 Ga0495605_0050725_375_1511 378
1253 3300046475 Ga0495639_0009401 Ga0495639_0009401_633_1769 378
1254 3300046476 Ga0495662_0044954 Ga0495662_0044954_859_1995 378
1255 3300046491 Ga0495584_0047032 Ga0495584_0047032_810_1946 378
1256 3300046525 Ga0495663_0004637 Ga0495663_0004637_196_1332 378
1257 3300046528 Ga0495642_0030874 Ga0495642_0030874_231_1367 378
1258 3300046535 Ga0495586_0073234 Ga0495586_0073234_680_1816 378
1259 3300046537 Ga0495598_0027229 Ga0495598_0027229_389_1525 378
1260 3300046615 Ga0495656_0060612 Ga0495656_0060612_189_1325 378
1261 3300046689 Ga0495613_0037745 Ga0495613_0037745_1295_2431 378
1262 3300046794 Ga0495589_0012843 Ga0495589_0012843_1487_2623 378
1263 3300047315 Ga0495581_0003773 Ga0495581_0003773_1115_2251 378
1264 3300047318 Ga0495636_0050080 Ga0495636_0050080_101_1237 378
1265 3300047445 Ga0495677_0038918 Ga0495677_0038918_500_1636 378
1266 3300048903 Ga0496100_0020151 Ga0496100_0020151_2440_3576 378
1267 3300048904 Ga0496101_0128378 Ga0496101_0128378_492_1628 378
1268 3300048904 Ga0496101_0175641 Ga0496101_0175641_310_1446 378
1269 3300048905 Ga0496102_0008881 Ga0496102_0008881_715_1851 378
1270 3300048906 Ga0496103_0003699 Ga0496103_0003699_2636_3772 378
1271 3300048907 Ga0496104_0120837 Ga0496104_0120837_1291_2427 378
1272 3300048909 Ga0496106_0002243 Ga0496106_0002243_2563_3699 378
1273 3300048909 Ga0496106_0165013 Ga0496106_0165013_39_1175 378
1274 3300048910 Ga0496107_0003821 Ga0496107_0003821_3905_5041 378
1275 3300048911 Ga0496108_0012265 Ga0496108_0012265_1260_2396 378
1276 3300048911 Ga0496108_0306534 Ga0496108_0306534_51_1187 378
1277 3300048912 Ga0496109_0001786 Ga0496109_0001786_6686_7822 378
1278 3300048912 Ga0496109_0012091 Ga0496109_0012091_2500_3636 378
1279 3300048912 Ga0496109_0179306 Ga0496109_0179306_254_1390 378
1280 3300048913 Ga0496110_0000261 Ga0496110_0000261_30646_31782 378
1281 3300048913 Ga0496110_0122847 Ga0496110_0122847_427_1563 378
1282 3300048913 Ga0496110_0190478 Ga0496110_0190478_551_1687 378
1283 3300048914 Ga0496111_0000086 Ga0496111_0000086_29941_31077 378
1284 3300048914 Ga0496111_0015566 Ga0496111_0015566_3732_4868 378
1285 3300048914 Ga0496111_0037091 Ga0496111_0037091_221_1357 378
1286 3300048915 Ga0496112_0001342 Ga0496112_0001342_15485_16621 378
1287 3300048915 Ga0496112_0138629 Ga0496112_0138629_869_2005 378
1288 3300048917 Ga0496114_0005038 Ga0496114_0005038_546_1682 378
1289 3300048917 Ga0496114_0013075 Ga0496114_0013075_4993_6129 378
1290 3300048917 Ga0496114_0051774 Ga0496114_0051774_210_1346 378
1291 3300048918 Ga0496115_0001444 Ga0496115_0001444_10817_11953 378
1292 3300049572 Ga0501036_0113958 Ga0501036_0113958_1078_2214 378
1293 3300049576 Ga0501040_0047682 Ga0501040_0047682_775_1911 378
1294 3300049583 Ga0501067_0007671 Ga0501067_0007671_381_1517 378
1295 3300049587 Ga0501071_0047455 Ga0501071_0047455_40_1176 378
