F494643

General Info

Members Datasets Scaffolds Average Seq Length
1538 583 3076 424

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10003643|Ga0207690_100036439
Length 469
Sequence MSASFEATSTWAAARDAVDPLRAFRDEFLIPPHEGRDSAYFCGNSLGLQPRAVREAVNAELDYWGELGVEGHFKGRLPWMDYHEFVRDDLAAVVGALPAEVVAMNTLGVNLHLMMVSFYRPSAGRPAILIEAGAFPTDRYAVESQIRFHGFDPASALIELEADEPNGIVSLAAIERALVEHGERIALVMLPGVQYRTGQAFDLKAITALGHKHGCTVGFDLAHAVGNLPLQLHDSGADFAIWCSYKYLNSGPGAVGGAFVHQRHAKAVLPRFAGWWGHDKTTRFQMGPEFVPTPGADGWQLSNPPILALAPLRVSLEIFRRAGIAALREKSLALTGYLEWLVQTQLSDVLEVVTPAEPQRRGAQLSIRVTGGRERGRALFEYLMAHGIIGDWREPDVIRISPAPAVQPVRGLPGVCRSGEGVASRLTLRGRNQPDPPNAALVALPRDCARIHRASTQAIGPSPDAQAKH

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
100 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
101 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
102 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
103 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
104 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
105 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
112 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
157 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
160 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
161 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
162 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
167 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
177 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
178 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
181 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
182 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
183 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
264 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
265 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
266 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
267 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
268 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
269 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
270 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
271 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
272 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
273 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
275 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
276 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
277 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
278 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
279 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
280 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
281 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
282 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
283 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
284 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
285 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
286 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
287 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
288 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
289 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
292 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
293 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
294 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
295 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
298 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
299 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
300 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
301 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
302 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
303 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
304 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
308 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
317 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
318 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
319 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
320 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
321 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
322 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
323 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
324 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
325 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
326 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
327 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
328 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
329 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
330 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
331 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
332 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
333 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
334 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
335 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
336 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
337 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
338 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
339 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
340 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
341 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
342 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
343 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
344 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
345 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
346 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
347 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
348 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
349 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
350 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
351 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
352 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
353 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
354 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
355 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
356 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
357 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
358 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
359 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
360 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
361 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
362 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
363 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
364 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
365 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
366 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
369 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
370 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
371 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
372 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
373 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
374 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
377 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
378 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
379 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
382 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
383 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
384 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
385 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
386 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
391 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
392 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
393 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
394 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
395 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
396 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
397 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
398 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
399 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
400 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
401 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
402 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
405 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
406 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
407 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
408 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
409 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
414 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
415 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
425 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
426 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
427 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
428 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
429 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
430 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
431 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
432 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
433 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
434 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
435 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
436 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
437 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
438 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
439 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
452 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
453 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
454 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
455 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
456 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
457 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
458 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
459 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
460 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
461 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
462 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
463 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
464 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
471 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
472 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
473 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
474 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
475 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
476 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
477 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
478 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
479 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
480 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
481 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
482 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
483 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
484 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
485 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
488 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
489 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
490 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
491 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
492 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
493 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
494 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
495 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
496 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
497 2643221559 Lysobacter sp. Root559 Isolate Unclassified
498 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
499 2643221573 Lysobacter sp. Root604 Isolate Unclassified
500 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
501 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
502 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
503 2643221586 Lysobacter sp. Root667 Isolate Unclassified
504 2643221593 Lysobacter sp. Root690 Isolate Unclassified
505 2643221612 Lysobacter sp. Root76 Isolate Unclassified
506 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
507 2643221695 Lysobacter sp. Root494 Isolate Unclassified
508 2643221720 Lysobacter sp. Root916 Isolate Unclassified
509 2643221727 Lysobacter sp. Root96 Isolate Unclassified
510 2643221728 Lysobacter sp. Root983 Isolate Unclassified
511 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
512 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
513 2734482264 Dyella sp. AD052 Isolate Unclassified
514 2738541302 Pedobacter sp. CF074 Isolate Unclassified
515 2738543009 Luteibacter sp. OK325 Isolate Unclassified
516 2739367656 Pedobacter sp. CF523 Isolate Unclassified
517 2739367663 Pedobacter sp. YR510 Isolate Unclassified
518 2739367700 Dyella sp. YR388 Isolate Unclassified
519 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
520 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
521 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
522 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
523 2818991437 Pedobacter terrae 518 Isolate Unclassified
524 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
525 2818991457 Xanthomonas translucens 569 Isolate Unclassified
526 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
527 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
528 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
529 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
530 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
531 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
532 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
533 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
534 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
535 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
536 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
537 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
538 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
539 2884411467 Dyella sp. AD56 Isolate Rhizosphere
540 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
541 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
542 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
543 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
544 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
545 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
546 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
547 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
548 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
549 2919085039 Luteibacter sp. 1214 Isolate Unclassified
550 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
551 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
552 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
553 2919404418 Luteibacter sp. 3190 Isolate Unclassified
554 2919513703 Luteimonas sp. 3794 Isolate Unclassified
555 2919675420 Luteimonas terrae 4099 Isolate Unclassified
556 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
557 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
558 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
559 2928963466 Dyella japonica 1073 Isolate Unclassified
560 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
561 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
562 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
563 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
564 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
565 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
566 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
567 2941471342 Luteibacter sp. 621 Isolate Unclassified
568 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
569 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
570 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
571 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
572 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
573 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
574 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
575 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
576 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
577 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
578 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
579 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
580 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
581 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
582 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
583 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0.52
Isolates 6.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.2
Nodule 0.07
Rhizoplane 3.97
Rhizosphere 68.92
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10003643 3300025932 Bacteria 9174
2 MBSR1b_contig_900596 2162886012 Bacteria 1899
3 JGI24739J22299_10007286 3300001989 Bacteria 4156
4 JGI24737J22298_10009783 3300001990 Bacteria 3177
5 JGI24737J22298_10010243 3300001990 Bacteria 3098
6 JGI24735J21928_10000835 3300002067 Bacteria 10961
7 JGI24738J21930_10001462 3300002075 Bacteria 6561
8 JGI24751J29686_10003122 3300002459 Bacteria 3338
9 JGI25156J39149_1000463 3300002705 Bacteria 24552
10 JGI25156J39149_1005915 3300002705 Bacteria 3432
11 JGI25162J39368_1000163 3300002737 Bacteria 74121
12 JGI25162J39368_1001323 3300002737 Bacteria 13849
13 JGI25162J39368_1001643 3300002737 Bacteria 11141
14 JGI25162J39368_1002322 3300002737 Bacteria 7606
15 JGI25162J39368_1003786 3300002737 Bacteria 4030
16 JGI25157J39369_1000229 3300002741 Bacteria 43921
17 JGI25157J39369_1000575 3300002741 Bacteria 21822
18 JGI25157J39369_1001131 3300002741 Bacteria 11760
19 JGI25157J39369_1001217 3300002741 Bacteria 10709
20 JGI25163J39215_1000340 3300002771 Bacteria 15446
21 JGI25164J39214_1000045 3300002772 Bacteria 125909
22 JGI25164J39214_1000285 3300002772 Bacteria 35663
23 JGI25164J39214_1000485 3300002772 Bacteria 19655
24 JGI25164J39214_1000690 3300002772 Bacteria 13175
25 JGI25164J39214_1000749 3300002772 Bacteria 12067
