F494646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1539 | 431 | 3078 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_100330904|Ga0070668_1003309042 |
| Length | 75 |
| Sequence | LGRPGATDMAADNASAAAVVTVKPADLPVFCPNPAMPLWSSHPRVFLDIADTGSAMCPYCGTQYRLEGGPARAGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 211 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 212 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 213 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 214 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 215 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 240 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 241 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 242 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 243 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 246 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 249 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 250 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 253 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 254 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 261 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 262 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 393 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 398 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 416 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 417 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 418 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 419 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 420 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 421 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 422 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 423 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 424 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 425 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 426 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 427 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 428 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 429 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 430 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 431 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.31 |
| Metatranscriptomes | 0.65 |
| Isolates | 1.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.14 |
| Nodule | 0.32 |
| Rhizoplane | 3.83 |
| Rhizosphere | 90.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070668_100330904 | 3300005347 | Bacteria | 1285 |
| 2 | JGI25159J45721_1002873 | 3300002987 | Bacteria | 6310 |
| 3 | JGI25153J46596_10009071 | 3300003215 | Bacteria | 4671 |
| 4 | rootL2_10086410 | 3300003322 | Bacteria | 4413 |
| 5 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 6 | Ga0055542_1016302 | 3300003762 | Bacteria | 1173 |
| 7 | Ga0055526_1000856 | 3300003771 | Bacteria | 22650 |
| 8 | Ga0055526_1003371 | 3300003771 | Bacteria | 10190 |
| 9 | Ga0055537_1000496 | 3300003773 | Bacteria | 23957 |
| 10 | Ga0055524_1000027 | 3300003775 | Bacteria | 213655 |
| 11 | Ga0055524_1015123 | 3300003775 | Bacteria | 2827 |
| 12 | Ga0055534_1000583 | 3300003784 | Bacteria | 19177 |
| 13 | Ga0055528_1000686 | 3300003790 | Bacteria | 24151 |
| 14 | Ga0055543_1002543 | 3300004625 | Bacteria | 5951 |
| 15 | Ga0065165_1000298 | 3300005262 | Bacteria | 83243 |
| 16 | Ga0065165_1002921 | 3300005262 | Bacteria | 13057 |
| 17 | Ga0065165_1019195 | 3300005262 | Bacteria | 2450 |
| 18 | Ga0065715_10286429 | 3300005293 | Bacteria | 1073 |
| 19 | Ga0065715_10489296 | 3300005293 | Bacteria | 790 |
| 20 | Ga0070658_10022463 | 3300005327 | Bacteria | 5062 |
| 21 | Ga0070658_10971624 | 3300005327 | Bacteria | 739 |
| 22 | Ga0070658_11119261 | 3300005327 | Bacteria | 685 |
| 23 | Ga0070676_10007021 | 3300005328 | Bacteria | 6029 |
| 24 | Ga0070676_10075272 | 3300005328 | Bacteria | 2035 |
| 25 | Ga0070676_10927898 | 3300005328 | Bacteria | 650 |
| 26 | Ga0070683_102088025 | 3300005329 | Bacteria | 544 |
| 27 | Ga0070690_100254242 | 3300005330 | Bacteria | 1244 |
| 28 | Ga0070670_100044483 | 3300005331 | Bacteria | 3818 |
| 29 | Ga0070670_100109526 | 3300005331 | Bacteria | 2380 |
| 30 | Ga0070670_100238035 | 3300005331 | Bacteria | 1585 |
| 31 | Ga0070670_100267604 | 3300005331 | Bacteria | 1491 |
| 32 | Ga0070670_100324184 | 3300005331 | Bacteria | 1350 |
| 33 | Ga0070670_100708172 | 3300005331 | Bacteria | 906 |
| 34 | Ga0070677_10000892 | 3300005333 | Bacteria | 9819 |
| 35 | Ga0070677_10059181 | 3300005333 | Bacteria | 1575 |
| 36 | Ga0070677_10223564 | 3300005333 | Bacteria | 921 |
| 37 | Ga0068869_100011201 | 3300005334 | Bacteria | 5875 |
| 38 | Ga0068869_100873363 | 3300005334 | Bacteria | 777 |
| 39 | Ga0068869_101547310 | 3300005334 | Bacteria | 590 |
| 40 | Ga0068869_101618602 | 3300005334 | Bacteria | 577 |
| 41 | Ga0070666_10004003 | 3300005335 | Bacteria | 8943 |
| 42 | Ga0070666_10010423 | 3300005335 | Bacteria | 5814 |
| 43 | Ga0070666_10414163 | 3300005335 | Bacteria | 970 |
| 44 | Ga0070666_10534339 | 3300005335 | Bacteria | 852 |
| 45 | Ga0070680_100246895 | 3300005336 | Bacteria | 1509 |
| 46 | Ga0070680_100636766 | 3300005336 | Bacteria | 916 |
| 47 | Ga0070680_100738020 | 3300005336 | Unclassified | 848 |
| 48 | Ga0070680_100987645 | 3300005336 | Bacteria | 727 |
| 49 | Ga0070680_101151835 | 3300005336 | Bacteria | 670 |
| 50 | Ga0070680_101573786 | 3300005336 | Bacteria | 569 |
| 51 | Ga0070682_100310125 | 3300005337 | Bacteria | 1161 |
| 52 | Ga0068868_100103841 | 3300005338 | Bacteria | 2303 |
| 53 | Ga0068868_100590742 | 3300005338 | Bacteria | 983 |
| 54 | Ga0068868_100855323 | 3300005338 | Bacteria | 824 |
| 55 | Ga0068868_101284117 | 3300005338 | Bacteria | 679 |
| 56 | Ga0068868_101379636 | 3300005338 | Bacteria | 657 |
| 57 | Ga0068868_101617968 | 3300005338 | Bacteria | 609 |
| 58 | Ga0070660_100093006 | 3300005339 | Bacteria | 2380 |
| 59 | Ga0070660_100202965 | 3300005339 | Bacteria | 1608 |
| 60 | Ga0070660_100469114 | 3300005339 | Bacteria | 1045 |
| 61 | Ga0070660_100727981 | 3300005339 | Bacteria | 832 |
| 62 | Ga0070660_100762662 | 3300005339 | Bacteria | 813 |
| 63 | Ga0070660_101293982 | 3300005339 | Bacteria | 619 |
| 64 | Ga0070689_100528275 | 3300005340 | Bacteria | 1014 |
| 65 | Ga0070689_100641913 | 3300005340 | Bacteria | 923 |
| 66 | Ga0070689_100749064 | 3300005340 | Bacteria | 856 |
| 67 | Ga0070691_10791207 | 3300005341 | Bacteria | 577 |
| 68 | Ga0070661_100006065 | 3300005344 | Bacteria | 8316 |
| 69 | Ga0070661_100012593 | 3300005344 | Bacteria | 5920 |
| 70 | Ga0070661_100104081 | 3300005344 | Bacteria | 2114 |
| 71 | Ga0070661_100381808 | 3300005344 | Bacteria | 1111 |
| 72 | Ga0070661_100429083 | 3300005344 | Bacteria | 1049 |
| 73 | Ga0070661_100446000 | 3300005344 | Bacteria | 1029 |
| 74 | Ga0070661_100485472 | 3300005344 | Unclassified | 987 |
| 75 | Ga0070661_100670826 | 3300005344 | Bacteria | 843 |
| 76 | Ga0070661_100682501 | 3300005344 | Bacteria | 836 |
| 77 | Ga0070661_100996533 | 3300005344 | Bacteria | 695 |
| 78 | Ga0070668_100004304 | 3300005347 | Bacteria | 10566 |
| 79 | Ga0070668_100038060 | 3300005347 | Bacteria | 3675 |
| 80 | Ga0070668_100046330 | 3300005347 | Bacteria | 3338 |
| 81 | Ga0070668_100064293 | 3300005347 | Bacteria | 2844 |
| 82 | Ga0070668_100248915 | 3300005347 | Bacteria | 1475 |
| 83 | Ga0070668_100768448 | 3300005347 | Bacteria | 854 |
| 84 | Ga0070668_101783836 | 3300005347 | Bacteria | 566 |
| 85 | Ga0070669_100598822 | 3300005353 | Bacteria | 923 |
| 86 | Ga0070669_100689262 | 3300005353 | Bacteria | 862 |
| 87 | Ga0070675_100012175 | 3300005354 | Bacteria | 6744 |
| 88 | Ga0070675_100023439 | 3300005354 | Bacteria | 4936 |
| 89 | Ga0070675_100203050 | 3300005354 | Bacteria | 1721 |
| 90 | Ga0070675_100220892 | 3300005354 | Bacteria | 1650 |
| 91 | Ga0070675_100447531 | 3300005354 | Bacteria | 1158 |
| 92 | Ga0070675_101455532 | 3300005354 | Bacteria | 632 |
| 93 | Ga0070675_102098177 | 3300005354 | Unclassified | 521 |
| 94 | Ga0070671_100024028 | 3300005355 | Bacteria | 4988 |
| 95 | Ga0070671_100046161 | 3300005355 | Bacteria | 3622 |
| 96 | Ga0070671_100127720 | 3300005355 | Bacteria | 2141 |
| 97 | Ga0070671_100433137 | 3300005355 | Bacteria | 1127 |
| 98 | Ga0070671_100448569 | 3300005355 | Bacteria | 1107 |
| 99 | Ga0070671_100748475 | 3300005355 | Bacteria | 849 |
| 100 | Ga0070674_100012729 | 3300005356 | Bacteria | 5175 |
| 101 | Ga0070674_100022171 | 3300005356 | Bacteria | 4092 |
| 102 | Ga0070674_100306077 | 3300005356 | Bacteria | 1269 |
| 103 | Ga0070674_100435854 | 3300005356 | Bacteria | 1079 |
| 104 | Ga0070674_101035637 | 3300005356 | Bacteria | 722 |
| 105 | Ga0070673_100013874 | 3300005364 | Bacteria | 5593 |
| 106 | Ga0070673_100043093 | 3300005364 | Bacteria | 3484 |
| 107 | Ga0070673_100835315 | 3300005364 | Bacteria | 852 |
| 108 | Ga0070673_100991953 | 3300005364 | Bacteria | 782 |
| 109 | Ga0070673_101025308 | 3300005364 | Bacteria | 769 |
| 110 | Ga0070673_101281300 | 3300005364 | Bacteria | 688 |
| 111 | Ga0070688_101573172 | 3300005365 | Bacteria | 536 |
| 112 | Ga0070659_100156241 | 3300005366 | Bacteria | 1863 |
| 113 | Ga0070659_100241602 | 3300005366 | Bacteria | 1495 |
| 114 | Ga0070659_100286746 | 3300005366 | Bacteria | 1370 |
| 115 | Ga0070659_100600687 | 3300005366 | Bacteria | 946 |
| 116 | Ga0070667_100035038 | 3300005367 | Bacteria | 4204 |
| 117 | Ga0070667_100045561 | 3300005367 | Bacteria | 3688 |
| 118 | Ga0070667_100075567 | 3300005367 | Bacteria | 2876 |
| 119 | Ga0070667_100175495 | 3300005367 | Bacteria | 1894 |
| 120 | Ga0070667_101376825 | 3300005367 | Bacteria | 662 |
| 121 | Ga0070713_100000059 | 3300005436 | Bacteria | 69993 |
| 122 | Ga0070710_10097756 | 3300005437 | Bacteria | 1743 |
| 123 | Ga0070711_102033469 | 3300005439 | Bacteria | 505 |
| 124 | Ga0070705_100055248 | 3300005440 | Bacteria | 2333 |
| 125 | Ga0070705_101059937 | 3300005440 | Bacteria | 661 |
| 126 | Ga0070700_100205951 | 3300005441 | Bacteria | 1385 |
| 127 | Ga0070700_100727733 | 3300005441 | Bacteria | 792 |
| 128 | Ga0070694_101667444 | 3300005444 | Bacteria | 542 |
| 129 | Ga0070708_100000133 | 3300005445 | Bacteria | 50894 |
| 130 | Ga0070663_100042161 | 3300005455 | Bacteria | 3206 |
| 131 | Ga0070663_100081595 | 3300005455 | Bacteria | 2378 |
| 132 | Ga0070663_100860423 | 3300005455 | Bacteria | 781 |
| 133 | Ga0070663_101036835 | 3300005455 | Bacteria | 715 |
| 134 | Ga0070663_101727721 | 3300005455 | Bacteria | 560 |
| 135 | Ga0070663_101952830 | 3300005455 | Bacteria | 528 |
| 136 | Ga0070678_100031126 | 3300005456 | Bacteria | 3676 |
| 137 | Ga0070678_100270566 | 3300005456 | Bacteria | 1433 |
| 138 | Ga0070678_100805880 | 3300005456 | Bacteria | 853 |
| 139 | Ga0070678_101130463 | 3300005456 | Bacteria | 724 |
| 140 | Ga0070678_101780228 | 3300005456 | Bacteria | 580 |
| 141 | Ga0070662_100432303 | 3300005457 | Bacteria | 1090 |
| 142 | Ga0070662_100599106 | 3300005457 | Bacteria | 927 |
| 143 | Ga0070662_100635485 | 3300005457 | Bacteria | 900 |
| 144 | Ga0070662_101625691 | 3300005457 | Bacteria | 558 |
| 145 | Ga0070681_10000732 | 3300005458 | Bacteria | 27129 |
| 146 | Ga0070681_10946289 | 3300005458 | Bacteria | 780 |
| 147 | Ga0068867_100023621 | 3300005459 | Bacteria | 4401 |
| 148 | Ga0068867_100034889 | 3300005459 | Bacteria | 3647 |
| 149 | Ga0068867_100708853 | 3300005459 | Bacteria | 889 |
| 150 | Ga0070685_11234918 | 3300005466 | Bacteria | 569 |
| 151 | Ga0070706_100081572 | 3300005467 | Bacteria | 2995 |
| 152 | Ga0070707_100443909 | 3300005468 | Bacteria | 1258 |
| 153 | Ga0070699_100337949 | 3300005518 | Unclassified | 1355 |
| 154 | Ga0070679_100027165 | 3300005530 | Bacteria | 5630 |
| 155 | Ga0070679_100338526 | 3300005530 | Bacteria | 1453 |
| 156 | Ga0070679_101430793 | 3300005530 | Bacteria | 638 |
| 157 | Ga0070679_101761304 | 3300005530 | Bacteria | 568 |
| 158 | Ga0070679_101889359 | 3300005530 | Bacteria | 546 |
| 159 | Ga0070684_102052625 | 3300005535 | Unclassified | 540 |
| 160 | Ga0068853_100073590 | 3300005539 | Bacteria | 2979 |
| 161 | Ga0068853_100081768 | 3300005539 | Bacteria | 2829 |
| 162 | Ga0068853_100200958 | 3300005539 | Bacteria | 1814 |
| 163 | Ga0068853_101666327 | 3300005539 | Unclassified | 618 |
| 164 | Ga0070672_100094012 | 3300005543 | Bacteria | 2423 |
| 165 | Ga0070672_100154830 | 3300005543 | Unclassified | 1898 |
| 166 | Ga0070672_100176359 | 3300005543 | Bacteria | 1779 |
| 167 | Ga0070672_100237141 | 3300005543 | Bacteria | 1533 |
| 168 | Ga0070672_100282391 | 3300005543 | Bacteria | 1404 |
| 169 | Ga0070672_100514251 | 3300005543 | Bacteria | 1037 |
| 170 | Ga0070672_101060861 | 3300005543 | Bacteria | 719 |
| 171 | Ga0070672_101950935 | 3300005543 | Bacteria | 529 |
| 172 | Ga0070665_100011044 | 3300005548 | Bacteria | 9127 |
| 173 | Ga0070665_100090569 | 3300005548 | Bacteria | 3064 |
| 174 | Ga0070665_100142966 | 3300005548 | Bacteria | 2396 |
| 175 | Ga0070665_100342103 | 3300005548 | Bacteria | 1501 |
| 176 | Ga0070665_100476678 | 3300005548 | Bacteria | 1258 |
| 177 | Ga0070665_101263292 | 3300005548 | Bacteria | 749 |
| 178 | Ga0070665_101622153 | 3300005548 | Bacteria | 655 |
| 179 | Ga0070704_100676588 | 3300005549 | Bacteria | 913 |
| 180 | Ga0070704_101990410 | 3300005549 | Bacteria | 539 |
| 181 | Ga0068855_100050961 | 3300005563 | Bacteria | 4877 |
| 182 | Ga0068855_100382107 | 3300005563 | Bacteria | 1546 |
| 183 | Ga0068855_100418756 | 3300005563 | Bacteria | 1465 |
| 184 | Ga0068855_100661580 | 3300005563 | Bacteria | 1121 |
| 185 | Ga0068855_100946816 | 3300005563 | Bacteria | 907 |
| 186 | Ga0070664_100005997 | 3300005564 | Bacteria | 9824 |
| 187 | Ga0070664_100173534 | 3300005564 | Bacteria | 1913 |
| 188 | Ga0070664_100258184 | 3300005564 | Bacteria | 1567 |
| 189 | Ga0070664_100317296 | 3300005564 | Bacteria | 1411 |
| 190 | Ga0070664_100380118 | 3300005564 | Bacteria | 1289 |
| 191 | Ga0070664_100483507 | 3300005564 | Bacteria | 1140 |
| 192 | Ga0070664_100534169 | 3300005564 | Bacteria | 1083 |
| 193 | Ga0070664_101042049 | 3300005564 | Bacteria | 769 |
| 194 | Ga0070664_101801496 | 3300005564 | Bacteria | 581 |
| 195 | Ga0068857_100274151 | 3300005577 | Bacteria | 1551 |
| 196 | Ga0068857_100380950 | 3300005577 | Bacteria | 1310 |
| 197 | Ga0068857_100726651 | 3300005577 | Bacteria | 945 |
| 198 | Ga0068857_101067587 | 3300005577 | Bacteria | 779 |
| 199 | Ga0068857_101318552 | 3300005577 | Bacteria | 701 |
| 200 | Ga0068854_100080480 | 3300005578 | Bacteria | 2404 |
| 201 | Ga0068854_100223809 | 3300005578 | Bacteria | 1490 |
| 202 | Ga0068854_100402196 | 3300005578 | Bacteria | 1133 |
| 203 | Ga0068856_100024938 | 3300005614 | Bacteria | 5827 |
| 204 | Ga0068856_101489452 | 3300005614 | Bacteria | 691 |
| 205 | Ga0068856_101757956 | 3300005614 | Unclassified | 632 |
| 206 | Ga0068852_100016562 | 3300005616 | Bacteria | 5755 |
| 207 | Ga0068852_100126901 | 3300005616 | Bacteria | 2344 |
| 208 | Ga0068852_100206082 | 3300005616 | Bacteria | 1863 |
| 209 | Ga0068852_100547845 | 3300005616 | Bacteria | 1157 |
| 210 | Ga0068852_101720545 | 3300005616 | Bacteria | 650 |
| 211 | Ga0068852_102166693 | 3300005616 | Bacteria | 577 |
| 212 | Ga0068859_100034422 | 3300005617 | Bacteria | 5084 |
| 213 | Ga0068859_100572538 | 3300005617 | Bacteria | 1223 |