1296 3300049588 Ga0501072_0033625 Ga0501072_0033625_2350_3486 378
1297 3300049592 Ga0501076_0015191 Ga0501076_0015191_1374_2510 378
1298 3300049824 Ga0501045_0007918 Ga0501045_0007918_76_1212 378
1299 3300050507 nmdc:mga05p37_35371_c1 nmdc:mga05p37_35371_c1_1946_3085 378
1300 3300050508 nmdc:mga09592_48544_c1 nmdc:mga09592_48544_c1_984_2123 378
1301 3300050510 nmdc:mga06r32_43576_c2 nmdc:mga06r32_43576_c2_221_1360 378
1302 3300054114 Ga0501084_0255200 Ga0501084_0255200_132_1268 378
1303 3300061734 Ga0530510_0215536 Ga0530510_0215536_83_1219 378
1304 3300048907 Ga0496104_0015356 Ga0496104_0015356_579_1778 379
1305 3300048911 Ga0496108_0029111 Ga0496108_0029111_389_1588 379
1306 3300048914 Ga0496111_0015513 Ga0496111_0015513_80_1279 379
1307 3300049572 Ga0501036_0074584 Ga0501036_0074584_143_1285 379
1308 3300049588 Ga0501072_0255574 Ga0501072_0255574_190_1332 379
1309 3300061734 Ga0530510_0140585 Ga0530510_0140585_244_1386 379
1310 3300005468 Ga0070707_100203123 Ga0070707_1002031232 380
1311 3300005983 Ga0081540_1008249 Ga0081540_10082493 380
1312 3300041443 Ga0451789_0859302 Ga0451789_0859302_938_2083 380
1313 3300041451 Ga0451791_0558386 Ga0451791_0558386_176_1321 380
1314 3300041486 Ga0451807_0425442 Ga0451807_0425442_926_2071 380
1315 3300041494 Ga0451837_1761312 Ga0451837_1761312_334_1479 380
1316 3300041503 Ga0451847_0357101 Ga0451847_0357101_328_1473 380
1317 3300044706 Ga0466964_0002134 Ga0466964_0002134_2229_3374 380
1318 3300044901 Ga0466960_0009045 Ga0466960_0009045_14_1159 380
1319 3300045976 Ga0466967_0041989 Ga0466967_0041989_367_1512 380
1320 3300048908 Ga0496105_0204154 Ga0496105_0204154_11_1159 381
1321 3300005329 Ga0070683_100054436 Ga0070683_1000544363 382
1322 3300005336 Ga0070680_100017682 Ga0070680_1000176823 382
1323 3300005337 Ga0070682_100008611 Ga0070682_1000086114 382
1324 3300005347 Ga0070668_100099745 Ga0070668_1000997452 382
1325 3300005354 Ga0070675_100069430 Ga0070675_1000694301 382
1326 3300005366 Ga0070659_100079890 Ga0070659_1000798902 382
1327 3300005366 Ga0070659_100183694 Ga0070659_1001836942 382
1328 3300005459 Ga0068867_100162036 Ga0068867_1001620362 382
1329 3300005467 Ga0070706_100239936 Ga0070706_1002399362 382
1330 3300005468 Ga0070707_100010999 Ga0070707_1000109991 382
1331 3300005530 Ga0070679_100050153 Ga0070679_1000501533 382
1332 3300005539 Ga0068853_100107962 Ga0068853_1001079623 382
1333 3300005842 Ga0068858_100169895 Ga0068858_1001698952 382
1334 3300005937 Ga0081455_10001617 Ga0081455_100016176 382
1335 3300006028 Ga0070717_10011073 Ga0070717_100110732 382
1336 3300006058 Ga0075432_10000750 Ga0075432_100007508 382
1337 3300006844 Ga0075428_100001303 Ga0075428_10000130320 382
1338 3300006880 Ga0075429_100084138 Ga0075429_1000841382 382
1339 3300006914 Ga0075436_100003785 Ga0075436_1000037852 382
1340 3300009094 Ga0111539_10003299 Ga0111539_1000329923 382