26 JGI25164J39214_1002903 3300002772 Unclassified 2366
27 JGI25152J39213_1000032 3300002773 Bacteria 96369
28 JGI25152J39213_1000075 3300002773 Bacteria 66427
29 JGI25150J39212_1000009 3300002774 Bacteria 249509
30 JGI25150J39212_1000179 3300002774 Bacteria 35481
31 JGI25151J46595_10000017 3300003187 Bacteria 249509
32 JGI25151J46595_10000138 3300003187 Bacteria 96369
33 JGI25151J46595_10000148 3300003187 Bacteria 92040
34 JGI25165J46597_1000072 3300003214 Bacteria 192184
35 JGI25165J46597_1000215 3300003214 Bacteria 81941
36 JGI25165J46597_1000812 3300003214 Bacteria 23523
37 JGI25165J46597_1002118 3300003214 Bacteria 7197
38 JGI25153J46596_10000023 3300003215 Bacteria 249509
39 JGI25153J46596_10000102 3300003215 Bacteria 96369
40 rootH1_10029918 3300003316 Bacteria 3941
41 rootH2_10004805 3300003320 Bacteria 5713
42 rootL2_10019089 3300003322 Bacteria 14586
43 rootL2_10163832 3300003322 Bacteria 2064
44 rootL2_10251176 3300003322 Bacteria 1660
45 rootL2_10337394 3300003322 Unclassified 2851
46 Ga0006562J51391_1006721 3300003578 Bacteria 25172
47 Ga0006562J51391_1006724 3300003578 Bacteria 2940
48 Ga0006562J51391_1025422 3300003578 Bacteria 3940
49 Ga0006562J51391_1025425 3300003578 Bacteria 3340
50 Ga0055538_1000813 3300003751 Bacteria 8451
51 Ga0055539_1000576 3300003752 Bacteria 10355
52 Ga0055533_1000506 3300003756 Bacteria 14133
53 Ga0055525_1000027 3300003759 Bacteria 340506
54 Ga0055527_1000082 3300003760 Bacteria 75048
55 Ga0055527_1000209 3300003760 Bacteria 37913
56 Ga0055527_1001662 3300003760 Bacteria 4387
57 Ga0055535_1000124 3300003761 Bacteria 81941
58 Ga0055535_1000143 3300003761 Bacteria 75049
59 Ga0055535_1000451 3300003761 Bacteria 37913
60 Ga0055535_1000831 3300003761 Bacteria 22164
61 Ga0055535_1000945 3300003761 Bacteria 19255
62 Ga0055542_1000190 3300003762 Bacteria 75049
63 Ga0055542_1000197 3300003762 Bacteria 74121
64 Ga0055542_1000242 3300003762 Bacteria 62798
65 Ga0055542_1000349 3300003762 Bacteria 48521
66 Ga0055542_1000466 3300003762 Bacteria 37913
67 Ga0055542_1000497 3300003762 Bacteria 36142
68 Ga0055529_1000197 3300003763 Bacteria 81941
69 Ga0055529_1000204 3300003763 Bacteria 78293
70 Ga0055529_1000217 3300003763 Bacteria 75049
71 Ga0055529_1001596 3300003763 Bacteria 6169
72 Ga0055526_1000006 3300003771 Bacteria 330857
73 Ga0055526_1007145 3300003771 Bacteria 5882
74 Ga0055537_1000018 3300003773 Bacteria 123452
75 Ga0055524_1000009 3300003775 Bacteria 295254
76 Ga0055524_1004161 3300003775 Bacteria 6764
77 Ga0055524_1015188 3300003775 Bacteria 2818
78 Ga0055536_1002383 3300003781 Bacteria 10598
79 Ga0055536_1003808 3300003781 Bacteria 7949
80 Ga0055536_1004891 3300003781 Bacteria 6687
81 Ga0055536_1006471 3300003781 Bacteria 5457
82 Ga0055536_1012472 3300003781 Bacteria 3152
83 Ga0055534_1000004 3300003784 Bacteria 295251
84 Ga0055534_1000073 3300003784 Bacteria 77473
85 Ga0055528_1000003 3300003790 Bacteria 330875
86 Ga0055528_1000080 3300003790 Bacteria 75390
87 Ga0055530_10001767 3300003791 Bacteria 15103
88 Ga0055530_10001774 3300003791 Bacteria 15004
89 Ga0055530_10003477 3300003791 Bacteria 8935
90 Ga0055531_10003032 3300003794 Bacteria 10884
91 Ga0055531_10011795 3300003794 Bacteria 4173
92 Ga0055531_10011796 3300003794 Bacteria 4173
93 Ga0055531_10011911 3300003794 Bacteria 4140
94 Ga0055531_10016716 3300003794 Bacteria 3146
95 Ga0055531_10017787 3300003794 Bacteria 2976
96 Ga0058692_1000012 3300003856 Bacteria 318930
97 Ga0058692_1000023 3300003856 Bacteria 237263
98 Ga0065165_1000118 3300005262 Bacteria 134488
99 Ga0065165_1004303 3300005262 Bacteria 8959
100 Ga0065714_10004312 3300005288 Bacteria 6023
101 Ga0065714_10064511 3300005288 Bacteria 45172
102 Ga0065704_10071057 3300005289 Bacteria 13463
103 Ga0065715_10007275 3300005293 Bacteria 3620
104 Ga0065715_10100212 3300005293 Bacteria 3311
105 Ga0065715_10123711 3300005293 Bacteria 2171
106 Ga0070658_10001254 3300005327 Bacteria 21751
107 Ga0070658_10013372 3300005327 Bacteria 6584
108 Ga0070676_10003356 3300005328 Bacteria 8331
109 Ga0070683_100001622 3300005329 Bacteria 17399
110 Ga0070683_100053648 3300005329 Bacteria 3736
111 Ga0070690_100000327 3300005330 Bacteria 24351
112 Ga0070690_100049203 3300005330 Bacteria 2686
113 Ga0070670_100005062 3300005331 Bacteria 11088
114 Ga0070670_100013423 3300005331 Bacteria 7016
115 Ga0070677_10000209 3300005333 Bacteria 20187
116 Ga0068869_100000286 3300005334 Bacteria 26923
117 Ga0068869_100119781 3300005334 Bacteria 2012
118 Ga0070666_10000005 3300005335 Bacteria 343092
119 Ga0070666_10000109 3300005335 Bacteria 56796
120 Ga0070666_10000805 3300005335 Bacteria 19067
121 Ga0070666_10002869 3300005335 Bacteria 10405
122 Ga0070666_10057434 3300005335 Bacteria 2629
123 Ga0070666_10075482 3300005335 Bacteria 2298
124 Ga0070680_100002873 3300005336 Bacteria 12792
125 Ga0070680_100011321 3300005336 Bacteria 6898
126 Ga0070680_100023548 3300005336 Bacteria 4912
127 Ga0070682_100007901 3300005337 Bacteria 5987
128 Ga0068868_100000557 3300005338 Bacteria 24976
129 Ga0068868_100013762 3300005338 Bacteria 5944
130 Ga0068868_100028857 3300005338 Bacteria 4246
131 Ga0068868_100202520 3300005338 Bacteria 1655
132 Ga0070660_100000479 3300005339 Bacteria 26732
133 Ga0070660_100016908 3300005339 Bacteria 5308
134 Ga0070660_100038440 3300005339 Bacteria 3633
135 Ga0070689_100000344 3300005340 Bacteria 27203
136 Ga0070689_100001122 3300005340 Bacteria 16865
137 Ga0070689_100123459 3300005340 Bacteria 2070
138 Ga0070687_100000032 3300005343 Bacteria 43649
139 Ga0070661_100000412 3300005344 Bacteria 33114
140 Ga0070661_100001964 3300005344 Bacteria 14204
141 Ga0070661_100060203 3300005344 Bacteria 2786
142 Ga0070661_100087117 3300005344 Bacteria 2309
143 Ga0070661_100214566 3300005344 Bacteria 1474
144 Ga0070692_10025985 3300005345 Bacteria 2891
145 Ga0070668_100000345 3300005347 Bacteria 30655
146 Ga0070668_100015091 3300005347 Bacteria 5772
147 Ga0070668_100084432 3300005347 Bacteria 2494
148 Ga0070668_100121502 3300005347 Bacteria 2088
149 Ga0070669_100000307 3300005353 Bacteria 38485
150 Ga0070669_100179532 3300005353 Bacteria 1655
151 Ga0070675_100001155 3300005354 Bacteria 19067
152 Ga0070675_100203501 3300005354 Bacteria 1719
153 Ga0070671_100001287 3300005355 Bacteria 18808
154 Ga0070671_100040396 3300005355 Bacteria 3874
155 Ga0070674_100000600 3300005356 Bacteria 18217
156 Ga0070674_100057417 3300005356 Bacteria 2702
157 Ga0070674_100121502 3300005356 Bacteria 1934
158 Ga0070673_100001765 3300005364 Bacteria 12883
159 Ga0070673_100164532 3300005364 Bacteria 1889
160 Ga0070673_100266514 3300005364 Bacteria 1498
161 Ga0070688_100000122 3300005365 Bacteria 41175
162 Ga0070659_100000635 3300005366 Bacteria 25714
163 Ga0070659_100210426 3300005366 Bacteria 1603
164 Ga0070659_100266770 3300005366 Bacteria 1421
165 Ga0070667_100000008 3300005367 Bacteria 285591
166 Ga0070667_100001757 3300005367 Bacteria 19320
167 Ga0070667_100008888 3300005367 Bacteria 8315
168 Ga0070667_100012080 3300005367 Bacteria 7149
169 Ga0070709_10000150 3300005434 Bacteria 45712
170 Ga0070709_10002949 3300005434 Bacteria 9163
171 Ga0070709_10008131 3300005434 Bacteria 5758
172 Ga0070709_10019946 3300005434 Bacteria 3885
173 Ga0070714_100000149 3300005435 Bacteria 55827
174 Ga0070714_100000458 3300005435 Bacteria 29649
175 Ga0070714_100004355 3300005435 Bacteria 10668
176 Ga0070714_100036194 3300005435 Bacteria 4139
177 Ga0070714_100143837 3300005435 Bacteria 2143
178 Ga0070714_100173984 3300005435 Bacteria 1955
179 Ga0070713_100003277 3300005436 Bacteria 10669
180 Ga0070713_100008095 3300005436 Bacteria 7433
181 Ga0070713_100109078 3300005436 Bacteria 2411
182 Ga0070713_100155737 3300005436 Bacteria 2036
183 Ga0070710_10025891 3300005437 Bacteria 3110
184 Ga0070701_10005911 3300005438 Bacteria 5107
185 Ga0070711_100002260 3300005439 Bacteria 10929
186 Ga0070705_100000279 3300005440 Bacteria 30554
187 Ga0070700_100002942 3300005441 Bacteria 8741
188 Ga0070694_100000204 3300005444 Bacteria 31438
189 Ga0070708_100020082 3300005445 Bacteria 5627
190 Ga0070663_100000597 3300005455 Bacteria 19230
191 Ga0070663_100002347 3300005455 Bacteria 10638
192 Ga0070663_100003417 3300005455 Bacteria 9162
193 Ga0070663_100057041 3300005455 Bacteria 2800
194 Ga0070678_100002705 3300005456 Bacteria 9783
195 Ga0070678_100003908 3300005456 Bacteria 8377
196 Ga0070662_100000190 3300005457 Bacteria 35766
197 Ga0070662_100075920 3300005457 Bacteria 2490
198 Ga0070662_100107941 3300005457 Bacteria 2116
199 Ga0070681_10003155 3300005458 Bacteria 15329
200 Ga0070681_10007152 3300005458 Bacteria 10874
201 Ga0070681_10009885 3300005458 Bacteria 9400
202 Ga0070681_10034041 3300005458 Bacteria 5117
203 Ga0070681_10075230 3300005458 Bacteria 3337
204 Ga0070681_10157559 3300005458 Bacteria 2195
205 Ga0068867_100054893 3300005459 Bacteria 2944
206 Ga0068867_100066135 3300005459 Bacteria 2692
207 Ga0068867_100132916 3300005459 Bacteria 1936
208 Ga0070685_10000369 3300005466 Bacteria 27325
209 Ga0070685_10006608 3300005466 Bacteria 5916
210 Ga0070706_100173054 3300005467 Bacteria 2016
211 Ga0070679_100018451 3300005530 Bacteria 6771
212 Ga0070679_100092110 3300005530 Bacteria 3019
213 Ga0070684_100014406 3300005535 Bacteria 6407
214 Ga0070684_100137306 3300005535 Unclassified 2209
215 Ga0070684_100141543 3300005535 Bacteria 2175
216 Ga0070684_100290343 3300005535 Bacteria 1499
217 Ga0068853_100000259 3300005539 Bacteria 37244
218 Ga0068853_100032558 3300005539 Bacteria 4416
219 Ga0068853_100047562 3300005539 Bacteria 3681
220 Ga0068853_100048355 3300005539 Bacteria 3653
221 Ga0068853_100110242 3300005539 Bacteria 2444
222 Ga0070672_100000406 3300005543 Bacteria 24976
223 Ga0070672_100026633 3300005543 Bacteria 4306
224 Ga0070672_100069142 3300005543 Bacteria 2802
225 Ga0070686_100000081 3300005544 Bacteria 69623
226 Ga0070696_100004581 3300005546 Bacteria 9229
227 Ga0070693_100005994 3300005547 Bacteria 5877
228 Ga0070693_100032053 3300005547 Bacteria 2886
229 Ga0070665_100000057 3300005548 Bacteria 237271
230 Ga0070665_100000509 3300005548 Bacteria 55803
231 Ga0070665_100002620 3300005548 Bacteria 19622
232 Ga0070665_100009037 3300005548 Bacteria 10094
233 Ga0070665_100010946 3300005548 Bacteria 9174
234 Ga0070665_100012054 3300005548 Bacteria 8721
235 Ga0070665_100025397 3300005548 Bacteria 5970
236 Ga0070665_100031583 3300005548 Bacteria 5331
237 Ga0070665_100102384 3300005548 Bacteria 2867
238 Ga0070704_100000581 3300005549 Bacteria 17577
239 Ga0070704_100045333 3300005549 Bacteria 3059
240 Ga0068855_100001159 3300005563 Bacteria 32670
241 Ga0068855_100003960 3300005563 Bacteria 18083
242 Ga0068855_100010678 3300005563 Bacteria 11080
243 Ga0068855_100018608 3300005563 Bacteria 8355
244 Ga0068855_100072638 3300005563 Bacteria 3998
245 Ga0068855_100102303 3300005563 Bacteria 3297
246 Ga0068855_100116428 3300005563 Bacteria 3063
247 Ga0068855_100156309 3300005563 Bacteria 2590
248 Ga0068855_100242798 3300005563 Bacteria 2012
249 Ga0068855_100429319 3300005563 Bacteria 1444
250 Ga0070664_100001026 3300005564 Bacteria 21934
251 Ga0070664_100001532 3300005564 Bacteria 18458
252 Ga0070664_100153113 3300005564 Bacteria 2036
253 Ga0070664_100283393 3300005564 Bacteria 1494
254 Ga0068857_100001061 3300005577 Bacteria 21266
255 Ga0068857_100003310 3300005577 Bacteria 13395
256 Ga0068857_100007464 3300005577 Bacteria 9411
257 Ga0068857_100179486 3300005577 Bacteria 1927
258 Ga0068857_100191818 3300005577 Bacteria 1861
259 Ga0068857_100232965 3300005577 Bacteria 1685
260 Ga0068854_100000223 3300005578 Bacteria 38461
261 Ga0068854_100000451 3300005578 Bacteria 25413
262 Ga0068854_100002922 3300005578 Bacteria 10604
263 Ga0068856_100003203 3300005614 Bacteria 16665
264 Ga0068856_100005028 3300005614 Bacteria 13094
265 Ga0068856_100024970 3300005614 Bacteria 5824
266 Ga0068856_100030925 3300005614 Bacteria 5236
267 Ga0068856_100091233 3300005614 Bacteria 3031
268 Ga0068856_100091831 3300005614 Bacteria 3020
269 Ga0070702_100000849 3300005615 Bacteria 11781
270 Ga0068852_100000420 3300005616 Bacteria 28321
271 Ga0068852_100017202 3300005616 Bacteria 5668
272 Ga0068852_100078806 3300005616 Bacteria 2916
273 Ga0068859_100000604 3300005617 Bacteria 35899
274 Ga0068859_100010357 3300005617 Bacteria 9379
275 Ga0068859_100012737 3300005617 Bacteria 8451
276 Ga0068859_100059622 3300005617 Bacteria 3845
277 Ga0068864_100004095 3300005618 Bacteria 11973
278 Ga0068864_100087119 3300005618 Bacteria 2748
279 Ga0068866_10000018 3300005718 Bacteria 65387
280 Ga0068866_10086156 3300005718 Unclassified 1699
281 Ga0068861_100000738 3300005719 Bacteria 19593
282 Ga0068861_100004789 3300005719 Bacteria 9094
283 Ga0068861_100110762 3300005719 Bacteria 2199
284 Ga0068851_10000206 3300005834 Bacteria 28472
285 Ga0068851_10000825 3300005834 Bacteria 13378
286 Ga0068851_10014760 3300005834 Bacteria 3714
287 Ga0068851_10026573 3300005834 Bacteria 2846
288 Ga0068870_10000033 3300005840 Bacteria 44161
289 Ga0068863_100000937 3300005841 Bacteria 29293
290 Ga0068863_100002484 3300005841 Bacteria 18330
291 Ga0068863_100005670 3300005841 Bacteria 12263
292 Ga0068863_100006860 3300005841 Bacteria 11163
293 Ga0068863_100006983 3300005841 Bacteria 11070
294 Ga0068863_100024210 3300005841 Bacteria 5790
295 Ga0068863_100031963 3300005841 Bacteria 5019
296 Ga0068863_100090106 3300005841 Bacteria 2908
297 Ga0068863_100268757 3300005841 Bacteria 1650
298 Ga0068858_100000598 3300005842 Bacteria 37671
299 Ga0068858_100001840 3300005842 Bacteria 21631
300 Ga0068858_100002641 3300005842 Bacteria 18052
301 Ga0068858_100009300 3300005842 Bacteria 9379
302 Ga0068858_100018715 3300005842 Bacteria 6482
303 Ga0068858_100085620 3300005842 Bacteria 2932
304 Ga0068858_100147153 3300005842 Bacteria 2213
305 Ga0068858_100352335 3300005842 Bacteria 1410
306 Ga0068860_100000771 3300005843 Bacteria 36058
307 Ga0068860_100002378 3300005843 Bacteria 19763
308 Ga0068860_100008084 3300005843 Bacteria 10475
309 Ga0068860_100022800 3300005843 Bacteria 6055
310 Ga0068860_100035103 3300005843 Bacteria 4811
311 Ga0068860_100038341 3300005843 Bacteria 4583
312 Ga0068862_100000354 3300005844 Bacteria 49717
313 Ga0068862_100000659 3300005844 Bacteria 35380
314 Ga0068862_100041500 3300005844 Bacteria 3915
315 Ga0081540_1000141 3300005983 Bacteria 75070
316 Ga0081540_1000258 3300005983 Bacteria 55927
317 Ga0081540_1003160 3300005983 Bacteria 13144
318 Ga0081539_10000011 3300005985 Bacteria 461887
319 Ga0070717_10012772 3300006028 Bacteria 6411
320 Ga0070717_10021430 3300006028 Bacteria 5092
321 Ga0075364_10001177 3300006051 Bacteria 14015
322 Ga0075364_10013314 3300006051 Bacteria 5051
323 Ga0075364_10032361 3300006051 Bacteria 3361
324 Ga0070715_10001990 3300006163 Bacteria 6161
325 Ga0070716_100002786 3300006173 Bacteria 8122
326 Ga0070716_100018735 3300006173 Bacteria 3610
327 Ga0070712_100000241 3300006175 Bacteria 30820
328 Ga0070712_100000683 3300006175 Bacteria 20066
329 Ga0070712_100073425 3300006175 Bacteria 2454
330 Ga0097621_100000812 3300006237 Bacteria 22030
331 Ga0097621_100050678 3300006237 Bacteria 3376
332 Ga0097621_100066714 3300006237 Bacteria 2964
333 Ga0068871_100000098 3300006358 Bacteria 51943
334 Ga0068871_100015422 3300006358 Bacteria 5719
335 Ga0068871_100072963 3300006358 Bacteria 2828
336 Ga0068871_100095723 3300006358 Bacteria 2480
337 Ga0068871_100212280 3300006358 Bacteria 1674
338 Ga0075428_100066180 3300006844 Bacteria 3957
339 Ga0075434_100010839 3300006871 Bacteria 8567
340 Ga0068865_100000442 3300006881 Bacteria 23069
341 Ga0068865_100009034 3300006881 Bacteria 6165
342 Ga0097620_100000604 3300006931 Bacteria 35899
343 Ga0097620_100010356 3300006931 Bacteria 9379
344 Ga0097620_100012737 3300006931 Bacteria 8451
345 Ga0097620_100041171 3300006931 Bacteria 4641
346 Ga0097620_100059620 3300006931 Bacteria 3845
347 Ga0105251_10000108 3300009011 Bacteria 81679
348 Ga0105251_10006958 3300009011 Bacteria 7082
349 Ga0105250_10019433 3300009092 Bacteria 2746
350 Ga0105240_10003023 3300009093 Bacteria 26451
351 Ga0105240_10007393 3300009093 Bacteria 15971
352 Ga0105240_10008662 3300009093 Bacteria 14524
353 Ga0105240_10020449 3300009093 Bacteria 8828
354 Ga0105240_10021699 3300009093 Bacteria 8537
355 Ga0105240_10035269 3300009093 Bacteria 6448
356 Ga0105240_10042160 3300009093 Bacteria 5818
357 Ga0105240_10046310 3300009093 Bacteria 5511
358 Ga0105240_10185591 3300009093 Bacteria 2450
359 Ga0105240_10326788 3300009093 Bacteria 1746
360 Ga0111539_10213983 3300009094 Bacteria 2245
361 Ga0105245_10000849 3300009098 Bacteria 27700
362 Ga0105245_10002228 3300009098 Bacteria 17557
363 Ga0105245_10005446 3300009098 Bacteria 11181
364 Ga0105247_10000091 3300009101 Bacteria 97097
365 Ga0105247_10000104 3300009101 Bacteria 90342
366 Ga0114129_10001664 3300009147 Bacteria 30263
367 Ga0105243_10001938 3300009148 Bacteria 17625
368 Ga0105241_10001545 3300009174 Bacteria 17642
369 Ga0105241_10009602 3300009174 Bacteria 7113
370 Ga0105241_10081995 3300009174 Bacteria 2527
371 Ga0105241_10103116 3300009174 Bacteria 2271
372 Ga0105242_10000422 3300009176 Bacteria 33749
373 Ga0105242_10006695 3300009176 Bacteria 8892
374 Ga0105248_10000984 3300009177 Bacteria 31617
375 Ga0105248_10002035 3300009177 Bacteria 22415
376 Ga0105248_10038118 3300009177 Bacteria 5378
377 Ga0105248_10056265 3300009177 Bacteria 4413
378 Ga0105248_10131828 3300009177 Bacteria 2820
379 Ga0105248_10147865 3300009177 Bacteria 2651
380 Ga0105237_10000007 3300009545 Bacteria 367690
381 Ga0105237_10000064 3300009545 Bacteria 139463
382 Ga0105237_10000477 3300009545 Bacteria 56910
383 Ga0105237_10033265 3300009545 Bacteria 5223
384 Ga0105237_10049004 3300009545 Bacteria 4247
385 Ga0105237_10067757 3300009545 Bacteria 3563
386 Ga0105237_10144535 3300009545 Bacteria 2373
387 Ga0105237_10214244 3300009545 Bacteria 1926
388 Ga0105237_10217157 3300009545 Bacteria 1912
389 Ga0105238_10000688 3300009551 Bacteria 35470
390 Ga0105238_10007057 3300009551 Bacteria 11236
391 Ga0105238_10023524 3300009551 Bacteria 6279
392 Ga0105238_10049638 3300009551 Bacteria 4225
393 Ga0105238_10060979 3300009551 Bacteria 3775
394 Ga0105238_10098206 3300009551 Bacteria 2913
395 Ga0105238_10297923 3300009551 Bacteria 1596
396 Ga0105249_10000615 3300009553 Bacteria 32508