| 214 | Ga0068859_102269884 | 3300005617 | Bacteria | 599 |
| 215 | Ga0068859_102309756 | 3300005617 | Bacteria | 593 |
| 216 | Ga0068859_102748906 | 3300005617 | Bacteria | 541 |
| 217 | Ga0068859_102825347 | 3300005617 | Bacteria | 533 |
| 218 | Ga0068864_100025549 | 3300005618 | Bacteria | 4976 |
| 219 | Ga0068864_100045559 | 3300005618 | Bacteria | 3762 |
| 220 | Ga0068864_100380281 | 3300005618 | Bacteria | 1338 |
| 221 | Ga0068864_100882262 | 3300005618 | Bacteria | 883 |
| 222 | Ga0068864_101720323 | 3300005618 | Bacteria | 632 |
| 223 | Ga0068866_10355485 | 3300005718 | Bacteria | 932 |
| 224 | Ga0068861_100008821 | 3300005719 | Bacteria | 6946 |
| 225 | Ga0068861_100039895 | 3300005719 | Bacteria | 3508 |
| 226 | Ga0068861_100236576 | 3300005719 | Bacteria | 1551 |
| 227 | Ga0068861_100390749 | 3300005719 | Bacteria | 1232 |
| 228 | Ga0068861_101332348 | 3300005719 | Bacteria | 699 |
| 229 | Ga0068861_101474782 | 3300005719 | Bacteria | 667 |
| 230 | Ga0068851_10003475 | 3300005834 | Bacteria | 7015 |
| 231 | Ga0068851_10008417 | 3300005834 | Bacteria | 4768 |
| 232 | Ga0068851_10058716 | 3300005834 | Bacteria | 1967 |
| 233 | Ga0068851_10102704 | 3300005834 | Bacteria | 1518 |
| 234 | Ga0068851_10175940 | 3300005834 | Bacteria | 1183 |
| 235 | Ga0068870_10121168 | 3300005840 | Bacteria | 1507 |
| 236 | Ga0068870_10215621 | 3300005840 | Bacteria | 1172 |
| 237 | Ga0068863_100032414 | 3300005841 | Bacteria | 4981 |
| 238 | Ga0068863_100065636 | 3300005841 | Bacteria | 3434 |
| 239 | Ga0068863_100152835 | 3300005841 | Bacteria | 2209 |
| 240 | Ga0068863_100244169 | 3300005841 | Bacteria | 1733 |
| 241 | Ga0068863_101474403 | 3300005841 | Bacteria | 689 |
| 242 | Ga0068858_100016937 | 3300005842 | Bacteria | 6842 |
| 243 | Ga0068858_100049107 | 3300005842 | Bacteria | 3908 |
| 244 | Ga0068858_100396380 | 3300005842 | Bacteria | 1326 |
| 245 | Ga0068858_100511682 | 3300005842 | Bacteria | 1160 |
| 246 | Ga0068858_100531518 | 3300005842 | Bacteria | 1138 |
| 247 | Ga0068860_100035988 | 3300005843 | Bacteria | 4746 |
| 248 | Ga0068860_100129695 | 3300005843 | Bacteria | 2419 |
| 249 | Ga0068860_100152816 | 3300005843 | Bacteria | 2223 |
| 250 | Ga0068860_100231923 | 3300005843 | Bacteria | 1794 |
| 251 | Ga0068860_100818437 | 3300005843 | Bacteria | 945 |
| 252 | Ga0068860_102001362 | 3300005843 | Bacteria | 601 |
| 253 | Ga0068862_100053978 | 3300005844 | Bacteria | 3441 |
| 254 | Ga0068862_100192017 | 3300005844 | Bacteria | 1838 |
| 255 | Ga0068862_101288240 | 3300005844 | Bacteria | 732 |
| 256 | Ga0068862_101567735 | 3300005844 | Bacteria | 665 |
| 257 | Ga0081539_10076122 | 3300005985 | Bacteria | 1779 |
| 258 | Ga0097621_100113760 | 3300006237 | Bacteria | 2289 |
| 259 | Ga0097621_100204644 | 3300006237 | Bacteria | 1715 |
| 260 | Ga0097621_101158512 | 3300006237 | Bacteria | 727 |
| 261 | Ga0097621_102284412 | 3300006237 | Bacteria | 518 |
| 262 | Ga0068871_100003539 | 3300006358 | Bacteria | 10743 |
| 263 | Ga0068871_100062575 | 3300006358 | Bacteria | 3042 |
| 264 | Ga0068871_101440378 | 3300006358 | Bacteria | 650 |
| 265 | Ga0075428_100385438 | 3300006844 | Bacteria | 1503 |
| 266 | Ga0075428_101664963 | 3300006844 | Bacteria | 666 |
| 267 | Ga0075430_100785270 | 3300006846 | Bacteria | 785 |
| 268 | Ga0075431_100580711 | 3300006847 | Bacteria | 1106 |
| 269 | Ga0075434_100079491 | 3300006871 | Bacteria | 3276 |
| 270 | Ga0075434_100295497 | 3300006871 | Bacteria | 1640 |
| 271 | Ga0068865_100063942 | 3300006881 | Bacteria | 2588 |
| 272 | Ga0068865_100105285 | 3300006881 | Bacteria | 2072 |
| 273 | Ga0068865_100151128 | 3300006881 | Bacteria | 1762 |
| 274 | Ga0068865_100184960 | 3300006881 | Bacteria | 1607 |
| 275 | Ga0097620_100034419 | 3300006931 | Bacteria | 5084 |
| 276 | Ga0097620_100572465 | 3300006931 | Bacteria | 1223 |
| 277 | Ga0097620_102269903 | 3300006931 | Bacteria | 599 |
| 278 | Ga0097620_102310119 | 3300006931 | Bacteria | 593 |
| 279 | Ga0097620_102748872 | 3300006931 | Bacteria | 541 |
| 280 | Ga0097620_102825148 | 3300006931 | Bacteria | 533 |
| 281 | Ga0079104_1011335 | 3300006946 | Bacteria | 2872 |
| 282 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 283 | Ga0105251_10067213 | 3300009011 | Bacteria | 1674 |
| 284 | Ga0105244_10046293 | 3300009036 | Bacteria | 2235 |
| 285 | Ga0105244_10328141 | 3300009036 | Bacteria | 706 |
| 286 | Ga0105240_10457373 | 3300009093 | Bacteria | 1427 |
| 287 | Ga0111539_11515077 | 3300009094 | Bacteria | 778 |
| 288 | Ga0105245_11785741 | 3300009098 | Bacteria | 668 |
| 289 | Ga0105247_10015325 | 3300009101 | Bacteria | 4592 |
| 290 | Ga0105247_10830563 | 3300009101 | Bacteria | 707 |
| 291 | Ga0114129_10238463 | 3300009147 | Bacteria | 2446 |
| 292 | Ga0114129_10612786 | 3300009147 | Bacteria | 1409 |
| 293 | Ga0105243_10125495 | 3300009148 | Bacteria | 2170 |
| 294 | Ga0105243_10713487 | 3300009148 | Bacteria | 979 |
| 295 | Ga0105243_11123056 | 3300009148 | Bacteria | 795 |
| 296 | Ga0105243_11558536 | 3300009148 | Bacteria | 686 |
| 297 | Ga0105241_10033689 | 3300009174 | Bacteria | 3846 |
| 298 | Ga0105241_10079364 | 3300009174 | Bacteria | 2566 |
| 299 | Ga0105241_11123245 | 3300009174 | Bacteria | 741 |
| 300 | Ga0105241_11249007 | 3300009174 | Unclassified | 705 |
| 301 | Ga0105242_10031663 | 3300009176 | Bacteria | 4227 |
| 302 | Ga0105248_10018374 | 3300009177 | Bacteria | 7723 |
| 303 | Ga0105248_10230519 | 3300009177 | Bacteria | 2085 |
| 304 | Ga0105248_10349308 | 3300009177 | Bacteria | 1665 |
| 305 | Ga0105248_10537816 | 3300009177 | Bacteria | 1318 |
| 306 | Ga0105248_11255955 | 3300009177 | Bacteria | 838 |
| 307 | Ga0105248_12219715 | 3300009177 | Unclassified | 625 |
| 308 | Ga0105248_12572172 | 3300009177 | Bacteria | 580 |
| 309 | Ga0105237_10048709 | 3300009545 | Bacteria | 4259 |
| 310 | Ga0105238_10642008 | 3300009551 | Bacteria | 1071 |
| 311 | Ga0105238_11668142 | 3300009551 | Bacteria | 668 |
| 312 | Ga0105238_12506712 | 3300009551 | Bacteria | 552 |
| 313 | Ga0105249_10057399 | 3300009553 | Bacteria | 3566 |
| 314 | Ga0105239_11133507 | 3300010375 | Bacteria | 901 |
| 315 | Ga0105246_12018409 | 3300011119 | Unclassified | 557 |
| 316 | Ga0157373_10006600 | 3300013100 | Bacteria | 8655 |
| 317 | Ga0157373_10045628 | 3300013100 | Bacteria | 3128 |
| 318 | Ga0157373_11169062 | 3300013100 | Bacteria | 579 |
| 319 | Ga0157371_10000399 | 3300013102 | Bacteria | 54380 |
| 320 | Ga0157371_10370695 | 3300013102 | Bacteria | 1044 |
| 321 | Ga0157371_10535771 | 3300013102 | Bacteria | 867 |
| 322 | Ga0157371_11286349 | 3300013102 | Bacteria | 565 |
| 323 | Ga0157370_10098882 | 3300013104 | Bacteria | 2735 |
| 324 | Ga0157370_10705462 | 3300013104 | Bacteria | 921 |
| 325 | Ga0157370_10837359 | 3300013104 | Bacteria | 836 |
| 326 | Ga0157369_10808246 | 3300013105 | Bacteria | 963 |
| 327 | Ga0157369_10868506 | 3300013105 | Bacteria | 926 |
| 328 | Ga0157369_11084540 | 3300013105 | Bacteria | 819 |
| 329 | Ga0157374_10168397 | 3300013296 | Bacteria | 2136 |
| 330 | Ga0157374_10337908 | 3300013296 | Bacteria | 1495 |
| 331 | Ga0157374_10422569 | 3300013296 | Bacteria | 1332 |
| 332 | Ga0157374_11355355 | 3300013296 | Bacteria | 734 |
| 333 | Ga0157374_11575314 | 3300013296 | Bacteria | 681 |
| 334 | Ga0157378_10024227 | 3300013297 | Bacteria | 5337 |
| 335 | Ga0157378_10182581 | 3300013297 | Bacteria | 1974 |
| 336 | Ga0157378_10437287 | 3300013297 | Bacteria | 1296 |
| 337 | Ga0157378_11327644 | 3300013297 | Bacteria | 761 |
| 338 | Ga0157378_11729837 | 3300013297 | Bacteria | 673 |
| 339 | Ga0163162_10068518 | 3300013306 | Bacteria | 3600 |
| 340 | Ga0163162_10225298 | 3300013306 | Bacteria | 2004 |
| 341 | Ga0163162_10745223 | 3300013306 | Bacteria | 1099 |
| 342 | Ga0163162_11534257 | 3300013306 | Bacteria | 759 |
| 343 | Ga0163162_12879765 | 3300013306 | Bacteria | 554 |
| 344 | Ga0157372_10010615 | 3300013307 | Bacteria | 9799 |
| 345 | Ga0157372_10222379 | 3300013307 | Bacteria | 2188 |
| 346 | Ga0157372_10268210 | 3300013307 | Bacteria | 1983 |
| 347 | Ga0157372_10334231 | 3300013307 | Bacteria | 1765 |
| 348 | Ga0157372_10798005 | 3300013307 | Bacteria | 1097 |
| 349 | Ga0157372_10838602 | 3300013307 | Bacteria | 1067 |
| 350 | Ga0157372_12067318 | 3300013307 | Bacteria | 654 |
| 351 | Ga0157372_12439620 | 3300013307 | Bacteria | 600 |
| 352 | Ga0157372_12773552 | 3300013307 | Bacteria | 562 |
| 353 | Ga0157375_10213714 | 3300013308 | Bacteria | 2086 |
| 354 | Ga0157375_10489177 | 3300013308 | Bacteria | 1395 |
| 355 | Ga0157375_10549912 | 3300013308 | Bacteria | 1316 |
| 356 | Ga0157375_10726496 | 3300013308 | Bacteria | 1145 |
| 357 | Ga0157375_10742023 | 3300013308 | Bacteria | 1134 |
| 358 | Ga0157375_11050558 | 3300013308 | Bacteria | 952 |
| 359 | Ga0163163_10059545 | 3300014325 | Bacteria | 3778 |
| 360 | Ga0163163_10193532 | 3300014325 | Bacteria | 2082 |
| 361 | Ga0163163_10214218 | 3300014325 | Bacteria | 1975 |
| 362 | Ga0163163_12014976 | 3300014325 | Bacteria | 637 |
| 363 | Ga0163163_12826689 | 3300014325 | Bacteria | 542 |
| 364 | Ga0157380_10717171 | 3300014326 | Unclassified | 1007 |
| 365 | Ga0157380_10753047 | 3300014326 | Bacteria | 986 |
| 366 | Ga0157380_12834519 | 3300014326 | Bacteria | 551 |
| 367 | Ga0182008_10171922 | 3300014497 | Bacteria | 1094 |
| 368 | Ga0182008_10634246 | 3300014497 | Bacteria | 603 |
| 369 | Ga0182008_10694490 | 3300014497 | Bacteria | 581 |
| 370 | Ga0157377_10869744 | 3300014745 | Bacteria | 671 |
| 371 | Ga0157379_10004686 | 3300014968 | Bacteria | 11736 |
| 372 | Ga0157379_10113285 | 3300014968 | Bacteria | 2438 |
| 373 | Ga0157376_10064276 | 3300014969 | Bacteria | 3094 |
| 374 | Ga0157376_10344263 | 3300014969 | Bacteria | 1425 |
| 375 | Ga0157376_11633773 | 3300014969 | Bacteria | 679 |
| 376 | Ga0182006_1000055 | 3300015261 | Bacteria | 173139 |
| 377 | Ga0182006_1022308 | 3300015261 | Bacteria | 2633 |
| 378 | Ga0182007_10049382 | 3300015262 | Bacteria | 1390 |
| 379 | Ga0182007_10198265 | 3300015262 | Bacteria | 701 |
| 380 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 381 | Ga0163161_10081332 | 3300017792 | Bacteria | 2385 |
| 382 | Ga0163161_10853066 | 3300017792 | Bacteria | 769 |
| 383 | Ga0163161_11010145 | 3300017792 | Bacteria | 710 |
| 384 | Ga0213872_10266511 | 3300021361 | Bacteria | 718 |
| 385 | Ga0224712_10693215 | 3300022467 | Bacteria | 501 |
| 386 | Ga0209436_109615 | 3300025208 | Bacteria | 1826 |
| 387 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 388 | Ga0207425_1001644 | 3300025245 | Bacteria | 8998 |
| 389 | Ga0209026_1016232 | 3300025250 | Unclassified | 1208 |
| 390 | Ga0209677_107904 | 3300025253 | Bacteria | 2158 |
| 391 | Ga0209148_1000272 | 3300025254 | Bacteria | 81330 |
| 392 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 393 | Ga0209565_1024423 | 3300025263 | Bacteria | 1230 |
| 394 | Ga0209565_1042407 | 3300025263 | Bacteria | 843 |
| 395 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 396 | Ga0209130_1000067 | 3300025284 | Bacteria | 184277 |
| 397 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 398 | Ga0209025_1006507 | 3300025294 | Bacteria | 9037 |
| 399 | Ga0209564_1000026 | 3300025295 | Bacteria | 519154 |
| 400 | Ga0209564_1000102 | 3300025295 | Bacteria | 222597 |
| 401 | Ga0209758_1000314 | 3300025297 | Bacteria | 93818 |
| 402 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 403 | Ga0209256_1000037 | 3300025299 | Bacteria | 377661 |
| 404 | Ga0207697_10098252 | 3300025315 | Bacteria | 1246 |
| 405 | Ga0207656_10021063 | 3300025321 | Bacteria | 2599 |
| 406 | Ga0207656_10107968 | 3300025321 | Bacteria | 1283 |
| 407 | Ga0207656_10411906 | 3300025321 | Bacteria | 680 |
| 408 | Ga0207696_1175319 | 3300025711 | Bacteria | 567 |
| 409 | Ga0207713_1209093 | 3300025735 | Unclassified | 594 |
| 410 | Ga0207682_10001543 | 3300025893 | Bacteria | 10582 |
| 411 | Ga0207682_10088790 | 3300025893 | Bacteria | 1337 |
| 412 | Ga0207682_10116098 | 3300025893 | Bacteria | 1183 |
| 413 | Ga0207692_10203011 | 3300025898 | Bacteria | 1166 |
| 414 | Ga0207710_10032167 | 3300025900 | Bacteria | 2298 |
| 415 | Ga0207688_10315124 | 3300025901 | Bacteria | 959 |
| 416 | Ga0207688_10370002 | 3300025901 | Bacteria | 885 |
| 417 | Ga0207680_10129237 | 3300025903 | Bacteria | 1663 |
| 418 | Ga0207680_10260380 | 3300025903 | Bacteria | 1200 |
| 419 | Ga0207680_10262336 | 3300025903 | Bacteria | 1196 |
| 420 | Ga0207680_10490789 | 3300025903 | Bacteria | 874 |
| 421 | Ga0207680_10507510 | 3300025903 | Bacteria | 859 |
| 422 | Ga0207680_11114922 | 3300025903 | Bacteria | 564 |
| 423 | Ga0207645_10000368 | 3300025907 | Bacteria | 37407 |
| 424 | Ga0207645_10029705 | 3300025907 | Bacteria | 3523 |
| 425 | Ga0207645_10038810 | 3300025907 | Bacteria | 3052 |
| 426 | Ga0207643_10019972 | 3300025908 | Bacteria | 3675 |
| 427 | Ga0207643_10040959 | 3300025908 | Bacteria | 2609 |
| 428 | Ga0207705_10003612 | 3300025909 | Bacteria | 11782 |
| 429 | Ga0207705_10219637 | 3300025909 | Bacteria | 1443 |
| 430 | Ga0207705_10625432 | 3300025909 | Bacteria | 837 |
| 431 | Ga0207705_10797712 | 3300025909 | Bacteria | 733 |
| 432 | Ga0207705_10833828 | 3300025909 | Unclassified | 715 |
| 433 | Ga0207705_10854721 | 3300025909 | Bacteria | 705 |
| 434 | Ga0207684_10068001 | 3300025910 | Bacteria | 3028 |
| 435 | Ga0207654_10013588 | 3300025911 | Bacteria | 4190 |
| 436 | Ga0207654_10644104 | 3300025911 | Unclassified | 758 |
| 437 | Ga0207707_10012370 | 3300025912 | Bacteria | 7417 |
| 438 | Ga0207707_11183761 | 3300025912 | Bacteria | 619 |
| 439 | Ga0207695_10618639 | 3300025913 | Bacteria | 964 |
| 440 | Ga0207671_10103323 | 3300025914 | Bacteria | 2161 |
| 441 | Ga0207693_10276442 | 3300025915 | Bacteria | 1316 |
| 442 | Ga0207663_11619838 | 3300025916 | Bacteria | 521 |
| 443 | Ga0207660_10187555 | 3300025917 | Bacteria | 1609 |
| 444 | Ga0207660_10402231 | 3300025917 | Bacteria | 1103 |
| 445 | Ga0207660_10749542 | 3300025917 | Unclassified | 797 |
| 446 | Ga0207660_11340601 | 3300025917 | Bacteria | 581 |
| 447 | Ga0207662_11373708 | 3300025918 | Bacteria | 502 |
| 448 | Ga0207657_10065714 | 3300025919 | Bacteria | 3091 |
| 449 | Ga0207657_10144069 | 3300025919 | Bacteria | 1944 |
| 450 | Ga0207657_10366664 | 3300025919 | Bacteria | 1135 |
| 451 | Ga0207657_11135535 | 3300025919 | Bacteria | 596 |
| 452 | Ga0207649_10001571 | 3300025920 | Bacteria | 13320 |
| 453 | Ga0207649_10097664 | 3300025920 | Bacteria | 1937 |
| 454 | Ga0207649_10207781 | 3300025920 | Bacteria | 1387 |
| 455 | Ga0207649_10535415 | 3300025920 | Bacteria | 894 |
| 456 | Ga0207649_11597826 | 3300025920 | Bacteria | 516 |
| 457 | Ga0207652_10005028 | 3300025921 | Bacteria | 10716 |
| 458 | Ga0207652_10120365 | 3300025921 | Bacteria | 2335 |
| 459 | Ga0207652_10459034 | 3300025921 | Bacteria | 1148 |
| 460 | Ga0207652_11433260 | 3300025921 | Bacteria | 594 |
| 461 | Ga0207646_10441645 | 3300025922 | Bacteria | 1174 |
| 462 | Ga0207681_10128874 | 3300025923 | Bacteria | 1868 |
| 463 | Ga0207681_10185637 | 3300025923 | Bacteria | 1587 |
| 464 | Ga0207650_10006340 | 3300025925 | Bacteria | 8060 |
| 465 | Ga0207650_10149150 | 3300025925 | Bacteria | 1844 |
| 466 | Ga0207650_10214992 | 3300025925 | Bacteria | 1545 |
| 467 | Ga0207650_10301466 | 3300025925 | Bacteria | 1309 |
| 468 | Ga0207650_10539728 | 3300025925 | Bacteria | 977 |
| 469 | Ga0207650_10675039 | 3300025925 | Bacteria | 872 |