1341 3300009094 Ga0111539_10003971 Ga0111539_1000397110 382
1342 3300009094 Ga0111539_10248138 Ga0111539_102481382 382
1343 3300009098 Ga0105245_10023427 Ga0105245_100234273 382
1344 3300009098 Ga0105245_10056010 Ga0105245_100560103 382
1345 3300009098 Ga0105245_10099401 Ga0105245_100994012 382
1346 3300009147 Ga0114129_10004297 Ga0114129_100042972 382
1347 3300009147 Ga0114129_10044815 Ga0114129_100448152 382
1348 3300009148 Ga0105243_10006339 Ga0105243_100063392 382
1349 3300009174 Ga0105241_10268157 Ga0105241_102681572 382
1350 3300009177 Ga0105248_10082769 Ga0105248_100827693 382
1351 3300009553 Ga0105249_10077274 Ga0105249_100772743 382
1352 3300010375 Ga0105239_10253809 Ga0105239_102538092 382
1353 3300013308 Ga0157375_10215987 Ga0157375_102159872 382
1354 3300013308 Ga0157375_10257845 Ga0157375_102578451 382
1355 3300025901 Ga0207688_10014046 Ga0207688_100140463 382
1356 3300025912 Ga0207707_10066774 Ga0207707_100667743 382
1357 3300025912 Ga0207707_10086183 Ga0207707_100861832 382
1358 3300025917 Ga0207660_10017835 Ga0207660_100178352 382
1359 3300025918 Ga0207662_10043243 Ga0207662_100432432 382
1360 3300025919 Ga0207657_10069183 Ga0207657_100691832 382
1361 3300025921 Ga0207652_10027760 Ga0207652_100277603 382
1362 3300025922 Ga0207646_10034267 Ga0207646_100342672 382
1363 3300025927 Ga0207687_10272718 Ga0207687_102727181 382
1364 3300025928 Ga0207700_10050286 Ga0207700_100502862 382
1365 3300025940 Ga0207691_10081765 Ga0207691_100817653 382
1366 3300025944 Ga0207661_10049766 Ga0207661_100497663 382
1367 3300025944 Ga0207661_10351678 Ga0207661_103516781 382
1368 3300025945 Ga0207679_10028164 Ga0207679_100281643 382
1369 3300025961 Ga0207712_10093076 Ga0207712_100930762 382
1370 3300026035 Ga0207703_10062061 Ga0207703_100620611 382
1371 3300026078 Ga0207702_10039464 Ga0207702_100394642 382
1372 3300026088 Ga0207641_10162474 Ga0207641_101624742 382
1373 3300026116 Ga0207674_10279718 Ga0207674_102797182 382
1374 3300026121 Ga0207683_10040649 Ga0207683_100406492 382
1375 3300027907 Ga0207428_10000401 Ga0207428_1000040123 382
1376 3300028379 Ga0268266_10134823 Ga0268266_101348232 382
1377 3300035112 Ga0373932_0016885 Ga0373932_0016885_420_1568 382
1378 3300037418 Ga0395900_0017760 Ga0395900_0017760_1629_2783 382
1379 3300037418 Ga0395900_0073341 Ga0395900_0073341_2256_3410 382
1380 3300037466 Ga0395898_0025376 Ga0395898_0025376_2804_3958 382
1381 3300037466 Ga0395898_0234078 Ga0395898_0234078_133_1287 382
1382 3300037471 Ga0395905_0074344 Ga0395905_0074344_1221_2375 382
1383 3300037471 Ga0395905_0153969 Ga0395905_0153969_130_1284 382
1384 3300038443 Ga0395901_0025193 Ga0395901_0025193_2322_3476 382
1385 3300038443 Ga0395901_0400462 Ga0395901_0400462_64_1218 382
1386 3300042115 Ga0450911_006739 Ga0450911_006739_49_1200 382
1387 3300046462 Ga0495651_0034559 Ga0495651_0034559_993_2150 382