397 Ga0105249_10020112 3300009553 Bacteria 5963
398 Ga0105249_10062989 3300009553 Bacteria 3405
399 Ga0105249_10158755 3300009553 Bacteria 2184
400 Ga0105239_10000030 3300010375 Bacteria 233669
401 Ga0105239_10001432 3300010375 Bacteria 31805
402 Ga0105239_10002511 3300010375 Bacteria 23340
403 Ga0105239_10036277 3300010375 Bacteria 5414
404 Ga0105239_10062522 3300010375 Bacteria 4086
405 Ga0105239_10074879 3300010375 Bacteria 3722
406 Ga0105239_10169559 3300010375 Bacteria 2440
407 Ga0105239_10457682 3300010375 Unclassified 1448
408 Ga0105246_10000541 3300011119 Bacteria 20751
409 Ga0105246_10023422 3300011119 Bacteria 3995
410 Ga0105246_10042632 3300011119 Bacteria 3074
411 Ga0157314_1000608 3300012500 Bacteria 3259
412 Ga0157373_10000852 3300013100 Bacteria 23693
413 Ga0157373_10029899 3300013100 Bacteria 3922
414 Ga0157371_10000009 3300013102 Bacteria 392895
415 Ga0157371_10000852 3300013102 Bacteria 34878
416 Ga0157371_10006025 3300013102 Bacteria 10094
417 Ga0157371_10014602 3300013102 Bacteria 5920
418 Ga0157371_10026030 3300013102 Bacteria 4257
419 Ga0157371_10099694 3300013102 Bacteria 2060
420 Ga0157370_10007902 3300013104 Bacteria 11525
421 Ga0157370_10015720 3300013104 Bacteria 7685
422 Ga0157370_10041050 3300013104 Bacteria 4466
423 Ga0157369_10000097 3300013105 Bacteria 121042
424 Ga0157369_10001434 3300013105 Bacteria 29251
425 Ga0157369_10004547 3300013105 Bacteria 16312
426 Ga0157369_10008581 3300013105 Bacteria 11719
427 Ga0157369_10012799 3300013105 Bacteria 9513
428 Ga0157369_10016335 3300013105 Bacteria 8354
429 Ga0157369_10025071 3300013105 Bacteria 6624
430 Ga0157369_10104428 3300013105 Bacteria 3017
431 Ga0157369_10375797 3300013105 Bacteria 1475
432 Ga0157374_10000442 3300013296 Bacteria 37639
433 Ga0157374_10001660 3300013296 Bacteria 18628
434 Ga0157374_10008158 3300013296 Bacteria 8949
435 Ga0157374_10055081 3300013296 Bacteria 3711
436 Ga0157374_10080675 3300013296 Bacteria 3086
437 Ga0157378_10000565 3300013297 Bacteria 35099
438 Ga0157378_10002030 3300013297 Bacteria 18126
439 Ga0163162_10000015 3300013306 Bacteria 261996
440 Ga0163162_10000281 3300013306 Bacteria 46556
441 Ga0163162_10000521 3300013306 Bacteria 35677
442 Ga0163162_10013266 3300013306 Bacteria 8049
443 Ga0163162_10120099 3300013306 Bacteria 2732
444 Ga0163162_10234144 3300013306 Bacteria 1967
445 Ga0157372_10000001 3300013307 Bacteria 791349
446 Ga0157372_10000634 3300013307 Bacteria 38527
447 Ga0157372_10003349 3300013307 Bacteria 17301
448 Ga0157372_10005441 3300013307 Bacteria 13531
449 Ga0157372_10214285 3300013307 Bacteria 2232
450 Ga0157372_10382748 3300013307 Bacteria 1639
451 Ga0157375_10000441 3300013308 Bacteria 37587
452 Ga0157375_10000867 3300013308 Bacteria 26326
453 Ga0157375_10002945 3300013308 Bacteria 14770
454 Ga0157375_10004887 3300013308 Bacteria 11646
455 Ga0157375_10013335 3300013308 Bacteria 7310
456 Ga0157375_10186388 3300013308 Bacteria 2228
457 Ga0163163_10000196 3300014325 Bacteria 62407
458 Ga0163163_10002728 3300014325 Bacteria 14906
459 Ga0163163_10015406 3300014325 Bacteria 7068
460 Ga0163163_10027917 3300014325 Bacteria 5412
461 Ga0163163_10137097 3300014325 Bacteria 2488
462 Ga0163163_10305122 3300014325 Bacteria 1644
463 Ga0157380_10012708 3300014326 Bacteria 6115
464 Ga0182008_10001118 3300014497 Bacteria 18460
465 Ga0182008_10001546 3300014497 Bacteria 15298
466 Ga0182008_10001765 3300014497 Bacteria 14173
467 Ga0182008_10002596 3300014497 Bacteria 11222
468 Ga0182008_10015389 3300014497 Bacteria 3991
469 Ga0157377_10000187 3300014745 Bacteria 35834
470 Ga0157379_10000098 3300014968 Bacteria 59060
471 Ga0157379_10000690 3300014968 Bacteria 27381
472 Ga0157379_10009924 3300014968 Bacteria 8293
473 Ga0157379_10013698 3300014968 Bacteria 7106
474 Ga0157379_10092640 3300014968 Bacteria 2711
475 Ga0157376_10000542 3300014969 Bacteria 24267
476 Ga0157376_10021201 3300014969 Bacteria 5045
477 Ga0157376_10035731 3300014969 Bacteria 4021
478 Ga0182006_1000308 3300015261 Bacteria 42741
479 Ga0182006_1000689 3300015261 Bacteria 23570
480 Ga0182006_1001555 3300015261 Bacteria 13706
481 Ga0182006_1007530 3300015261 Bacteria 4975
482 Ga0182006_1012898 3300015261 Bacteria 3646
483 Ga0182007_10000001 3300015262 Bacteria 1127301
484 Ga0182007_10000353 3300015262 Bacteria 29023
485 Ga0182007_10007125 3300015262 Bacteria 4723
486 Ga0182005_1000344 3300015265 Bacteria 26562
487 Ga0182005_1001893 3300015265 Bacteria 7928
488 Ga0182005_1004819 3300015265 Bacteria 4296
489 Ga0183373_1006 3300015682 Bacteria 328276
490 Ga0183369_1007 3300015685 Bacteria 414878
491 Ga0183368_1003 3300015687 Bacteria 1276390
492 Ga0183360_10001 3300015689 Bacteria 3943671
493 Ga0163161_10000934 3300017792 Bacteria 22533
494 Ga0163161_10002464 3300017792 Bacteria 13212
495 Ga0163161_10012244 3300017792 Bacteria 5951
496 Ga0206354_10239192 3300020081 Bacteria 1741
497 Ga0206353_11300788 3300020082 Bacteria 2255
498 Ga0224572_1016453 3300024225 Bacteria 1418
499 Ga0209760_100328 3300025207 Bacteria 14335
500 Ga0209784_100120 3300025224 Bacteria 82684
501 Ga0209566_104344 3300025225 Bacteria 1953
502 Ga0209674_100012 3300025226 Bacteria 950162
503 Ga0209674_100119 3300025226 Bacteria 135468
504 Ga0209674_100426 3300025226 Bacteria 20351
505 Ga0209674_100933 3300025226 Bacteria 9345
506 Ga0209674_101921 3300025226 Bacteria 4881
507 Ga0209672_100005 3300025228 Bacteria 1069303
508 Ga0209672_100016 3300025228 Bacteria 522604
509 Ga0209672_100277 3300025228 Bacteria 37238
510 Ga0209672_101145 3300025228 Bacteria 10937
511 Ga0209672_101582 3300025228 Bacteria 7713
512 Ga0209563_100023 3300025230 Bacteria 636844
513 Ga0207427_100013 3300025231 Bacteria 581419
514 Ga0207427_100055 3300025231 Bacteria 209093
515 Ga0207427_100163 3300025231 Bacteria 74501
516 Ga0207427_100244 3300025231 Bacteria 43765
517 Ga0207427_100248 3300025231 Bacteria 42623
518 Ga0207427_101271 3300025231 Bacteria 9637
519 Ga0209437_100015 3300025233 Bacteria 713457
520 Ga0209437_100020 3300025233 Bacteria 656374
521 Ga0209437_100079 3300025233 Bacteria 275948
522 Ga0209437_100101 3300025233 Bacteria 226668
523 Ga0209437_100161 3300025233 Bacteria 148264
524 Ga0209437_100224 3300025233 Bacteria 101515
525 Ga0209258_100006 3300025242 Bacteria 1069303
526 Ga0209258_100012 3300025242 Bacteria 825544
527 Ga0209258_100049 3300025242 Bacteria 358328
528 Ga0209258_100064 3300025242 Bacteria 293837
529 Ga0209258_100186 3300025242 Bacteria 132381
530 Ga0209258_101114 3300025242 Bacteria 11291
531 Ga0209258_104987 3300025242 Bacteria 2366
532 Ga0207425_1000007 3300025245 Bacteria 777411
533 Ga0207425_1000078 3300025245 Bacteria 104429
534 Ga0207425_1001471 3300025245 Bacteria 9810
535 Ga0209646_1000467 3300025246 Bacteria 20487
536 Ga0209646_1001466 3300025246 Bacteria 6299
537 Ga0209646_1005450 3300025246 Bacteria 2216
538 Ga0209026_1000037 3300025250 Bacteria 282562
539 Ga0209026_1000204 3300025250 Bacteria 81999
540 Ga0209026_1000375 3300025250 Bacteria 41000
541 Ga0209026_1000433 3300025250 Bacteria 34956
542 Ga0209026_1000493 3300025250 Bacteria 28912
543 Ga0209026_1001302 3300025250 Bacteria 11274
544 Ga0209148_1000005 3300025254 Bacteria 1806504
545 Ga0209148_1000010 3300025254 Bacteria 1265567
546 Ga0209148_1000012 3300025254 Bacteria 1069303
547 Ga0209148_1000014 3300025254 Bacteria 925277
548 Ga0209148_1000073 3300025254 Bacteria 320851
549 Ga0209148_1000142 3300025254 Bacteria 163404
550 Ga0209148_1003823 3300025254 Bacteria 3937
551 Ga0209759_1000103 3300025256 Bacteria 153195
552 Ga0209759_1000725 3300025256 Bacteria 28902
553 Ga0209759_1003050 3300025256 Bacteria 6898
554 Ga0209129_1000006 3300025258 Bacteria 777761
555 Ga0209129_1000157 3300025258 Bacteria 105043
556 Ga0209129_1002361 3300025258 Bacteria 9320
557 Ga0209129_1011788 3300025258 Bacteria 2061
558 Ga0209233_1000009 3300025261 Bacteria 1265567
559 Ga0209233_1000020 3300025261 Bacteria 798224
560 Ga0209233_1000063 3300025261 Bacteria 395810
561 Ga0209233_1000124 3300025261 Bacteria 226743
562 Ga0209233_1000147 3300025261 Bacteria 186517
563 Ga0209565_1000001 3300025263 Bacteria 2950419
564 Ga0209565_1000022 3300025263 Bacteria 390888
565 Ga0209455_1000008 3300025272 Bacteria 1069303
566 Ga0209455_1000014 3300025272 Bacteria 806601
567 Ga0209455_1000082 3300025272 Bacteria 257909
568 Ga0209455_1000177 3300025272 Bacteria 106026
569 Ga0209455_1000842 3300025272 Bacteria 16523
570 Ga0209455_1006708 3300025272 Bacteria 3363
571 Ga0209673_1000001 3300025273 Bacteria 3176258
572 Ga0209673_1000087 3300025273 Bacteria 205213
573 Ga0209673_1011850 3300025273 Bacteria 3560
574 Ga0209130_1004465 3300025284 Bacteria 5292
575 Ga0209130_1014570 3300025284 Bacteria 1967
576 Ga0209675_1000001 3300025291 Bacteria 2950293
577 Ga0209675_1000060 3300025291 Bacteria 184316
578 Ga0209675_1023097 3300025291 Bacteria 1618
579 Ga0209676_1000011 3300025292 Bacteria 860463
580 Ga0209676_1000086 3300025292 Bacteria 264155
581 Ga0209676_1000114 3300025292 Bacteria 207416
582 Ga0209676_1000976 3300025292 Bacteria 34430
583 Ga0209676_1002896 3300025292 Bacteria 11248
584 Ga0209676_1005159 3300025292 Bacteria 6946
585 Ga0209676_1006425 3300025292 Bacteria 5806
586 Ga0209676_1007576 3300025292 Bacteria 5053
587 Ga0209025_1000005 3300025294 Bacteria 1272149
588 Ga0209025_1000025 3300025294 Bacteria 524454
589 Ga0209025_1000054 3300025294 Bacteria 317002
590 Ga0209025_1000888 3300025294 Bacteria 46712
591 Ga0209025_1007641 3300025294 Bacteria 7995
592 Ga0209564_1000001 3300025295 Bacteria 3176258
593 Ga0209564_1000302 3300025295 Bacteria 97770
594 Ga0209758_1000016 3300025297 Bacteria 778557
595 Ga0209758_1000062 3300025297 Bacteria 317002
596 Ga0209758_1000269 3300025297 Bacteria 103013
597 Ga0209758_1000309 3300025297 Bacteria 94619
598 Ga0209758_1024058 3300025297 Bacteria 2727
599 Ga0209050_1001760 3300025298 Bacteria 21464
600 Ga0209050_1002154 3300025298 Bacteria 17919
601 Ga0209050_1004098 3300025298 Bacteria 10183
602 Ga0209050_1015747 3300025298 Bacteria 3151
603 Ga0209256_1000002 3300025299 Bacteria 1906740
604 Ga0209256_1001644 3300025299 Bacteria 21742
605 Ga0209256_1003098 3300025299 Bacteria 12168
606 Ga0209256_1003127 3300025299 Bacteria 12071
607 Ga0209256_1003341 3300025299 Bacteria 11380
608 Ga0209256_1004365 3300025299 Bacteria 8952
609 Ga0209051_1000606 3300025303 Bacteria 41704
610 Ga0209257_1000014 3300025304 Bacteria 946850
611 Ga0209257_1000080 3300025304 Bacteria 312038
612 Ga0209257_1000121 3300025304 Bacteria 222588
613 Ga0209257_1000145 3300025304 Bacteria 195152
614 Ga0209257_1000369 3300025304 Bacteria 90982
615 Ga0209257_1002588 3300025304 Bacteria 17583
616 Ga0209257_1003930 3300025304 Bacteria 12080
617 Ga0209257_1005504 3300025304 Bacteria 8844
618 Ga0209257_1009732 3300025304 Bacteria 5052
619 Ga0207697_10001247 3300025315 Bacteria 13947
620 Ga0207656_10000650 3300025321 Bacteria 11340
621 Ga0207713_1000507 3300025735 Bacteria 39676
622 Ga0207713_1007579 3300025735 Bacteria 6371
623 Ga0207682_10001691 3300025893 Bacteria 10110
624 Ga0207692_10012207 3300025898 Bacteria 3683
625 Ga0207642_10000386 3300025899 Bacteria 13199
626 Ga0207710_10000241 3300025900 Bacteria 46419
627 Ga0207710_10001837 3300025900 Bacteria 10231
628 Ga0207688_10000100 3300025901 Bacteria 34208
629 Ga0207680_10000005 3300025903 Bacteria 660983
630 Ga0207680_10000207 3300025903 Bacteria 28427
631 Ga0207680_10000260 3300025903 Bacteria 25299
632 Ga0207680_10001066 3300025903 Bacteria 12935
633 Ga0207680_10061944 3300025903 Bacteria 2283
634 Ga0207647_10000747 3300025904 Bacteria 25485
635 Ga0207647_10001302 3300025904 Bacteria 19206
636 Ga0207647_10003082 3300025904 Bacteria 12529
637 Ga0207647_10003735 3300025904 Bacteria 11386
638 Ga0207647_10005423 3300025904 Bacteria 9349
639 Ga0207699_10009178 3300025906 Bacteria 4913
640 Ga0207699_10024570 3300025906 Bacteria 3297
641 Ga0207699_10059533 3300025906 Unclassified 2289
642 Ga0207645_10000386 3300025907 Bacteria 36411
643 Ga0207643_10000002 3300025908 Bacteria 224909
644 Ga0207643_10033103 3300025908 Unclassified 2892
645 Ga0207705_10003142 3300025909 Bacteria 12576
646 Ga0207654_10000065 3300025911 Bacteria 69237
647 Ga0207654_10004228 3300025911 Bacteria 7243
648 Ga0207654_10090616 3300025911 Bacteria 1863
649 Ga0207707_10002994 3300025912 Bacteria 15031
650 Ga0207707_10020200 3300025912 Bacteria 5815
651 Ga0207707_10024817 3300025912 Bacteria 5245
652 Ga0207707_10057895 3300025912 Bacteria 3373
653 Ga0207707_10063401 3300025912 Bacteria 3217
654 Ga0207695_10000007 3300025913 Bacteria 1092551
655 Ga0207695_10001474 3300025913 Bacteria 39362
656 Ga0207695_10001492 3300025913 Bacteria 39028
657 Ga0207695_10001749 3300025913 Bacteria 34474
658 Ga0207695_10002287 3300025913 Bacteria 28632
659 Ga0207695_10004269 3300025913 Bacteria 19628
660 Ga0207695_10005487 3300025913 Bacteria 16790
661 Ga0207695_10016119 3300025913 Bacteria 8766
662 Ga0207695_10016612 3300025913 Bacteria 8604
663 Ga0207695_10041050 3300025913 Bacteria 4953
664 Ga0207695_10043836 3300025913 Bacteria 4763
665 Ga0207695_10058982 3300025913 Bacteria 3983
666 Ga0207695_10251534 3300025913 Bacteria 1666
667 Ga0207671_10000061 3300025914 Bacteria 175061
668 Ga0207671_10000074 3300025914 Bacteria 156482
669 Ga0207671_10000756 3300025914 Bacteria 41002
670 Ga0207671_10001709 3300025914 Bacteria 24785
671 Ga0207671_10006886 3300025914 Bacteria 10031
672 Ga0207671_10060676 3300025914 Bacteria 2806
673 Ga0207671_10087628 3300025914 Bacteria 2341
674 Ga0207671_10110370 3300025914 Bacteria 2092
675 Ga0207693_10000047 3300025915 Bacteria 100876
676 Ga0207693_10000226 3300025915 Bacteria 51496
677 Ga0207693_10049558 3300025915 Bacteria 3298
678 Ga0207663_10008602 3300025916 Bacteria 5352
679 Ga0207663_10032979 3300025916 Bacteria 3080
680 Ga0207660_10011891 3300025917 Bacteria 5678
681 Ga0207660_10023604 3300025917 Bacteria 4156
682 Ga0207662_10000011 3300025918 Bacteria 90777
683 Ga0207657_10000607 3300025919 Bacteria 38122
684 Ga0207657_10039587 3300025919 Bacteria 4186
685 Ga0207649_10000447 3300025920 Bacteria 29709
686 Ga0207649_10000627 3300025920 Bacteria 23719
687 Ga0207649_10002450 3300025920 Bacteria 10388
688 Ga0207649_10058638 3300025920 Bacteria 2412
689 Ga0207649_10067555 3300025920 Bacteria 2270
690 Ga0207652_10081715 3300025921 Bacteria 2827
691 Ga0207681_10000108 3300025923 Bacteria 71434
692 Ga0207694_10001596 3300025924 Bacteria 19186
693 Ga0207694_10007411 3300025924 Bacteria 8322
694 Ga0207694_10013688 3300025924 Bacteria 6112
695 Ga0207694_10026580 3300025924 Bacteria 4405
696 Ga0207694_10035312 3300025924 Bacteria 3835
697 Ga0207694_10051556 3300025924 Bacteria 3189
698 Ga0207694_10117902 3300025924 Bacteria 2117
699 Ga0207694_10141607 3300025924 Bacteria 1934
700 Ga0207650_10000349 3300025925 Bacteria 44570
701 Ga0207650_10005976 3300025925 Bacteria 8307
702 Ga0207650_10057943 3300025925 Bacteria 2883
703 Ga0207659_10000123 3300025926 Bacteria 45421
704 Ga0207687_10003914 3300025927 Bacteria 9981
705 Ga0207687_10065600 3300025927 Bacteria 2578
706 Ga0207687_10067964 3300025927 Bacteria 2537
707 Ga0207664_10000093 3300025929 Bacteria 81829
708 Ga0207664_10010012 3300025929 Bacteria 6681
709 Ga0207664_10015495 3300025929 Bacteria 5535
710 Ga0207664_10077604 3300025929 Bacteria 2692
711 Ga0207664_10092113 3300025929 Bacteria 2487
712 Ga0207644_10000565 3300025931 Bacteria 23709
713 Ga0207644_10002119 3300025931 Bacteria 12872
714 Ga0207644_10055215 3300025931 Bacteria 2863
715 Ga0207644_10148738 3300025931 Bacteria 1811
716 Ga0207706_10000078 3300025933 Bacteria 100847
717 Ga0207706_10001116 3300025933 Bacteria 27311
718 Ga0207686_10005642 3300025934 Bacteria 6707
719 Ga0207709_10004839 3300025935 Bacteria 7716
720 Ga0207709_10017085 3300025935 Bacteria 4044
721 Ga0207670_10000224 3300025936 Bacteria 36974
722 Ga0207670_10000772 3300025936 Bacteria 16832
723 Ga0207669_10002589 3300025937 Bacteria 7729
724 Ga0207704_10000199 3300025938 Bacteria 30848
725 Ga0207704_10010019 3300025938 Bacteria 4601
726 Ga0207704_10027205 3300025938 Bacteria 3151
727 Ga0207665_10002048 3300025939 Bacteria 13569
728 Ga0207665_10004295 3300025939 Bacteria 9474
729 Ga0207665_10022137 3300025939 Bacteria 4178
730 Ga0207665_10081049 3300025939 Bacteria 2233
731 Ga0207691_10000389 3300025940 Bacteria 43983
732 Ga0207691_10021605 3300025940 Bacteria 6075
733 Ga0207691_10021853 3300025940 Bacteria 6039
734 Ga0207691_10067827 3300025940 Bacteria 3225
735 Ga0207711_10001003 3300025941 Bacteria 27077
736 Ga0207711_10002894 3300025941 Bacteria 15037
737 Ga0207711_10023847 3300025941 Bacteria 5122
738 Ga0207711_10036542 3300025941 Bacteria 4168
739 Ga0207689_10000523 3300025942 Bacteria 36411
740 Ga0207689_10122955 3300025942 Bacteria 2134
741 Ga0207661_10002620 3300025944 Bacteria 12385
742 Ga0207661_10097009 3300025944 Bacteria 2468
743 Ga0207679_10000442 3300025945 Bacteria 29194
744 Ga0207679_10003533 3300025945 Bacteria 9676
745 Ga0207679_10070215 3300025945 Bacteria 2639
746 Ga0207667_10000119 3300025949 Bacteria 124365
747 Ga0207667_10001426 3300025949 Bacteria 29941
748 Ga0207667_10007542 3300025949 Bacteria 13055
749 Ga0207667_10012452 3300025949 Bacteria 9800
750 Ga0207667_10025614 3300025949 Bacteria 6453
751 Ga0207667_10034658 3300025949 Bacteria 5419
752 Ga0207651_10000020 3300025960 Bacteria 83049
753 Ga0207651_10123664 3300025960 Bacteria 1967
754 Ga0207712_10000302 3300025961 Bacteria 46123
755 Ga0207712_10000666 3300025961 Bacteria 26658
756 Ga0207712_10000677 3300025961 Bacteria 26367
757 Ga0207712_10056662 3300025961 Bacteria 2761
758 Ga0207668_10060724 3300025972 Bacteria 2654
759 Ga0207640_10000429 3300025981 Bacteria 25864
760 Ga0207640_10000696 3300025981 Bacteria 19598
761 Ga0207640_10006938 3300025981 Bacteria 6232
762 Ga0207658_10000030 3300025986 Bacteria 168693
763 Ga0207658_10000437 3300025986 Bacteria 39386
764 Ga0207658_10001333 3300025986 Bacteria 19334
765 Ga0207658_10002572 3300025986 Bacteria 13182
766 Ga0207658_10010121 3300025986 Bacteria 6405
767 Ga0207658_10029600 3300025986 Bacteria 3869
768 Ga0207658_10268241 3300025986 Bacteria 1458
769 Ga0207677_10000079 3300026023 Bacteria 79753
770 Ga0207677_10032413 3300026023 Bacteria 3359