| 470 | Ga0207659_10064240 | 3300025926 | Bacteria | 2655 |
| 471 | Ga0207659_10553718 | 3300025926 | Bacteria | 978 |
| 472 | Ga0207659_11138108 | 3300025926 | Bacteria | 671 |
| 473 | Ga0207659_11353513 | 3300025926 | Bacteria | 611 |
| 474 | Ga0207659_11353677 | 3300025926 | Bacteria | 611 |
| 475 | Ga0207687_10353201 | 3300025927 | Bacteria | 1198 |
| 476 | Ga0207644_10029990 | 3300025931 | Bacteria | 3777 |
| 477 | Ga0207644_10073521 | 3300025931 | Bacteria | 2507 |
| 478 | Ga0207644_10103113 | 3300025931 | Bacteria | 2146 |
| 479 | Ga0207644_10191598 | 3300025931 | Bacteria | 1608 |
| 480 | Ga0207644_10396446 | 3300025931 | Bacteria | 1127 |
| 481 | Ga0207644_10422742 | 3300025931 | Bacteria | 1092 |
| 482 | Ga0207690_10157164 | 3300025932 | Bacteria | 1691 |
| 483 | Ga0207690_10293463 | 3300025932 | Bacteria | 1270 |
| 484 | Ga0207690_10509945 | 3300025932 | Bacteria | 974 |
| 485 | Ga0207690_11527119 | 3300025932 | Bacteria | 558 |
| 486 | Ga0207706_10063812 | 3300025933 | Bacteria | 3243 |
| 487 | Ga0207706_10457026 | 3300025933 | Bacteria | 1104 |
| 488 | Ga0207706_10554159 | 3300025933 | Bacteria | 990 |
| 489 | Ga0207706_10615781 | 3300025933 | Bacteria | 932 |
| 490 | Ga0207706_11671023 | 3300025933 | Bacteria | 514 |
| 491 | Ga0207686_10001803 | 3300025934 | Bacteria | 11906 |
| 492 | Ga0207686_11767895 | 3300025934 | Bacteria | 511 |
| 493 | Ga0207709_10082951 | 3300025935 | Bacteria | 2071 |
| 494 | Ga0207709_10532319 | 3300025935 | Bacteria | 921 |
| 495 | Ga0207709_10724088 | 3300025935 | Bacteria | 798 |
| 496 | Ga0207670_10271353 | 3300025936 | Unclassified | 1319 |
| 497 | Ga0207670_10500182 | 3300025936 | Bacteria | 987 |
| 498 | Ga0207670_11090899 | 3300025936 | Bacteria | 674 |
| 499 | Ga0207669_10017906 | 3300025937 | Bacteria | 3648 |
| 500 | Ga0207669_10026360 | 3300025937 | Bacteria | 3160 |
| 501 | Ga0207669_10101094 | 3300025937 | Bacteria | 1906 |
| 502 | Ga0207669_10460658 | 3300025937 | Unclassified | 1009 |
| 503 | Ga0207704_10185449 | 3300025938 | Bacteria | 1508 |
| 504 | Ga0207704_10320033 | 3300025938 | Bacteria | 1196 |
| 505 | Ga0207704_10529692 | 3300025938 | Bacteria | 954 |
| 506 | Ga0207704_10651686 | 3300025938 | Bacteria | 867 |
| 507 | Ga0207691_10006372 | 3300025940 | Bacteria | 11401 |
| 508 | Ga0207691_10012848 | 3300025940 | Bacteria | 8016 |
| 509 | Ga0207691_10119991 | 3300025940 | Bacteria | 2332 |
| 510 | Ga0207691_11013169 | 3300025940 | Unclassified | 693 |
| 511 | Ga0207711_10020304 | 3300025941 | Bacteria | 5537 |
| 512 | Ga0207711_10341617 | 3300025941 | Bacteria | 1386 |
| 513 | Ga0207711_11236495 | 3300025941 | Bacteria | 689 |
| 514 | Ga0207711_11401504 | 3300025941 | Bacteria | 641 |
| 515 | Ga0207689_10005836 | 3300025942 | Bacteria | 10916 |
| 516 | Ga0207689_11099388 | 3300025942 | Bacteria | 670 |
| 517 | Ga0207661_10492556 | 3300025944 | Bacteria | 1120 |
| 518 | Ga0207661_11525248 | 3300025944 | Bacteria | 612 |
| 519 | Ga0207679_10030854 | 3300025945 | Bacteria | 3747 |
| 520 | Ga0207679_10091484 | 3300025945 | Bacteria | 2354 |
| 521 | Ga0207679_10163139 | 3300025945 | Bacteria | 1827 |
| 522 | Ga0207679_10233950 | 3300025945 | Bacteria | 1553 |
| 523 | Ga0207679_10361540 | 3300025945 | Bacteria | 1268 |
| 524 | Ga0207679_10970334 | 3300025945 | Bacteria | 779 |
| 525 | Ga0207679_11384313 | 3300025945 | Bacteria | 645 |
| 526 | Ga0207679_11853047 | 3300025945 | Bacteria | 551 |
| 527 | Ga0207667_10030564 | 3300025949 | Bacteria | 5826 |
| 528 | Ga0207667_10151829 | 3300025949 | Bacteria | 2384 |
| 529 | Ga0207667_10263976 | 3300025949 | Bacteria | 1761 |
| 530 | Ga0207667_10552718 | 3300025949 | Bacteria | 1164 |
| 531 | Ga0207667_11820104 | 3300025949 | Bacteria | 573 |
| 532 | Ga0207651_10023058 | 3300025960 | Bacteria | 3820 |
| 533 | Ga0207651_10051601 | 3300025960 | Bacteria | 2800 |
| 534 | Ga0207651_10120286 | 3300025960 | Bacteria | 1990 |
| 535 | Ga0207651_10348725 | 3300025960 | Bacteria | 1246 |
| 536 | Ga0207651_10703746 | 3300025960 | Bacteria | 890 |
| 537 | Ga0207651_10844961 | 3300025960 | Bacteria | 813 |
| 538 | Ga0207651_11521131 | 3300025960 | Unclassified | 603 |
| 539 | Ga0207712_10397044 | 3300025961 | Bacteria | 1158 |
| 540 | Ga0207668_10022709 | 3300025972 | Bacteria | 4021 |
| 541 | Ga0207668_10067696 | 3300025972 | Bacteria | 2536 |
| 542 | Ga0207668_10129019 | 3300025972 | Bacteria | 1928 |
| 543 | Ga0207668_10176179 | 3300025972 | Bacteria | 1682 |
| 544 | Ga0207668_10209871 | 3300025972 | Bacteria | 1557 |
| 545 | Ga0207668_10223605 | 3300025972 | Bacteria | 1513 |
| 546 | Ga0207668_10621981 | 3300025972 | Bacteria | 942 |
| 547 | Ga0207668_12073607 | 3300025972 | Bacteria | 512 |
| 548 | Ga0207640_10082781 | 3300025981 | Bacteria | 2198 |
| 549 | Ga0207640_10094501 | 3300025981 | Bacteria | 2079 |
| 550 | Ga0207640_10110565 | 3300025981 | Bacteria | 1947 |
| 551 | Ga0207640_10699991 | 3300025981 | Bacteria | 868 |
| 552 | Ga0207640_11263544 | 3300025981 | Bacteria | 658 |
| 553 | Ga0207658_10019638 | 3300025986 | Bacteria | 4674 |
| 554 | Ga0207658_10022338 | 3300025986 | Bacteria | 4405 |
| 555 | Ga0207658_10060980 | 3300025986 | Bacteria | 2816 |
| 556 | Ga0207658_10082890 | 3300025986 | Bacteria | 2463 |
| 557 | Ga0207658_10433285 | 3300025986 | Bacteria | 1161 |
| 558 | Ga0207658_10831241 | 3300025986 | Bacteria | 839 |
| 559 | Ga0207658_11001033 | 3300025986 | Bacteria | 763 |
| 560 | Ga0207658_11962576 | 3300025986 | Unclassified | 533 |
| 561 | Ga0207677_10088942 | 3300026023 | Bacteria | 2241 |
| 562 | Ga0207677_11192209 | 3300026023 | Bacteria | 697 |
| 563 | Ga0207677_11224537 | 3300026023 | Bacteria | 688 |
| 564 | Ga0207703_10014225 | 3300026035 | Bacteria | 6206 |
| 565 | Ga0207703_10036826 | 3300026035 | Bacteria | 3896 |
| 566 | Ga0207703_10282736 | 3300026035 | Bacteria | 1507 |
| 567 | Ga0207703_10440708 | 3300026035 | Bacteria | 1215 |
| 568 | Ga0207703_10601445 | 3300026035 | Bacteria | 1040 |
| 569 | Ga0207703_10859204 | 3300026035 | Bacteria | 868 |
| 570 | Ga0207639_10039565 | 3300026041 | Bacteria | 3514 |
| 571 | Ga0207639_10425974 | 3300026041 | Bacteria | 1201 |
| 572 | Ga0207678_10077076 | 3300026067 | Bacteria | 2855 |
| 573 | Ga0207678_10081513 | 3300026067 | Bacteria | 2770 |
| 574 | Ga0207678_10264948 | 3300026067 | Bacteria | 1473 |
| 575 | Ga0207678_10292521 | 3300026067 | Bacteria | 1399 |
| 576 | Ga0207678_11561065 | 3300026067 | Bacteria | 582 |
| 577 | Ga0207708_10261482 | 3300026075 | Bacteria | 1397 |
| 578 | Ga0207702_10197665 | 3300026078 | Bacteria | 1862 |
| 579 | Ga0207702_11504987 | 3300026078 | Bacteria | 666 |
| 580 | Ga0207702_11988689 | 3300026078 | Unclassified | 572 |
| 581 | Ga0207641_10219619 | 3300026088 | Bacteria | 1762 |
| 582 | Ga0207641_10347622 | 3300026088 | Bacteria | 1413 |
| 583 | Ga0207641_10411492 | 3300026088 | Bacteria | 1300 |
| 584 | Ga0207641_11638720 | 3300026088 | Bacteria | 645 |
| 585 | Ga0207648_10003902 | 3300026089 | Bacteria | 15550 |
| 586 | Ga0207648_10024219 | 3300026089 | Bacteria | 5422 |
| 587 | Ga0207648_10034231 | 3300026089 | Bacteria | 4478 |
| 588 | Ga0207648_10172541 | 3300026089 | Bacteria | 1912 |
| 589 | Ga0207648_10477723 | 3300026089 | Bacteria | 1138 |
| 590 | Ga0207648_10849287 | 3300026089 | Bacteria | 851 |
| 591 | Ga0207648_10864382 | 3300026089 | Bacteria | 844 |
| 592 | Ga0207676_10066601 | 3300026095 | Bacteria | 2873 |
| 593 | Ga0207676_10296095 | 3300026095 | Bacteria | 1475 |
| 594 | Ga0207676_11037557 | 3300026095 | Bacteria | 809 |
| 595 | Ga0207674_10039264 | 3300026116 | Bacteria | 4908 |
| 596 | Ga0207674_10829827 | 3300026116 | Bacteria | 892 |
| 597 | Ga0207674_11846118 | 3300026116 | Unclassified | 571 |
| 598 | Ga0207675_100015978 | 3300026118 | Bacteria | 7006 |
| 599 | Ga0207675_100111715 | 3300026118 | Bacteria | 2579 |
| 600 | Ga0207675_100132289 | 3300026118 | Bacteria | 2365 |
| 601 | Ga0207675_100153753 | 3300026118 | Bacteria | 2191 |
| 602 | Ga0207675_101681530 | 3300026118 | Bacteria | 655 |
| 603 | Ga0207683_10000133 | 3300026121 | Bacteria | 61157 |
| 604 | Ga0207683_10006603 | 3300026121 | Bacteria | 9927 |
| 605 | Ga0207683_10124932 | 3300026121 | Bacteria | 2312 |
| 606 | Ga0207683_10770050 | 3300026121 | Bacteria | 893 |
| 607 | Ga0207683_11016479 | 3300026121 | Bacteria | 769 |
| 608 | Ga0207698_10016189 | 3300026142 | Bacteria | 5018 |
| 609 | Ga0207698_10121705 | 3300026142 | Bacteria | 2210 |
| 610 | Ga0207698_10151986 | 3300026142 | Bacteria | 2011 |
| 611 | Ga0207698_10220574 | 3300026142 | Bacteria | 1713 |
| 612 | Ga0207698_11771343 | 3300026142 | Bacteria | 633 |
| 613 | Ga0207698_11886918 | 3300026142 | Bacteria | 612 |
| 614 | Ga0209281_1009550 | 3300027111 | Bacteria | 2273 |
| 615 | Ga0209281_1029163 | 3300027111 | Bacteria | 998 |
| 616 | Ga0209995_1020790 | 3300027471 | Bacteria | 1087 |
| 617 | Ga0209982_1007086 | 3300027552 | Bacteria | 1638 |
| 618 | Ga0209970_1016029 | 3300027614 | Bacteria | 1249 |
| 619 | Ga0209983_1001756 | 3300027665 | Bacteria | 4800 |
| 620 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 621 | Ga0209971_1041737 | 3300027682 | Bacteria | 1104 |
| 622 | Ga0209974_10003884 | 3300027876 | Bacteria | 5351 |
| 623 | Ga0268266_10005854 | 3300028379 | Bacteria | 11375 |
| 624 | Ga0268266_10045453 | 3300028379 | Bacteria | 3756 |
| 625 | Ga0268266_10399109 | 3300028379 | Bacteria | 1300 |
| 626 | Ga0268266_10518022 | 3300028379 | Bacteria | 1140 |
| 627 | Ga0268266_10522635 | 3300028379 | Bacteria | 1135 |
| 628 | Ga0268266_10832539 | 3300028379 | Bacteria | 892 |
| 629 | Ga0268266_11118884 | 3300028379 | Bacteria | 762 |
| 630 | Ga0268266_11211901 | 3300028379 | Bacteria | 730 |
| 631 | Ga0268266_11711516 | 3300028379 | Bacteria | 604 |
| 632 | Ga0268265_10025981 | 3300028380 | Bacteria | 4163 |
| 633 | Ga0268265_10051917 | 3300028380 | Bacteria | 3098 |
| 634 | Ga0268265_11607699 | 3300028380 | Bacteria | 655 |
| 635 | Ga0268265_12151680 | 3300028380 | Bacteria | 565 |
| 636 | Ga0268264_10013805 | 3300028381 | Bacteria | 6643 |
| 637 | Ga0268264_10337642 | 3300028381 | Bacteria | 1430 |
| 638 | Ga0268264_10337807 | 3300028381 | Bacteria | 1430 |
| 639 | Ga0268264_11809884 | 3300028381 | Bacteria | 621 |
| 640 | Ga0314311_1058868 | 3300030733 | Bacteria | 1483 |
| 641 | Ga0316179_1043648 | 3300030734 | Bacteria | 616 |
| 642 | Ga0316178_1018302 | 3300030735 | Bacteria | 1234 |
| 643 | Ga0316178_1162240 | 3300030735 | Bacteria | 952 |
| 644 | Ga0316180_1182415 | 3300030736 | Bacteria | 2249 |
| 645 | Ga0316181_1063650 | 3300030744 | Bacteria | 731 |
| 646 | Ga0316182_1040109 | 3300030745 | Bacteria | 1091 |
| 647 | Ga0316182_1423195 | 3300030745 | Bacteria | 2008 |
| 648 | Ga0307408_102018375 | 3300031548 | Bacteria | 555 |
| 649 | Ga0307408_102161790 | 3300031548 | Unclassified | 537 |
| 650 | Ga0307408_102296887 | 3300031548 | Bacteria | 522 |
| 651 | Ga0307508_10869251 | 3300031616 | Bacteria | 525 |
| 652 | Ga0307413_10348692 | 3300031824 | Bacteria | 1141 |
| 653 | Ga0307410_10173914 | 3300031852 | Bacteria | 1625 |
| 654 | Ga0307406_10692327 | 3300031901 | Bacteria | 850 |
| 655 | Ga0307412_10750418 | 3300031911 | Bacteria | 842 |
| 656 | Ga0307412_11957523 | 3300031911 | Bacteria | 542 |
| 657 | Ga0307416_100483523 | 3300032002 | Bacteria | 1299 |
| 658 | Ga0307416_100977425 | 3300032002 | Bacteria | 949 |
| 659 | Ga0307416_102172070 | 3300032002 | Bacteria | 657 |
| 660 | Ga0307414_10032835 | 3300032004 | Bacteria | 3422 |
| 661 | Ga0307414_11579506 | 3300032004 | Bacteria | 611 |
| 662 | Ga0307411_10254974 | 3300032005 | Bacteria | 1382 |
| 663 | Ga0307411_12040825 | 3300032005 | Bacteria | 536 |
| 664 | Ga0373939_0037009 | 3300035114 | Bacteria | 1447 |
| 665 | Ga0373939_0359489 | 3300035114 | Unclassified | 595 |
| 666 | Ga0373955_1038558 | 3300035172 | Unclassified | 505 |
| 667 | Ga0373962_0030329 | 3300035242 | Bacteria | 1479 |
| 668 | Ga0373931_0039145 | 3300035691 | Bacteria | 2484 |
| 669 | Ga0373927_0016950 | 3300035695 | Bacteria | 4801 |
| 670 | Ga0373947_0450463 | 3300035725 | Bacteria | 872 |
| 671 | Ga0373937_2078343 | 3300036401 | Bacteria | 514 |
| 672 | Ga0373925_0077420 | 3300037068 | Bacteria | 2524 |
| 673 | Ga0395899_0014265 | 3300037312 | Bacteria | 6067 |
| 674 | Ga0395899_0028741 | 3300037312 | Bacteria | 4183 |
| 675 | Ga0395899_0125689 | 3300037312 | Bacteria | 1834 |
| 676 | Ga0395899_0138615 | 3300037312 | Bacteria | 1732 |
| 677 | Ga0395899_0250816 | 3300037312 | Bacteria | 1214 |
| 678 | Ga0395899_0351708 | 3300037312 | Bacteria | 985 |
| 679 | Ga0395899_0361322 | 3300037312 | Bacteria | 969 |
| 680 | Ga0395899_0361614 | 3300037312 | Bacteria | 968 |
| 681 | Ga0395899_0634879 | 3300037312 | Bacteria | 676 |
| 682 | Ga0395900_0001494 | 3300037418 | Bacteria | 27808 |
| 683 | Ga0395900_0021829 | 3300037418 | Bacteria | 6545 |
| 684 | Ga0395900_0047752 | 3300037418 | Bacteria | 4409 |
| 685 | Ga0395900_0138452 | 3300037418 | Bacteria | 2493 |
| 686 | Ga0395900_0139030 | 3300037418 | Bacteria | 2487 |
| 687 | Ga0395900_0161730 | 3300037418 | Bacteria | 2283 |
| 688 | Ga0395900_0288207 | 3300037418 | Bacteria | 1631 |
| 689 | Ga0395900_0347433 | 3300037418 | Bacteria | 1457 |
| 690 | Ga0395898_0196908 | 3300037466 | Bacteria | 1924 |
| 691 | Ga0395898_0198622 | 3300037466 | Bacteria | 1915 |
| 692 | Ga0395898_0212010 | 3300037466 | Bacteria | 1847 |
| 693 | Ga0395898_0453878 | 3300037466 | Bacteria | 1220 |
| 694 | Ga0395898_1063544 | 3300037466 | Bacteria | 743 |
| 695 | Ga0395898_1162943 | 3300037466 | Bacteria | 703 |
| 696 | Ga0395898_1822184 | 3300037466 | Bacteria | 529 |
| 697 | Ga0395898_1987891 | 3300037466 | Bacteria | 501 |
| 698 | Ga0395905_0198403 | 3300037471 | Bacteria | 1881 |
| 699 | Ga0395905_0256158 | 3300037471 | Bacteria | 1634 |
| 700 | Ga0395905_0304423 | 3300037471 | Bacteria | 1482 |
| 701 | Ga0395905_0407115 | 3300037471 | Bacteria | 1255 |
| 702 | Ga0395905_0542878 | 3300037471 | Bacteria | 1063 |
| 703 | Ga0395901_0000307 | 3300038443 | Bacteria | 60012 |
| 704 | Ga0395901_0113663 | 3300038443 | Bacteria | 2843 |
| 705 | Ga0395901_0126863 | 3300038443 | Bacteria | 2681 |
| 706 | Ga0395901_0209180 | 3300038443 | Bacteria | 2042 |
| 707 | Ga0395901_0270454 | 3300038443 | Bacteria | 1767 |
| 708 | Ga0395901_0350961 | 3300038443 | Bacteria | 1522 |
| 709 | Ga0395901_0757520 | 3300038443 | Bacteria | 963 |
| 710 | Ga0436361_0594176 | 3300039447 | Bacteria | 724 |
| 711 | Ga0436361_0604351 | 3300039447 | Bacteria | 1263 |
| 712 | Ga0436361_0715458 | 3300039447 | Bacteria | 2223 |
| 713 | Ga0439439_0109738 | 3300041406 | Bacteria | 764 |
| 714 | Ga0439465_0087983 | 3300041413 | Bacteria | 1060 |
| 715 | Ga0451835_0902887 | 3300041492 | Bacteria | 743 |
| 716 | Ga0451839_0120065 | 3300041496 | Bacteria | 658 |
| 717 | Ga0451843_0217578 | 3300041509 | Bacteria | 528 |
| 718 | Ga0451853_3236455 | 3300041512 | Bacteria | 993 |
| 719 | Ga0439433_0050697 | 3300041999 | Bacteria | 978 |
| 720 | Ga0439448_0011757 | 3300042005 | Bacteria | 2610 |
| 721 | Ga0439448_0013577 | 3300042005 | Bacteria | 2449 |
| 722 | Ga0439448_0133979 | 3300042005 | Bacteria | 855 |
| 723 | Ga0439449_0004853 | 3300042007 | Bacteria | 5183 |
| 724 | Ga0439454_079792 | 3300042011 | Bacteria | 592 |
| 725 | Ga0439455_0059997 | 3300042012 | Bacteria | 1007 |
| 726 | Ga0439458_0056572 | 3300042157 | Bacteria | 974 |
| 727 | Ga0439458_0064848 | 3300042157 | Bacteria | 916 |