1388 3300046463 Ga0495653_0060441 Ga0495653_0060441_651_1808 382
1389 3300046516 Ga0495628_0062049 Ga0495628_0062049_948_2105 382
1390 3300046559 Ga0495667_0086952 Ga0495667_0086952_112_1269 382
1391 3300046642 Ga0495634_0099324 Ga0495634_0099324_582_1739 382
1392 3300047317 Ga0495604_0096542 Ga0495604_0096542_586_1743 382
1393 3300047471 Ga0495684_0048770 Ga0495684_0048770_290_1447 382
1394 3300048903 Ga0496100_0104827 Ga0496100_0104827_141_1289 382
1395 3300048907 Ga0496104_0010706 Ga0496104_0010706_1459_2622 382
1396 3300048911 Ga0496108_0004699 Ga0496108_0004699_39_1190 382
1397 3300048913 Ga0496110_0269960 Ga0496110_0269960_255_1406 382
1398 3300048915 Ga0496112_0181955 Ga0496112_0181955_226_1377 382
1399 3300049568 Ga0501031_0097335 Ga0501031_0097335_726_1877 382
1400 3300049569 Ga0501032_0048700 Ga0501032_0048700_675_1826 382
1401 3300049572 Ga0501036_0038558 Ga0501036_0038558_2186_3337 382
1402 3300049572 Ga0501036_0139634 Ga0501036_0139634_646_1794 382
1403 3300049573 Ga0501037_0018639 Ga0501037_0018639_491_1642 382
1404 3300049574 Ga0501038_0011276 Ga0501038_0011276_172_1323 382
1405 3300049575 Ga0501039_0044588 Ga0501039_0044588_2261_3412 382
1406 3300049576 Ga0501040_0007687 Ga0501040_0007687_4533_5681 382
1407 3300049577 Ga0501041_0040000 Ga0501041_0040000_618_1769 382
1408 3300049578 Ga0501042_0008403 Ga0501042_0008403_532_1683 382
1409 3300049578 Ga0501042_0060847 Ga0501042_0060847_1460_2608 382
1410 3300049578 Ga0501042_0135235 Ga0501042_0135235_496_1647 382
1411 3300049579 Ga0501043_0021319 Ga0501043_0021319_3239_4390 382
1412 3300049580 Ga0501046_0121329 Ga0501046_0121329_255_1406 382
1413 3300049582 Ga0501048_0005096 Ga0501048_0005096_2604_3752 382
1414 3300049584 Ga0501068_0002912 Ga0501068_0002912_1939_3090 382
1415 3300049584 Ga0501068_0023831 Ga0501068_0023831_1589_2740 382
1416 3300049584 Ga0501068_0051755 Ga0501068_0051755_1022_2170 382
1417 3300049586 Ga0501070_0014203 Ga0501070_0014203_608_1759 382
1418 3300049587 Ga0501071_0022278 Ga0501071_0022278_2801_3952 382
1419 3300049587 Ga0501071_0150202 Ga0501071_0150202_256_1407 382
1420 3300049588 Ga0501072_0005951 Ga0501072_0005951_3014_4165 382
1421 3300049588 Ga0501072_0006650 Ga0501072_0006650_7541_8689 382
1422 3300049589 Ga0501073_0021438 Ga0501073_0021438_3465_4616 382
1423 3300049591 Ga0501075_0072389 Ga0501075_0072389_744_1895 382
1424 3300049592 Ga0501076_0005825 Ga0501076_0005825_7500_8651 382
1425 3300049593 Ga0501077_0003592 Ga0501077_0003592_30_1181 382
1426 3300049593 Ga0501077_0006692 Ga0501077_0006692_5493_6644 382
1427 3300049593 Ga0501077_0027290 Ga0501077_0027290_1478_2626 382
1428 3300049741 Ga0501079_0010228 Ga0501079_0010228_5801_6952 382
1429 3300049741 Ga0501079_0145813 Ga0501079_0145813_574_1725 382
1430 3300049742 Ga0501080_0002972 Ga0501080_0002972_8283_9434 382
1431 3300049742 Ga0501080_0120549 Ga0501080_0120549_1014_2162 382