771 Ga0207703_10000148 3300026035 Bacteria 81341
772 Ga0207703_10000236 3300026035 Bacteria 62877
773 Ga0207703_10000456 3300026035 Bacteria 43004
774 Ga0207703_10000729 3300026035 Bacteria 32318
775 Ga0207703_10014984 3300026035 Bacteria 6051
776 Ga0207703_10087696 3300026035 Bacteria 2610
777 Ga0207703_10101099 3300026035 Bacteria 2444
778 Ga0207703_10230131 3300026035 Bacteria 1661
779 Ga0207639_10000130 3300026041 Bacteria 55330
780 Ga0207639_10000609 3300026041 Bacteria 24634
781 Ga0207639_10003127 3300026041 Bacteria 11131
782 Ga0207639_10009755 3300026041 Bacteria 6632
783 Ga0207639_10020170 3300026041 Bacteria 4768
784 Ga0207639_10086489 3300026041 Bacteria 2496
785 Ga0207678_10001757 3300026067 Bacteria 19846
786 Ga0207678_10005621 3300026067 Bacteria 11211
787 Ga0207678_10005736 3300026067 Bacteria 11079
788 Ga0207678_10010212 3300026067 Bacteria 8242
789 Ga0207678_10015110 3300026067 Bacteria 6791
790 Ga0207678_10039062 3300026067 Bacteria 4121
791 Ga0207708_10002045 3300026075 Bacteria 14864
792 Ga0207702_10000937 3300026078 Bacteria 30118
793 Ga0207702_10001010 3300026078 Bacteria 28892
794 Ga0207702_10009610 3300026078 Bacteria 8116
795 Ga0207641_10000491 3300026088 Bacteria 44561
796 Ga0207641_10007360 3300026088 Bacteria 9164
797 Ga0207641_10038688 3300026088 Bacteria 3987
798 Ga0207641_10092094 3300026088 Bacteria 2654
799 Ga0207641_10158682 3300026088 Bacteria 2054
800 Ga0207641_10248831 3300026088 Bacteria 1659
801 Ga0207648_10000497 3300026089 Bacteria 43780
802 Ga0207648_10118309 3300026089 Bacteria 2329
803 Ga0207648_10241626 3300026089 Bacteria 1608
804 Ga0207676_10000636 3300026095 Bacteria 28319
805 Ga0207676_10014625 3300026095 Bacteria 5651
806 Ga0207674_10000226 3300026116 Bacteria 70605
807 Ga0207674_10000427 3300026116 Bacteria 54893
808 Ga0207674_10001529 3300026116 Bacteria 29791
809 Ga0207674_10002998 3300026116 Bacteria 20947
810 Ga0207674_10153164 3300026116 Bacteria 2262
811 Ga0207674_10274694 3300026116 Bacteria 1633
812 Ga0207675_100000006 3300026118 Bacteria 189749
813 Ga0207675_100040578 3300026118 Bacteria 4347
814 Ga0207675_100126190 3300026118 Bacteria 2424
815 Ga0207683_10000589 3300026121 Bacteria 33426
816 Ga0207683_10001388 3300026121 Bacteria 21837
817 Ga0207698_10000382 3300026142 Bacteria 25568
818 Ga0207698_10010862 3300026142 Bacteria 5877
819 Ga0207698_10059956 3300026142 Bacteria 2957
820 Ga0207698_10064208 3300026142 Bacteria 2877
821 Ga0207698_10067623 3300026142 Bacteria 2818
822 Ga0207698_10085888 3300026142 Bacteria 2557
823 Ga0207698_10123143 3300026142 Bacteria 2199
824 Ga0209371_1000007 3300027312 Bacteria 1050654
825 Ga0209371_1000059 3300027312 Bacteria 237154
826 Ga0268266_10000001 3300028379 Bacteria 4040580
827 Ga0268266_10000004 3300028379 Bacteria 1495817
828 Ga0268266_10000006 3300028379 Bacteria 1410021
829 Ga0268266_10000687 3300028379 Bacteria 45601
830 Ga0268266_10002398 3300028379 Bacteria 20201
831 Ga0268266_10020953 3300028379 Bacteria 5573
832 Ga0268266_10024656 3300028379 Bacteria 5118
833 Ga0268266_10067108 3300028379 Bacteria 3104
834 Ga0268266_10115045 3300028379 Bacteria 2387
835 Ga0268265_10000775 3300028380 Bacteria 30819
836 Ga0268265_10001081 3300028380 Bacteria 24268
837 Ga0268264_10000102 3300028381 Bacteria 222526
838 Ga0268264_10000705 3300028381 Bacteria 38562
839 Ga0268264_10005664 3300028381 Bacteria 10587
840 Ga0268264_10012475 3300028381 Bacteria 6996
841 Ga0268264_10014286 3300028381 Bacteria 6528
842 Ga0268264_10028281 3300028381 Bacteria 4584
843 Ga0265334_10001247 3300028573 Bacteria 12415
844 Ga0265318_10007437 3300028577 Bacteria 4949
845 Ga0307515_10109988 3300028794 Bacteria 3230
846 Ga0265338_10002238 3300028800 Bacteria 29484
847 Ga0265338_10029272 3300028800 Bacteria 5463
848 Ga0265338_10043276 3300028800 Unclassified 4179
849 Ga0265338_10076396 3300028800 Bacteria 2837
850 Ga0265338_10103614 3300028800 Bacteria 2310
851 Ga0268256_1000008 3300030500 Bacteria 1050654
852 Ga0268256_1000055 3300030500 Bacteria 237299
853 Ga0307511_10001554 3300030521 Bacteria 24331
854 Ga0307511_10058906 3300030521 Bacteria 2961
855 Ga0314311_1181543 3300030733 Bacteria 3024
856 Ga0316183_1016040 3300030742 Bacteria 1494
857 Ga0316181_1273914 3300030744 Bacteria 4325
858 Ga0316182_1146374 3300030745 Bacteria 1493
859 Ga0265762_1000028 3300030760 Bacteria 16236
860 Ga0265762_1006299 3300030760 Bacteria 2123
861 Ga0265330_10005661 3300031235 Bacteria 6213
862 Ga0265332_10002256 3300031238 Bacteria 9887
863 Ga0265328_10027922 3300031239 Bacteria 2113
864 Ga0265325_10011929 3300031241 Bacteria 4981
865 Ga0265329_10009490 3300031242 Bacteria 3630
866 Ga0265340_10031667 3300031247 Bacteria 2644
867 Ga0265339_10024581 3300031249 Bacteria 3469
868 Ga0265339_10044204 3300031249 Bacteria 2458
869 Ga0265331_10000593 3300031250 Bacteria 32186
870 Ga0265331_10013499 3300031250 Bacteria 4387
871 Ga0265316_10001008 3300031344 Bacteria 30578
872 Ga0265316_10060621 3300031344 Bacteria 2941
873 Ga0265316_10061855 3300031344 Bacteria 2906
874 Ga0307513_10149751 3300031456 Bacteria 2244
875 Ga0307509_10000005 3300031507 Bacteria 435959
876 Ga0307408_100141691 3300031548 Bacteria 1888
877 Ga0265313_10000653 3300031595 Bacteria 35705
878 Ga0265313_10000851 3300031595 Bacteria 30740
879 Ga0307508_10045448 3300031616 Bacteria 3924
880 Ga0265314_10013071 3300031711 Bacteria 6733
881 Ga0265314_10013166 3300031711 Bacteria 6699
882 Ga0265342_10001779 3300031712 Bacteria 19637
883 Ga0265342_10026864 3300031712 Bacteria 3603
884 Ga0307405_10000010 3300031731 Bacteria 250978
885 Ga0307405_10131717 3300031731 Bacteria 1729
886 Ga0307413_10004383 3300031824 Bacteria 6136
887 Ga0307413_10019171 3300031824 Bacteria 3607
888 Ga0307410_10042723 3300031852 Unclassified 2998
889 Ga0307410_10136931 3300031852 Bacteria 1806
890 Ga0307410_10165405 3300031852 Bacteria 1662
891 Ga0307406_10015277 3300031901 Bacteria 4439
892 Ga0307406_10030161 3300031901 Bacteria 3290
893 Ga0307407_10000009 3300031903 Bacteria 188746
894 Ga0307412_10005560 3300031911 Bacteria 7075
895 Ga0307412_10008456 3300031911 Bacteria 5876
896 Ga0307416_100000019 3300032002 Bacteria 199706
897 Ga0307416_100066948 3300032002 Bacteria 2960
898 Ga0307414_10000078 3300032004 Bacteria 90911
899 Ga0307414_10000472 3300032004 Bacteria 21101
900 Ga0307414_10007232 3300032004 Bacteria 6234
901 Ga0307414_10011902 3300032004 Bacteria 5125
902 Ga0307414_10049704 3300032004 Bacteria 2901
903 Ga0307414_10051588 3300032004 Bacteria 2857
904 Ga0307414_10065834 3300032004 Bacteria 2587
905 Ga0307415_100201450 3300032126 Bacteria 1580
906 Ga0307510_10000006 3300033180 Bacteria 566474
907 Ga0307510_10000301 3300033180 Bacteria 45621
908 Ga0307510_10016283 3300033180 Bacteria 8778
909 Ga0373944_0019268 3300035089 Bacteria 1957
910 Ga0373936_0010040 3300035113 Bacteria 3574
911 Ga0373936_0014947 3300035113 Archaea 2972
912 Ga0373955_0048344 3300035172 Bacteria 2307
913 Ga0373935_0089841 3300035692 Bacteria 2009
914 Ga0373927_0015771 3300035695 Bacteria 4986
915 Ga0373947_0028534 3300035725 Bacteria 3273
916 Ga0373937_0024309 3300036401 Bacteria 5462
917 Ga0373937_0058864 3300036401 Bacteria 3530
918 Ga0373937_0406687 3300036401 Bacteria 1291
919 Ga0316584_0061039 3300036712 Bacteria 2824
920 Ga0373925_0076490 3300037068 Bacteria 2538
921 Ga0395899_0000108 3300037312 Bacteria 142347
922 Ga0395899_0000402 3300037312 Bacteria 50694
923 Ga0395899_0002056 3300037312 Bacteria 16562
924 Ga0395899_0018303 3300037312 Bacteria 5327
925 Ga0395899_0030119 3300037312 Bacteria 4082
926 Ga0395899_0033379 3300037312 Bacteria 3864
927 Ga0395899_0058179 3300037312 Bacteria 2851
928 Ga0395900_0000144 3300037418 Bacteria 119971
929 Ga0395900_0005984 3300037418 Bacteria 12701
930 Ga0395900_0007251 3300037418 Bacteria 11478
931 Ga0395898_0000018 3300037466 Bacteria 418600
932 Ga0395898_0000049 3300037466 Bacteria 284792
933 Ga0395898_0003039 3300037466 Bacteria 19013
934 Ga0395898_0003336 3300037466 Bacteria 18023
935 Ga0395898_0004639 3300037466 Bacteria 14984
936 Ga0395898_0004927 3300037466 Bacteria 14491
937 Ga0395898_0012224 3300037466 Bacteria 8876
938 Ga0395898_0069584 3300037466 Bacteria 3405
939 Ga0395905_0000577 3300037471 Bacteria 49489
940 Ga0395905_0061451 3300037471 Bacteria 3514
941 Ga0395905_0295764 3300037471 Bacteria 1506
942 Ga0395901_0004384 3300038443 Bacteria 14232
943 Ga0395901_0004732 3300038443 Bacteria 13738
944 Ga0395901_0028809 3300038443 Bacteria 5713
945 Ga0395901_0029839 3300038443 Bacteria 5616
946 Ga0237819_00252 3300038705 Bacteria 19595
947 Ga0436365_1682843 3300039437 Bacteria 2509
948 Ga0436360_1015686 3300039438 Bacteria 10514
949 Ga0436361_0007496 3300039447 Bacteria 2383
950 Ga0436361_1061145 3300039447 Bacteria 1589
951 Ga0436363_0044813 3300039450 Bacteria 2990
952 Ga0436363_0581112 3300039450 Bacteria 6599
953 Ga0436363_1395368 3300039450 Bacteria 8364
954 Ga0439436_0000156 3300041404 Bacteria 15891
955 Ga0439436_0004026 3300041404 Bacteria 4504
956 Ga0439436_0007384 3300041404 Bacteria 3382
957 Ga0439436_0019565 3300041404 Bacteria 2021
958 Ga0439436_0022885 3300041404 Bacteria 1850
959 Ga0439436_0023471 3300041404 Bacteria 1825
960 Ga0439447_001882 3300041407 Bacteria 7675
961 Ga0439465_0014317 3300041413 Bacteria 2472
962 Ga0439465_0022811 3300041413 Bacteria 1967
963 Ga0451789_0366723 3300041443 Bacteria 1758
964 Ga0451791_1324246 3300041451 Bacteria 4258
965 Ga0451791_1942420 3300041451 Bacteria 2072
966 Ga0451793_0571811 3300041452 Bacteria 6240
967 Ga0451797_0509949 3300041453 Bacteria 3119
968 Ga0451795_0315781 3300041456 Bacteria 1863
969 Ga0451800_0139849 3300041459 Bacteria 5083
970 Ga0451802_0008253 3300041460 Bacteria 2313
971 Ga0451802_1802042 3300041460 Bacteria 2333
972 Ga0451806_807826 3300041462 Bacteria 2483
973 Ga0451807_1656299 3300041486 Bacteria 2562
974 Ga0451807_1936347 3300041486 Bacteria 3656
975 Ga0451807_2008150 3300041486 Bacteria 2328
976 Ga0451837_0562306 3300041494 Bacteria 3045
977 Ga0451843_0305836 3300041509 Bacteria 3815
978 Ga0439448_0012856 3300042005 Bacteria 2510
979 Ga0439432_042309 3300042006 Bacteria 1440
980 Ga0439449_0000062 3300042007 Bacteria 33240
981 Ga0439449_0003943 3300042007 Bacteria 5747
982 Ga0439449_0007202 3300042007 Bacteria 4231
983 Ga0439449_0027837 3300042007 Bacteria 2108
984 Ga0439462_0023848 3300042015 Bacteria 1605
985 Ga0450908_000427 3300042184 Bacteria 8125
986 Ga0451577_0003011 3300042876 Bacteria 19199
987 Ga0451577_0006420 3300042876 Bacteria 11731
988 Ga0451577_0007000 3300042876 Bacteria 11137
989 Ga0451577_0012316 3300042876 Bacteria 8033
990 Ga0439440_0018462 3300042993 Bacteria 1545
991 Ga0466969_0004660 3300044656 Bacteria 7307
992 Ga0466969_0006957 3300044656 Bacteria 6019
993 Ga0466972_0001559 3300044658 Bacteria 11179
994 Ga0466982_0000003 3300044672 Bacteria 417243
995 Ga0466982_0000061 3300044672 Bacteria 29699
996 Ga0466965_0000550 3300044683 Bacteria 13502
997 Ga0466966_0001316 3300044684 Bacteria 15936
998 Ga0466966_0002565 3300044684 Bacteria 11899
999 Ga0466966_0003790 3300044684 Bacteria 9973
1000 Ga0466966_0041409 3300044684 Bacteria 2959
1001 Ga0466966_0059924 3300044684 Bacteria 2403
1002 Ga0466961_0002737 3300044693 Bacteria 10964
1003 Ga0466961_0003481 3300044693 Bacteria 9811
1004 Ga0466961_0016250 3300044693 Bacteria 4779
1005 Ga0466961_0018361 3300044693 Bacteria 4497
1006 Ga0466961_0030091 3300044693 Bacteria 3489
1007 Ga0466961_0049132 3300044693 Bacteria 2696
1008 Ga0466964_0001509 3300044706 Bacteria 7995
1009 Ga0453684_0000377 3300044712 Bacteria 183445
1010 Ga0453684_0001190 3300044712 Bacteria 80396
1011 Ga0453684_0162905 3300044712 Bacteria 2636
1012 Ga0453684_0295912 3300044712 Bacteria 1841
1013 Ga0466971_0017684 3300044719 Bacteria 3155
1014 Ga0466971_0018786 3300044719 Bacteria 3065
1015 Ga0466968_0012084 3300044735 Bacteria 3373
1016 Ga0466970_0001017 3300044765 Bacteria 13518
1017 Ga0466970_0025383 3300044765 Bacteria 3102
1018 Ga0466970_0034705 3300044765 Bacteria 2672
1019 Ga0466957_0008584 3300044842 Bacteria 5815
1020 Ga0466957_0009065 3300044842 Bacteria 5673
1021 Ga0466957_0009119 3300044842 Bacteria 5657
1022 Ga0466960_0001879 3300044901 Bacteria 7710
1023 Ga0466959_0016770 3300045049 Bacteria 5360
1024 Ga0466959_0031587 3300045049 Bacteria 3918
1025 Ga0466959_0037823 3300045049 Bacteria 3566
1026 Ga0466959_0063186 3300045049 Bacteria 2689
1027 Ga0466959_0072457 3300045049 Bacteria 2493
1028 Ga0466959_0118583 3300045049 Unclassified 1883
1029 Ga0451576_0000033 3300045051 Bacteria 393131
1030 Ga0451576_0014574 3300045051 Bacteria 8738
1031 Ga0466958_0001823 3300045836 Bacteria 10354
1032 Ga0466958_0005648 3300045836 Bacteria 6753
1033 Ga0466958_0014155 3300045836 Bacteria 4552
1034 Ga0495617_000684 3300046452 Bacteria 16982
1035 Ga0495629_0001766 3300046459 Bacteria 16951
1036 Ga0495638_0000038 3300046460 Bacteria 249534
1037 Ga0495638_0000153 3300046460 Bacteria 109155
1038 Ga0495638_0000234 3300046460 Bacteria 75860
1039 Ga0495638_0000753 3300046460 Bacteria 34502
1040 Ga0495638_0010655 3300046460 Bacteria 6367
1041 Ga0495638_0055642 3300046460 Bacteria 2456
1042 Ga0495638_0064504 3300046460 Bacteria 2256
1043 Ga0495638_0072514 3300046460 Bacteria 2104
1044 Ga0495638_0080148 3300046460 Bacteria 1984
1045 Ga0495650_0000003 3300046471 Bacteria 900730
1046 Ga0495650_0000247 3300046471 Bacteria 106616
1047 Ga0495650_0000337 3300046471 Bacteria 83530
1048 Ga0495650_0002162 3300046471 Bacteria 16654
1049 Ga0495650_0056124 3300046471 Bacteria 1599
1050 Ga0495580_0001193 3300046472 Bacteria 22854
1051 Ga0495580_0008063 3300046472 Bacteria 8404
1052 Ga0495580_0019458 3300046472 Bacteria 5044
1053 Ga0495580_0085264 3300046472 Bacteria 2200
1054 Ga0495582_0002834 3300046473 Bacteria 9694
1055 Ga0495582_0067364 3300046473 Bacteria 1978
1056 Ga0495639_0014943 3300046475 Bacteria 3365
1057 Ga0495662_0138884 3300046476 Unclassified 1196
1058 Ga0495664_0007493 3300046477 Bacteria 6064
1059 Ga0495584_0000598 3300046491 Bacteria 24294
1060 Ga0495585_0000085 3300046492 Bacteria 97836
1061 Ga0495585_0000104 3300046492 Bacteria 90097
1062 Ga0495585_0001499 3300046492 Bacteria 18186
1063 Ga0495607_0000088 3300046501 Bacteria 95203
1064 Ga0495607_0000120 3300046501 Bacteria 82667
1065 Ga0495607_0006640 3300046501 Bacteria 8109
1066 Ga0495606_0000338 3300046507 Bacteria 80898
1067 Ga0495606_0000401 3300046507 Bacteria 73149
1068 Ga0495606_0001054 3300046507 Bacteria 39827
1069 Ga0495606_0005269 3300046507 Bacteria 12464
1070 Ga0495606_0013607 3300046507 Bacteria 6416
1071 Ga0495606_0031838 3300046507 Bacteria 3661
1072 Ga0495606_0100632 3300046507 Unclassified 1760
1073 Ga0495610_0000028 3300046512 Bacteria 272572
1074 Ga0495610_0002689 3300046512 Bacteria 14657
1075 Ga0495610_0003644 3300046512 Bacteria 11861
1076 Ga0495610_0028837 3300046512 Bacteria 2930
1077 Ga0495610_0049064 3300046512 Bacteria 2069
1078 Ga0495610_0069720 3300046512 Bacteria 1644
1079 Ga0495616_0000086 3300046513 Bacteria 78187
1080 Ga0495616_0018646 3300046513 Bacteria 3803
1081 Ga0495616_0027621 3300046513 Bacteria 3010
1082 Ga0495620_0000469 3300046515 Bacteria 26346
1083 Ga0495620_0000533 3300046515 Bacteria 24362
1084 Ga0495630_0240659 3300046517 Bacteria 1383
1085 Ga0495631_0000029 3300046518 Bacteria 86555
1086 Ga0495631_0000298 3300046518 Bacteria 34707
1087 Ga0495632_0000004 3300046519 Bacteria 381372
1088 Ga0495632_0003675 3300046519 Bacteria 10763
1089 Ga0495643_0003481 3300046522 Bacteria 11485
1090 Ga0495643_0029363 3300046522 Bacteria 3077
1091 Ga0495648_0000914 3300046524 Bacteria 30767
1092 Ga0495663_0001970 3300046525 Bacteria 6312
1093 Ga0495663_0012197 3300046525 Bacteria 2395
1094 Ga0495663_0015267 3300046525 Bacteria 2162
1095 Ga0495663_0017819 3300046525 Bacteria 2018
1096 Ga0495640_0135613 3300046533 Bacteria 1590
1097 Ga0495586_0025754 3300046535 Unclassified 3148
1098 Ga0495586_0090625 3300046535 Bacteria 1689
1099 Ga0495587_0053519 3300046536 Unclassified 2380
1100 Ga0495609_0013205 3300046538 Bacteria 3905
1101 Ga0495622_0022776 3300046557 Bacteria 2919
1102 Ga0495633_0075274 3300046558 Bacteria 1572
1103 Ga0495633_0075959 3300046558 Bacteria 1564
1104 Ga0495656_0009515 3300046615 Bacteria 3496
1105 Ga0495656_0024604 3300046615 Bacteria 2379
1106 Ga0495668_0001397 3300046616 Bacteria 23507
1107 Ga0495668_0001767 3300046616 Bacteria 19788
1108 Ga0495611_0000001 3300046648 Bacteria 2628469
1109 Ga0495611_0000313 3300046648 Bacteria 32576
1110 Ga0495625_0000022 3300046660 Bacteria 278823
1111 Ga0495625_0003692 3300046660 Bacteria 14968
1112 Ga0495625_0021801 3300046660 Bacteria 4921
1113 Ga0495625_0034220 3300046660 Bacteria 3751
1114 Ga0495625_0062675 3300046660 Bacteria 2627
1115 Ga0495661_0001748 3300046665 Bacteria 17477
1116 Ga0495661_0007842 3300046665 Bacteria 7427
1117 Ga0495661_0085849 3300046665 Bacteria 1803
1118 Ga0495657_0130585 3300046675 Bacteria 1574
1119 Ga0495599_0049355 3300046678 Bacteria 2638
1120 Ga0495646_0065203 3300046680 Bacteria 2157
1121 Ga0495647_0035350 3300046681 Bacteria 1876
1122 Ga0495647_0074953 3300046681 Bacteria 1361
1123 Ga0495658_0005711 3300046683 Bacteria 6112
1124 Ga0495658_0006515 3300046683 Bacteria 5736
1125 Ga0495613_0162385 3300046689 Unclassified 1589
1126 Ga0495670_0003226 3300046691 Bacteria 8030
1127 Ga0495670_0012044 3300046691 Bacteria 4256
1128 Ga0495670_0030018 3300046691 Bacteria 2700
1129 Ga0495671_0000492 3300046692 Bacteria 30463
1130 Ga0495649_0000553 3300046694 Bacteria 31708
1131 Ga0495649_0005373 3300046694 Bacteria 8162
1132 Ga0495589_0000059 3300046794 Bacteria 107171
1133 Ga0495660_0000092 3300046810 Bacteria 96197
1134 Ga0495660_0000583 3300046810 Bacteria 29142
1135 Ga0495636_0000522 3300047318 Bacteria 14147
1136 Ga0495636_0000979 3300047318 Bacteria 10693
1137 Ga0495636_0007664 3300047318 Bacteria 4244
1138 Ga0495636_0028788 3300047318 Bacteria 2266
1139 Ga0495674_0030491 3300047319 Bacteria 4904
1140 Ga0495672_0000455 3300047320 Bacteria 48439
1141 Ga0495683_0002566 3300047323 Bacteria 10907
1142 Ga0495687_010815 3300047443 Bacteria 4966
1143 Ga0495687_024115 3300047443 Bacteria 2897
1144 Ga0495687_051164 3300047443 Bacteria 1755
1145 Ga0495675_0149672 3300047444 Unclassified 1442
1146 Ga0495679_000004 3300047446 Bacteria 748056