| 728 | Ga0439458_0142327 | 3300042157 | Bacteria | 639 |
| 729 | Ga0466969_0040955 | 3300044656 | Bacteria | 2319 |
| 730 | Ga0466969_0083497 | 3300044656 | Bacteria | 1521 |
| 731 | Ga0466969_0208581 | 3300044656 | Bacteria | 890 |
| 732 | Ga0466969_0247245 | 3300044656 | Bacteria | 809 |
| 733 | Ga0466972_0050496 | 3300044658 | Bacteria | 2007 |
| 734 | Ga0466972_0187318 | 3300044658 | Bacteria | 970 |
| 735 | Ga0466972_0302413 | 3300044658 | Bacteria | 747 |
| 736 | Ga0466981_0488731 | 3300044669 | Bacteria | 697 |
| 737 | Ga0466982_0538337 | 3300044672 | Bacteria | 594 |
| 738 | Ga0466965_0009825 | 3300044683 | Bacteria | 4450 |
| 739 | Ga0466965_0026965 | 3300044683 | Bacteria | 2786 |
| 740 | Ga0466965_0050771 | 3300044683 | Bacteria | 2056 |
| 741 | Ga0466965_0224624 | 3300044683 | Bacteria | 1001 |
| 742 | Ga0466965_0252364 | 3300044683 | Bacteria | 946 |
| 743 | Ga0466965_0855735 | 3300044683 | Bacteria | 528 |
| 744 | Ga0466966_0012240 | 3300044684 | Bacteria | 5683 |
| 745 | Ga0466966_0078906 | 3300044684 | Bacteria | 2052 |
| 746 | Ga0466966_0210961 | 3300044684 | Bacteria | 1173 |
| 747 | Ga0466966_0353044 | 3300044684 | Bacteria | 883 |
| 748 | Ga0466961_0083269 | 3300044693 | Bacteria | 2023 |
| 749 | Ga0466961_0319201 | 3300044693 | Bacteria | 947 |
| 750 | Ga0466961_0680748 | 3300044693 | Bacteria | 616 |
| 751 | Ga0466963_0059622 | 3300044694 | Bacteria | 2547 |
| 752 | Ga0466963_0409524 | 3300044694 | Bacteria | 956 |
| 753 | Ga0466963_0418318 | 3300044694 | Bacteria | 945 |
| 754 | Ga0466963_0666384 | 3300044694 | Bacteria | 734 |
| 755 | Ga0466963_1147463 | 3300044694 | Bacteria | 546 |
| 756 | Ga0466964_0000552 | 3300044706 | Bacteria | 11764 |
| 757 | Ga0466964_0033680 | 3300044706 | Bacteria | 2041 |
| 758 | Ga0466964_0384223 | 3300044706 | Bacteria | 729 |
| 759 | Ga0466964_0455036 | 3300044706 | Bacteria | 679 |
| 760 | Ga0466971_0052468 | 3300044719 | Bacteria | 1836 |
| 761 | Ga0466971_0088068 | 3300044719 | Bacteria | 1420 |
| 762 | Ga0466968_0007533 | 3300044735 | Bacteria | 4143 |
| 763 | Ga0466968_0250458 | 3300044735 | Bacteria | 841 |
| 764 | Ga0466970_0162276 | 3300044765 | Bacteria | 1236 |
| 765 | Ga0466970_0171504 | 3300044765 | Bacteria | 1202 |
| 766 | Ga0466970_0330396 | 3300044765 | Bacteria | 863 |
| 767 | Ga0466970_0340968 | 3300044765 | Bacteria | 849 |
| 768 | Ga0466957_0000668 | 3300044842 | Bacteria | 17441 |
| 769 | Ga0466957_0051398 | 3300044842 | Bacteria | 2508 |
| 770 | Ga0466957_0086804 | 3300044842 | Bacteria | 1955 |
| 771 | Ga0466957_0110014 | 3300044842 | Bacteria | 1746 |
| 772 | Ga0466957_0323888 | 3300044842 | Bacteria | 1040 |
| 773 | Ga0466957_0708193 | 3300044842 | Bacteria | 711 |
| 774 | Ga0466960_0222389 | 3300044901 | Bacteria | 1039 |
| 775 | Ga0466959_0043758 | 3300045049 | Bacteria | 3299 |
| 776 | Ga0466959_0047700 | 3300045049 | Bacteria | 3150 |
| 777 | Ga0466959_0081465 | 3300045049 | Bacteria | 2332 |
| 778 | Ga0466959_0714228 | 3300045049 | Bacteria | 671 |
| 779 | Ga0466958_0046174 | 3300045836 | Bacteria | 2628 |
| 780 | Ga0466958_0301047 | 3300045836 | Bacteria | 1029 |
| 781 | Ga0466958_0492134 | 3300045836 | Bacteria | 795 |
| 782 | Ga0466967_0009493 | 3300045976 | Bacteria | 7223 |
| 783 | Ga0466967_0031395 | 3300045976 | Bacteria | 4471 |
| 784 | Ga0466967_0328960 | 3300045976 | Bacteria | 1475 |
| 785 | Ga0495627_000915 | 3300046453 | Bacteria | 20456 |
| 786 | Ga0495627_036768 | 3300046453 | Bacteria | 1520 |
| 787 | Ga0495627_155408 | 3300046453 | Bacteria | 637 |
| 788 | Ga0495603_0028708 | 3300046455 | Bacteria | 3356 |
| 789 | Ga0495603_0055836 | 3300046455 | Bacteria | 2339 |
| 790 | Ga0495603_0315462 | 3300046455 | Bacteria | 897 |
| 791 | Ga0495603_0388289 | 3300046455 | Bacteria | 800 |
| 792 | Ga0495590_0008345 | 3300046457 | Bacteria | 3957 |
| 793 | Ga0495590_0026698 | 3300046457 | Bacteria | 2026 |
| 794 | Ga0495590_0032462 | 3300046457 | Bacteria | 1826 |
| 795 | Ga0495590_0214299 | 3300046457 | Bacteria | 710 |
| 796 | Ga0495591_000893 | 3300046458 | Bacteria | 20883 |
| 797 | Ga0495591_011947 | 3300046458 | Bacteria | 3258 |
| 798 | Ga0495591_122164 | 3300046458 | Bacteria | 635 |
| 799 | Ga0495629_0124313 | 3300046459 | Bacteria | 1797 |
| 800 | Ga0495629_0340118 | 3300046459 | Bacteria | 1024 |
| 801 | Ga0495638_0033948 | 3300046460 | Bacteria | 3259 |
| 802 | Ga0495638_0060673 | 3300046460 | Bacteria | 2338 |
| 803 | Ga0495638_0078119 | 3300046460 | Bacteria | 2014 |
| 804 | Ga0495638_0131803 | 3300046460 | Bacteria | 1467 |
| 805 | Ga0495638_0168730 | 3300046460 | Bacteria | 1257 |
| 806 | Ga0495638_0169429 | 3300046460 | Bacteria | 1254 |
| 807 | Ga0495638_0218367 | 3300046460 | Bacteria | 1067 |
| 808 | Ga0495638_0321762 | 3300046460 | Bacteria | 826 |
| 809 | Ga0495653_0028500 | 3300046463 | Bacteria | 4464 |
| 810 | Ga0495653_0058852 | 3300046463 | Bacteria | 2919 |
| 811 | Ga0495653_0297967 | 3300046463 | Bacteria | 1052 |
| 812 | Ga0495650_0000391 | 3300046471 | Bacteria | 74982 |
| 813 | Ga0495650_0001570 | 3300046471 | Bacteria | 21478 |
| 814 | Ga0495650_0002148 | 3300046471 | Bacteria | 16739 |
| 815 | Ga0495650_0025108 | 3300046471 | Bacteria | 2800 |
| 816 | Ga0495650_0089685 | 3300046471 | Bacteria | 1171 |
| 817 | Ga0495580_0009402 | 3300046472 | Bacteria | 7689 |
| 818 | Ga0495580_0264633 | 3300046472 | Bacteria | 1175 |
| 819 | Ga0495580_0429849 | 3300046472 | Bacteria | 887 |
| 820 | Ga0495582_0020418 | 3300046473 | Bacteria | 3626 |
| 821 | Ga0495582_0051053 | 3300046473 | Bacteria | 2280 |
| 822 | Ga0495582_0102349 | 3300046473 | Bacteria | 1604 |
| 823 | Ga0495582_0120275 | 3300046473 | Bacteria | 1479 |
| 824 | Ga0495605_0000005 | 3300046474 | Bacteria | 376973 |
| 825 | Ga0495605_0000276 | 3300046474 | Bacteria | 57745 |
| 826 | Ga0495605_0012653 | 3300046474 | Bacteria | 4672 |
| 827 | Ga0495605_0015789 | 3300046474 | Bacteria | 4102 |
| 828 | Ga0495605_0020432 | 3300046474 | Bacteria | 3519 |
| 829 | Ga0495605_0038749 | 3300046474 | Bacteria | 2389 |
| 830 | Ga0495605_0133776 | 3300046474 | Bacteria | 1116 |
| 831 | Ga0495605_0254020 | 3300046474 | Bacteria | 751 |
| 832 | Ga0495639_0297710 | 3300046475 | Bacteria | 804 |
| 833 | Ga0495639_0316473 | 3300046475 | Bacteria | 780 |
| 834 | Ga0495584_0000011 | 3300046491 | Bacteria | 208322 |
| 835 | Ga0495584_0001422 | 3300046491 | Bacteria | 14421 |
| 836 | Ga0495584_0001472 | 3300046491 | Bacteria | 14115 |
| 837 | Ga0495584_0005508 | 3300046491 | Bacteria | 6703 |
| 838 | Ga0495584_0005815 | 3300046491 | Bacteria | 6499 |
| 839 | Ga0495584_0005912 | 3300046491 | Bacteria | 6447 |
| 840 | Ga0495584_0011529 | 3300046491 | Bacteria | 4528 |
| 841 | Ga0495584_0027406 | 3300046491 | Bacteria | 2887 |
| 842 | Ga0495584_0031834 | 3300046491 | Bacteria | 2669 |
| 843 | Ga0495584_0037508 | 3300046491 | Bacteria | 2450 |
| 844 | Ga0495584_0088559 | 3300046491 | Bacteria | 1560 |
| 845 | Ga0495584_0325461 | 3300046491 | Bacteria | 780 |
| 846 | Ga0495584_0440124 | 3300046491 | Bacteria | 663 |
| 847 | Ga0495585_0000231 | 3300046492 | Bacteria | 57572 |
| 848 | Ga0495585_0000661 | 3300046492 | Bacteria | 31722 |
| 849 | Ga0495585_0002388 | 3300046492 | Bacteria | 13467 |
| 850 | Ga0495585_0005416 | 3300046492 | Bacteria | 8049 |
| 851 | Ga0495585_0011649 | 3300046492 | Bacteria | 5201 |
| 852 | Ga0495585_0016127 | 3300046492 | Bacteria | 4331 |
| 853 | Ga0495585_0017357 | 3300046492 | Bacteria | 4158 |
| 854 | Ga0495585_0022952 | 3300046492 | Bacteria | 3581 |
| 855 | Ga0495585_0040248 | 3300046492 | Bacteria | 2624 |
| 856 | Ga0495585_0043165 | 3300046492 | Bacteria | 2523 |
| 857 | Ga0495585_0044484 | 3300046492 | Bacteria | 2480 |
| 858 | Ga0495585_0045810 | 3300046492 | Bacteria | 2440 |
| 859 | Ga0495585_0099299 | 3300046492 | Bacteria | 1558 |
| 860 | Ga0495585_0169492 | 3300046492 | Bacteria | 1128 |
| 861 | Ga0495585_0222060 | 3300046492 | Bacteria | 953 |
| 862 | Ga0495585_0283329 | 3300046492 | Bacteria | 818 |
| 863 | Ga0495585_0365608 | 3300046492 | Bacteria | 699 |
| 864 | Ga0495585_0539679 | 3300046492 | Bacteria | 551 |
| 865 | Ga0495594_0011833 | 3300046499 | Bacteria | 4538 |
| 866 | Ga0495594_0021249 | 3300046499 | Bacteria | 3463 |
| 867 | Ga0495594_0036723 | 3300046499 | Bacteria | 2672 |
| 868 | Ga0495594_0051108 | 3300046499 | Bacteria | 2274 |
| 869 | Ga0495594_0054367 | 3300046499 | Bacteria | 2206 |
| 870 | Ga0495594_0324754 | 3300046499 | Bacteria | 876 |
| 871 | Ga0495594_0338716 | 3300046499 | Bacteria | 856 |
| 872 | Ga0495594_0356054 | 3300046499 | Bacteria | 833 |
| 873 | Ga0495594_0382486 | 3300046499 | Bacteria | 801 |
| 874 | Ga0495596_0000167 | 3300046500 | Bacteria | 46189 |
| 875 | Ga0495596_0001014 | 3300046500 | Bacteria | 16692 |
| 876 | Ga0495596_0001935 | 3300046500 | Bacteria | 11457 |
| 877 | Ga0495596_0007949 | 3300046500 | Bacteria | 4746 |
| 878 | Ga0495596_0026810 | 3300046500 | Bacteria | 2320 |
| 879 | Ga0495596_0029308 | 3300046500 | Bacteria | 2207 |
| 880 | Ga0495596_0031074 | 3300046500 | Bacteria | 2135 |
| 881 | Ga0495596_0042041 | 3300046500 | Bacteria | 1801 |
| 882 | Ga0495596_0068204 | 3300046500 | Bacteria | 1382 |
| 883 | Ga0495596_0143485 | 3300046500 | Bacteria | 927 |
| 884 | Ga0495596_0150353 | 3300046500 | Bacteria | 904 |
| 885 | Ga0495596_0240678 | 3300046500 | Bacteria | 702 |
| 886 | Ga0495596_0241420 | 3300046500 | Bacteria | 701 |
| 887 | Ga0495607_0000541 | 3300046501 | Bacteria | 36992 |
| 888 | Ga0495607_0002543 | 3300046501 | Bacteria | 14752 |
| 889 | Ga0495607_0007152 | 3300046501 | Bacteria | 7756 |
| 890 | Ga0495607_0007566 | 3300046501 | Bacteria | 7499 |
| 891 | Ga0495607_0011135 | 3300046501 | Bacteria | 6005 |
| 892 | Ga0495607_0013308 | 3300046501 | Bacteria | 5395 |
| 893 | Ga0495607_0037147 | 3300046501 | Bacteria | 2927 |
| 894 | Ga0495607_0037367 | 3300046501 | Bacteria | 2917 |
| 895 | Ga0495607_0039743 | 3300046501 | Bacteria | 2807 |
| 896 | Ga0495607_0075265 | 3300046501 | Bacteria | 1871 |
| 897 | Ga0495607_0077343 | 3300046501 | Bacteria | 1838 |
| 898 | Ga0495607_0085457 | 3300046501 | Bacteria | 1723 |
| 899 | Ga0495607_0172731 | 3300046501 | Bacteria | 1090 |
| 900 | Ga0495607_0186214 | 3300046501 | Bacteria | 1037 |
| 901 | Ga0495607_0285720 | 3300046501 | Bacteria | 781 |
| 902 | Ga0495607_0432634 | 3300046501 | Bacteria | 593 |
| 903 | Ga0495583_0000973 | 3300046506 | Bacteria | 32896 |
| 904 | Ga0495583_0001039 | 3300046506 | Bacteria | 31364 |
| 905 | Ga0495583_0002475 | 3300046506 | Bacteria | 15701 |
| 906 | Ga0495583_0003003 | 3300046506 | Bacteria | 13506 |
| 907 | Ga0495583_0003424 | 3300046506 | Bacteria | 12095 |
| 908 | Ga0495583_0016509 | 3300046506 | Bacteria | 3965 |
| 909 | Ga0495583_0024796 | 3300046506 | Bacteria | 3007 |
| 910 | Ga0495583_0040804 | 3300046506 | Bacteria | 2177 |
| 911 | Ga0495583_0046883 | 3300046506 | Bacteria | 1991 |
| 912 | Ga0495583_0118288 | 3300046506 | Bacteria | 1117 |
| 913 | Ga0495583_0141923 | 3300046506 | Bacteria | 999 |
| 914 | Ga0495583_0177964 | 3300046506 | Bacteria | 871 |
| 915 | Ga0495583_0206862 | 3300046506 | Bacteria | 796 |
| 916 | Ga0495583_0284704 | 3300046506 | Bacteria | 658 |
| 917 | Ga0495583_0412657 | 3300046506 | Bacteria | 530 |
| 918 | Ga0495606_0000044 | 3300046507 | Bacteria | 212802 |
| 919 | Ga0495606_0004147 | 3300046507 | Bacteria | 14690 |
| 920 | Ga0495606_0007667 | 3300046507 | Bacteria | 9571 |
| 921 | Ga0495606_0117704 | 3300046507 | Bacteria | 1594 |
| 922 | Ga0495606_0135869 | 3300046507 | Bacteria | 1456 |
| 923 | Ga0495606_0163968 | 3300046507 | Bacteria | 1294 |
| 924 | Ga0495606_0363673 | 3300046507 | Bacteria | 764 |
| 925 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 926 | Ga0495610_0000670 | 3300046512 | Bacteria | 33331 |
| 927 | Ga0495610_0006470 | 3300046512 | Bacteria | 8053 |
| 928 | Ga0495610_0290292 | 3300046512 | Bacteria | 634 |
| 929 | Ga0495616_0000513 | 3300046513 | Bacteria | 29356 |
| 930 | Ga0495616_0001343 | 3300046513 | Bacteria | 17155 |
| 931 | Ga0495616_0014810 | 3300046513 | Bacteria | 4354 |
| 932 | Ga0495616_0026160 | 3300046513 | Bacteria | 3109 |
| 933 | Ga0495616_0026806 | 3300046513 | Bacteria | 3062 |
| 934 | Ga0495616_0030576 | 3300046513 | Bacteria | 2828 |
| 935 | Ga0495616_0033581 | 3300046513 | Bacteria | 2671 |
| 936 | Ga0495616_0050386 | 3300046513 | Bacteria | 2082 |
| 937 | Ga0495616_0059048 | 3300046513 | Bacteria | 1887 |
| 938 | Ga0495616_0070740 | 3300046513 | Bacteria | 1688 |
| 939 | Ga0495616_0111796 | 3300046513 | Bacteria | 1268 |
| 940 | Ga0495616_0180477 | 3300046513 | Bacteria | 938 |
| 941 | Ga0495616_0193188 | 3300046513 | Bacteria | 898 |
| 942 | Ga0495628_0113774 | 3300046516 | Bacteria | 2080 |
| 943 | Ga0495630_0034352 | 3300046517 | Bacteria | 3787 |
| 944 | Ga0495630_0128986 | 3300046517 | Bacteria | 1920 |
| 945 | Ga0495631_0001460 | 3300046518 | Bacteria | 14333 |
| 946 | Ga0495631_0002828 | 3300046518 | Bacteria | 9638 |
| 947 | Ga0495631_0009060 | 3300046518 | Bacteria | 4984 |
| 948 | Ga0495631_0010172 | 3300046518 | Bacteria | 4667 |
| 949 | Ga0495631_0016695 | 3300046518 | Bacteria | 3491 |
| 950 | Ga0495631_0017704 | 3300046518 | Bacteria | 3364 |
| 951 | Ga0495631_0017820 | 3300046518 | Bacteria | 3353 |
| 952 | Ga0495631_0022351 | 3300046518 | Bacteria | 2940 |
| 953 | Ga0495631_0039135 | 3300046518 | Bacteria | 2105 |
| 954 | Ga0495631_0040628 | 3300046518 | Bacteria | 2060 |
| 955 | Ga0495631_0047668 | 3300046518 | Bacteria | 1880 |
| 956 | Ga0495631_0057785 | 3300046518 | Bacteria | 1687 |
| 957 | Ga0495631_0060076 | 3300046518 | Bacteria | 1650 |
| 958 | Ga0495631_0073921 | 3300046518 | Bacteria | 1471 |
| 959 | Ga0495631_0087777 | 3300046518 | Bacteria | 1339 |
| 960 | Ga0495632_0001800 | 3300046519 | Bacteria | 17287 |
| 961 | Ga0495632_0002267 | 3300046519 | Bacteria | 14828 |
| 962 | Ga0495632_0005326 | 3300046519 | Bacteria | 8538 |
| 963 | Ga0495632_0008341 | 3300046519 | Bacteria | 6369 |
| 964 | Ga0495632_0010039 | 3300046519 | Bacteria | 5642 |
| 965 | Ga0495632_0038108 | 3300046519 | Bacteria | 2435 |
| 966 | Ga0495632_0047193 | 3300046519 | Bacteria | 2137 |
| 967 | Ga0495632_0243404 | 3300046519 | Bacteria | 808 |
| 968 | Ga0495632_0246601 | 3300046519 | Bacteria | 802 |
| 969 | Ga0495637_0002124 | 3300046520 | Bacteria | 11128 |
| 970 | Ga0495637_0036587 | 3300046520 | Bacteria | 2137 |
| 971 | Ga0495637_0112935 | 3300046520 | Bacteria | 1051 |
| 972 | Ga0495637_0162171 | 3300046520 | Bacteria | 838 |
| 973 | Ga0495643_0000672 | 3300046522 | Bacteria | 40238 |
| 974 | Ga0495643_0009379 | 3300046522 | Bacteria | 6085 |
| 975 | Ga0495643_0014488 | 3300046522 | Bacteria | 4690 |
| 976 | Ga0495643_0036703 | 3300046522 | Bacteria | 2691 |
| 977 | Ga0495643_0081703 | 3300046522 | Bacteria | 1680 |
| 978 | Ga0495643_0089486 | 3300046522 | Bacteria | 1590 |
| 979 | Ga0495643_0097179 | 3300046522 | Bacteria | 1513 |
| 980 | Ga0495643_0120133 | 3300046522 | Bacteria | 1328 |
| 981 | Ga0495643_0129321 | 3300046522 | Bacteria | 1269 |
| 982 | Ga0495644_0011476 | 3300046523 | Bacteria | 3410 |
| 983 | Ga0495644_0025470 | 3300046523 | Bacteria | 2245 |
| 984 | Ga0495644_0026300 | 3300046523 | Bacteria | 2208 |
| 985 | Ga0495644_0029820 | 3300046523 | Bacteria | 2060 |
| 986 | Ga0495644_0105894 | 3300046523 | Bacteria | 1065 |
| 987 | Ga0495644_0164353 | 3300046523 | Bacteria | 851 |