1432 3300049743 Ga0501081_0054276 Ga0501081_0054276_208_1356 382
1433 3300049744 Ga0501083_0002782 Ga0501083_0002782_5759_6910 382
1434 3300049822 Ga0501035_0134410 Ga0501035_0134410_144_1295 382
1435 3300049824 Ga0501045_0044673 Ga0501045_0044673_1305_2453 382
1436 3300050491 nmdc:mga00v17_122428_c1 nmdc:mga00v17_122428_c1_171_1322 382
1437 3300050491 nmdc:mga00v17_33219_c1 nmdc:mga00v17_33219_c1_556_1707 382
1438 3300050507 nmdc:mga05p37_19483_c1 nmdc:mga05p37_19483_c1_3672_4832 382
1439 3300050507 nmdc:mga05p37_36077_c1 nmdc:mga05p37_36077_c1_3591_4745 382
1440 3300050507 nmdc:mga05p37_3733_c1 nmdc:mga05p37_3733_c1_1476_2627 382
1441 3300050508 nmdc:mga09592_80395_c1 nmdc:mga09592_80395_c1_397_1548 382
1442 3300050511 nmdc:mga08y16_18269_c1 nmdc:mga08y16_18269_c1_3375_4526 382
1443 3300050511 nmdc:mga08y16_23428_c1 nmdc:mga08y16_23428_c1_3959_5128 382
1444 3300050511 nmdc:mga08y16_62848_c1 nmdc:mga08y16_62848_c1_2235_3383 382
1445 3300050513 nmdc:mga0rr50_37927_c1 nmdc:mga0rr50_37927_c1_1604_2758 382
1446 3300050514 nmdc:mga08x19_30543_c1 nmdc:mga08x19_30543_c1_1948_3102 382
1447 3300050515 nmdc:mga0a205_25950_c1 nmdc:mga0a205_25950_c1_2405_3559 382
1448 3300050515 nmdc:mga0a205_4243_c1 nmdc:mga0a205_4243_c1_9559_10710 382
1449 3300053085 Ga0495619_0032595 Ga0495619_0032595_1691_2854 382
1450 3300054114 Ga0501084_0017510 Ga0501084_0017510_4031_5182 382
1451 3300054114 Ga0501084_0072193 Ga0501084_0072193_1098_2246 382
1452 3300060353 Ga0501082_0001301 Ga0501082_0001301_1492_2643 382
1453 3300060353 Ga0501082_0238202 Ga0501082_0238202_381_1532 382
1454 3300009098 Ga0105245_10156419 Ga0105245_101564191 384
1455 3300013308 Ga0157375_10010636 Ga0157375_100106364 384
1456 3300025940 Ga0207691_10161330 Ga0207691_101613302 384
1457 3300046500 Ga0495596_0010418 Ga0495596_0010418_2129_3322 384
1458 3300048903 Ga0496100_0033386 Ga0496100_0033386_1513_2685 385
1459 3300048904 Ga0496101_0011238 Ga0496101_0011238_311_1483 385
1460 3300048912 Ga0496109_0320670 Ga0496109_0320670_223_1395 385
1461 3300048914 Ga0496111_0084877 Ga0496111_0084877_225_1397 385
1462 3300050490 nmdc:mga03n38_105198_c1 nmdc:mga03n38_105198_c1_164_1333 387
1463 3300009177 Ga0105248_10523474 Ga0105248_105234741 388
1464 3300037312 Ga0395899_0045828 Ga0395899_0045828_132_1298 388
1465 3300037418 Ga0395900_0002489 Ga0395900_0002489_5961_7127 388
1466 3300037471 Ga0395905_0002440 Ga0395905_0002440_17833_18999 388
1467 3300038443 Ga0395901_0001334 Ga0395901_0001334_5018_6184 388
1468 3300025922 Ga0207646_10151998 Ga0207646_101519981 389
1469 3300005329 Ga0070683_100005382 Ga0070683_10000538211 392
1470 3300005458 Ga0070681_10003469 Ga0070681_100034696 392
1471 3300005547 Ga0070693_100001220 Ga0070693_1000012203 392
1472 3300005614 Ga0068856_100067683 Ga0068856_1000676834 392
1473 3300025935 Ga0207709_10034102 Ga0207709_100341022 392