1147 Ga0495673_0000004 3300047469 Bacteria 1354526
1148 Ga0495673_0000048 3300047469 Bacteria 265950
1149 Ga0495673_0000902 3300047469 Bacteria 27227
1150 Ga0495686_0000017 3300047472 Bacteria 435554
1151 Ga0495686_0000034 3300047472 Bacteria 325038
1152 Ga0495686_0001142 3300047472 Bacteria 31243
1153 Ga0495686_0006281 3300047472 Bacteria 9140
1154 Ga0495686_0015980 3300047472 Bacteria 5102
1155 Ga0495602_0236175 3300048088 Unclassified 1370
1156 Ga0496100_0013405 3300048903 Bacteria 4727
1157 Ga0496100_0041482 3300048903 Bacteria 2933
1158 Ga0496101_0000755 3300048904 Bacteria 19172
1159 Ga0496101_0078983 3300048904 Bacteria 2428
1160 Ga0496101_0104609 3300048904 Unclassified 2123
1161 Ga0496101_0187584 3300048904 Bacteria 1595
1162 Ga0496102_0000795 3300048905 Bacteria 30629
1163 Ga0496102_0013331 3300048905 Bacteria 7120
1164 Ga0496102_0025626 3300048905 Bacteria 5253
1165 Ga0496102_0063865 3300048905 Bacteria 3372
1166 Ga0496102_0218818 3300048905 Bacteria 1795
1167 Ga0496102_0324523 3300048905 Bacteria 1450
1168 Ga0496104_0000011 3300048907 Bacteria 459358
1169 Ga0496104_0001093 3300048907 Bacteria 23181
1170 Ga0496104_0018753 3300048907 Bacteria 6318
1171 Ga0496104_0031519 3300048907 Bacteria 4931
1172 Ga0496104_0150300 3300048907 Bacteria 2236
1173 Ga0496105_0000071 3300048908 Bacteria 79908
1174 Ga0496105_0001142 3300048908 Bacteria 18520
1175 Ga0496105_0017638 3300048908 Bacteria 5727
1176 Ga0496105_0034731 3300048908 Bacteria 4148
1177 Ga0496105_0193819 3300048908 Bacteria 1661
1178 Ga0496106_0000509 3300048909 Bacteria 27515
1179 Ga0496106_0000648 3300048909 Bacteria 24888
1180 Ga0496108_0000833 3300048911 Bacteria 24009
1181 Ga0496108_0233272 3300048911 Unclassified 1600
1182 Ga0496109_0028206 3300048912 Bacteria 5019
1183 Ga0496109_0153552 3300048912 Unclassified 2156
1184 Ga0496109_0265689 3300048912 Bacteria 1616
1185 Ga0496110_0000259 3300048913 Bacteria 34407
1186 Ga0496110_0004926 3300048913 Bacteria 10428
1187 Ga0496111_0001711 3300048914 Bacteria 12816
1188 Ga0496111_0093431 3300048914 Bacteria 2205
1189 Ga0496112_0000385 3300048915 Bacteria 28974
1190 Ga0496112_0296853 3300048915 Bacteria 1562
1191 Ga0496112_0335633 3300048915 Unclassified 1455
1192 Ga0496113_0009116 3300048916 Bacteria 6502
1193 Ga0496113_0051107 3300048916 Bacteria 3084
1194 Ga0496113_0257385 3300048916 Bacteria 1394
1195 Ga0496114_0003309 3300048917 Bacteria 12378
1196 Ga0496114_0003626 3300048917 Bacteria 11871
1197 Ga0496114_0084519 3300048917 Bacteria 2687
1198 Ga0496114_0178403 3300048917 Bacteria 1854
1199 Ga0496115_0000153 3300048918 Bacteria 64207
1200 Ga0496115_0000206 3300048918 Bacteria 54824
1201 Ga0496115_0000946 3300048918 Bacteria 21065
1202 Ga0496115_0063047 3300048918 Bacteria 2991
1203 Ga0496115_0092503 3300048918 Bacteria 2472
1204 Ga0496116_0008342 3300048919 Bacteria 9004
1205 Ga0496116_0009818 3300048919 Bacteria 8110
1206 Ga0496116_0021663 3300048919 Bacteria 4838
1207 Ga0496116_0063156 3300048919 Bacteria 2387
1208 Ga0496117_0000229 3300048920 Bacteria 105861
1209 Ga0496117_0005879 3300048920 Bacteria 12682
1210 Ga0496117_0006203 3300048920 Bacteria 12192
1211 Ga0496117_0008476 3300048920 Bacteria 9759
1212 Ga0496117_0009735 3300048920 Bacteria 8868
1213 Ga0496117_0011389 3300048920 Bacteria 7968
1214 Ga0496117_0013334 3300048920 Bacteria 7177
1215 Ga0496117_0033016 3300048920 Bacteria 3920
1216 Ga0496117_0035686 3300048920 Bacteria 3729
1217 Ga0496117_0058954 3300048920 Bacteria 2655
1218 Ga0496117_0071363 3300048920 Bacteria 2327
1219 Ga0496118_0000016 3300048921 Bacteria 549586
1220 Ga0496118_0000362 3300048921 Bacteria 76786
1221 Ga0496118_0001608 3300048921 Bacteria 33395
1222 Ga0496118_0003118 3300048921 Bacteria 21238
1223 Ga0496118_0004394 3300048921 Bacteria 16754
1224 Ga0496118_0006389 3300048921 Bacteria 12979
1225 Ga0496118_0006962 3300048921 Bacteria 12210
1226 Ga0496118_0007348 3300048921 Bacteria 11715
1227 Ga0496118_0008539 3300048921 Bacteria 10565
1228 Ga0496118_0033388 3300048921 Bacteria 4223
1229 Ga0496118_0048926 3300048921 Bacteria 3259
1230 Ga0496118_0053333 3300048921 Bacteria 3076
1231 Ga0496118_0056089 3300048921 Bacteria 2965
1232 Ga0496118_0105515 3300048921 Bacteria 1888
1233 Ga0496119_0000851 3300048922 Bacteria 40261
1234 Ga0496119_0001081 3300048922 Bacteria 34425
1235 Ga0496119_0006339 3300048922 Bacteria 11010
1236 Ga0496119_0006549 3300048922 Bacteria 10742
1237 Ga0496119_0010886 3300048922 Bacteria 7601
1238 Ga0496119_0014335 3300048922 Bacteria 6214
1239 Ga0496119_0028839 3300048922 Bacteria 3778
1240 Ga0496120_0000839 3300048923 Bacteria 43743
1241 Ga0496120_0001250 3300048923 Bacteria 31970
1242 Ga0496120_0001337 3300048923 Bacteria 30388
1243 Ga0496120_0001387 3300048923 Bacteria 29403
1244 Ga0496120_0002462 3300048923 Bacteria 18657
1245 Ga0496121_0000045 3300048924 Bacteria 336130
1246 Ga0496121_0000743 3300048924 Bacteria 59998
1247 Ga0496121_0000755 3300048924 Bacteria 59452
1248 Ga0496121_0002194 3300048924 Bacteria 30543
1249 Ga0496121_0007504 3300048924 Bacteria 13160
1250 Ga0496121_0007867 3300048924 Bacteria 12750
1251 Ga0496121_0011918 3300048924 Bacteria 9570
1252 Ga0496121_0014077 3300048924 Bacteria 8532
1253 Ga0496121_0015063 3300048924 Bacteria 8138
1254 Ga0496121_0026438 3300048924 Bacteria 5470
1255 Ga0496121_0031203 3300048924 Bacteria 4873
1256 Ga0496121_0124894 3300048924 Bacteria 1936
1257 Ga0496121_0186718 3300048924 Bacteria 1490
1258 Ga0496122_0001419 3300048925 Bacteria 38784
1259 Ga0496122_0003014 3300048925 Bacteria 22846
1260 Ga0496122_0003143 3300048925 Bacteria 22097
1261 Ga0496122_0010988 3300048925 Bacteria 9251
1262 Ga0496122_0011267 3300048925 Bacteria 9083
1263 Ga0496122_0012114 3300048925 Bacteria 8634
1264 Ga0496122_0018388 3300048925 Bacteria 6465
1265 Ga0496123_0000619 3300048926 Bacteria 59624
1266 Ga0496123_0000624 3300048926 Bacteria 59382
1267 Ga0496123_0001240 3300048926 Bacteria 37029
1268 Ga0496123_0005952 3300048926 Bacteria 12009
1269 Ga0496123_0011606 3300048926 Bacteria 7615
1270 Ga0496123_0025282 3300048926 Bacteria 4482
1271 Ga0496123_0050317 3300048926 Bacteria 2784
1272 Ga0496123_0050349 3300048926 Bacteria 2783
1273 Ga0496123_0051844 3300048926 Bacteria 2729
1274 Ga0496123_0053672 3300048926 Bacteria 2661
1275 Ga0496124_0000009 3300048927 Bacteria 734820
1276 Ga0496124_0001044 3300048927 Bacteria 43754
1277 Ga0496124_0001822 3300048927 Bacteria 29452
1278 Ga0496124_0008706 3300048927 Bacteria 10546
1279 Ga0496124_0009017 3300048927 Bacteria 10320
1280 Ga0496124_0009858 3300048927 Bacteria 9770
1281 Ga0496124_0015807 3300048927 Bacteria 7211
1282 Ga0496124_0017163 3300048927 Bacteria 6839
1283 Ga0496124_0028626 3300048927 Bacteria 4981
1284 Ga0496124_0030624 3300048927 Bacteria 4773
1285 Ga0496124_0044067 3300048927 Bacteria 3830
1286 Ga0496124_0084515 3300048927 Bacteria 2602
1287 Ga0496124_0150076 3300048927 Bacteria 1829
1288 Ga0496124_0191141 3300048927 Bacteria 1566
1289 Ga0496124_0239680 3300048927 Bacteria 1349
1290 Ga0496125_0000353 3300048928 Bacteria 86674
1291 Ga0496125_0008250 3300048928 Bacteria 10940
1292 Ga0496125_0009310 3300048928 Bacteria 10130
1293 Ga0496125_0011414 3300048928 Bacteria 8886
1294 Ga0496125_0013084 3300048928 Bacteria 8182
1295 Ga0496125_0013390 3300048928 Bacteria 8067
1296 Ga0496125_0023264 3300048928 Bacteria 5723
1297 Ga0496125_0073817 3300048928 Bacteria 2649
1298 Ga0496125_0089911 3300048928 Bacteria 2307
1299 Ga0496126_0000199 3300048929 Bacteria 133742
1300 Ga0496126_0002458 3300048929 Bacteria 24978
1301 Ga0496126_0003516 3300048929 Bacteria 19717
1302 Ga0496126_0010449 3300048929 Bacteria 9727
1303 Ga0496126_0017231 3300048929 Bacteria 7200
1304 Ga0496126_0018477 3300048929 Bacteria 6907
1305 Ga0496126_0022327 3300048929 Bacteria 6160
1306 Ga0496126_0045112 3300048929 Bacteria 4054
1307 Ga0496126_0055718 3300048929 Bacteria 3575
1308 Ga0496126_0108422 3300048929 Bacteria 2421
1309 Ga0496126_0135863 3300048929 Bacteria 2121
1310 Ga0496126_0143201 3300048929 Bacteria 2055
1311 Ga0495678_000237 3300049459 Bacteria 62286
1312 Ga0495682_0001382 3300049460 Bacteria 13255
1313 Ga0501290_002268 3300049513 Bacteria 2497
1314 Ga0501300_001548 3300049523 Bacteria 3455
1315 Ga0501031_0054554 3300049568 Bacteria 2604
1316 Ga0501031_0061396 3300049568 Bacteria 2449
1317 Ga0501031_0104613 3300049568 Bacteria 1847
1318 Ga0501031_0173825 3300049568 Bacteria 1407
1319 Ga0501032_0007509 3300049569 Bacteria 7963
1320 Ga0501032_0015091 3300049569 Bacteria 5456
1321 Ga0501033_0000560 3300049570 Bacteria 34587
1322 Ga0501033_0001952 3300049570 Bacteria 17946
1323 Ga0501034_0000344 3300049571 Bacteria 80851
1324 Ga0501034_0000355 3300049571 Bacteria 78528
1325 Ga0501034_0000462 3300049571 Bacteria 67291
1326 Ga0501034_0004256 3300049571 Bacteria 15964
1327 Ga0501034_0005495 3300049571 Bacteria 13833
1328 Ga0501034_0030346 3300049571 Bacteria 5496
1329 Ga0501034_0046181 3300049571 Unclassified 4401
1330 Ga0501034_0050421 3300049571 Bacteria 4198
1331 Ga0501034_0068398 3300049571 Bacteria 3561
1332 Ga0501034_0073364 3300049571 Bacteria 3431
1333 Ga0501034_0238680 3300049571 Bacteria 1764
1334 Ga0501034_0240730 3300049571 Bacteria 1755
1335 Ga0501036_0022240 3300049572 Bacteria 5333
1336 Ga0501036_0152719 3300049572 Bacteria 1947
1337 Ga0501036_0176325 3300049572 Bacteria 1800
1338 Ga0501037_0092948 3300049573 Bacteria 2181
1339 Ga0501037_0160316 3300049573 Bacteria 1604
1340 Ga0501038_0004661 3300049574 Bacteria 12768
1341 Ga0501038_0026234 3300049574 Bacteria 5190
1342 Ga0501038_0081413 3300049574 Bacteria 2728
1343 Ga0501038_0111583 3300049574 Bacteria 2265
1344 Ga0501038_0128316 3300049574 Bacteria 2085
1345 Ga0501039_0003438 3300049575 Bacteria 11824
1346 Ga0501039_0021737 3300049575 Bacteria 4923
1347 Ga0501039_0072678 3300049575 Bacteria 2672
1348 Ga0501042_0050657 3300049578 Bacteria 2962
1349 Ga0501043_0005996 3300049579 Bacteria 9768
1350 Ga0501043_0016000 3300049579 Bacteria 5880
1351 Ga0501043_0044225 3300049579 Bacteria 3501
1352 Ga0501043_0071704 3300049579 Bacteria 2720
1353 Ga0501043_0080290 3300049579 Bacteria 2562
1354 Ga0501043_0203771 3300049579 Bacteria 1534
1355 Ga0501046_0018914 3300049580 Bacteria 5721
1356 Ga0501046_0024699 3300049580 Bacteria 4925
1357 Ga0501047_0000349 3300049581 Bacteria 52184
1358 Ga0501047_0003090 3300049581 Bacteria 15796
1359 Ga0501047_0005767 3300049581 Bacteria 11659
1360 Ga0501047_0016313 3300049581 Bacteria 7087
1361 Ga0501047_0018637 3300049581 Bacteria 6655
1362 Ga0501047_0047595 3300049581 Bacteria 4142
1363 Ga0501047_0244415 3300049581 Bacteria 1644
1364 Ga0501067_0000269 3300049583 Bacteria 28395
1365 Ga0501068_0016510 3300049584 Bacteria 4256
1366 Ga0501068_0021384 3300049584 Bacteria 3777
1367 Ga0501069_0019699 3300049585 Bacteria 3650
1368 Ga0501069_0023705 3300049585 Bacteria 3346
1369 Ga0501070_0007994 3300049586 Bacteria 8956
1370 Ga0501070_0021123 3300049586 Bacteria 5463
1371 Ga0501070_0078688 3300049586 Bacteria 2728
1372 Ga0501070_0086159 3300049586 Bacteria 2600
1373 Ga0501070_0135852 3300049586 Bacteria 2030
1374 Ga0501073_0000424 3300049589 Bacteria 28912
1375 Ga0501073_0003183 3300049589 Bacteria 12318
1376 Ga0501073_0030080 3300049589 Bacteria 3879
1377 Ga0501073_0068177 3300049589 Bacteria 2479
1378 Ga0501073_0131814 3300049589 Bacteria 1732
1379 Ga0501074_0004717 3300049590 Bacteria 9767
1380 Ga0501074_0005580 3300049590 Bacteria 9051
1381 Ga0501074_0021678 3300049590 Bacteria 4665
1382 Ga0501257_014392 3300049686 Bacteria 1819
1383 Ga0501225_0004420 3300049705 Bacteria 4186
1384 Ga0501079_0180051 3300049741 Bacteria 1649
1385 Ga0501080_0001205 3300049742 Bacteria 21436
1386 Ga0501080_0003297 3300049742 Bacteria 14263
1387 Ga0501080_0009653 3300049742 Bacteria 8812
1388 Ga0501080_0010508 3300049742 Bacteria 8475
1389 Ga0501080_0012469 3300049742 Bacteria 7792
1390 Ga0501080_0099330 3300049742 Bacteria 2701
1391 Ga0501080_0124623 3300049742 Bacteria 2386
1392 Ga0501080_0240779 3300049742 Bacteria 1651
1393 Ga0501083_0001868 3300049744 Bacteria 14459
1394 Ga0501275_000978 3300049772 Bacteria 3002
1395 Ga0501280_003643 3300049776 Bacteria 2341
1396 Ga0501035_0001816 3300049822 Bacteria 21577
1397 Ga0501035_0002412 3300049822 Bacteria 18314
1398 Ga0501035_0013058 3300049822 Bacteria 7664
1399 Ga0501035_0014642 3300049822 Bacteria 7242
1400 Ga0501035_0028145 3300049822 Bacteria 5132
1401 Ga0501044_0009710 3300049823 Bacteria 10469
1402 Ga0501044_0015840 3300049823 Bacteria 8112
1403 Ga0501044_0045645 3300049823 Bacteria 4539
1404 Ga0501044_0069622 3300049823 Bacteria 3581
1405 Ga0501044_0099429 3300049823 Bacteria 2927
1406 Ga0501044_0154097 3300049823 Bacteria 2278
1407 Ga0501044_0194903 3300049823 Bacteria 1986
1408 Ga0501044_0286563 3300049823 Bacteria 1579
1409 Ga0501044_0319618 3300049823 Bacteria 1477
1410 nmdc:mga00v17_10323_c1 3300050491 Bacteria 5093
1411 nmdc:mga00v17_11438_c1 3300050491 Bacteria 4876
1412 nmdc:mga05p37_430896_c1 3300050507 Bacteria 1532
1413 nmdc:mga0n895_327485_c1 3300050512 Bacteria 1552
1414 nmdc:mga0n895_37617_c1 3300050512 Bacteria 4683
1415 nmdc:mga0n895_82096_c1 3300050512 Bacteria 3213
1416 nmdc:mga0rr50_27235_c1 3300050513 Bacteria 3998
1417 nmdc:mga0a205_59921_c1 3300050515 Bacteria 3676
1418 Ga0495601_0042966 3300053077 Bacteria 2838
1419 Ga0500643_000108 3300053087 Bacteria 86547
1420 Ga0500643_002812 3300053087 Bacteria 8699
1421 Ga0500651_0000413 3300053093 Bacteria 23063
1422 Ga0500651_0002847 3300053093 Bacteria 9293
1423 Ga0500651_0077668 3300053093 Bacteria 2060
1424 Ga0500555_000973 3300053103 Bacteria 9908
1425 Ga0500617_025827 3300053124 Bacteria 2611
1426 Ga0500564_040749 3300053138 Bacteria 2138
1427 Ga0500568_0000145 3300053139 Bacteria 62300
1428 Ga0500577_0004561 3300053142 Bacteria 3673
1429 Ga0500588_0025031 3300053146 Bacteria 1654
1430 Ga0500616_0000042 3300053153 Bacteria 351293
1431 Ga0500633_0000332 3300053160 Bacteria 7084
1432 Ga0500634_0000095 3300053161 Bacteria 34310
1433 Ga0500637_0021375 3300053178 Bacteria 3515
1434 Ga0500637_0095565 3300053178 Unclassified 1721
1435 Ga0500645_001933 3300053730 Bacteria 9842
1436 Ga0501084_0045125 3300054114 Bacteria 3691
1437 Ga0501084_0179028 3300054114 Bacteria 1790
1438 Ga0501084_0257486 3300054114 Bacteria 1473
1439 Ga0501082_0000082 3300060353 Bacteria 71065
1440 Ga0501082_0094292 3300060353 Bacteria 2586
1441 Ga0466962_0009930 3300061719 Bacteria 4567
1442 Ga0466962_0010461 3300061719 Bacteria 4460
1443 2525556789 2524614729 Bacteria 3091755
1444 2538832297 2537561836 Bacteria 3910579
1445 2547501130 2547132130 Bacteria 4660562
1446 2572255019 2571042365 Bacteria 3289345
1447 2578457870 2576861471 Bacteria 4648976
1448 2586206561 2585427687 Bacteria 5544917
1449 2595446771 2593339238 Bacteria 4182970
1450 2595449540 2593339239 Bacteria 4124669
1451 2630648385 2627854209 Bacteria 3093011
1452 2643817684 2643221559 Bacteria 4424915
1453 2643830319 2643221562 Bacteria 4048635
1454 2643878909 2643221573 Bacteria 4784121
1455 2643894891 2643221577 Bacteria 3710843
1456 2643907830 2643221579 Bacteria 4443405
1457 2643915963 2643221581 Bacteria 3893603
1458 2643940395 2643221586 Bacteria 4446529
1459 2643976704 2643221593 Bacteria 6296053
1460 2644079469 2643221612 Bacteria 4361984
1461 2644477050 2643221685 Bacteria 3673288
1462 2644529429 2643221695 Bacteria 3441323
1463 2644660225 2643221720 Bacteria 4694283
1464 2644694911 2643221727 Bacteria 4415595
1465 2644697527 2643221728 Bacteria 4797149
1466 2687583738 2687453130 Bacteria 4227172
1467 2721026552 2718218334 Bacteria 4765486
1468 2735833453 2734482264 Unclassified 5014763
1469 2738853853 2738541302 Bacteria 5944758
1470 2739229455 2738543009 Bacteria 4944499
1471 2739616097 2739367656 Bacteria 5152243
1472 2739645126 2739367663 Bacteria 5040914
1473 2739730284 2739367700 Bacteria 4747630
1474 2747948029 2747842428 Bacteria 4689383
1475 2748015776 2747842501 Bacteria 5293829
1476 2765579624 2765235840 Bacteria 4663337
1477 2816517704 2816332141 Bacteria 4436036
1478 2819549878 2818991437 Bacteria 5805520
1479 2819563931 2818991440 Bacteria 4774720
1480 2819663037 2818991457 Bacteria 5323295
1481 2842391886 2842391507 Bacteria 4486072
1482 2842723669 2842722452 Bacteria 6263924
1483 2842760160 2842757796 Bacteria 3981385
1484 2842780804 2842780639 Bacteria 4337790
1485 2842910175 2842909656 Bacteria 6185908
1486 2842918531 2842914999 Bacteria 4419378
1487 2842919849 2842918807 Bacteria 4289178
1488 2849285198 2849281842 Bacteria 6065644
1489 2852650307 2852649853 Bacteria 4036942
1490 2852685970 2852684882 Bacteria 5463342
1491 2857446785 2857442823 Bacteria 4562550
1492 2874222320 2874220319 Bacteria 4594709
1493 2884341446 2884338543 Bacteria 4610696
1494 2884412114 2884411467 Bacteria 5246714
1495 2884635712 2884634485 Bacteria 3928637
1496 2894415699 2894414249 Bacteria 4405451
1497 2895397695 2895395659 Bacteria 3983269
1498 2895500656 2895498888 Bacteria 5283788
1499 2895516474 2895511927 Bacteria 6802080
1500 2895523606 2895522137 Bacteria 3284416
1501 2895526812 2895525241 Bacteria 3388457
1502 2904445815 2904445276 Bacteria 5310396
1503 2904464567 2904463128 Bacteria 4775606
1504 2919088354 2919085039 Bacteria 4532964
1505 2919091095 2919089067 Bacteria 4560942
1506 2919133508 2919130084 Bacteria 5301837
1507 2919135422 2919134579 Bacteria 4480386
1508 2919406067 2919404418 Bacteria 4232372
1509 2919516387 2919513703 Bacteria 3844312
1510 2919676964 2919675420 Bacteria 3969095
1511 2919693433 2919692658 Bacteria 5943958
1512 2923518507 2923516293 Bacteria 3716336
1513 2928497645 2928496128 Bacteria 4631123
1514 2928967725 2928963466 Bacteria 5165703
1515 2929197438 2929195423 Bacteria 5325372
1516 2931384226 2931380184 Bacteria 4455911
1517 2937613289 2937610967 Bacteria 4618818
1518 2939592929 2939589442 Bacteria 4214238
1519 2939612492 2939611941 Bacteria 3892017
1520 2939625669 2939622612 Bacteria 4698046
1521 2939628955 2939626828 Bacteria 4695272
1522 2941472896 2941471342 Bacteria 5018624
1523 2941476388 2941475908 Bacteria 4145589
1524 2941490478 2941489479 Bacteria 6313767
1525 2946000488 2945997725 Bacteria 6404843
1526 2953995145 2953994433 Bacteria 4303959
1527 2954017407 2954016120 Bacteria 6446024
1528 2961049085 2961047084 Bacteria 4594415