| 988 | Ga0495644_0203464 | 3300046523 | Bacteria | 763 |
| 989 | Ga0495644_0310720 | 3300046523 | Bacteria | 617 |
| 990 | Ga0495648_0000305 | 3300046524 | Bacteria | 54610 |
| 991 | Ga0495648_0001823 | 3300046524 | Bacteria | 20505 |
| 992 | Ga0495648_0006047 | 3300046524 | Bacteria | 9929 |
| 993 | Ga0495648_0010172 | 3300046524 | Bacteria | 7194 |
| 994 | Ga0495648_0013289 | 3300046524 | Bacteria | 6096 |
| 995 | Ga0495648_0028695 | 3300046524 | Bacteria | 3702 |
| 996 | Ga0495648_0044607 | 3300046524 | Bacteria | 2766 |
| 997 | Ga0495648_0085246 | 3300046524 | Bacteria | 1785 |
| 998 | Ga0495648_0088322 | 3300046524 | Bacteria | 1743 |
| 999 | Ga0495648_0154615 | 3300046524 | Bacteria | 1192 |
| 1000 | Ga0495648_0252550 | 3300046524 | Bacteria | 850 |
| 1001 | Ga0495663_0011840 | 3300046525 | Bacteria | 2431 |
| 1002 | Ga0495663_0078783 | 3300046525 | Bacteria | 1058 |
| 1003 | Ga0495663_0356533 | 3300046525 | Bacteria | 533 |
| 1004 | Ga0495666_0001755 | 3300046526 | Bacteria | 10695 |
| 1005 | Ga0495666_0007423 | 3300046526 | Bacteria | 5495 |
| 1006 | Ga0495666_0016804 | 3300046526 | Bacteria | 3643 |
| 1007 | Ga0495666_0091741 | 3300046526 | Bacteria | 1433 |
| 1008 | Ga0495666_0394005 | 3300046526 | Bacteria | 622 |
| 1009 | Ga0495642_0000183 | 3300046528 | Bacteria | 37080 |
| 1010 | Ga0495642_0001255 | 3300046528 | Bacteria | 11589 |
| 1011 | Ga0495642_0007953 | 3300046528 | Bacteria | 4056 |
| 1012 | Ga0495642_0012702 | 3300046528 | Bacteria | 3249 |
| 1013 | Ga0495642_0014164 | 3300046528 | Bacteria | 3090 |
| 1014 | Ga0495642_0016993 | 3300046528 | Bacteria | 2840 |
| 1015 | Ga0495642_0025887 | 3300046528 | Bacteria | 2327 |
| 1016 | Ga0495642_0033505 | 3300046528 | Bacteria | 2065 |
| 1017 | Ga0495642_0034030 | 3300046528 | Bacteria | 2050 |
| 1018 | Ga0495642_0065935 | 3300046528 | Bacteria | 1508 |
| 1019 | Ga0495642_0115111 | 3300046528 | Bacteria | 1151 |
| 1020 | Ga0495642_0117360 | 3300046528 | Bacteria | 1140 |
| 1021 | Ga0495642_0267938 | 3300046528 | Bacteria | 747 |
| 1022 | Ga0495642_0494475 | 3300046528 | Bacteria | 541 |
| 1023 | Ga0495652_0004868 | 3300046529 | Bacteria | 12746 |
| 1024 | Ga0495652_0067329 | 3300046529 | Bacteria | 3003 |
| 1025 | Ga0495654_0012134 | 3300046530 | Bacteria | 4637 |
| 1026 | Ga0495654_0027865 | 3300046530 | Bacteria | 2891 |
| 1027 | Ga0495654_0034900 | 3300046530 | Bacteria | 2535 |
| 1028 | Ga0495654_0046888 | 3300046530 | Bacteria | 2126 |
| 1029 | Ga0495654_0096931 | 3300046530 | Bacteria | 1362 |
| 1030 | Ga0495654_0136419 | 3300046530 | Bacteria | 1097 |
| 1031 | Ga0495654_0155184 | 3300046530 | Bacteria | 1009 |
| 1032 | Ga0495665_0019946 | 3300046531 | Bacteria | 3604 |
| 1033 | Ga0495665_0056383 | 3300046531 | Bacteria | 2074 |
| 1034 | Ga0495665_0120444 | 3300046531 | Bacteria | 1374 |
| 1035 | Ga0495640_0086504 | 3300046533 | Bacteria | 2075 |
| 1036 | Ga0495586_0004976 | 3300046535 | Bacteria | 7105 |
| 1037 | Ga0495586_0012825 | 3300046535 | Bacteria | 4442 |
| 1038 | Ga0495586_0095563 | 3300046535 | Bacteria | 1645 |
| 1039 | Ga0495586_0103072 | 3300046535 | Bacteria | 1584 |
| 1040 | Ga0495586_0452278 | 3300046535 | Bacteria | 740 |
| 1041 | Ga0495587_0032789 | 3300046536 | Bacteria | 3137 |
| 1042 | Ga0495587_0103788 | 3300046536 | Bacteria | 1636 |
| 1043 | Ga0495598_0192449 | 3300046537 | Bacteria | 733 |
| 1044 | Ga0495609_0005634 | 3300046538 | Bacteria | 6531 |
| 1045 | Ga0495609_0006036 | 3300046538 | Bacteria | 6242 |
| 1046 | Ga0495609_0008274 | 3300046538 | Bacteria | 5101 |
| 1047 | Ga0495609_0018251 | 3300046538 | Bacteria | 3251 |
| 1048 | Ga0495609_0039214 | 3300046538 | Bacteria | 2133 |
| 1049 | Ga0495609_0039663 | 3300046538 | Bacteria | 2119 |
| 1050 | Ga0495609_0044547 | 3300046538 | Bacteria | 1989 |
| 1051 | Ga0495609_0079497 | 3300046538 | Bacteria | 1434 |
| 1052 | Ga0495609_0266738 | 3300046538 | Bacteria | 702 |
| 1053 | Ga0495597_0000750 | 3300046542 | Bacteria | 25631 |
| 1054 | Ga0495597_0001696 | 3300046542 | Bacteria | 15257 |
| 1055 | Ga0495597_0002408 | 3300046542 | Bacteria | 11907 |
| 1056 | Ga0495597_0003492 | 3300046542 | Bacteria | 9117 |
| 1057 | Ga0495597_0009047 | 3300046542 | Bacteria | 4947 |
| 1058 | Ga0495597_0018655 | 3300046542 | Bacteria | 3253 |
| 1059 | Ga0495597_0047011 | 3300046542 | Bacteria | 1911 |
| 1060 | Ga0495597_0064538 | 3300046542 | Bacteria | 1590 |
| 1061 | Ga0495597_0070070 | 3300046542 | Bacteria | 1512 |
| 1062 | Ga0495597_0078307 | 3300046542 | Bacteria | 1416 |
| 1063 | Ga0495597_0145064 | 3300046542 | Bacteria | 977 |
| 1064 | Ga0495597_0148938 | 3300046542 | Bacteria | 961 |
| 1065 | Ga0495597_0318896 | 3300046542 | Bacteria | 600 |
| 1066 | Ga0495645_0017268 | 3300046543 | Bacteria | 5169 |
| 1067 | Ga0495622_0004031 | 3300046557 | Bacteria | 6857 |
| 1068 | Ga0495622_0004396 | 3300046557 | Bacteria | 6556 |
| 1069 | Ga0495622_0027134 | 3300046557 | Bacteria | 2672 |
| 1070 | Ga0495622_0052977 | 3300046557 | Bacteria | 1882 |
| 1071 | Ga0495622_0117707 | 3300046557 | Bacteria | 1214 |
| 1072 | Ga0495622_0259833 | 3300046557 | Bacteria | 762 |
| 1073 | Ga0495622_0307603 | 3300046557 | Bacteria | 690 |
| 1074 | Ga0495633_0001801 | 3300046558 | Bacteria | 15811 |
| 1075 | Ga0495633_0004010 | 3300046558 | Bacteria | 9527 |
| 1076 | Ga0495633_0005029 | 3300046558 | Bacteria | 8241 |
| 1077 | Ga0495633_0007250 | 3300046558 | Bacteria | 6417 |
| 1078 | Ga0495633_0016596 | 3300046558 | Bacteria | 3791 |
| 1079 | Ga0495633_0022110 | 3300046558 | Bacteria | 3170 |
| 1080 | Ga0495633_0057402 | 3300046558 | Bacteria | 1828 |
| 1081 | Ga0495633_0058811 | 3300046558 | Bacteria | 1804 |
| 1082 | Ga0495633_0106076 | 3300046558 | Bacteria | 1303 |
| 1083 | Ga0495633_0109078 | 3300046558 | Bacteria | 1283 |
| 1084 | Ga0495633_0126302 | 3300046558 | Bacteria | 1183 |
| 1085 | Ga0495633_0195211 | 3300046558 | Bacteria | 930 |
| 1086 | Ga0495633_0423340 | 3300046558 | Bacteria | 602 |
| 1087 | Ga0495633_0513054 | 3300046558 | Bacteria | 540 |
| 1088 | Ga0495667_0161036 | 3300046559 | Bacteria | 1443 |
| 1089 | Ga0495667_0771660 | 3300046559 | Bacteria | 594 |
| 1090 | Ga0495656_0001534 | 3300046615 | Bacteria | 7545 |
| 1091 | Ga0495656_0009091 | 3300046615 | Bacteria | 3566 |
| 1092 | Ga0495656_0034549 | 3300046615 | Bacteria | 2071 |
| 1093 | Ga0495656_0072976 | 3300046615 | Bacteria | 1529 |
| 1094 | Ga0495656_0079357 | 3300046615 | Bacteria | 1477 |
| 1095 | Ga0495656_0575212 | 3300046615 | Bacteria | 602 |
| 1096 | Ga0495656_0721638 | 3300046615 | Bacteria | 537 |
| 1097 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 1098 | Ga0495668_0000147 | 3300046616 | Bacteria | 106018 |
| 1099 | Ga0495668_0002087 | 3300046616 | Bacteria | 17292 |
| 1100 | Ga0495668_0002663 | 3300046616 | Bacteria | 14338 |
| 1101 | Ga0495668_0006725 | 3300046616 | Bacteria | 7485 |
| 1102 | Ga0495668_0007013 | 3300046616 | Bacteria | 7275 |
| 1103 | Ga0495668_0011308 | 3300046616 | Bacteria | 5353 |
| 1104 | Ga0495668_0018876 | 3300046616 | Bacteria | 3983 |
| 1105 | Ga0495668_0026166 | 3300046616 | Bacteria | 3312 |
| 1106 | Ga0495668_0038446 | 3300046616 | Bacteria | 2673 |
| 1107 | Ga0495668_0040587 | 3300046616 | Bacteria | 2595 |
| 1108 | Ga0495668_0049125 | 3300046616 | Bacteria | 2339 |
| 1109 | Ga0495668_0107267 | 3300046616 | Bacteria | 1527 |
| 1110 | Ga0495668_0124011 | 3300046616 | Bacteria | 1413 |
| 1111 | Ga0495668_0257876 | 3300046616 | Bacteria | 954 |
| 1112 | Ga0495668_0626220 | 3300046616 | Bacteria | 594 |
| 1113 | Ga0495634_0071133 | 3300046642 | Bacteria | 2291 |
| 1114 | Ga0495634_0382547 | 3300046642 | Bacteria | 838 |
| 1115 | Ga0495634_0414708 | 3300046642 | Bacteria | 798 |
| 1116 | Ga0495611_0004165 | 3300046648 | Bacteria | 6293 |
| 1117 | Ga0495611_0008787 | 3300046648 | Bacteria | 4272 |
| 1118 | Ga0495611_0013099 | 3300046648 | Bacteria | 3526 |
| 1119 | Ga0495611_0018491 | 3300046648 | Bacteria | 2988 |
| 1120 | Ga0495611_0027894 | 3300046648 | Bacteria | 2471 |
| 1121 | Ga0495611_0037430 | 3300046648 | Bacteria | 2156 |
| 1122 | Ga0495611_0061736 | 3300046648 | Bacteria | 1703 |
| 1123 | Ga0495611_0377273 | 3300046648 | Bacteria | 649 |
| 1124 | Ga0495625_0004860 | 3300046660 | Bacteria | 12532 |
| 1125 | Ga0495625_0006363 | 3300046660 | Bacteria | 10542 |
| 1126 | Ga0495625_0009751 | 3300046660 | Bacteria | 7993 |
| 1127 | Ga0495625_0071803 | 3300046660 | Bacteria | 2428 |
| 1128 | Ga0495625_0120141 | 3300046660 | Bacteria | 1789 |
| 1129 | Ga0495625_0165047 | 3300046660 | Bacteria | 1481 |
| 1130 | Ga0495625_0374666 | 3300046660 | Bacteria | 894 |
| 1131 | Ga0495635_0061833 | 3300046663 | Bacteria | 2571 |
| 1132 | Ga0495635_0253179 | 3300046663 | Bacteria | 1187 |
| 1133 | Ga0495659_0006683 | 3300046664 | Bacteria | 3644 |
| 1134 | Ga0495659_0063289 | 3300046664 | Bacteria | 1371 |
| 1135 | Ga0495659_0096027 | 3300046664 | Bacteria | 1143 |
| 1136 | Ga0495661_0002137 | 3300046665 | Bacteria | 15482 |
| 1137 | Ga0495661_0007102 | 3300046665 | Bacteria | 7819 |
| 1138 | Ga0495661_0007586 | 3300046665 | Bacteria | 7560 |
| 1139 | Ga0495661_0009450 | 3300046665 | Bacteria | 6691 |
| 1140 | Ga0495661_0010426 | 3300046665 | Bacteria | 6340 |
| 1141 | Ga0495661_0013323 | 3300046665 | Bacteria | 5527 |
| 1142 | Ga0495661_0021589 | 3300046665 | Bacteria | 4196 |
| 1143 | Ga0495661_0027087 | 3300046665 | Bacteria | 3683 |
| 1144 | Ga0495661_0033130 | 3300046665 | Bacteria | 3260 |
| 1145 | Ga0495661_0036060 | 3300046665 | Bacteria | 3099 |
| 1146 | Ga0495661_0039437 | 3300046665 | Bacteria | 2935 |
| 1147 | Ga0495661_0044737 | 3300046665 | Bacteria | 2711 |
| 1148 | Ga0495661_0047611 | 3300046665 | Bacteria | 2610 |
| 1149 | Ga0495661_0051913 | 3300046665 | Bacteria | 2473 |
| 1150 | Ga0495661_0059915 | 3300046665 | Bacteria | 2263 |
| 1151 | Ga0495661_0076266 | 3300046665 | Bacteria | 1945 |
| 1152 | Ga0495661_0076505 | 3300046665 | Bacteria | 1941 |
| 1153 | Ga0495661_0080102 | 3300046665 | Bacteria | 1885 |
| 1154 | Ga0495661_0090702 | 3300046665 | Bacteria | 1739 |
| 1155 | Ga0495661_0149782 | 3300046665 | Bacteria | 1261 |
| 1156 | Ga0495661_0216054 | 3300046665 | Bacteria | 995 |
| 1157 | Ga0495661_0247407 | 3300046665 | Bacteria | 911 |
| 1158 | Ga0495661_0445173 | 3300046665 | Bacteria | 624 |
| 1159 | Ga0495661_0554911 | 3300046665 | Bacteria | 543 |
| 1160 | Ga0495588_0000070 | 3300046674 | Bacteria | 227611 |
| 1161 | Ga0495588_0021639 | 3300046674 | Bacteria | 3171 |
| 1162 | Ga0495588_0024022 | 3300046674 | Bacteria | 3024 |
| 1163 | Ga0495588_0028284 | 3300046674 | Bacteria | 2804 |
| 1164 | Ga0495588_0036330 | 3300046674 | Bacteria | 2499 |
| 1165 | Ga0495588_0037675 | 3300046674 | Bacteria | 2457 |
| 1166 | Ga0495588_0056773 | 3300046674 | Bacteria | 2021 |
| 1167 | Ga0495588_0087644 | 3300046674 | Bacteria | 1628 |
| 1168 | Ga0495588_0131471 | 3300046674 | Bacteria | 1320 |
| 1169 | Ga0495588_0134741 | 3300046674 | Bacteria | 1303 |
| 1170 | Ga0495623_0005716 | 3300046679 | Bacteria | 8120 |
| 1171 | Ga0495623_0016901 | 3300046679 | Bacteria | 4712 |
| 1172 | Ga0495623_0072479 | 3300046679 | Bacteria | 2142 |
| 1173 | Ga0495623_0194837 | 3300046679 | Bacteria | 1168 |
| 1174 | Ga0495623_0211900 | 3300046679 | Bacteria | 1108 |
| 1175 | Ga0495646_0118017 | 3300046680 | Bacteria | 1504 |
| 1176 | Ga0495646_0567688 | 3300046680 | Bacteria | 578 |
| 1177 | Ga0495669_0003622 | 3300046684 | Bacteria | 6361 |
| 1178 | Ga0495669_0005289 | 3300046684 | Bacteria | 5377 |
| 1179 | Ga0495669_0006862 | 3300046684 | Bacteria | 4767 |
| 1180 | Ga0495669_0010378 | 3300046684 | Bacteria | 3934 |
| 1181 | Ga0495669_0010911 | 3300046684 | Bacteria | 3845 |
| 1182 | Ga0495669_0013578 | 3300046684 | Bacteria | 3473 |
| 1183 | Ga0495669_0029766 | 3300046684 | Bacteria | 2395 |
| 1184 | Ga0495669_0070653 | 3300046684 | Bacteria | 1590 |
| 1185 | Ga0495669_0082095 | 3300046684 | Bacteria | 1480 |
| 1186 | Ga0495669_0555180 | 3300046684 | Bacteria | 559 |
| 1187 | Ga0495669_0566692 | 3300046684 | Bacteria | 552 |
| 1188 | Ga0495613_0008593 | 3300046689 | Bacteria | 7580 |
| 1189 | Ga0495613_0077562 | 3300046689 | Bacteria | 2417 |
| 1190 | Ga0495613_0472519 | 3300046689 | Bacteria | 847 |
| 1191 | Ga0495624_0053063 | 3300046690 | Bacteria | 2560 |
| 1192 | Ga0495670_0000858 | 3300046691 | Bacteria | 14716 |
| 1193 | Ga0495670_0007604 | 3300046691 | Bacteria | 5328 |
| 1194 | Ga0495670_0010624 | 3300046691 | Bacteria | 4523 |
| 1195 | Ga0495670_0020705 | 3300046691 | Bacteria | 3243 |
| 1196 | Ga0495670_0024382 | 3300046691 | Bacteria | 2989 |
| 1197 | Ga0495670_0037875 | 3300046691 | Bacteria | 2403 |
| 1198 | Ga0495670_0055003 | 3300046691 | Bacteria | 1995 |
| 1199 | Ga0495670_0089031 | 3300046691 | Bacteria | 1578 |
| 1200 | Ga0495670_0212799 | 3300046691 | Bacteria | 1025 |
| 1201 | Ga0495670_0333239 | 3300046691 | Bacteria | 815 |
| 1202 | Ga0495670_0474476 | 3300046691 | Bacteria | 678 |
| 1203 | Ga0495671_0000024 | 3300046692 | Bacteria | 246812 |
| 1204 | Ga0495671_0001399 | 3300046692 | Bacteria | 16265 |
| 1205 | Ga0495671_0001573 | 3300046692 | Bacteria | 15111 |
| 1206 | Ga0495671_0010899 | 3300046692 | Bacteria | 5022 |
| 1207 | Ga0495671_0031350 | 3300046692 | Bacteria | 2718 |
| 1208 | Ga0495671_0077072 | 3300046692 | Bacteria | 1634 |
| 1209 | Ga0495671_0105022 | 3300046692 | Bacteria | 1379 |
| 1210 | Ga0495671_0114595 | 3300046692 | Bacteria | 1316 |
| 1211 | Ga0495671_0147315 | 3300046692 | Bacteria | 1146 |
| 1212 | Ga0495649_0001152 | 3300046694 | Bacteria | 20593 |
| 1213 | Ga0495649_0001587 | 3300046694 | Bacteria | 17010 |
| 1214 | Ga0495649_0005680 | 3300046694 | Bacteria | 7873 |
| 1215 | Ga0495649_0023517 | 3300046694 | Bacteria | 3442 |
| 1216 | Ga0495649_0070020 | 3300046694 | Bacteria | 1881 |
| 1217 | Ga0495649_0070599 | 3300046694 | Bacteria | 1872 |
| 1218 | Ga0495649_0083163 | 3300046694 | Bacteria | 1710 |
| 1219 | Ga0495649_0212700 | 3300046694 | Bacteria | 1001 |
| 1220 | Ga0495649_0241260 | 3300046694 | Bacteria | 930 |
| 1221 | Ga0495649_0420604 | 3300046694 | Bacteria | 669 |
| 1222 | Ga0495649_0548529 | 3300046694 | Bacteria | 572 |
| 1223 | Ga0495589_0000175 | 3300046794 | Bacteria | 57368 |
| 1224 | Ga0495589_0006172 | 3300046794 | Bacteria | 6326 |
| 1225 | Ga0495589_0008611 | 3300046794 | Bacteria | 5319 |
| 1226 | Ga0495589_0015652 | 3300046794 | Bacteria | 3899 |
| 1227 | Ga0495589_0029680 | 3300046794 | Bacteria | 2757 |
| 1228 | Ga0495589_0059859 | 3300046794 | Bacteria | 1871 |
| 1229 | Ga0495589_0096445 | 3300046794 | Bacteria | 1433 |
| 1230 | Ga0495589_0100072 | 3300046794 | Bacteria | 1403 |
| 1231 | Ga0495589_0111488 | 3300046794 | Bacteria | 1320 |
| 1232 | Ga0495589_0133853 | 3300046794 | Bacteria | 1189 |
| 1233 | Ga0495589_0149748 | 3300046794 | Bacteria | 1114 |
| 1234 | Ga0495589_0428732 | 3300046794 | Bacteria | 606 |
| 1235 | Ga0495589_0509956 | 3300046794 | Bacteria | 549 |
| 1236 | Ga0495600_0029364 | 3300046809 | Bacteria | 3560 |
| 1237 | Ga0495600_0077432 | 3300046809 | Bacteria | 2171 |
| 1238 | Ga0495660_0000113 | 3300046810 | Bacteria | 86593 |
| 1239 | Ga0495660_0007231 | 3300046810 | Bacteria | 6535 |
| 1240 | Ga0495660_0008596 | 3300046810 | Bacteria | 5975 |
| 1241 | Ga0495660_0011822 | 3300046810 | Bacteria | 5060 |
| 1242 | Ga0495660_0013074 | 3300046810 | Bacteria | 4811 |
| 1243 | Ga0495660_0018065 | 3300046810 | Bacteria | 4055 |