1474 3300025944 Ga0207661_10019880 Ga0207661_100198805 392
1475 3300026078 Ga0207702_10064741 Ga0207702_100647411 392
1476 3300048904 Ga0496101_0027736 Ga0496101_0027736_2727_3923 392
1477 3300048905 Ga0496102_0189023 Ga0496102_0189023_636_1814 392
1478 3300048907 Ga0496104_0001048 Ga0496104_0001048_15036_16262 392
1479 3300048907 Ga0496104_0033050 Ga0496104_0033050_1506_2684 392
1480 3300048908 Ga0496105_0006507 Ga0496105_0006507_2710_3936 392
1481 3300048912 Ga0496109_0000463 Ga0496109_0000463_3258_4484 392
1482 3300048913 Ga0496110_0000563 Ga0496110_0000563_4190_5416 392
1483 3300048914 Ga0496111_0009336 Ga0496111_0009336_4992_6188 392
1484 3300048917 Ga0496114_0007053 Ga0496114_0007053_241_1467 392
1485 3300048917 Ga0496114_0043772 Ga0496114_0043772_1994_3172 392
1486 3300009148 Ga0105243_10139786 Ga0105243_101397862 394
1487 3300048910 Ga0496107_0039267 Ga0496107_0039267_2084_3286 394
1488 3300048915 Ga0496112_0081946 Ga0496112_0081946_1588_2790 394
1489 3300050511 nmdc:mga08y16_104427_c1 nmdc:mga08y16_104427_c1_31_1326 394
1490 3300001991 JGI24743J22301_10000282 JGI24743J22301_100002823 398
1491 3300001991 JGI24743J22301_10000603 JGI24743J22301_100006033 398
1492 3300002075 JGI24738J21930_10003185 JGI24738J21930_100031852 398
1493 3300005327 Ga0070658_10004240 Ga0070658_1000424010 398
1494 3300005329 Ga0070683_100007989 Ga0070683_1000079898 398
1495 3300005338 Ga0068868_100009122 Ga0068868_1000091224 398
1496 3300005339 Ga0070660_100002662 Ga0070660_1000026624 398
1497 3300005341 Ga0070691_10008182 Ga0070691_100081823 398
1498 3300005344 Ga0070661_100004700 Ga0070661_1000047009 398
1499 3300005364 Ga0070673_100018041 Ga0070673_1000180414 398
1500 3300005456 Ga0070678_100005626 Ga0070678_1000056267 398
1501 3300005457 Ga0070662_100005800 Ga0070662_1000058003 398
1502 3300005458 Ga0070681_10044643 Ga0070681_100446432 398
1503 3300005466 Ga0070685_10102893 Ga0070685_101028931 398
1504 3300005530 Ga0070679_100030486 Ga0070679_1000304862 398
1505 3300005539 Ga0068853_100005085 Ga0068853_1000050859 398
1506 3300005543 Ga0070672_100014580 Ga0070672_1000145803 398
1507 3300005544 Ga0070686_100012478 Ga0070686_1000124782 398
1508 3300005547 Ga0070693_100104181 Ga0070693_1001041811 398
1509 3300005564 Ga0070664_100023185 Ga0070664_1000231852 398
1510 3300005578 Ga0068854_100002544 Ga0068854_1000025445 398
1511 3300005614 Ga0068856_100081000 Ga0068856_1000810002 398
1512 3300005718 Ga0068866_10030513 Ga0068866_100305133 398
1513 3300005834 Ga0068851_10004369 Ga0068851_100043695 398
1514 3300006881 Ga0068865_100025366 Ga0068865_1000253664 398
1515 3300006931 Ga0097620_100094397 Ga0097620_1000943973 398
1516 3300013102 Ga0157371_10005631 Ga0157371_1000563110 398
1517 3300014745 Ga0157377_10006271 Ga0157377_100062716 398
1518 3300025321 Ga0207656_10068963 Ga0207656_100689631 398