1529 2961066219 2961064222 Bacteria 4749990
1530 2974308470 2974307012 Bacteria 4172388
1531 2977249224 2977247770 Bacteria 4160543
1532 2987607267 2987605356 Bacteria 4187822
1533 2995951554 2995948881 Bacteria 6358104
1534 8002872200 8002869464 Bacteria 3588529
1535 8003016097 8003014200 Bacteria 4059994
1536 8021624228 8021622325 Bacteria 4844743
1537 8021628274 8021626552 Bacteria 4665214
1538 8021652027 8021648035 Bacteria 4772378
1539 Ga0207690_10003643
1540 MBSR1b_contig_900596
1541 JGI24739J22299_10007286
1542 JGI24737J22298_10009783
1543 JGI24737J22298_10010243
1544 JGI24735J21928_10000835
1545 JGI24738J21930_10001462
1546 JGI24751J29686_10003122
1547 JGI25156J39149_1000463
1548 JGI25156J39149_1005915
1549 JGI25162J39368_1000163
1550 JGI25162J39368_1001323
1551 JGI25162J39368_1001643
1552 JGI25162J39368_1002322
1553 JGI25162J39368_1003786
1554 JGI25157J39369_1000229
1555 JGI25157J39369_1000575
1556 JGI25157J39369_1001131
1557 JGI25157J39369_1001217
1558 JGI25163J39215_1000340
1559 JGI25164J39214_1000045
1560 JGI25164J39214_1000285
1561 JGI25164J39214_1000485
1562 JGI25164J39214_1000690
1563 JGI25164J39214_1000749
1564 JGI25164J39214_1002903
1565 JGI25152J39213_1000032
1566 JGI25152J39213_1000075
1567 JGI25150J39212_1000009
1568 JGI25150J39212_1000179
1569 JGI25151J46595_10000017
1570 JGI25151J46595_10000138
1571 JGI25151J46595_10000148
1572 JGI25165J46597_1000072
1573 JGI25165J46597_1000215
1574 JGI25165J46597_1000812
1575 JGI25165J46597_1002118
1576 JGI25153J46596_10000023
1577 JGI25153J46596_10000102
1578 rootH1_10029918
1579 rootH2_10004805
1580 rootL2_10019089
1581 rootL2_10163832
1582 rootL2_10251176
1583 rootL2_10337394
1584 Ga0006562J51391_1006721
1585 Ga0006562J51391_1006724
1586 Ga0006562J51391_1025422
1587 Ga0006562J51391_1025425
1588 Ga0055538_1000813
1589 Ga0055539_1000576
1590 Ga0055533_1000506
1591 Ga0055525_1000027
1592 Ga0055527_1000082
1593 Ga0055527_1000209
1594 Ga0055527_1001662
1595 Ga0055535_1000124
1596 Ga0055535_1000143
1597 Ga0055535_1000451
1598 Ga0055535_1000831
1599 Ga0055535_1000945
1600 Ga0055542_1000190
1601 Ga0055542_1000197
1602 Ga0055542_1000242
1603 Ga0055542_1000349
1604 Ga0055542_1000466
1605 Ga0055542_1000497
1606 Ga0055529_1000197
1607 Ga0055529_1000204
1608 Ga0055529_1000217
1609 Ga0055529_1001596
1610 Ga0055526_1000006
1611 Ga0055526_1007145
1612 Ga0055537_1000018
1613 Ga0055524_1000009
1614 Ga0055524_1004161
1615 Ga0055524_1015188
1616 Ga0055536_1002383
1617 Ga0055536_1003808
1618 Ga0055536_1004891
1619 Ga0055536_1006471
1620 Ga0055536_1012472
1621 Ga0055534_1000004
1622 Ga0055534_1000073
1623 Ga0055528_1000003
1624 Ga0055528_1000080
1625 Ga0055530_10001767
1626 Ga0055530_10001774
1627 Ga0055530_10003477
1628 Ga0055531_10003032
1629 Ga0055531_10011795
1630 Ga0055531_10011796
1631 Ga0055531_10011911
1632 Ga0055531_10016716
1633 Ga0055531_10017787
1634 Ga0058692_1000012
1635 Ga0058692_1000023
1636 Ga0065165_1000118
1637 Ga0065165_1004303
1638 Ga0065714_10004312
1639 Ga0065714_10064511
1640 Ga0065704_10071057
1641 Ga0065715_10007275
1642 Ga0065715_10100212
1643 Ga0065715_10123711
1644 Ga0070658_10001254
1645 Ga0070658_10013372
1646 Ga0070676_10003356
1647 Ga0070683_100001622
1648 Ga0070683_100053648
1649 Ga0070690_100000327
1650 Ga0070690_100049203
1651 Ga0070670_100005062
1652 Ga0070670_100013423
1653 Ga0070677_10000209
1654 Ga0068869_100000286
1655 Ga0068869_100119781
1656 Ga0070666_10000005
1657 Ga0070666_10000109
1658 Ga0070666_10000805
1659 Ga0070666_10002869
1660 Ga0070666_10057434
1661 Ga0070666_10075482
1662 Ga0070680_100002873
1663 Ga0070680_100011321
1664 Ga0070680_100023548
1665 Ga0070682_100007901
1666 Ga0068868_100000557
1667 Ga0068868_100013762
1668 Ga0068868_100028857
1669 Ga0068868_100202520
1670 Ga0070660_100000479
1671 Ga0070660_100016908
1672 Ga0070660_100038440
1673 Ga0070689_100000344
1674 Ga0070689_100001122
1675 Ga0070689_100123459
1676 Ga0070687_100000032
1677 Ga0070661_100000412
1678 Ga0070661_100001964
1679 Ga0070661_100060203
1680 Ga0070661_100087117
1681 Ga0070661_100214566
1682 Ga0070692_10025985
1683 Ga0070668_100000345
1684 Ga0070668_100015091
1685 Ga0070668_100084432
1686 Ga0070668_100121502
1687 Ga0070669_100000307
1688 Ga0070669_100179532
1689 Ga0070675_100001155
1690 Ga0070675_100203501
1691 Ga0070671_100001287
1692 Ga0070671_100040396
1693 Ga0070674_100000600
1694 Ga0070674_100057417
1695 Ga0070674_100121502
1696 Ga0070673_100001765
1697 Ga0070673_100164532
1698 Ga0070673_100266514
1699 Ga0070688_100000122
1700 Ga0070659_100000635
1701 Ga0070659_100210426
1702 Ga0070659_100266770
1703 Ga0070667_100000008
1704 Ga0070667_100001757
1705 Ga0070667_100008888
1706 Ga0070667_100012080
1707 Ga0070709_10000150
1708 Ga0070709_10002949
1709 Ga0070709_10008131
1710 Ga0070709_10019946
1711 Ga0070714_100000149
1712 Ga0070714_100000458
1713 Ga0070714_100004355
1714 Ga0070714_100036194
1715 Ga0070714_100143837
1716 Ga0070714_100173984
1717 Ga0070713_100003277
1718 Ga0070713_100008095
1719 Ga0070713_100109078
1720 Ga0070713_100155737
1721 Ga0070710_10025891
1722 Ga0070701_10005911
1723 Ga0070711_100002260
1724 Ga0070705_100000279
1725 Ga0070700_100002942
1726 Ga0070694_100000204
1727 Ga0070708_100020082
1728 Ga0070663_100000597
1729 Ga0070663_100002347
1730 Ga0070663_100003417
1731 Ga0070663_100057041
1732 Ga0070678_100002705
1733 Ga0070678_100003908
1734 Ga0070662_100000190
1735 Ga0070662_100075920
1736 Ga0070662_100107941
1737 Ga0070681_10003155
1738 Ga0070681_10007152
1739 Ga0070681_10009885
1740 Ga0070681_10034041
1741 Ga0070681_10075230
1742 Ga0070681_10157559
1743 Ga0068867_100054893
1744 Ga0068867_100066135
1745 Ga0068867_100132916
1746 Ga0070685_10000369
1747 Ga0070685_10006608
1748 Ga0070706_100173054
1749 Ga0070679_100018451
1750 Ga0070679_100092110
1751 Ga0070684_100014406
1752 Ga0070684_100137306
1753 Ga0070684_100141543
1754 Ga0070684_100290343
1755 Ga0068853_100000259
1756 Ga0068853_100032558
1757 Ga0068853_100047562
1758 Ga0068853_100048355
1759 Ga0068853_100110242
1760 Ga0070672_100000406
1761 Ga0070672_100026633
1762 Ga0070672_100069142
1763 Ga0070686_100000081
1764 Ga0070696_100004581
1765 Ga0070693_100005994
1766 Ga0070693_100032053
1767 Ga0070665_100000057
1768 Ga0070665_100000509
1769 Ga0070665_100002620
1770 Ga0070665_100009037
1771 Ga0070665_100010946
1772 Ga0070665_100012054
1773 Ga0070665_100025397
1774 Ga0070665_100031583
1775 Ga0070665_100102384
1776 Ga0070704_100000581
1777 Ga0070704_100045333
1778 Ga0068855_100001159
1779 Ga0068855_100003960
1780 Ga0068855_100010678
1781 Ga0068855_100018608
1782 Ga0068855_100072638
1783 Ga0068855_100102303
1784 Ga0068855_100116428
1785 Ga0068855_100156309
1786 Ga0068855_100242798
1787 Ga0068855_100429319
1788 Ga0070664_100001026
1789 Ga0070664_100001532
1790 Ga0070664_100153113
1791 Ga0070664_100283393
1792 Ga0068857_100001061
1793 Ga0068857_100003310
1794 Ga0068857_100007464
1795 Ga0068857_100179486
1796 Ga0068857_100191818
1797 Ga0068857_100232965
1798 Ga0068854_100000223
1799 Ga0068854_100000451
1800 Ga0068854_100002922
1801 Ga0068856_100003203
1802 Ga0068856_100005028
1803 Ga0068856_100024970
1804 Ga0068856_100030925
1805 Ga0068856_100091233
1806 Ga0068856_100091831
1807 Ga0070702_100000849
1808 Ga0068852_100000420
1809 Ga0068852_100017202
1810 Ga0068852_100078806
1811 Ga0068859_100000604
1812 Ga0068859_100010357
1813 Ga0068859_100012737
1814 Ga0068859_100059622
1815 Ga0068864_100004095
1816 Ga0068864_100087119
1817 Ga0068866_10000018
1818 Ga0068866_10086156
1819 Ga0068861_100000738
1820 Ga0068861_100004789
1821 Ga0068861_100110762
1822 Ga0068851_10000206
1823 Ga0068851_10000825
1824 Ga0068851_10014760
1825 Ga0068851_10026573
1826 Ga0068870_10000033
1827 Ga0068863_100000937
1828 Ga0068863_100002484
1829 Ga0068863_100005670
1830 Ga0068863_100006860
1831 Ga0068863_100006983
1832 Ga0068863_100024210
1833 Ga0068863_100031963
1834 Ga0068863_100090106
1835 Ga0068863_100268757
1836 Ga0068858_100000598
1837 Ga0068858_100001840
1838 Ga0068858_100002641
1839 Ga0068858_100009300
1840 Ga0068858_100018715
1841 Ga0068858_100085620
1842 Ga0068858_100147153
1843 Ga0068858_100352335
1844 Ga0068860_100000771
1845 Ga0068860_100002378
1846 Ga0068860_100008084
1847 Ga0068860_100022800
1848 Ga0068860_100035103
1849 Ga0068860_100038341
1850 Ga0068862_100000354
1851 Ga0068862_100000659
1852 Ga0068862_100041500
1853 Ga0081540_1000141
1854 Ga0081540_1000258
1855 Ga0081540_1003160
1856 Ga0081539_10000011
1857 Ga0070717_10012772
1858 Ga0070717_10021430
1859 Ga0075364_10001177
1860 Ga0075364_10013314
1861 Ga0075364_10032361
1862 Ga0070715_10001990
1863 Ga0070716_100002786
1864 Ga0070716_100018735
1865 Ga0070712_100000241
1866 Ga0070712_100000683
1867 Ga0070712_100073425
1868 Ga0097621_100000812
1869 Ga0097621_100050678
1870 Ga0097621_100066714
1871 Ga0068871_100000098
1872 Ga0068871_100015422
1873 Ga0068871_100072963
1874 Ga0068871_100095723
1875 Ga0068871_100212280
1876 Ga0075428_100066180
1877 Ga0075434_100010839
1878 Ga0068865_100000442
1879 Ga0068865_100009034
1880 Ga0097620_100000604
1881 Ga0097620_100010356
1882 Ga0097620_100012737
1883 Ga0097620_100041171
1884 Ga0097620_100059620
1885 Ga0105251_10000108
1886 Ga0105251_10006958
1887 Ga0105250_10019433
1888 Ga0105240_10003023
1889 Ga0105240_10007393
1890 Ga0105240_10008662
1891 Ga0105240_10020449
1892 Ga0105240_10021699
1893 Ga0105240_10035269
1894 Ga0105240_10042160
1895 Ga0105240_10046310
1896 Ga0105240_10185591
1897 Ga0105240_10326788
1898 Ga0111539_10213983
1899 Ga0105245_10000849
1900 Ga0105245_10002228
1901 Ga0105245_10005446
1902 Ga0105247_10000091
1903 Ga0105247_10000104
1904 Ga0114129_10001664
1905 Ga0105243_10001938
1906 Ga0105241_10001545
1907 Ga0105241_10009602
1908 Ga0105241_10081995
1909 Ga0105241_10103116
1910 Ga0105242_10000422
1911 Ga0105242_10006695
1912 Ga0105248_10000984
1913 Ga0105248_10002035
1914 Ga0105248_10038118
1915 Ga0105248_10056265
1916 Ga0105248_10131828
1917 Ga0105248_10147865
1918 Ga0105237_10000007
1919 Ga0105237_10000064
1920 Ga0105237_10000477
1921 Ga0105237_10033265
1922 Ga0105237_10049004
1923 Ga0105237_10067757
1924 Ga0105237_10144535
1925 Ga0105237_10214244
1926 Ga0105237_10217157
1927 Ga0105238_10000688
1928 Ga0105238_10007057
1929 Ga0105238_10023524
1930 Ga0105238_10049638
1931 Ga0105238_10060979
1932 Ga0105238_10098206
1933 Ga0105238_10297923
1934 Ga0105249_10000615
1935 Ga0105249_10020112
1936 Ga0105249_10062989
1937 Ga0105249_10158755
1938 Ga0105239_10000030
1939 Ga0105239_10001432
1940 Ga0105239_10002511
1941 Ga0105239_10036277
1942 Ga0105239_10062522
1943 Ga0105239_10074879
1944 Ga0105239_10169559
1945 Ga0105239_10457682
1946 Ga0105246_10000541
1947 Ga0105246_10023422
1948 Ga0105246_10042632
1949 Ga0157314_1000608
1950 Ga0157373_10000852
1951 Ga0157373_10029899
1952 Ga0157371_10000009
1953 Ga0157371_10000852
1954 Ga0157371_10006025
1955 Ga0157371_10014602
1956 Ga0157371_10026030
1957 Ga0157371_10099694
1958 Ga0157370_10007902
1959 Ga0157370_10015720
1960 Ga0157370_10041050
1961 Ga0157369_10000097
1962 Ga0157369_10001434
1963 Ga0157369_10004547
1964 Ga0157369_10008581
1965 Ga0157369_10012799
1966 Ga0157369_10016335
1967 Ga0157369_10025071
1968 Ga0157369_10104428
1969 Ga0157369_10375797
1970 Ga0157374_10000442
1971 Ga0157374_10001660
1972 Ga0157374_10008158
1973 Ga0157374_10055081
1974 Ga0157374_10080675
1975 Ga0157378_10000565
1976 Ga0157378_10002030
1977 Ga0163162_10000015
1978 Ga0163162_10000281
1979 Ga0163162_10000521
1980 Ga0163162_10013266
1981 Ga0163162_10120099
1982 Ga0163162_10234144
1983 Ga0157372_10000001
1984 Ga0157372_10000634
1985 Ga0157372_10003349
1986 Ga0157372_10005441
1987 Ga0157372_10214285
1988 Ga0157372_10382748
1989 Ga0157375_10000441
1990 Ga0157375_10000867
1991 Ga0157375_10002945
1992 Ga0157375_10004887
1993 Ga0157375_10013335
1994 Ga0157375_10186388
1995 Ga0163163_10000196
1996 Ga0163163_10002728
1997 Ga0163163_10015406
1998 Ga0163163_10027917
1999 Ga0163163_10137097
2000 Ga0163163_10305122
2001 Ga0157380_10012708
2002 Ga0182008_10001118
2003 Ga0182008_10001546
2004 Ga0182008_10001765
2005 Ga0182008_10002596
2006 Ga0182008_10015389
2007 Ga0157377_10000187
2008 Ga0157379_10000098
2009 Ga0157379_10000690
2010 Ga0157379_10009924
2011 Ga0157379_10013698
2012 Ga0157379_10092640
2013 Ga0157376_10000542
2014 Ga0157376_10021201
2015 Ga0157376_10035731
2016 Ga0182006_1000308
2017 Ga0182006_1000689
2018 Ga0182006_1001555
2019 Ga0182006_1007530
2020 Ga0182006_1012898
2021 Ga0182007_10000001
2022 Ga0182007_10000353
2023 Ga0182007_10007125
2024 Ga0182005_1000344
2025 Ga0182005_1001893
2026 Ga0182005_1004819
2027 Ga0183373_1006
2028 Ga0183369_1007
2029 Ga0183368_1003
2030 Ga0183360_10001
2031 Ga0163161_10000934
2032 Ga0163161_10002464
2033 Ga0163161_10012244
2034 Ga0206354_10239192
2035 Ga0206353_11300788
2036 Ga0224572_1016453
2037 Ga0209760_100328
2038 Ga0209784_100120
2039 Ga0209566_104344
2040 Ga0209674_100012
2041 Ga0209674_100119
2042 Ga0209674_100426
2043 Ga0209674_100933
2044 Ga0209674_101921
2045 Ga0209672_100005
2046 Ga0209672_100016
2047 Ga0209672_100277
2048 Ga0209672_101145
2049 Ga0209672_101582
2050 Ga0209563_100023
2051 Ga0207427_100013
2052 Ga0207427_100055
2053 Ga0207427_100163
2054 Ga0207427_100244
2055 Ga0207427_100248
2056 Ga0207427_101271
2057 Ga0209437_100015
2058 Ga0209437_100020
2059 Ga0209437_100079
2060 Ga0209437_100101
2061 Ga0209437_100161
2062 Ga0209437_100224
2063 Ga0209258_100006
2064 Ga0209258_100012
2065 Ga0209258_100049
2066 Ga0209258_100064
2067 Ga0209258_100186
2068 Ga0209258_101114
2069 Ga0209258_104987
2070 Ga0207425_1000007
2071 Ga0207425_1000078
2072 Ga0207425_1001471
2073 Ga0209646_1000467
2074 Ga0209646_1001466
2075 Ga0209646_1005450
2076 Ga0209026_1000037
2077 Ga0209026_1000204
2078 Ga0209026_1000375
2079 Ga0209026_1000433
2080 Ga0209026_1000493
2081 Ga0209026_1001302
2082 Ga0209148_1000005
2083 Ga0209148_1000010
2084 Ga0209148_1000012
2085 Ga0209148_1000014
2086 Ga0209148_1000073
2087 Ga0209148_1000142
2088 Ga0209148_1003823
2089 Ga0209759_1000103
2090 Ga0209759_1000725
2091 Ga0209759_1003050
2092 Ga0209129_1000006
2093 Ga0209129_1000157
2094 Ga0209129_1002361
2095 Ga0209129_1011788
2096 Ga0209233_1000009
2097 Ga0209233_1000020
2098 Ga0209233_1000063
2099 Ga0209233_1000124
2100 Ga0209233_1000147
2101 Ga0209565_1000001
2102 Ga0209565_1000022
2103 Ga0209455_1000008
2104 Ga0209455_1000014
2105 Ga0209455_1000082
2106 Ga0209455_1000177
2107 Ga0209455_1000842
2108 Ga0209455_1006708
2109 Ga0209673_1000001
2110 Ga0209673_1000087
2111 Ga0209673_1011850
2112 Ga0209130_1004465
2113 Ga0209130_1014570
2114 Ga0209675_1000001
2115 Ga0209675_1000060
2116 Ga0209675_1023097
2117 Ga0209676_1000011
2118 Ga0209676_1000086
2119 Ga0209676_1000114
2120 Ga0209676_1000976
2121 Ga0209676_1002896
2122 Ga0209676_1005159
2123 Ga0209676_1006425
2124 Ga0209676_1007576
2125 Ga0209025_1000005
2126 Ga0209025_1000025
2127 Ga0209025_1000054
2128 Ga0209025_1000888
2129 Ga0209025_1007641
2130 Ga0209564_1000001
2131 Ga0209564_1000302
2132 Ga0209758_1000016
2133 Ga0209758_1000062
2134 Ga0209758_1000269
2135 Ga0209758_1000309
2136 Ga0209758_1024058
2137 Ga0209050_1001760
2138 Ga0209050_1002154
2139 Ga0209050_1004098
2140 Ga0209050_1015747
2141 Ga0209256_1000002
2142 Ga0209256_1001644
2143 Ga0209256_1003098
2144 Ga0209256_1003127
2145 Ga0209256_1003341
2146 Ga0209256_1004365
2147 Ga0209051_1000606
2148 Ga0209257_1000014
2149 Ga0209257_1000080
2150 Ga0209257_1000121
2151 Ga0209257_1000145
2152 Ga0209257_1000369
2153 Ga0209257_1002588
2154 Ga0209257_1003930
2155 Ga0209257_1005504
2156 Ga0209257_1009732
2157 Ga0207697_10001247
2158 Ga0207656_10000650
2159 Ga0207713_1000507
2160 Ga0207713_1007579
2161 Ga0207682_10001691
2162 Ga0207692_10012207
2163 Ga0207642_10000386
2164 Ga0207710_10000241
2165 Ga0207710_10001837
2166 Ga0207688_10000100
2167 Ga0207680_10000005
2168 Ga0207680_10000207
2169 Ga0207680_10000260
2170 Ga0207680_10001066
2171 Ga0207680_10061944
2172 Ga0207647_10000747
2173 Ga0207647_10001302
2174 Ga0207647_10003082
2175 Ga0207647_10003735
2176 Ga0207647_10005423
2177 Ga0207699_10009178
2178 Ga0207699_10024570
2179 Ga0207699_10059533
2180 Ga0207645_10000386
2181 Ga0207643_10000002
2182 Ga0207643_10033103
2183 Ga0207705_10003142
2184 Ga0207654_10000065
2185 Ga0207654_10004228
2186 Ga0207654_10090616
2187 Ga0207707_10002994
2188 Ga0207707_10020200
2189 Ga0207707_10024817
2190 Ga0207707_10057895
2191 Ga0207707_10063401
2192 Ga0207695_10000007
2193 Ga0207695_10001474
2194 Ga0207695_10001492
2195 Ga0207695_10001749
2196 Ga0207695_10002287
2197 Ga0207695_10004269
2198 Ga0207695_10005487
2199 Ga0207695_10016119
2200 Ga0207695_10016612
2201 Ga0207695_10041050
2202 Ga0207695_10043836
2203 Ga0207695_10058982
2204 Ga0207695_10251534
2205 Ga0207671_10000061
2206 Ga0207671_10000074
2207 Ga0207671_10000756
2208 Ga0207671_10001709
2209 Ga0207671_10006886
2210 Ga0207671_10060676
2211 Ga0207671_10087628
2212 Ga0207671_10110370
2213 Ga0207693_10000047
2214 Ga0207693_10000226
2215 Ga0207693_10049558
2216 Ga0207663_10008602
2217 Ga0207663_10032979
2218 Ga0207660_10011891
2219 Ga0207660_10023604
2220 Ga0207662_10000011
2221 Ga0207657_10000607
2222 Ga0207657_10039587
2223 Ga0207649_10000447
2224 Ga0207649_10000627
2225 Ga0207649_10002450
2226 Ga0207649_10058638
2227 Ga0207649_10067555
2228 Ga0207652_10081715
2229 Ga0207681_10000108
2230 Ga0207694_10001596
2231 Ga0207694_10007411
2232 Ga0207694_10013688
2233 Ga0207694_10026580
2234 Ga0207694_10035312
2235 Ga0207694_10051556
2236 Ga0207694_10117902
2237 Ga0207694_10141607
2238 Ga0207650_10000349
2239 Ga0207650_10005976
2240 Ga0207650_10057943
2241 Ga0207659_10000123
2242 Ga0207687_10003914
2243 Ga0207687_10065600
2244 Ga0207687_10067964
2245 Ga0207664_10000093
2246 Ga0207664_10010012
2247 Ga0207664_10015495
2248 Ga0207664_10077604
2249 Ga0207664_10092113
2250 Ga0207644_10000565
2251 Ga0207644_10002119
2252 Ga0207644_10055215
2253 Ga0207644_10148738
2254 Ga0207706_10000078
2255 Ga0207706_10001116
2256 Ga0207686_10005642
2257 Ga0207709_10004839
2258 Ga0207709_10017085
2259 Ga0207670_10000224
2260 Ga0207670_10000772
2261 Ga0207669_10002589
2262 Ga0207704_10000199
2263 Ga0207704_10010019
2264 Ga0207704_10027205
2265 Ga0207665_10002048
2266 Ga0207665_10004295
2267 Ga0207665_10022137
2268 Ga0207665_10081049
2269 Ga0207691_10000389