| 1244 | Ga0495660_0058835 | 3300046810 | Bacteria | 2068 |
| 1245 | Ga0495660_0087344 | 3300046810 | Bacteria | 1626 |
| 1246 | Ga0495660_0089041 | 3300046810 | Bacteria | 1607 |
| 1247 | Ga0495660_0091058 | 3300046810 | Bacteria | 1585 |
| 1248 | Ga0495660_0119957 | 3300046810 | Bacteria | 1331 |
| 1249 | Ga0495660_0191455 | 3300046810 | Bacteria | 982 |
| 1250 | Ga0495581_0036204 | 3300047315 | Bacteria | 2855 |
| 1251 | Ga0495581_0106183 | 3300047315 | Bacteria | 1632 |
| 1252 | Ga0495581_0128311 | 3300047315 | Bacteria | 1477 |
| 1253 | Ga0495581_0239874 | 3300047315 | Bacteria | 1060 |
| 1254 | Ga0495581_0326300 | 3300047315 | Bacteria | 896 |
| 1255 | Ga0495604_0037771 | 3300047317 | Bacteria | 3801 |
| 1256 | Ga0495604_0104486 | 3300047317 | Bacteria | 2075 |
| 1257 | Ga0495604_0215908 | 3300047317 | Bacteria | 1323 |
| 1258 | Ga0495604_0994598 | 3300047317 | Bacteria | 519 |
| 1259 | Ga0495636_0002635 | 3300047318 | Bacteria | 6911 |
| 1260 | Ga0495636_0024504 | 3300047318 | Bacteria | 2447 |
| 1261 | Ga0495636_0024928 | 3300047318 | Bacteria | 2427 |
| 1262 | Ga0495636_0094257 | 3300047318 | Bacteria | 1302 |
| 1263 | Ga0495636_0459209 | 3300047318 | Bacteria | 612 |
| 1264 | Ga0495674_0126304 | 3300047319 | Bacteria | 2158 |
| 1265 | Ga0495674_1463061 | 3300047319 | Bacteria | 507 |
| 1266 | Ga0495672_0000014 | 3300047320 | Bacteria | 505636 |
| 1267 | Ga0495672_0000802 | 3300047320 | Bacteria | 33855 |
| 1268 | Ga0495672_0001524 | 3300047320 | Bacteria | 22682 |
| 1269 | Ga0495672_0008898 | 3300047320 | Bacteria | 7338 |
| 1270 | Ga0495672_0049785 | 3300047320 | Bacteria | 2478 |
| 1271 | Ga0495672_0075371 | 3300047320 | Bacteria | 1897 |
| 1272 | Ga0495672_0081406 | 3300047320 | Bacteria | 1803 |
| 1273 | Ga0495672_0091240 | 3300047320 | Bacteria | 1672 |
| 1274 | Ga0495672_0232320 | 3300047320 | Bacteria | 904 |
| 1275 | Ga0495672_0293467 | 3300047320 | Bacteria | 772 |
| 1276 | Ga0495672_0371481 | 3300047320 | Bacteria | 659 |
| 1277 | Ga0495676_0000635 | 3300047321 | Bacteria | 29072 |
| 1278 | Ga0495676_0024556 | 3300047321 | Bacteria | 5215 |
| 1279 | Ga0495680_0007985 | 3300047322 | Bacteria | 9647 |
| 1280 | Ga0495680_0886271 | 3300047322 | Bacteria | 577 |
| 1281 | Ga0495683_0004597 | 3300047323 | Bacteria | 7792 |
| 1282 | Ga0495683_0014426 | 3300047323 | Bacteria | 4116 |
| 1283 | Ga0495683_0018374 | 3300047323 | Bacteria | 3616 |
| 1284 | Ga0495683_0051367 | 3300047323 | Bacteria | 2061 |
| 1285 | Ga0495683_0084867 | 3300047323 | Bacteria | 1540 |
| 1286 | Ga0495683_0092427 | 3300047323 | Bacteria | 1464 |
| 1287 | Ga0495683_0123858 | 3300047323 | Bacteria | 1224 |
| 1288 | Ga0495683_0131796 | 3300047323 | Bacteria | 1178 |
| 1289 | Ga0495683_0300778 | 3300047323 | Bacteria | 689 |
| 1290 | Ga0495687_000256 | 3300047443 | Bacteria | 71778 |
| 1291 | Ga0495687_001662 | 3300047443 | Bacteria | 19944 |
| 1292 | Ga0495687_002171 | 3300047443 | Bacteria | 16339 |
| 1293 | Ga0495687_002621 | 3300047443 | Bacteria | 14113 |
| 1294 | Ga0495687_012555 | 3300047443 | Bacteria | 4470 |
| 1295 | Ga0495687_081327 | 3300047443 | Bacteria | 1267 |
| 1296 | Ga0495675_0004484 | 3300047444 | Bacteria | 8459 |
| 1297 | Ga0495675_0009446 | 3300047444 | Bacteria | 6068 |
| 1298 | Ga0495675_0083856 | 3300047444 | Bacteria | 2006 |
| 1299 | Ga0495675_0283877 | 3300047444 | Bacteria | 986 |
| 1300 | Ga0495677_0000285 | 3300047445 | Bacteria | 22182 |
| 1301 | Ga0495677_0000526 | 3300047445 | Bacteria | 16029 |
| 1302 | Ga0495677_0002208 | 3300047445 | Bacteria | 7718 |
| 1303 | Ga0495677_0002393 | 3300047445 | Bacteria | 7368 |
| 1304 | Ga0495677_0004272 | 3300047445 | Bacteria | 5495 |
| 1305 | Ga0495677_0006101 | 3300047445 | Bacteria | 4556 |
| 1306 | Ga0495677_0013292 | 3300047445 | Bacteria | 2994 |
| 1307 | Ga0495677_0022540 | 3300047445 | Bacteria | 2284 |
| 1308 | Ga0495677_0023041 | 3300047445 | Bacteria | 2260 |
| 1309 | Ga0495677_0081451 | 3300047445 | Bacteria | 1213 |
| 1310 | Ga0495677_0133912 | 3300047445 | Bacteria | 949 |
| 1311 | Ga0495677_0153867 | 3300047445 | Bacteria | 886 |
| 1312 | Ga0495679_001976 | 3300047446 | Bacteria | 10913 |
| 1313 | Ga0495679_008571 | 3300047446 | Bacteria | 4144 |
| 1314 | Ga0495679_021490 | 3300047446 | Bacteria | 2226 |
| 1315 | Ga0495679_038226 | 3300047446 | Bacteria | 1504 |
| 1316 | Ga0495679_042065 | 3300047446 | Bacteria | 1411 |
| 1317 | Ga0495679_050380 | 3300047446 | Bacteria | 1252 |
| 1318 | Ga0495679_085372 | 3300047446 | Bacteria | 891 |
| 1319 | Ga0495679_090044 | 3300047446 | Bacteria | 861 |
| 1320 | Ga0495685_001659 | 3300047447 | Bacteria | 6859 |
| 1321 | Ga0495685_017258 | 3300047447 | Bacteria | 2471 |
| 1322 | Ga0495685_023277 | 3300047447 | Bacteria | 2132 |
| 1323 | Ga0495685_042836 | 3300047447 | Bacteria | 1544 |
| 1324 | Ga0495685_101556 | 3300047447 | Bacteria | 950 |
| 1325 | Ga0495685_223931 | 3300047447 | Bacteria | 600 |
| 1326 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 1327 | Ga0495673_0000219 | 3300047469 | Bacteria | 84634 |
| 1328 | Ga0495673_0026744 | 3300047469 | Bacteria | 2754 |
| 1329 | Ga0495681_0002303 | 3300047470 | Bacteria | 13735 |
| 1330 | Ga0495681_0002957 | 3300047470 | Bacteria | 11975 |
| 1331 | Ga0495681_0003979 | 3300047470 | Bacteria | 10171 |
| 1332 | Ga0495681_0004255 | 3300047470 | Bacteria | 9819 |
| 1333 | Ga0495681_0009090 | 3300047470 | Bacteria | 6157 |
| 1334 | Ga0495681_0016882 | 3300047470 | Bacteria | 4072 |
| 1335 | Ga0495681_0016966 | 3300047470 | Bacteria | 4060 |
| 1336 | Ga0495681_0026169 | 3300047470 | Bacteria | 3042 |
| 1337 | Ga0495681_0045254 | 3300047470 | Bacteria | 2107 |
| 1338 | Ga0495681_0046523 | 3300047470 | Bacteria | 2068 |
| 1339 | Ga0495681_0087970 | 3300047470 | Bacteria | 1376 |
| 1340 | Ga0495681_0116679 | 3300047470 | Bacteria | 1150 |
| 1341 | Ga0495681_0149333 | 3300047470 | Bacteria | 981 |
| 1342 | Ga0495681_0166863 | 3300047470 | Bacteria | 913 |
| 1343 | Ga0495681_0224552 | 3300047470 | Bacteria | 752 |
| 1344 | Ga0495681_0233152 | 3300047470 | Bacteria | 733 |
| 1345 | Ga0495686_0000612 | 3300047472 | Bacteria | 49335 |
| 1346 | Ga0495686_0007392 | 3300047472 | Bacteria | 8242 |
| 1347 | Ga0495686_0007517 | 3300047472 | Bacteria | 8161 |
| 1348 | Ga0495686_0026052 | 3300047472 | Bacteria | 3827 |
| 1349 | Ga0495686_0040407 | 3300047472 | Bacteria | 2975 |
| 1350 | Ga0495686_0052739 | 3300047472 | Bacteria | 2549 |
| 1351 | Ga0495686_0057652 | 3300047472 | Bacteria | 2424 |
| 1352 | Ga0495593_0065585 | 3300047673 | Bacteria | 1893 |
| 1353 | Ga0495593_0090787 | 3300047673 | Bacteria | 1573 |
| 1354 | Ga0495593_0191581 | 3300047673 | Bacteria | 1028 |
| 1355 | Ga0495593_0199628 | 3300047673 | Bacteria | 1005 |
| 1356 | Ga0495593_0240489 | 3300047673 | Bacteria | 907 |
| 1357 | Ga0495602_0006516 | 3300048088 | Bacteria | 12245 |
| 1358 | Ga0495602_0129568 | 3300048088 | Bacteria | 2014 |
| 1359 | Ga0495614_0010297 | 3300048089 | Bacteria | 4123 |
| 1360 | Ga0495614_0034116 | 3300048089 | Bacteria | 2188 |
| 1361 | Ga0495614_0078450 | 3300048089 | Bacteria | 1429 |
| 1362 | Ga0495615_0277052 | 3300048090 | Bacteria | 538 |
| 1363 | Ga0495626_0000030 | 3300048091 | Bacteria | 202562 |
| 1364 | Ga0495626_0001112 | 3300048091 | Bacteria | 22702 |
| 1365 | Ga0495626_0003446 | 3300048091 | Bacteria | 10138 |
| 1366 | Ga0495626_0008158 | 3300048091 | Bacteria | 5770 |
| 1367 | Ga0495626_0013319 | 3300048091 | Bacteria | 4274 |
| 1368 | Ga0495626_0017773 | 3300048091 | Bacteria | 3585 |
| 1369 | Ga0495626_0019121 | 3300048091 | Bacteria | 3428 |
| 1370 | Ga0495626_0037898 | 3300048091 | Bacteria | 2288 |
| 1371 | Ga0495626_0050532 | 3300048091 | Bacteria | 1920 |
| 1372 | Ga0495626_0069697 | 3300048091 | Bacteria | 1583 |
| 1373 | Ga0495626_0118822 | 3300048091 | Bacteria | 1138 |
| 1374 | Ga0495626_0129870 | 3300048091 | Bacteria | 1076 |
| 1375 | Ga0495626_0147652 | 3300048091 | Bacteria | 993 |
| 1376 | Ga0495626_0182393 | 3300048091 | Bacteria | 869 |
| 1377 | Ga0496100_0015402 | 3300048903 | Bacteria | 4465 |
| 1378 | Ga0496100_0522339 | 3300048903 | Bacteria | 916 |
| 1379 | Ga0496100_0731895 | 3300048903 | Bacteria | 773 |
| 1380 | Ga0496100_0748557 | 3300048903 | Bacteria | 764 |
| 1381 | Ga0496100_0775748 | 3300048903 | Bacteria | 750 |
| 1382 | Ga0496101_0022303 | 3300048904 | Bacteria | 4357 |
| 1383 | Ga0496101_1151843 | 3300048904 | Bacteria | 608 |
| 1384 | Ga0496102_0000107 | 3300048905 | Bacteria | 118250 |
| 1385 | Ga0496102_0002399 | 3300048905 | Bacteria | 15993 |
| 1386 | Ga0496102_0131601 | 3300048905 | Bacteria | 2342 |
| 1387 | Ga0496102_0154892 | 3300048905 | Bacteria | 2154 |
| 1388 | Ga0496102_0281805 | 3300048905 | Bacteria | 1567 |
| 1389 | Ga0496102_0360849 | 3300048905 | Bacteria | 1368 |
| 1390 | Ga0496102_0471576 | 3300048905 | Bacteria | 1176 |
| 1391 | Ga0496102_0905887 | 3300048905 | Bacteria | 803 |
| 1392 | Ga0496103_0013925 | 3300048906 | Bacteria | 4774 |
| 1393 | Ga0496103_0024228 | 3300048906 | Bacteria | 3661 |
| 1394 | Ga0496103_0027712 | 3300048906 | Bacteria | 3435 |
| 1395 | Ga0496103_0114725 | 3300048906 | Bacteria | 1713 |
| 1396 | Ga0496103_0272794 | 3300048906 | Bacteria | 1088 |
| 1397 | Ga0496103_0459573 | 3300048906 | Bacteria | 816 |
| 1398 | Ga0496103_0547058 | 3300048906 | Bacteria | 739 |
| 1399 | Ga0496104_0514006 | 3300048907 | Bacteria | 1109 |
| 1400 | Ga0496104_1176458 | 3300048907 | Bacteria | 670 |
| 1401 | Ga0496105_0423836 | 3300048908 | Bacteria | 1053 |
| 1402 | Ga0496105_0715560 | 3300048908 | Bacteria | 767 |
| 1403 | Ga0496106_0415535 | 3300048909 | Bacteria | 1081 |
| 1404 | Ga0496106_1048597 | 3300048909 | Bacteria | 640 |
| 1405 | Ga0496107_0045165 | 3300048910 | Bacteria | 3168 |
| 1406 | Ga0496107_0089723 | 3300048910 | Bacteria | 2245 |
| 1407 | Ga0496107_0131886 | 3300048910 | Bacteria | 1845 |
| 1408 | Ga0496108_0041836 | 3300048911 | Bacteria | 3826 |
| 1409 | Ga0496108_0173153 | 3300048911 | Bacteria | 1868 |
| 1410 | Ga0496108_1079097 | 3300048911 | Bacteria | 683 |
| 1411 | Ga0496109_0022473 | 3300048912 | Bacteria | 5587 |
| 1412 | Ga0496109_1039118 | 3300048912 | Bacteria | 757 |
| 1413 | Ga0496109_1433848 | 3300048912 | Bacteria | 626 |
| 1414 | Ga0496110_0000073 | 3300048913 | Bacteria | 51301 |
| 1415 | Ga0496110_0017013 | 3300048913 | Bacteria | 6078 |
| 1416 | Ga0496110_0215525 | 3300048913 | Bacteria | 1746 |
| 1417 | Ga0496110_0408481 | 3300048913 | Bacteria | 1238 |
| 1418 | Ga0496110_0729724 | 3300048913 | Bacteria | 893 |
| 1419 | Ga0496110_1500749 | 3300048913 | Bacteria | 584 |
| 1420 | Ga0496110_1800402 | 3300048913 | Bacteria | 522 |
| 1421 | Ga0496111_0023601 | 3300048914 | Bacteria | 4320 |
| 1422 | Ga0496111_0076108 | 3300048914 | Bacteria | 2446 |
| 1423 | Ga0496111_0243968 | 3300048914 | Bacteria | 1334 |
| 1424 | Ga0496111_0244250 | 3300048914 | Bacteria | 1333 |
| 1425 | Ga0496111_0308709 | 3300048914 | Bacteria | 1172 |
| 1426 | Ga0496111_0342449 | 3300048914 | Bacteria | 1107 |
| 1427 | Ga0496111_0419145 | 3300048914 | Bacteria | 989 |
| 1428 | Ga0496113_0006791 | 3300048916 | Bacteria | 7293 |
| 1429 | Ga0496113_0115806 | 3300048916 | Bacteria | 2091 |
| 1430 | Ga0496113_0534784 | 3300048916 | Bacteria | 940 |
| 1431 | Ga0496114_0819080 | 3300048917 | Bacteria | 810 |
| 1432 | Ga0496115_0005153 | 3300048918 | Bacteria | 9510 |
| 1433 | Ga0496115_0131387 | 3300048918 | Bacteria | 2064 |
| 1434 | Ga0496115_0367281 | 3300048918 | Bacteria | 1172 |
| 1435 | Ga0496115_0648522 | 3300048918 | Bacteria | 835 |
| 1436 | Ga0496121_0010080 | 3300048924 | Bacteria | 10722 |
| 1437 | Ga0496121_0319154 | 3300048924 | Bacteria | 1047 |
| 1438 | Ga0496121_0397102 | 3300048924 | Bacteria | 904 |
| 1439 | Ga0496122_0004240 | 3300048925 | Bacteria | 17984 |
| 1440 | Ga0496122_0005480 | 3300048925 | Bacteria | 15100 |
| 1441 | Ga0496122_0014909 | 3300048925 | Bacteria | 7481 |
| 1442 | Ga0496122_0166992 | 3300048925 | Bacteria | 1333 |
| 1443 | Ga0496123_0004584 | 3300048926 | Bacteria | 14394 |
| 1444 | Ga0496123_0004651 | 3300048926 | Bacteria | 14248 |
| 1445 | Ga0496123_0093325 | 3300048926 | Bacteria | 1778 |
| 1446 | Ga0496124_0025849 | 3300048927 | Bacteria | 5307 |
| 1447 | Ga0496124_0042104 | 3300048927 | Bacteria | 3934 |
| 1448 | Ga0496124_0045034 | 3300048927 | Bacteria | 3783 |
| 1449 | Ga0496124_0073546 | 3300048927 | Bacteria | 2828 |
| 1450 | Ga0496124_0088863 | 3300048927 | Bacteria | 2524 |
| 1451 | Ga0496124_0158903 | 3300048927 | Bacteria | 1764 |
| 1452 | Ga0496124_0221766 | 3300048927 | Bacteria | 1421 |
| 1453 | Ga0496124_0348273 | 3300048927 | Bacteria | 1049 |
| 1454 | Ga0496124_0923772 | 3300048927 | Bacteria | 527 |
| 1455 | Ga0496124_0989646 | 3300048927 | Bacteria | 502 |
| 1456 | Ga0496125_0005966 | 3300048928 | Bacteria | 13335 |
| 1457 | Ga0496125_0166028 | 3300048928 | Bacteria | 1491 |
| 1458 | Ga0496125_0272016 | 3300048928 | Bacteria | 1055 |
| 1459 | Ga0496126_0039407 | 3300048929 | Bacteria | 4384 |
| 1460 | Ga0501308_029752 | 3300049128 | Bacteria | 727 |
| 1461 | Ga0495678_000230 | 3300049459 | Bacteria | 64445 |
| 1462 | Ga0495678_000523 | 3300049459 | Bacteria | 37505 |
| 1463 | Ga0495678_001473 | 3300049459 | Bacteria | 18420 |
| 1464 | Ga0495678_004643 | 3300049459 | Bacteria | 7881 |
| 1465 | Ga0495678_011801 | 3300049459 | Bacteria | 4167 |
| 1466 | Ga0495678_031893 | 3300049459 | Bacteria | 2191 |
| 1467 | Ga0495678_071428 | 3300049459 | Bacteria | 1271 |
| 1468 | Ga0495678_141569 | 3300049459 | Bacteria | 786 |
| 1469 | Ga0495678_166213 | 3300049459 | Bacteria | 701 |
| 1470 | Ga0495682_0001242 | 3300049460 | Bacteria | 14423 |
| 1471 | Ga0495682_0008310 | 3300049460 | Bacteria | 4094 |
| 1472 | Ga0495682_0008772 | 3300049460 | Bacteria | 3976 |
| 1473 | Ga0495682_0017767 | 3300049460 | Bacteria | 2680 |
| 1474 | Ga0495682_0169457 | 3300049460 | Bacteria | 777 |
| 1475 | Ga0495682_0285193 | 3300049460 | Bacteria | 583 |
| 1476 | Ga0501336_012305 | 3300049552 | Bacteria | 705 |
| 1477 | Ga0501034_0039455 | 3300049571 | Bacteria | 4783 |
| 1478 | Ga0501036_0231432 | 3300049572 | Bacteria | 1551 |
| 1479 | Ga0501036_0966774 | 3300049572 | Bacteria | 698 |
| 1480 | Ga0501042_0915141 | 3300049578 | Bacteria | 639 |
| 1481 | Ga0501043_1185868 | 3300049579 | Bacteria | 537 |
| 1482 | Ga0501047_0481759 | 3300049581 | Bacteria | 1068 |
| 1483 | Ga0501047_0512813 | 3300049581 | Bacteria | 1025 |
| 1484 | Ga0501048_1072039 | 3300049582 | Bacteria | 580 |
| 1485 | Ga0501067_0011741 | 3300049583 | Bacteria | 4852 |
| 1486 | Ga0501067_0578406 | 3300049583 | Bacteria | 629 |
| 1487 | Ga0501069_0464898 | 3300049585 | Bacteria | 753 |
| 1488 | Ga0501070_0022870 | 3300049586 | Bacteria | 5232 |
| 1489 | Ga0501070_0734491 | 3300049586 | Bacteria | 779 |
| 1490 | Ga0501072_0296063 | 3300049588 | Bacteria | 1286 |
| 1491 | Ga0501072_0324694 | 3300049588 | Bacteria | 1223 |
| 1492 | Ga0501073_0036699 | 3300049589 | Bacteria | 3481 |
| 1493 | Ga0501076_1489561 | 3300049592 | Bacteria | 556 |
| 1494 | Ga0501238_005850 | 3300049671 | Bacteria | 1573 |
| 1495 | Ga0501240_087372 | 3300049673 | Bacteria | 585 |
| 1496 | Ga0501249_081265 | 3300049679 | Bacteria | 763 |
| 1497 | Ga0501079_0396811 | 3300049741 | Bacteria | 1082 |
| 1498 | Ga0501080_0020160 | 3300049742 | Bacteria | 6171 |
| 1499 | Ga0501080_0332827 | 3300049742 | Bacteria | 1373 |
| 1500 | Ga0501083_0083255 | 3300049744 | Bacteria | 2119 |