1519 3300025901 Ga0207688_10000576 Ga0207688_100005766 398
1520 3300025909 Ga0207705_10134791 Ga0207705_101347912 398
1521 3300025912 Ga0207707_10045926 Ga0207707_100459263 398
1522 3300025917 Ga0207660_10168532 Ga0207660_101685321 398
1523 3300025926 Ga0207659_10003581 Ga0207659_100035814 398
1524 3300025927 Ga0207687_10014378 Ga0207687_100143782 398
1525 3300025932 Ga0207690_10033102 Ga0207690_100331023 398
1526 3300025937 Ga0207669_10016551 Ga0207669_100165513 398
1527 3300025940 Ga0207691_10008282 Ga0207691_100082824 398
1528 3300025960 Ga0207651_10009549 Ga0207651_100095494 398
1529 3300025981 Ga0207640_10005817 Ga0207640_100058173 398
1530 3300026041 Ga0207639_10031208 Ga0207639_100312082 398
1531 3300026067 Ga0207678_10054666 Ga0207678_100546663 398
1532 3300026078 Ga0207702_10176573 Ga0207702_101765732 398
1533 3300026089 Ga0207648_10005403 Ga0207648_100054036 398
1534 3300026118 Ga0207675_100074404 Ga0207675_1000744043 398
1535 3300026121 Ga0207683_10012548 Ga0207683_100125482 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04551

GcpE

GcpE protein

18

391

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mwa-assembly2.cif.gz_F 1.85 angstrom crystal structure of gcpe protein from bacillus anthracis 0.9706 21 270
4mwa-assembly3.cif.gz_C 1.85 angstrom crystal structure of gcpe protein from bacillus anthracis 0.9646 17 270
4mwa-assembly3.cif.gz_D 1.85 angstrom crystal structure of gcpe protein from bacillus anthracis 0.9549 17 270
4mwa-assembly3.cif.gz_C 1.85 angstrom crystal structure of gcpe protein from bacillus anthracis 0.95 17 270
4mwa-assembly3.cif.gz_D 1.85 angstrom crystal structure of gcpe protein from bacillus anthracis 0.94 17 270
ID Description Score Start End Superfamily
4mwaH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9595 17 267 3.20.20.20
3noyC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.957 17 269 3.20.20.20
4mwaH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.952 17 267 3.20.20.20
3noyC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9425 17 269 3.20.20.20
af_Q8IJH7_114_401_3.20.20.20 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.924 17 269 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A7Y6CGD7-F1-model_v4 Flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase 1.001 17 105 GO:0016114
GO:0019288
GO:0046429
AF-A0A535T8F0-F1-model_v4 Flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase 0.9994 21 114 GO:0016114
GO:0019288
GO:0046429
AF-A0A3B9J5S5-F1-model_v4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 0.9938 21 107 GO:0016114
GO:0019288
GO:0046429
AF-A0A7V6RLE3-F1-model_v4 Flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase 0.9927 21 109 GO:0016114
GO:0019288
GO:0046429
AF-A0A3C0RQJ6-F1-model_v4 deleted 0.9924 21 110

Feature Viewer

pLDDT pTM Quality
86.7 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map