2270 Ga0207691_10021605
2271 Ga0207691_10021853
2272 Ga0207691_10067827
2273 Ga0207711_10001003
2274 Ga0207711_10002894
2275 Ga0207711_10023847
2276 Ga0207711_10036542
2277 Ga0207689_10000523
2278 Ga0207689_10122955
2279 Ga0207661_10002620
2280 Ga0207661_10097009
2281 Ga0207679_10000442
2282 Ga0207679_10003533
2283 Ga0207679_10070215
2284 Ga0207667_10000119
2285 Ga0207667_10001426
2286 Ga0207667_10007542
2287 Ga0207667_10012452
2288 Ga0207667_10025614
2289 Ga0207667_10034658
2290 Ga0207651_10000020
2291 Ga0207651_10123664
2292 Ga0207712_10000302
2293 Ga0207712_10000666
2294 Ga0207712_10000677
2295 Ga0207712_10056662
2296 Ga0207668_10060724
2297 Ga0207640_10000429
2298 Ga0207640_10000696
2299 Ga0207640_10006938
2300 Ga0207658_10000030
2301 Ga0207658_10000437
2302 Ga0207658_10001333
2303 Ga0207658_10002572
2304 Ga0207658_10010121
2305 Ga0207658_10029600
2306 Ga0207658_10268241
2307 Ga0207677_10000079
2308 Ga0207677_10032413
2309 Ga0207703_10000148
2310 Ga0207703_10000236
2311 Ga0207703_10000456
2312 Ga0207703_10000729
2313 Ga0207703_10014984
2314 Ga0207703_10087696
2315 Ga0207703_10101099
2316 Ga0207703_10230131
2317 Ga0207639_10000130
2318 Ga0207639_10000609
2319 Ga0207639_10003127
2320 Ga0207639_10009755
2321 Ga0207639_10020170
2322 Ga0207639_10086489
2323 Ga0207678_10001757
2324 Ga0207678_10005621
2325 Ga0207678_10005736
2326 Ga0207678_10010212
2327 Ga0207678_10015110
2328 Ga0207678_10039062
2329 Ga0207708_10002045
2330 Ga0207702_10000937
2331 Ga0207702_10001010
2332 Ga0207702_10009610
2333 Ga0207641_10000491
2334 Ga0207641_10007360
2335 Ga0207641_10038688
2336 Ga0207641_10092094
2337 Ga0207641_10158682
2338 Ga0207641_10248831
2339 Ga0207648_10000497
2340 Ga0207648_10118309
2341 Ga0207648_10241626
2342 Ga0207676_10000636
2343 Ga0207676_10014625
2344 Ga0207674_10000226
2345 Ga0207674_10000427
2346 Ga0207674_10001529
2347 Ga0207674_10002998
2348 Ga0207674_10153164
2349 Ga0207674_10274694
2350 Ga0207675_100000006
2351 Ga0207675_100040578
2352 Ga0207675_100126190
2353 Ga0207683_10000589
2354 Ga0207683_10001388
2355 Ga0207698_10000382
2356 Ga0207698_10010862
2357 Ga0207698_10059956
2358 Ga0207698_10064208
2359 Ga0207698_10067623
2360 Ga0207698_10085888
2361 Ga0207698_10123143
2362 Ga0209371_1000007
2363 Ga0209371_1000059
2364 Ga0268266_10000001
2365 Ga0268266_10000004
2366 Ga0268266_10000006
2367 Ga0268266_10000687
2368 Ga0268266_10002398
2369 Ga0268266_10020953
2370 Ga0268266_10024656
2371 Ga0268266_10067108
2372 Ga0268266_10115045
2373 Ga0268265_10000775
2374 Ga0268265_10001081
2375 Ga0268264_10000102
2376 Ga0268264_10000705
2377 Ga0268264_10005664
2378 Ga0268264_10012475
2379 Ga0268264_10014286
2380 Ga0268264_10028281
2381 Ga0265334_10001247
2382 Ga0265318_10007437
2383 Ga0307515_10109988
2384 Ga0265338_10002238
2385 Ga0265338_10029272
2386 Ga0265338_10043276
2387 Ga0265338_10076396
2388 Ga0265338_10103614
2389 Ga0268256_1000008
2390 Ga0268256_1000055
2391 Ga0307511_10001554
2392 Ga0307511_10058906
2393 Ga0314311_1181543
2394 Ga0316183_1016040
2395 Ga0316181_1273914
2396 Ga0316182_1146374
2397 Ga0265762_1000028
2398 Ga0265762_1006299
2399 Ga0265330_10005661
2400 Ga0265332_10002256
2401 Ga0265328_10027922
2402 Ga0265325_10011929
2403 Ga0265329_10009490
2404 Ga0265340_10031667
2405 Ga0265339_10024581
2406 Ga0265339_10044204
2407 Ga0265331_10000593
2408 Ga0265331_10013499
2409 Ga0265316_10001008
2410 Ga0265316_10060621
2411 Ga0265316_10061855
2412 Ga0307513_10149751
2413 Ga0307509_10000005
2414 Ga0307408_100141691
2415 Ga0265313_10000653
2416 Ga0265313_10000851
2417 Ga0307508_10045448
2418 Ga0265314_10013071
2419 Ga0265314_10013166
2420 Ga0265342_10001779
2421 Ga0265342_10026864
2422 Ga0307405_10000010
2423 Ga0307405_10131717
2424 Ga0307413_10004383
2425 Ga0307413_10019171
2426 Ga0307410_10042723
2427 Ga0307410_10136931
2428 Ga0307410_10165405
2429 Ga0307406_10015277
2430 Ga0307406_10030161
2431 Ga0307407_10000009
2432 Ga0307412_10005560
2433 Ga0307412_10008456
2434 Ga0307416_100000019
2435 Ga0307416_100066948
2436 Ga0307414_10000078
2437 Ga0307414_10000472
2438 Ga0307414_10007232
2439 Ga0307414_10011902
2440 Ga0307414_10049704
2441 Ga0307414_10051588
2442 Ga0307414_10065834
2443 Ga0307415_100201450
2444 Ga0307510_10000006
2445 Ga0307510_10000301
2446 Ga0307510_10016283
2447 Ga0373944_0019268
2448 Ga0373936_0010040
2449 Ga0373936_0014947
2450 Ga0373955_0048344
2451 Ga0373935_0089841
2452 Ga0373927_0015771
2453 Ga0373947_0028534
2454 Ga0373937_0024309
2455 Ga0373937_0058864
2456 Ga0373937_0406687
2457 Ga0316584_0061039
2458 Ga0373925_0076490
2459 Ga0395899_0000108
2460 Ga0395899_0000402
2461 Ga0395899_0002056
2462 Ga0395899_0018303
2463 Ga0395899_0030119
2464 Ga0395899_0033379
2465 Ga0395899_0058179
2466 Ga0395900_0000144
2467 Ga0395900_0005984
2468 Ga0395900_0007251
2469 Ga0395898_0000018
2470 Ga0395898_0000049
2471 Ga0395898_0003039
2472 Ga0395898_0003336
2473 Ga0395898_0004639
2474 Ga0395898_0004927
2475 Ga0395898_0012224
2476 Ga0395898_0069584
2477 Ga0395905_0000577
2478 Ga0395905_0061451
2479 Ga0395905_0295764
2480 Ga0395901_0004384
2481 Ga0395901_0004732
2482 Ga0395901_0028809
2483 Ga0395901_0029839
2484 Ga0237819_00252
2485 Ga0436365_1682843
2486 Ga0436360_1015686
2487 Ga0436361_0007496
2488 Ga0436361_1061145
2489 Ga0436363_0044813
2490 Ga0436363_0581112
2491 Ga0436363_1395368
2492 Ga0439436_0000156
2493 Ga0439436_0004026
2494 Ga0439436_0007384
2495 Ga0439436_0019565
2496 Ga0439436_0022885
2497 Ga0439436_0023471
2498 Ga0439447_001882
2499 Ga0439465_0014317
2500 Ga0439465_0022811
2501 Ga0451789_0366723
2502 Ga0451791_1324246
2503 Ga0451791_1942420
2504 Ga0451793_0571811
2505 Ga0451797_0509949
2506 Ga0451795_0315781
2507 Ga0451800_0139849
2508 Ga0451802_0008253
2509 Ga0451802_1802042
2510 Ga0451806_807826
2511 Ga0451807_1656299
2512 Ga0451807_1936347
2513 Ga0451807_2008150
2514 Ga0451837_0562306
2515 Ga0451843_0305836
2516 Ga0439448_0012856
2517 Ga0439432_042309
2518 Ga0439449_0000062
2519 Ga0439449_0003943
2520 Ga0439449_0007202
2521 Ga0439449_0027837
2522 Ga0439462_0023848
2523 Ga0450908_000427
2524 Ga0451577_0003011
2525 Ga0451577_0006420
2526 Ga0451577_0007000
2527 Ga0451577_0012316
2528 Ga0439440_0018462
2529 Ga0466969_0004660
2530 Ga0466969_0006957
2531 Ga0466972_0001559
2532 Ga0466982_0000003
2533 Ga0466982_0000061
2534 Ga0466965_0000550
2535 Ga0466966_0001316
2536 Ga0466966_0002565
2537 Ga0466966_0003790
2538 Ga0466966_0041409
2539 Ga0466966_0059924
2540 Ga0466961_0002737
2541 Ga0466961_0003481
2542 Ga0466961_0016250
2543 Ga0466961_0018361
2544 Ga0466961_0030091
2545 Ga0466961_0049132
2546 Ga0466964_0001509
2547 Ga0453684_0000377
2548 Ga0453684_0001190
2549 Ga0453684_0162905
2550 Ga0453684_0295912
2551 Ga0466971_0017684
2552 Ga0466971_0018786
2553 Ga0466968_0012084
2554 Ga0466970_0001017
2555 Ga0466970_0025383
2556 Ga0466970_0034705
2557 Ga0466957_0008584
2558 Ga0466957_0009065
2559 Ga0466957_0009119
2560 Ga0466960_0001879
2561 Ga0466959_0016770
2562 Ga0466959_0031587
2563 Ga0466959_0037823
2564 Ga0466959_0063186
2565 Ga0466959_0072457
2566 Ga0466959_0118583
2567 Ga0451576_0000033
2568 Ga0451576_0014574
2569 Ga0466958_0001823
2570 Ga0466958_0005648
2571 Ga0466958_0014155
2572 Ga0495617_000684
2573 Ga0495629_0001766
2574 Ga0495638_0000038
2575 Ga0495638_0000153
2576 Ga0495638_0000234
2577 Ga0495638_0000753
2578 Ga0495638_0010655
2579 Ga0495638_0055642
2580 Ga0495638_0064504
2581 Ga0495638_0072514
2582 Ga0495638_0080148
2583 Ga0495650_0000003
2584 Ga0495650_0000247
2585 Ga0495650_0000337
2586 Ga0495650_0002162
2587 Ga0495650_0056124
2588 Ga0495580_0001193
2589 Ga0495580_0008063
2590 Ga0495580_0019458
2591 Ga0495580_0085264
2592 Ga0495582_0002834
2593 Ga0495582_0067364
2594 Ga0495639_0014943
2595 Ga0495662_0138884
2596 Ga0495664_0007493
2597 Ga0495584_0000598
2598 Ga0495585_0000085
2599 Ga0495585_0000104
2600 Ga0495585_0001499
2601 Ga0495607_0000088
2602 Ga0495607_0000120
2603 Ga0495607_0006640
2604 Ga0495606_0000338
2605 Ga0495606_0000401
2606 Ga0495606_0001054
2607 Ga0495606_0005269
2608 Ga0495606_0013607
2609 Ga0495606_0031838
2610 Ga0495606_0100632
2611 Ga0495610_0000028
2612 Ga0495610_0002689
2613 Ga0495610_0003644
2614 Ga0495610_0028837
2615 Ga0495610_0049064
2616 Ga0495610_0069720
2617 Ga0495616_0000086
2618 Ga0495616_0018646
2619 Ga0495616_0027621
2620 Ga0495620_0000469
2621 Ga0495620_0000533
2622 Ga0495630_0240659
2623 Ga0495631_0000029
2624 Ga0495631_0000298
2625 Ga0495632_0000004
2626 Ga0495632_0003675
2627 Ga0495643_0003481
2628 Ga0495643_0029363
2629 Ga0495648_0000914
2630 Ga0495663_0001970
2631 Ga0495663_0012197
2632 Ga0495663_0015267
2633 Ga0495663_0017819
2634 Ga0495640_0135613
2635 Ga0495586_0025754
2636 Ga0495586_0090625
2637 Ga0495587_0053519
2638 Ga0495609_0013205
2639 Ga0495622_0022776
2640 Ga0495633_0075274
2641 Ga0495633_0075959
2642 Ga0495656_0009515
2643 Ga0495656_0024604
2644 Ga0495668_0001397
2645 Ga0495668_0001767
2646 Ga0495611_0000001
2647 Ga0495611_0000313
2648 Ga0495625_0000022
2649 Ga0495625_0003692
2650 Ga0495625_0021801
2651 Ga0495625_0034220
2652 Ga0495625_0062675
2653 Ga0495661_0001748
2654 Ga0495661_0007842
2655 Ga0495661_0085849
2656 Ga0495657_0130585
2657 Ga0495599_0049355
2658 Ga0495646_0065203
2659 Ga0495647_0035350
2660 Ga0495647_0074953
2661 Ga0495658_0005711
2662 Ga0495658_0006515
2663 Ga0495613_0162385
2664 Ga0495670_0003226
2665 Ga0495670_0012044
2666 Ga0495670_0030018
2667 Ga0495671_0000492
2668 Ga0495649_0000553
2669 Ga0495649_0005373
2670 Ga0495589_0000059
2671 Ga0495660_0000092
2672 Ga0495660_0000583
2673 Ga0495636_0000522
2674 Ga0495636_0000979
2675 Ga0495636_0007664
2676 Ga0495636_0028788
2677 Ga0495674_0030491
2678 Ga0495672_0000455
2679 Ga0495683_0002566
2680 Ga0495687_010815
2681 Ga0495687_024115
2682 Ga0495687_051164
2683 Ga0495675_0149672
2684 Ga0495679_000004
2685 Ga0495673_0000004
2686 Ga0495673_0000048
2687 Ga0495673_0000902
2688 Ga0495686_0000017
2689 Ga0495686_0000034
2690 Ga0495686_0001142
2691 Ga0495686_0006281
2692 Ga0495686_0015980
2693 Ga0495602_0236175
2694 Ga0496100_0013405
2695 Ga0496100_0041482
2696 Ga0496101_0000755
2697 Ga0496101_0078983
2698 Ga0496101_0104609
2699 Ga0496101_0187584
2700 Ga0496102_0000795
2701 Ga0496102_0013331
2702 Ga0496102_0025626
2703 Ga0496102_0063865
2704 Ga0496102_0218818
2705 Ga0496102_0324523
2706 Ga0496104_0000011
2707 Ga0496104_0001093
2708 Ga0496104_0018753
2709 Ga0496104_0031519
2710 Ga0496104_0150300
2711 Ga0496105_0000071
2712 Ga0496105_0001142
2713 Ga0496105_0017638
2714 Ga0496105_0034731
2715 Ga0496105_0193819
2716 Ga0496106_0000509
2717 Ga0496106_0000648
2718 Ga0496108_0000833
2719 Ga0496108_0233272
2720 Ga0496109_0028206
2721 Ga0496109_0153552
2722 Ga0496109_0265689
2723 Ga0496110_0000259
2724 Ga0496110_0004926
2725 Ga0496111_0001711
2726 Ga0496111_0093431
2727 Ga0496112_0000385
2728 Ga0496112_0296853
2729 Ga0496112_0335633
2730 Ga0496113_0009116
2731 Ga0496113_0051107
2732 Ga0496113_0257385
2733 Ga0496114_0003309
2734 Ga0496114_0003626
2735 Ga0496114_0084519
2736 Ga0496114_0178403
2737 Ga0496115_0000153
2738 Ga0496115_0000206
2739 Ga0496115_0000946
2740 Ga0496115_0063047
2741 Ga0496115_0092503
2742 Ga0496116_0008342
2743 Ga0496116_0009818
2744 Ga0496116_0021663
2745 Ga0496116_0063156
2746 Ga0496117_0000229
2747 Ga0496117_0005879
2748 Ga0496117_0006203
2749 Ga0496117_0008476
2750 Ga0496117_0009735
2751 Ga0496117_0011389
2752 Ga0496117_0013334
2753 Ga0496117_0033016
2754 Ga0496117_0035686
2755 Ga0496117_0058954
2756 Ga0496117_0071363
2757 Ga0496118_0000016
2758 Ga0496118_0000362
2759 Ga0496118_0001608
2760 Ga0496118_0003118
2761 Ga0496118_0004394
2762 Ga0496118_0006389
2763 Ga0496118_0006962
2764 Ga0496118_0007348
2765 Ga0496118_0008539
2766 Ga0496118_0033388
2767 Ga0496118_0048926
2768 Ga0496118_0053333
2769 Ga0496118_0056089
2770 Ga0496118_0105515
2771 Ga0496119_0000851
2772 Ga0496119_0001081
2773 Ga0496119_0006339
2774 Ga0496119_0006549
2775 Ga0496119_0010886
2776 Ga0496119_0014335
2777 Ga0496119_0028839
2778 Ga0496120_0000839
2779 Ga0496120_0001250
2780 Ga0496120_0001337
2781 Ga0496120_0001387
2782 Ga0496120_0002462
2783 Ga0496121_0000045
2784 Ga0496121_0000743
2785 Ga0496121_0000755
2786 Ga0496121_0002194
2787 Ga0496121_0007504
2788 Ga0496121_0007867
2789 Ga0496121_0011918
2790 Ga0496121_0014077
2791 Ga0496121_0015063
2792 Ga0496121_0026438
2793 Ga0496121_0031203
2794 Ga0496121_0124894
2795 Ga0496121_0186718
2796 Ga0496122_0001419
2797 Ga0496122_0003014
2798 Ga0496122_0003143
2799 Ga0496122_0010988
2800 Ga0496122_0011267
2801 Ga0496122_0012114
2802 Ga0496122_0018388
2803 Ga0496123_0000619
2804 Ga0496123_0000624
2805 Ga0496123_0001240
2806 Ga0496123_0005952
2807 Ga0496123_0011606
2808 Ga0496123_0025282
2809 Ga0496123_0050317
2810 Ga0496123_0050349
2811 Ga0496123_0051844
2812 Ga0496123_0053672
2813 Ga0496124_0000009
2814 Ga0496124_0001044
2815 Ga0496124_0001822
2816 Ga0496124_0008706
2817 Ga0496124_0009017
2818 Ga0496124_0009858
2819 Ga0496124_0015807
2820 Ga0496124_0017163
2821 Ga0496124_0028626
2822 Ga0496124_0030624
2823 Ga0496124_0044067
2824 Ga0496124_0084515
2825 Ga0496124_0150076
2826 Ga0496124_0191141
2827 Ga0496124_0239680
2828 Ga0496125_0000353
2829 Ga0496125_0008250
2830 Ga0496125_0009310
2831 Ga0496125_0011414
2832 Ga0496125_0013084
2833 Ga0496125_0013390
2834 Ga0496125_0023264
2835 Ga0496125_0073817
2836 Ga0496125_0089911
2837 Ga0496126_0000199
2838 Ga0496126_0002458
2839 Ga0496126_0003516
2840 Ga0496126_0010449
2841 Ga0496126_0017231
2842 Ga0496126_0018477
2843 Ga0496126_0022327
2844 Ga0496126_0045112
2845 Ga0496126_0055718
2846 Ga0496126_0108422
2847 Ga0496126_0135863
2848 Ga0496126_0143201
2849 Ga0495678_000237
2850 Ga0495682_0001382
2851 Ga0501290_002268
2852 Ga0501300_001548
2853 Ga0501031_0054554
2854 Ga0501031_0061396
2855 Ga0501031_0104613
2856 Ga0501031_0173825
2857 Ga0501032_0007509
2858 Ga0501032_0015091
2859 Ga0501033_0000560
2860 Ga0501033_0001952
2861 Ga0501034_0000344
2862 Ga0501034_0000355
2863 Ga0501034_0000462
2864 Ga0501034_0004256
2865 Ga0501034_0005495
2866 Ga0501034_0030346
2867 Ga0501034_0046181
2868 Ga0501034_0050421
2869 Ga0501034_0068398
2870 Ga0501034_0073364
2871 Ga0501034_0238680
2872 Ga0501034_0240730
2873 Ga0501036_0022240
2874 Ga0501036_0152719
2875 Ga0501036_0176325
2876 Ga0501037_0092948
2877 Ga0501037_0160316
2878 Ga0501038_0004661
2879 Ga0501038_0026234
2880 Ga0501038_0081413
2881 Ga0501038_0111583
2882 Ga0501038_0128316
2883 Ga0501039_0003438
2884 Ga0501039_0021737
2885 Ga0501039_0072678
2886 Ga0501042_0050657
2887 Ga0501043_0005996
2888 Ga0501043_0016000
2889 Ga0501043_0044225
2890 Ga0501043_0071704
2891 Ga0501043_0080290
2892 Ga0501043_0203771
2893 Ga0501046_0018914
2894 Ga0501046_0024699
2895 Ga0501047_0000349
2896 Ga0501047_0003090
2897 Ga0501047_0005767
2898 Ga0501047_0016313
2899 Ga0501047_0018637
2900 Ga0501047_0047595
2901 Ga0501047_0244415
2902 Ga0501067_0000269
2903 Ga0501068_0016510
2904 Ga0501068_0021384
2905 Ga0501069_0019699
2906 Ga0501069_0023705
2907 Ga0501070_0007994
2908 Ga0501070_0021123
2909 Ga0501070_0078688
2910 Ga0501070_0086159
2911 Ga0501070_0135852
2912 Ga0501073_0000424
2913 Ga0501073_0003183
2914 Ga0501073_0030080
2915 Ga0501073_0068177
2916 Ga0501073_0131814
2917 Ga0501074_0004717
2918 Ga0501074_0005580
2919 Ga0501074_0021678
2920 Ga0501257_014392
2921 Ga0501225_0004420
2922 Ga0501079_0180051
2923 Ga0501080_0001205
2924 Ga0501080_0003297
2925 Ga0501080_0009653
2926 Ga0501080_0010508
2927 Ga0501080_0012469
2928 Ga0501080_0099330
2929 Ga0501080_0124623
2930 Ga0501080_0240779
2931 Ga0501083_0001868
2932 Ga0501275_000978
2933 Ga0501280_003643
2934 Ga0501035_0001816
2935 Ga0501035_0002412
2936 Ga0501035_0013058
2937 Ga0501035_0014642
2938 Ga0501035_0028145
2939 Ga0501044_0009710
2940 Ga0501044_0015840
2941 Ga0501044_0045645
2942 Ga0501044_0069622
2943 Ga0501044_0099429
2944 Ga0501044_0154097
2945 Ga0501044_0194903
2946 Ga0501044_0286563
2947 Ga0501044_0319618
2948 nmdc:mga00v17_10323_c1
2949 nmdc:mga00v17_11438_c1
2950 nmdc:mga05p37_430896_c1
2951 nmdc:mga0n895_327485_c1
2952 nmdc:mga0n895_37617_c1
2953 nmdc:mga0n895_82096_c1
2954 nmdc:mga0rr50_27235_c1
2955 nmdc:mga0a205_59921_c1
2956 Ga0495601_0042966
2957 Ga0500643_000108
2958 Ga0500643_002812
2959 Ga0500651_0000413
2960 Ga0500651_0002847
2961 Ga0500651_0077668
2962 Ga0500555_000973
2963 Ga0500617_025827
2964 Ga0500564_040749
2965 Ga0500568_0000145
2966 Ga0500577_0004561
2967 Ga0500588_0025031
2968 Ga0500616_0000042
2969 Ga0500633_0000332
2970 Ga0500634_0000095
2971 Ga0500637_0021375
2972 Ga0500637_0095565
2973 Ga0500645_001933
2974 Ga0501084_0045125
2975 Ga0501084_0179028
2976 Ga0501084_0257486
2977 Ga0501082_0000082
2978 Ga0501082_0094292
2979 Ga0466962_0009930
2980 Ga0466962_0010461
2981 2525556789
2982 2538832297
2983 2547501130
2984 2572255019
2985 2578457870
2986 2586206561
2987 2595446771
2988 2595449540
2989 2630648385
2990 2643817684
2991 2643830319
2992 2643878909
2993 2643894891
2994 2643907830
2995 2643915963
2996 2643940395
2997 2643976704
2998 2644079469
2999 2644477050
3000 2644529429
3001 2644660225
3002 2644694911
3003 2644697527
3004 2687583738
3005 2721026552
3006 2735833453
3007 2738853853
3008 2739229455
3009 2739616097
3010 2739645126
3011 2739730284
3012 2747948029
3013 2748015776
3014 2765579624
3015 2816517704
3016 2819549878
3017 2819563931
3018 2819663037
3019 2842391886
3020 2842723669
3021 2842760160
3022 2842780804
3023 2842910175
3024 2842918531
3025 2842919849
3026 2849285198
3027 2852650307
3028 2852685970
3029 2857446785
3030 2874222320
3031 2884341446
3032 2884412114
3033 2884635712
3034 2894415699
3035 2895397695
3036 2895500656
3037 2895516474
3038 2895523606
3039 2895526812
3040 2904445815
3041 2904464567
3042 2919088354
3043 2919091095
3044 2919133508
3045 2919135422
3046 2919406067
3047 2919516387
3048 2919676964
3049 2919693433
3050 2923518507
3051 2928497645
3052 2928967725
3053 2929197438
3054 2931384226
3055 2937613289
3056 2939592929
3057 2939612492
3058 2939625669
3059 2939628955
3060 2941472896
3061 2941476388
3062 2941490478
3063 2946000488
3064 2953995145
3065 2954017407
3066 2961049085
3067 2961066219
3068 2974308470
3069 2977249224
3070 2987607267
3071 2995951554
3072 8002872200
3073 8003016097
3074 8021624228
3075 8021628274
3076 8021652027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22580