| 1501 | Ga0501263_050956 | 3300049760 | Bacteria | 630 |
| 1502 | Ga0501035_0024716 | 3300049822 | Bacteria | 5507 |
| 1503 | Ga0501044_0484661 | 3300049823 | Bacteria | 1139 |
| 1504 | nmdc:mga0k408_690643_c1 | 3300050493 | Bacteria | 598 |
| 1505 | nmdc:mga05p37_1300868_c1 | 3300050507 | Bacteria | 741 |
| 1506 | nmdc:mga05p37_2069381_c1 | 3300050507 | Bacteria | 535 |
| 1507 | nmdc:mga06r32_1483801_c1 | 3300050510 | Unclassified | 618 |
| 1508 | nmdc:mga08y16_1491405_c1 | 3300050511 | Bacteria | 637 |
| 1509 | nmdc:mga0n895_143557_c1 | 3300050512 | Bacteria | 2416 |
| 1510 | nmdc:mga0n895_148088_c1 | 3300050512 | Bacteria | 2377 |
| 1511 | nmdc:mga0rr50_46757_c1 | 3300050513 | Bacteria | 3187 |
| 1512 | nmdc:mga0a205_241953_c1 | 3300050515 | Bacteria | 1685 |
| 1513 | Ga0587070_108964 | 3300059491 | Bacteria | 648 |
| 1514 | Ga0587083_0063905 | 3300059505 | Bacteria | 837 |
| 1515 | Ga0587088_084515 | 3300059508 | Bacteria | 685 |
| 1516 | Ga0587091_144887 | 3300059511 | Bacteria | 598 |
| 1517 | Ga0587098_051426 | 3300059604 | Bacteria | 626 |
| 1518 | Ga0587101_092632 | 3300059623 | Bacteria | 590 |
| 1519 | Ga0587079_051086 | 3300059647 | Bacteria | 868 |
| 1520 | Ga0501082_0631383 | 3300060353 | Bacteria | 937 |
| 1521 | Ga0466962_0090693 | 3300061719 | Bacteria | 1464 |
| 1522 | Ga0466962_0099875 | 3300061719 | Bacteria | 1393 |
| 1523 | Ga0466962_0119251 | 3300061719 | Bacteria | 1272 |
| 1524 | 2643790940 | 2643221554 | Bacteria | 6603920 |
| 1525 | 2644214932 | 2643221638 | Bacteria | 6579467 |
| 1526 | 2644249437 | 2643221645 | Bacteria | 7207331 |
| 1527 | 2738740854 | 2738541280 | Bacteria | 6630198 |
| 1528 | 2738825740 | 2738541297 | Bacteria | 6549566 |
| 1529 | 2738845175 | 2738541300 | Bacteria | 6675882 |
| 1530 | 2739149537 | 2738541357 | Bacteria | 6549408 |
| 1531 | 2739191456 | 2738543003 | Bacteria | 6549560 |
| 1532 | 2739274770 | 2738543018 | Bacteria | 6718814 |
| 1533 | 2739317933 | 2738543026 | Bacteria | 6549408 |
| 1534 | 2739336174 | 2738543029 | Bacteria | 6549249 |
| 1535 | 2739343814 | 2738543030 | Bacteria | 6719714 |
| 1536 | 2842713761 | 2842711865 | Bacteria | 7155354 |
| 1537 | 2857554895 | 2857553236 | Bacteria | 6166726 |
| 1538 | 2857562271 | 2857558681 | Bacteria | 6617694 |
| 1539 | 2919479016 | 2919476304 | Bacteria | 5888696 |
| 1540 | Ga0070668_100330904 | |||
| 1541 | JGI25159J45721_1002873 | |||
| 1542 | JGI25153J46596_10009071 | |||
| 1543 | rootL2_10086410 | |||
| 1544 | Ga0055525_1000009 | |||
| 1545 | Ga0055542_1016302 | |||
| 1546 | Ga0055526_1000856 | |||
| 1547 | Ga0055526_1003371 | |||
| 1548 | Ga0055537_1000496 | |||
| 1549 | Ga0055524_1000027 | |||
| 1550 | Ga0055524_1015123 | |||
| 1551 | Ga0055534_1000583 | |||
| 1552 | Ga0055528_1000686 | |||
| 1553 | Ga0055543_1002543 | |||
| 1554 | Ga0065165_1000298 | |||
| 1555 | Ga0065165_1002921 | |||
| 1556 | Ga0065165_1019195 | |||
| 1557 | Ga0065715_10286429 | |||
| 1558 | Ga0065715_10489296 | |||
| 1559 | Ga0070658_10022463 | |||
| 1560 | Ga0070658_10971624 | |||
| 1561 | Ga0070658_11119261 | |||
| 1562 | Ga0070676_10007021 | |||
| 1563 | Ga0070676_10075272 | |||
| 1564 | Ga0070676_10927898 | |||
| 1565 | Ga0070683_102088025 | |||
| 1566 | Ga0070690_100254242 | |||
| 1567 | Ga0070670_100044483 | |||
| 1568 | Ga0070670_100109526 | |||
| 1569 | Ga0070670_100238035 | |||
| 1570 | Ga0070670_100267604 | |||
| 1571 | Ga0070670_100324184 | |||
| 1572 | Ga0070670_100708172 | |||
| 1573 | Ga0070677_10000892 | |||
| 1574 | Ga0070677_10059181 | |||
| 1575 | Ga0070677_10223564 | |||
| 1576 | Ga0068869_100011201 | |||
| 1577 | Ga0068869_100873363 | |||
| 1578 | Ga0068869_101547310 | |||
| 1579 | Ga0068869_101618602 | |||
| 1580 | Ga0070666_10004003 | |||
| 1581 | Ga0070666_10010423 | |||
| 1582 | Ga0070666_10414163 | |||
| 1583 | Ga0070666_10534339 | |||
| 1584 | Ga0070680_100246895 | |||
| 1585 | Ga0070680_100636766 | |||
| 1586 | Ga0070680_100738020 | |||
| 1587 | Ga0070680_100987645 | |||
| 1588 | Ga0070680_101151835 | |||
| 1589 | Ga0070680_101573786 | |||
| 1590 | Ga0070682_100310125 | |||
| 1591 | Ga0068868_100103841 | |||
| 1592 | Ga0068868_100590742 | |||
| 1593 | Ga0068868_100855323 | |||
| 1594 | Ga0068868_101284117 | |||
| 1595 | Ga0068868_101379636 | |||
| 1596 | Ga0068868_101617968 | |||
| 1597 | Ga0070660_100093006 | |||
| 1598 | Ga0070660_100202965 | |||
| 1599 | Ga0070660_100469114 | |||
| 1600 | Ga0070660_100727981 | |||
| 1601 | Ga0070660_100762662 | |||
| 1602 | Ga0070660_101293982 | |||
| 1603 | Ga0070689_100528275 | |||
| 1604 | Ga0070689_100641913 | |||
| 1605 | Ga0070689_100749064 | |||
| 1606 | Ga0070691_10791207 | |||
| 1607 | Ga0070661_100006065 | |||
| 1608 | Ga0070661_100012593 | |||
| 1609 | Ga0070661_100104081 | |||
| 1610 | Ga0070661_100381808 | |||
| 1611 | Ga0070661_100429083 | |||
| 1612 | Ga0070661_100446000 | |||
| 1613 | Ga0070661_100485472 | |||
| 1614 | Ga0070661_100670826 | |||
| 1615 | Ga0070661_100682501 | |||
| 1616 | Ga0070661_100996533 | |||
| 1617 | Ga0070668_100004304 | |||
| 1618 | Ga0070668_100038060 | |||
| 1619 | Ga0070668_100046330 | |||
| 1620 | Ga0070668_100064293 | |||
| 1621 | Ga0070668_100248915 | |||
| 1622 | Ga0070668_100768448 | |||
| 1623 | Ga0070668_101783836 | |||
| 1624 | Ga0070669_100598822 | |||
| 1625 | Ga0070669_100689262 | |||
| 1626 | Ga0070675_100012175 | |||
| 1627 | Ga0070675_100023439 | |||
| 1628 | Ga0070675_100203050 | |||
| 1629 | Ga0070675_100220892 | |||
| 1630 | Ga0070675_100447531 | |||
| 1631 | Ga0070675_101455532 | |||
| 1632 | Ga0070675_102098177 | |||
| 1633 | Ga0070671_100024028 | |||
| 1634 | Ga0070671_100046161 | |||
| 1635 | Ga0070671_100127720 | |||
| 1636 | Ga0070671_100433137 | |||
| 1637 | Ga0070671_100448569 | |||
| 1638 | Ga0070671_100748475 | |||
| 1639 | Ga0070674_100012729 | |||
| 1640 | Ga0070674_100022171 | |||
| 1641 | Ga0070674_100306077 | |||
| 1642 | Ga0070674_100435854 | |||
| 1643 | Ga0070674_101035637 | |||
| 1644 | Ga0070673_100013874 | |||
| 1645 | Ga0070673_100043093 | |||
| 1646 | Ga0070673_100835315 | |||
| 1647 | Ga0070673_100991953 | |||
| 1648 | Ga0070673_101025308 | |||
| 1649 | Ga0070673_101281300 | |||
| 1650 | Ga0070688_101573172 | |||
| 1651 | Ga0070659_100156241 | |||
| 1652 | Ga0070659_100241602 | |||
| 1653 | Ga0070659_100286746 | |||
| 1654 | Ga0070659_100600687 | |||
| 1655 | Ga0070667_100035038 | |||
| 1656 | Ga0070667_100045561 | |||
| 1657 | Ga0070667_100075567 | |||
| 1658 | Ga0070667_100175495 | |||
| 1659 | Ga0070667_101376825 | |||
| 1660 | Ga0070713_100000059 | |||
| 1661 | Ga0070710_10097756 | |||
| 1662 | Ga0070711_102033469 | |||
| 1663 | Ga0070705_100055248 | |||
| 1664 | Ga0070705_101059937 | |||
| 1665 | Ga0070700_100205951 | |||
| 1666 | Ga0070700_100727733 | |||
| 1667 | Ga0070694_101667444 | |||
| 1668 | Ga0070708_100000133 | |||
| 1669 | Ga0070663_100042161 | |||
| 1670 | Ga0070663_100081595 | |||
| 1671 | Ga0070663_100860423 | |||
| 1672 | Ga0070663_101036835 | |||
| 1673 | Ga0070663_101727721 | |||
| 1674 | Ga0070663_101952830 | |||
| 1675 | Ga0070678_100031126 | |||
| 1676 | Ga0070678_100270566 | |||
| 1677 | Ga0070678_100805880 | |||
| 1678 | Ga0070678_101130463 | |||
| 1679 | Ga0070678_101780228 | |||
| 1680 | Ga0070662_100432303 | |||
| 1681 | Ga0070662_100599106 | |||
| 1682 | Ga0070662_100635485 | |||
| 1683 | Ga0070662_101625691 | |||
| 1684 | Ga0070681_10000732 | |||
| 1685 | Ga0070681_10946289 | |||
| 1686 | Ga0068867_100023621 | |||
| 1687 | Ga0068867_100034889 | |||
| 1688 | Ga0068867_100708853 | |||
| 1689 | Ga0070685_11234918 | |||
| 1690 | Ga0070706_100081572 | |||
| 1691 | Ga0070707_100443909 | |||
| 1692 | Ga0070699_100337949 | |||
| 1693 | Ga0070679_100027165 | |||
| 1694 | Ga0070679_100338526 | |||
| 1695 | Ga0070679_101430793 | |||
| 1696 | Ga0070679_101761304 | |||
| 1697 | Ga0070679_101889359 | |||
| 1698 | Ga0070684_102052625 | |||
| 1699 | Ga0068853_100073590 | |||
| 1700 | Ga0068853_100081768 | |||
| 1701 | Ga0068853_100200958 | |||
| 1702 | Ga0068853_101666327 | |||
| 1703 | Ga0070672_100094012 | |||
| 1704 | Ga0070672_100154830 | |||
| 1705 | Ga0070672_100176359 | |||
| 1706 | Ga0070672_100237141 | |||
| 1707 | Ga0070672_100282391 | |||
| 1708 | Ga0070672_100514251 | |||
| 1709 | Ga0070672_101060861 | |||
| 1710 | Ga0070672_101950935 | |||
| 1711 | Ga0070665_100011044 | |||
| 1712 | Ga0070665_100090569 | |||
| 1713 | Ga0070665_100142966 | |||
| 1714 | Ga0070665_100342103 | |||
| 1715 | Ga0070665_100476678 | |||
| 1716 | Ga0070665_101263292 | |||
| 1717 | Ga0070665_101622153 | |||
| 1718 | Ga0070704_100676588 | |||
| 1719 | Ga0070704_101990410 | |||
| 1720 | Ga0068855_100050961 | |||
| 1721 | Ga0068855_100382107 | |||
| 1722 | Ga0068855_100418756 | |||
| 1723 | Ga0068855_100661580 | |||
| 1724 | Ga0068855_100946816 | |||
| 1725 | Ga0070664_100005997 | |||
| 1726 | Ga0070664_100173534 | |||
| 1727 | Ga0070664_100258184 | |||
| 1728 | Ga0070664_100317296 | |||
| 1729 | Ga0070664_100380118 | |||
| 1730 | Ga0070664_100483507 | |||
| 1731 | Ga0070664_100534169 | |||
| 1732 | Ga0070664_101042049 | |||
| 1733 | Ga0070664_101801496 | |||
| 1734 | Ga0068857_100274151 | |||
| 1735 | Ga0068857_100380950 | |||
| 1736 | Ga0068857_100726651 | |||
| 1737 | Ga0068857_101067587 | |||
| 1738 | Ga0068857_101318552 | |||
| 1739 | Ga0068854_100080480 | |||
| 1740 | Ga0068854_100223809 | |||
| 1741 | Ga0068854_100402196 | |||
| 1742 | Ga0068856_100024938 | |||
| 1743 | Ga0068856_101489452 | |||
| 1744 | Ga0068856_101757956 | |||
| 1745 | Ga0068852_100016562 | |||
| 1746 | Ga0068852_100126901 | |||
| 1747 | Ga0068852_100206082 | |||
| 1748 | Ga0068852_100547845 | |||
| 1749 | Ga0068852_101720545 | |||
| 1750 | Ga0068852_102166693 | |||
| 1751 | Ga0068859_100034422 | |||
| 1752 | Ga0068859_100572538 | |||
| 1753 | Ga0068859_102269884 | |||
| 1754 | Ga0068859_102309756 | |||
| 1755 | Ga0068859_102748906 | |||
| 1756 | Ga0068859_102825347 | |||
| 1757 | Ga0068864_100025549 | |||
| 1758 | Ga0068864_100045559 | |||
| 1759 | Ga0068864_100380281 | |||
| 1760 | Ga0068864_100882262 | |||
| 1761 | Ga0068864_101720323 | |||
| 1762 | Ga0068866_10355485 | |||
| 1763 | Ga0068861_100008821 | |||
| 1764 | Ga0068861_100039895 | |||
| 1765 | Ga0068861_100236576 | |||
| 1766 | Ga0068861_100390749 | |||
| 1767 | Ga0068861_101332348 | |||
| 1768 | Ga0068861_101474782 | |||
| 1769 | Ga0068851_10003475 | |||
| 1770 | Ga0068851_10008417 | |||
| 1771 | Ga0068851_10058716 | |||
| 1772 | Ga0068851_10102704 | |||
| 1773 | Ga0068851_10175940 | |||
| 1774 | Ga0068870_10121168 | |||
| 1775 | Ga0068870_10215621 | |||
| 1776 | Ga0068863_100032414 | |||
| 1777 | Ga0068863_100065636 | |||
| 1778 | Ga0068863_100152835 | |||
| 1779 | Ga0068863_100244169 | |||
| 1780 | Ga0068863_101474403 | |||
| 1781 | Ga0068858_100016937 | |||
| 1782 | Ga0068858_100049107 | |||
| 1783 | Ga0068858_100396380 | |||
| 1784 | Ga0068858_100511682 | |||
| 1785 | Ga0068858_100531518 | |||
| 1786 | Ga0068860_100035988 | |||
| 1787 | Ga0068860_100129695 | |||
| 1788 | Ga0068860_100152816 | |||
| 1789 | Ga0068860_100231923 | |||
| 1790 | Ga0068860_100818437 | |||
| 1791 | Ga0068860_102001362 | |||
| 1792 | Ga0068862_100053978 | |||
| 1793 | Ga0068862_100192017 | |||
| 1794 | Ga0068862_101288240 | |||
| 1795 | Ga0068862_101567735 | |||
| 1796 | Ga0081539_10076122 | |||
| 1797 | Ga0097621_100113760 | |||
| 1798 | Ga0097621_100204644 | |||
| 1799 | Ga0097621_101158512 | |||
| 1800 | Ga0097621_102284412 | |||
| 1801 | Ga0068871_100003539 | |||
| 1802 | Ga0068871_100062575 | |||
| 1803 | Ga0068871_101440378 | |||
| 1804 | Ga0075428_100385438 | |||
| 1805 | Ga0075428_101664963 | |||
| 1806 | Ga0075430_100785270 | |||
| 1807 | Ga0075431_100580711 | |||
| 1808 | Ga0075434_100079491 | |||
| 1809 | Ga0075434_100295497 | |||
| 1810 | Ga0068865_100063942 | |||
| 1811 | Ga0068865_100105285 | |||
| 1812 | Ga0068865_100151128 | |||
| 1813 | Ga0068865_100184960 | |||
| 1814 | Ga0097620_100034419 | |||
| 1815 | Ga0097620_100572465 | |||
| 1816 | Ga0097620_102269903 | |||
| 1817 | Ga0097620_102310119 | |||
| 1818 | Ga0097620_102748872 | |||
| 1819 | Ga0097620_102825148 | |||
| 1820 | Ga0079104_1011335 | |||
| 1821 | Ga0099826_10000003 | |||
| 1822 | Ga0105251_10067213 | |||
| 1823 | Ga0105244_10046293 | |||
| 1824 | Ga0105244_10328141 | |||
| 1825 | Ga0105240_10457373 | |||
| 1826 | Ga0111539_11515077 | |||
| 1827 | Ga0105245_11785741 | |||
| 1828 | Ga0105247_10015325 | |||
| 1829 | Ga0105247_10830563 | |||
| 1830 | Ga0114129_10238463 | |||
| 1831 | Ga0114129_10612786 | |||
| 1832 | Ga0105243_10125495 | |||
| 1833 | Ga0105243_10713487 | |||
| 1834 | Ga0105243_11123056 | |||
| 1835 | Ga0105243_11558536 | |||
| 1836 | Ga0105241_10033689 | |||
| 1837 | Ga0105241_10079364 | |||
| 1838 | Ga0105241_11123245 | |||
| 1839 | Ga0105241_11249007 | |||
| 1840 | Ga0105242_10031663 | |||
| 1841 | Ga0105248_10018374 | |||
| 1842 | Ga0105248_10230519 | |||
| 1843 | Ga0105248_10349308 | |||
| 1844 | Ga0105248_10537816 | |||
| 1845 | Ga0105248_11255955 | |||
| 1846 | Ga0105248_12219715 | |||
| 1847 | Ga0105248_12572172 | |||
| 1848 | Ga0105237_10048709 | |||
| 1849 | Ga0105238_10642008 | |||
| 1850 | Ga0105238_11668142 | |||
| 1851 | Ga0105238_12506712 | |||
| 1852 | Ga0105249_10057399 | |||
| 1853 | Ga0105239_11133507 | |||
| 1854 | Ga0105246_12018409 | |||
| 1855 | Ga0157373_10006600 | |||
| 1856 | Ga0157373_10045628 | |||
| 1857 | Ga0157373_11169062 | |||
| 1858 | Ga0157371_10000399 | |||
| 1859 | Ga0157371_10370695 | |||
| 1860 | Ga0157371_10535771 | |||
| 1861 | Ga0157371_11286349 | |||
| 1862 | Ga0157370_10098882 | |||
| 1863 | Ga0157370_10705462 | |||
| 1864 | Ga0157370_10837359 | |||
| 1865 | Ga0157369_10808246 | |||
| 1866 | Ga0157369_10868506 | |||
| 1867 | Ga0157369_11084540 | |||
| 1868 | Ga0157374_10168397 | |||
| 1869 | Ga0157374_10337908 | |||
| 1870 | Ga0157374_10422569 | |||
| 1871 | Ga0157374_11355355 | |||
| 1872 | Ga0157374_11575314 | |||
| 1873 | Ga0157378_10024227 | |||
| 1874 | Ga0157378_10182581 | |||
| 1875 | Ga0157378_10437287 | |||
| 1876 | Ga0157378_11327644 | |||
| 1877 | Ga0157378_11729837 | |||
| 1878 | Ga0163162_10068518 | |||
| 1879 | Ga0163162_10225298 | |||
| 1880 | Ga0163162_10745223 | |||
| 1881 | Ga0163162_11534257 | |||
| 1882 | Ga0163162_12879765 | |||
| 1883 | Ga0157372_10010615 | |||
| 1884 | Ga0157372_10222379 | |||
| 1885 | Ga0157372_10268210 | |||
| 1886 | Ga0157372_10334231 | |||
| 1887 | Ga0157372_10798005 | |||
| 1888 | Ga0157372_10838602 | |||
| 1889 | Ga0157372_12067318 | |||
| 1890 | Ga0157372_12439620 | |||
| 1891 | Ga0157372_12773552 | |||
| 1892 | Ga0157375_10213714 | |||
| 1893 | Ga0157375_10489177 | |||
| 1894 | Ga0157375_10549912 | |||
| 1895 | Ga0157375_10726496 | |||
| 1896 | Ga0157375_10742023 | |||
| 1897 | Ga0157375_11050558 | |||
| 1898 | Ga0163163_10059545 | |||
| 1899 | Ga0163163_10193532 | |||
| 1900 | Ga0163163_10214218 | |||
| 1901 | Ga0163163_12014976 | |||
| 1902 | Ga0163163_12826689 | |||
| 1903 | Ga0157380_10717171 | |||
| 1904 | Ga0157380_10753047 | |||
| 1905 | Ga0157380_12834519 | |||
| 1906 | Ga0182008_10171922 | |||
| 1907 | Ga0182008_10634246 | |||
| 1908 | Ga0182008_10694490 | |||
| 1909 | Ga0157377_10869744 | |||
| 1910 | Ga0157379_10004686 | |||
| 1911 | Ga0157379_10113285 | |||
| 1912 | Ga0157376_10064276 | |||
| 1913 | Ga0157376_10344263 | |||
| 1914 | Ga0157376_11633773 | |||
| 1915 | Ga0182006_1000055 | |||