KYNU_C

Kynureninase C-terminal domain

327

409

0.96

PF00266

Aminotran_5

Aminotransferase class-V

152

389

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s3v-assembly1.cif.gz_A structure of hskynase_66, an evolved variant of human kynureninase with greatly increased activity towards kynurenine 0.9724 8 419
3e9k-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex 0.9653 8 421
2hzp-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase 0.9648 8 421
7s3v-assembly1.cif.gz_A structure of hskynase_66, an evolved variant of human kynureninase with greatly increased activity towards kynurenine 0.9497 8 419
3e9k-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex 0.9473 8 421
ID Description Score Start End Superfamily
af_Q4DQ63_67_341_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9801 53 318 3.40.640.10
af_Q05979_48_327_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9798 50 316 3.40.640.10
af_P70712_80_352_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9797 50 322 3.40.640.10
af_P70712_80_352_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9726 50 322 3.40.640.10
af_Q4DQ63_347_462_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9623 328 414 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A834F560-F1-model_v4 Kynureninase 0.9942 91 214 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A0F9G9U9-F1-model_v4 Aminotransferase class V domain-containing protein 0.9922 131 324 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A2N1X6U0-F1-model_v4 deleted 0.9868 9 289
AF-A0A098LVS7-F1-model_v4 Kynureninase (EC 3.7.1.3) (L-kynurenine hydrolase) 0.9864 41 416 GO:0005737
GO:0019441
GO:0019805
GO:0030170
GO:0030429
GO:0034354
GO:0043420
GO:0097053
AF-A0A3M1C6B9-F1-model_v4 Kynureninase (EC 3.7.1.3) (L-kynurenine hydrolase) 0.9852 50 419 GO:0005737
GO:0019441
GO:0019805
GO:0030170
GO:0030429
GO:0034354
GO:0043420
GO:0097053

Map