| 1916 | Ga0182006_1022308 | |||
| 1917 | Ga0182007_10049382 | |||
| 1918 | Ga0182007_10198265 | |||
| 1919 | Ga0182005_1000003 | |||
| 1920 | Ga0163161_10081332 | |||
| 1921 | Ga0163161_10853066 | |||
| 1922 | Ga0163161_11010145 | |||
| 1923 | Ga0213872_10266511 | |||
| 1924 | Ga0224712_10693215 | |||
| 1925 | Ga0209436_109615 | |||
| 1926 | Ga0209563_100015 | |||
| 1927 | Ga0207425_1001644 | |||
| 1928 | Ga0209026_1016232 | |||
| 1929 | Ga0209677_107904 | |||
| 1930 | Ga0209148_1000272 | |||
| 1931 | Ga0209565_1000006 | |||
| 1932 | Ga0209565_1024423 | |||
| 1933 | Ga0209565_1042407 | |||
| 1934 | Ga0209673_1000004 | |||
| 1935 | Ga0209130_1000067 | |||
| 1936 | Ga0209675_1000006 | |||
| 1937 | Ga0209025_1006507 | |||
| 1938 | Ga0209564_1000026 | |||
| 1939 | Ga0209564_1000102 | |||
| 1940 | Ga0209758_1000314 | |||
| 1941 | Ga0209256_1000013 | |||
| 1942 | Ga0209256_1000037 | |||
| 1943 | Ga0207697_10098252 | |||
| 1944 | Ga0207656_10021063 | |||
| 1945 | Ga0207656_10107968 | |||
| 1946 | Ga0207656_10411906 | |||
| 1947 | Ga0207696_1175319 | |||
| 1948 | Ga0207713_1209093 | |||
| 1949 | Ga0207682_10001543 | |||
| 1950 | Ga0207682_10088790 | |||
| 1951 | Ga0207682_10116098 | |||
| 1952 | Ga0207692_10203011 | |||
| 1953 | Ga0207710_10032167 | |||
| 1954 | Ga0207688_10315124 | |||
| 1955 | Ga0207688_10370002 | |||
| 1956 | Ga0207680_10129237 | |||
| 1957 | Ga0207680_10260380 | |||
| 1958 | Ga0207680_10262336 | |||
| 1959 | Ga0207680_10490789 | |||
| 1960 | Ga0207680_10507510 | |||
| 1961 | Ga0207680_11114922 | |||
| 1962 | Ga0207645_10000368 | |||
| 1963 | Ga0207645_10029705 | |||
| 1964 | Ga0207645_10038810 | |||
| 1965 | Ga0207643_10019972 | |||
| 1966 | Ga0207643_10040959 | |||
| 1967 | Ga0207705_10003612 | |||
| 1968 | Ga0207705_10219637 | |||
| 1969 | Ga0207705_10625432 | |||
| 1970 | Ga0207705_10797712 | |||
| 1971 | Ga0207705_10833828 | |||
| 1972 | Ga0207705_10854721 | |||
| 1973 | Ga0207684_10068001 | |||
| 1974 | Ga0207654_10013588 | |||
| 1975 | Ga0207654_10644104 | |||
| 1976 | Ga0207707_10012370 | |||
| 1977 | Ga0207707_11183761 | |||
| 1978 | Ga0207695_10618639 | |||
| 1979 | Ga0207671_10103323 | |||
| 1980 | Ga0207693_10276442 | |||
| 1981 | Ga0207663_11619838 | |||
| 1982 | Ga0207660_10187555 | |||
| 1983 | Ga0207660_10402231 | |||
| 1984 | Ga0207660_10749542 | |||
| 1985 | Ga0207660_11340601 | |||
| 1986 | Ga0207662_11373708 | |||
| 1987 | Ga0207657_10065714 | |||
| 1988 | Ga0207657_10144069 | |||
| 1989 | Ga0207657_10366664 | |||
| 1990 | Ga0207657_11135535 | |||
| 1991 | Ga0207649_10001571 | |||
| 1992 | Ga0207649_10097664 | |||
| 1993 | Ga0207649_10207781 | |||
| 1994 | Ga0207649_10535415 | |||
| 1995 | Ga0207649_11597826 | |||
| 1996 | Ga0207652_10005028 | |||
| 1997 | Ga0207652_10120365 | |||
| 1998 | Ga0207652_10459034 | |||
| 1999 | Ga0207652_11433260 | |||
| 2000 | Ga0207646_10441645 | |||
| 2001 | Ga0207681_10128874 | |||
| 2002 | Ga0207681_10185637 | |||
| 2003 | Ga0207650_10006340 | |||
| 2004 | Ga0207650_10149150 | |||
| 2005 | Ga0207650_10214992 | |||
| 2006 | Ga0207650_10301466 | |||
| 2007 | Ga0207650_10539728 | |||
| 2008 | Ga0207650_10675039 | |||
| 2009 | Ga0207659_10064240 | |||
| 2010 | Ga0207659_10553718 | |||
| 2011 | Ga0207659_11138108 | |||
| 2012 | Ga0207659_11353513 | |||
| 2013 | Ga0207659_11353677 | |||
| 2014 | Ga0207687_10353201 | |||
| 2015 | Ga0207644_10029990 | |||
| 2016 | Ga0207644_10073521 | |||
| 2017 | Ga0207644_10103113 | |||
| 2018 | Ga0207644_10191598 | |||
| 2019 | Ga0207644_10396446 | |||
| 2020 | Ga0207644_10422742 | |||
| 2021 | Ga0207690_10157164 | |||
| 2022 | Ga0207690_10293463 | |||
| 2023 | Ga0207690_10509945 | |||
| 2024 | Ga0207690_11527119 | |||
| 2025 | Ga0207706_10063812 | |||
| 2026 | Ga0207706_10457026 | |||
| 2027 | Ga0207706_10554159 | |||
| 2028 | Ga0207706_10615781 | |||
| 2029 | Ga0207706_11671023 | |||
| 2030 | Ga0207686_10001803 | |||
| 2031 | Ga0207686_11767895 | |||
| 2032 | Ga0207709_10082951 | |||
| 2033 | Ga0207709_10532319 | |||
| 2034 | Ga0207709_10724088 | |||
| 2035 | Ga0207670_10271353 | |||
| 2036 | Ga0207670_10500182 | |||
| 2037 | Ga0207670_11090899 | |||
| 2038 | Ga0207669_10017906 | |||
| 2039 | Ga0207669_10026360 | |||
| 2040 | Ga0207669_10101094 | |||
| 2041 | Ga0207669_10460658 | |||
| 2042 | Ga0207704_10185449 | |||
| 2043 | Ga0207704_10320033 | |||
| 2044 | Ga0207704_10529692 | |||
| 2045 | Ga0207704_10651686 | |||
| 2046 | Ga0207691_10006372 | |||
| 2047 | Ga0207691_10012848 | |||
| 2048 | Ga0207691_10119991 | |||
| 2049 | Ga0207691_11013169 | |||
| 2050 | Ga0207711_10020304 | |||
| 2051 | Ga0207711_10341617 | |||
| 2052 | Ga0207711_11236495 | |||
| 2053 | Ga0207711_11401504 | |||
| 2054 | Ga0207689_10005836 | |||
| 2055 | Ga0207689_11099388 | |||
| 2056 | Ga0207661_10492556 | |||
| 2057 | Ga0207661_11525248 | |||
| 2058 | Ga0207679_10030854 | |||
| 2059 | Ga0207679_10091484 | |||
| 2060 | Ga0207679_10163139 | |||
| 2061 | Ga0207679_10233950 | |||
| 2062 | Ga0207679_10361540 | |||
| 2063 | Ga0207679_10970334 | |||
| 2064 | Ga0207679_11384313 | |||
| 2065 | Ga0207679_11853047 | |||
| 2066 | Ga0207667_10030564 | |||
| 2067 | Ga0207667_10151829 | |||
| 2068 | Ga0207667_10263976 | |||
| 2069 | Ga0207667_10552718 | |||
| 2070 | Ga0207667_11820104 | |||
| 2071 | Ga0207651_10023058 | |||
| 2072 | Ga0207651_10051601 | |||
| 2073 | Ga0207651_10120286 | |||
| 2074 | Ga0207651_10348725 | |||
| 2075 | Ga0207651_10703746 | |||
| 2076 | Ga0207651_10844961 | |||
| 2077 | Ga0207651_11521131 | |||
| 2078 | Ga0207712_10397044 | |||
| 2079 | Ga0207668_10022709 | |||
| 2080 | Ga0207668_10067696 | |||
| 2081 | Ga0207668_10129019 | |||
| 2082 | Ga0207668_10176179 | |||
| 2083 | Ga0207668_10209871 | |||
| 2084 | Ga0207668_10223605 | |||
| 2085 | Ga0207668_10621981 | |||
| 2086 | Ga0207668_12073607 | |||
| 2087 | Ga0207640_10082781 | |||
| 2088 | Ga0207640_10094501 | |||
| 2089 | Ga0207640_10110565 | |||
| 2090 | Ga0207640_10699991 | |||
| 2091 | Ga0207640_11263544 | |||
| 2092 | Ga0207658_10019638 | |||
| 2093 | Ga0207658_10022338 | |||
| 2094 | Ga0207658_10060980 | |||
| 2095 | Ga0207658_10082890 | |||
| 2096 | Ga0207658_10433285 | |||
| 2097 | Ga0207658_10831241 | |||
| 2098 | Ga0207658_11001033 | |||
| 2099 | Ga0207658_11962576 | |||
| 2100 | Ga0207677_10088942 | |||
| 2101 | Ga0207677_11192209 | |||
| 2102 | Ga0207677_11224537 | |||
| 2103 | Ga0207703_10014225 | |||
| 2104 | Ga0207703_10036826 | |||
| 2105 | Ga0207703_10282736 | |||
| 2106 | Ga0207703_10440708 | |||
| 2107 | Ga0207703_10601445 | |||
| 2108 | Ga0207703_10859204 | |||
| 2109 | Ga0207639_10039565 | |||
| 2110 | Ga0207639_10425974 | |||
| 2111 | Ga0207678_10077076 | |||
| 2112 | Ga0207678_10081513 | |||
| 2113 | Ga0207678_10264948 | |||
| 2114 | Ga0207678_10292521 | |||
| 2115 | Ga0207678_11561065 | |||
| 2116 | Ga0207708_10261482 | |||
| 2117 | Ga0207702_10197665 | |||
| 2118 | Ga0207702_11504987 | |||
| 2119 | Ga0207702_11988689 | |||
| 2120 | Ga0207641_10219619 | |||
| 2121 | Ga0207641_10347622 | |||
| 2122 | Ga0207641_10411492 | |||
| 2123 | Ga0207641_11638720 | |||
| 2124 | Ga0207648_10003902 | |||
| 2125 | Ga0207648_10024219 | |||
| 2126 | Ga0207648_10034231 | |||
| 2127 | Ga0207648_10172541 | |||
| 2128 | Ga0207648_10477723 | |||
| 2129 | Ga0207648_10849287 | |||
| 2130 | Ga0207648_10864382 | |||
| 2131 | Ga0207676_10066601 | |||
| 2132 | Ga0207676_10296095 | |||
| 2133 | Ga0207676_11037557 | |||
| 2134 | Ga0207674_10039264 | |||
| 2135 | Ga0207674_10829827 | |||
| 2136 | Ga0207674_11846118 | |||
| 2137 | Ga0207675_100015978 | |||
| 2138 | Ga0207675_100111715 | |||
| 2139 | Ga0207675_100132289 | |||
| 2140 | Ga0207675_100153753 | |||
| 2141 | Ga0207675_101681530 | |||
| 2142 | Ga0207683_10000133 | |||
| 2143 | Ga0207683_10006603 | |||
| 2144 | Ga0207683_10124932 | |||
| 2145 | Ga0207683_10770050 | |||
| 2146 | Ga0207683_11016479 | |||
| 2147 | Ga0207698_10016189 | |||
| 2148 | Ga0207698_10121705 | |||
| 2149 | Ga0207698_10151986 | |||
| 2150 | Ga0207698_10220574 | |||
| 2151 | Ga0207698_11771343 | |||
| 2152 | Ga0207698_11886918 | |||
| 2153 | Ga0209281_1009550 | |||
| 2154 | Ga0209281_1029163 | |||
| 2155 | Ga0209995_1020790 | |||
| 2156 | Ga0209982_1007086 | |||
| 2157 | Ga0209970_1016029 | |||
| 2158 | Ga0209983_1001756 | |||
| 2159 | Ga0209282_1000002 | |||
| 2160 | Ga0209971_1041737 | |||
| 2161 | Ga0209974_10003884 | |||
| 2162 | Ga0268266_10005854 | |||
| 2163 | Ga0268266_10045453 | |||
| 2164 | Ga0268266_10399109 | |||
| 2165 | Ga0268266_10518022 | |||
| 2166 | Ga0268266_10522635 | |||
| 2167 | Ga0268266_10832539 | |||
| 2168 | Ga0268266_11118884 | |||
| 2169 | Ga0268266_11211901 | |||
| 2170 | Ga0268266_11711516 | |||
| 2171 | Ga0268265_10025981 | |||
| 2172 | Ga0268265_10051917 | |||
| 2173 | Ga0268265_11607699 | |||
| 2174 | Ga0268265_12151680 | |||
| 2175 | Ga0268264_10013805 | |||
| 2176 | Ga0268264_10337642 | |||
| 2177 | Ga0268264_10337807 | |||
| 2178 | Ga0268264_11809884 | |||
| 2179 | Ga0314311_1058868 | |||
| 2180 | Ga0316179_1043648 | |||
| 2181 | Ga0316178_1018302 | |||
| 2182 | Ga0316178_1162240 | |||
| 2183 | Ga0316180_1182415 | |||
| 2184 | Ga0316181_1063650 | |||
| 2185 | Ga0316182_1040109 | |||
| 2186 | Ga0316182_1423195 | |||
| 2187 | Ga0307408_102018375 | |||
| 2188 | Ga0307408_102161790 | |||
| 2189 | Ga0307408_102296887 | |||
| 2190 | Ga0307508_10869251 | |||
| 2191 | Ga0307413_10348692 | |||
| 2192 | Ga0307410_10173914 | |||
| 2193 | Ga0307406_10692327 | |||
| 2194 | Ga0307412_10750418 | |||
| 2195 | Ga0307412_11957523 | |||
| 2196 | Ga0307416_100483523 | |||
| 2197 | Ga0307416_100977425 | |||
| 2198 | Ga0307416_102172070 | |||
| 2199 | Ga0307414_10032835 | |||
| 2200 | Ga0307414_11579506 | |||
| 2201 | Ga0307411_10254974 | |||
| 2202 | Ga0307411_12040825 | |||
| 2203 | Ga0373939_0037009 | |||
| 2204 | Ga0373939_0359489 | |||
| 2205 | Ga0373955_1038558 | |||
| 2206 | Ga0373962_0030329 | |||
| 2207 | Ga0373931_0039145 | |||
| 2208 | Ga0373927_0016950 | |||
| 2209 | Ga0373947_0450463 | |||
| 2210 | Ga0373937_2078343 | |||
| 2211 | Ga0373925_0077420 | |||
| 2212 | Ga0395899_0014265 | |||
| 2213 | Ga0395899_0028741 | |||
| 2214 | Ga0395899_0125689 | |||
| 2215 | Ga0395899_0138615 | |||
| 2216 | Ga0395899_0250816 | |||
| 2217 | Ga0395899_0351708 | |||
| 2218 | Ga0395899_0361322 | |||
| 2219 | Ga0395899_0361614 | |||
| 2220 | Ga0395899_0634879 | |||
| 2221 | Ga0395900_0001494 | |||
| 2222 | Ga0395900_0021829 | |||
| 2223 | Ga0395900_0047752 | |||
| 2224 | Ga0395900_0138452 | |||
| 2225 | Ga0395900_0139030 | |||
| 2226 | Ga0395900_0161730 | |||
| 2227 | Ga0395900_0288207 | |||
| 2228 | Ga0395900_0347433 | |||
| 2229 | Ga0395898_0196908 | |||
| 2230 | Ga0395898_0198622 | |||
| 2231 | Ga0395898_0212010 | |||
| 2232 | Ga0395898_0453878 | |||
| 2233 | Ga0395898_1063544 | |||
| 2234 | Ga0395898_1162943 | |||
| 2235 | Ga0395898_1822184 | |||
| 2236 | Ga0395898_1987891 | |||
| 2237 | Ga0395905_0198403 | |||
| 2238 | Ga0395905_0256158 | |||
| 2239 | Ga0395905_0304423 | |||
| 2240 | Ga0395905_0407115 | |||
| 2241 | Ga0395905_0542878 | |||
| 2242 | Ga0395901_0000307 | |||
| 2243 | Ga0395901_0113663 | |||
| 2244 | Ga0395901_0126863 | |||
| 2245 | Ga0395901_0209180 | |||
| 2246 | Ga0395901_0270454 | |||
| 2247 | Ga0395901_0350961 | |||
| 2248 | Ga0395901_0757520 | |||
| 2249 | Ga0436361_0594176 | |||
| 2250 | Ga0436361_0604351 | |||
| 2251 | Ga0436361_0715458 | |||
| 2252 | Ga0439439_0109738 | |||
| 2253 | Ga0439465_0087983 | |||
| 2254 | Ga0451835_0902887 | |||
| 2255 | Ga0451839_0120065 | |||
| 2256 | Ga0451843_0217578 | |||
| 2257 | Ga0451853_3236455 | |||
| 2258 | Ga0439433_0050697 | |||
| 2259 | Ga0439448_0011757 | |||
| 2260 | Ga0439448_0013577 | |||
| 2261 | Ga0439448_0133979 | |||
| 2262 | Ga0439449_0004853 | |||
| 2263 | Ga0439454_079792 | |||
| 2264 | Ga0439455_0059997 | |||
| 2265 | Ga0439458_0056572 | |||
| 2266 | Ga0439458_0064848 | |||
| 2267 | Ga0439458_0142327 | |||
| 2268 | Ga0466969_0040955 | |||
| 2269 | Ga0466969_0083497 | |||
| 2270 | Ga0466969_0208581 | |||
| 2271 | Ga0466969_0247245 | |||
| 2272 | Ga0466972_0050496 | |||
| 2273 | Ga0466972_0187318 | |||
| 2274 | Ga0466972_0302413 | |||
| 2275 | Ga0466981_0488731 | |||
| 2276 | Ga0466982_0538337 | |||
| 2277 | Ga0466965_0009825 | |||
| 2278 | Ga0466965_0026965 | |||
| 2279 | Ga0466965_0050771 | |||
| 2280 | Ga0466965_0224624 | |||
| 2281 | Ga0466965_0252364 | |||
| 2282 | Ga0466965_0855735 | |||
| 2283 | Ga0466966_0012240 | |||
| 2284 | Ga0466966_0078906 | |||
| 2285 | Ga0466966_0210961 | |||
| 2286 | Ga0466966_0353044 | |||
| 2287 | Ga0466961_0083269 | |||
| 2288 | Ga0466961_0319201 | |||
| 2289 | Ga0466961_0680748 | |||
| 2290 | Ga0466963_0059622 | |||
| 2291 | Ga0466963_0409524 | |||
| 2292 | Ga0466963_0418318 | |||
| 2293 | Ga0466963_0666384 | |||
| 2294 | Ga0466963_1147463 | |||
| 2295 | Ga0466964_0000552 | |||
| 2296 | Ga0466964_0033680 | |||
| 2297 | Ga0466964_0384223 | |||
| 2298 | Ga0466964_0455036 | |||
| 2299 | Ga0466971_0052468 | |||
| 2300 | Ga0466971_0088068 | |||
| 2301 | Ga0466968_0007533 | |||
| 2302 | Ga0466968_0250458 | |||
| 2303 | Ga0466970_0162276 | |||
| 2304 | Ga0466970_0171504 | |||
| 2305 | Ga0466970_0330396 | |||
| 2306 | Ga0466970_0340968 | |||
| 2307 | Ga0466957_0000668 | |||
| 2308 | Ga0466957_0051398 | |||
| 2309 | Ga0466957_0086804 | |||
| 2310 | Ga0466957_0110014 | |||
| 2311 | Ga0466957_0323888 | |||
| 2312 | Ga0466957_0708193 | |||
| 2313 | Ga0466960_0222389 | |||
| 2314 | Ga0466959_0043758 | |||
| 2315 | Ga0466959_0047700 | |||
| 2316 | Ga0466959_0081465 | |||
| 2317 | Ga0466959_0714228 | |||
| 2318 | Ga0466958_0046174 | |||
| 2319 | Ga0466958_0301047 | |||
| 2320 | Ga0466958_0492134 | |||
| 2321 | Ga0466967_0009493 | |||
| 2322 | Ga0466967_0031395 | |||
| 2323 | Ga0466967_0328960 | |||
| 2324 | Ga0495627_000915 | |||
| 2325 | Ga0495627_036768 | |||
| 2326 | Ga0495627_155408 | |||
| 2327 | Ga0495603_0028708 | |||
| 2328 | Ga0495603_0055836 | |||
| 2329 | Ga0495603_0315462 | |||
| 2330 | Ga0495603_0388289 | |||
| 2331 | Ga0495590_0008345 | |||
| 2332 | Ga0495590_0026698 | |||
| 2333 | Ga0495590_0032462 | |||
| 2334 | Ga0495590_0214299 | |||
| 2335 | Ga0495591_000893 | |||
| 2336 | Ga0495591_011947 | |||
| 2337 | Ga0495591_122164 | |||
| 2338 | Ga0495629_0124313 | |||
| 2339 | Ga0495629_0340118 | |||
| 2340 | Ga0495638_0033948 | |||
| 2341 | Ga0495638_0060673 | |||
| 2342 | Ga0495638_0078119 | |||
| 2343 | Ga0495638_0131803 | |||
| 2344 | Ga0495638_0168730 | |||
| 2345 | Ga0495638_0169429 | |||
| 2346 | Ga0495638_0218367 | |||
| 2347 | Ga0495638_0321762 | |||
| 2348 | Ga0495653_0028500 | |||
| 2349 | Ga0495653_0058852 | |||
| 2350 | Ga0495653_0297967 | |||
| 2351 | Ga0495650_0000391 | |||
| 2352 | Ga0495650_0001570 | |||
| 2353 | Ga0495650_0002148 | |||
| 2354 | Ga0495650_0025108 | |||
| 2355 | Ga0495650_0089685 | |||
| 2356 | Ga0495580_0009402 | |||
| 2357 | Ga0495580_0264633 | |||
| 2358 | Ga0495580_0429849 | |||
| 2359 | Ga0495582_0020418 | |||
| 2360 | Ga0495582_0051053 | |||
| 2361 | Ga0495582_0102349 | |||
| 2362 | Ga0495582_0120275 | |||
| 2363 | Ga0495605_0000005 | |||
| 2364 | Ga0495605_0000276 | |||
| 2365 | Ga0495605_0012653 | |||
| 2366 | Ga0495605_0015789 | |||
| 2367 | Ga0495605_0020432 | |||
| 2368 | Ga0495605_0038749 | |||
| 2369 | Ga0495605_0133776 | |||
| 2370 | Ga0495605_0254020 | |||
| 2371 | Ga0495639_0297710 | |||
| 2372 | Ga0495639_0316473 | |||
| 2373 | Ga0495584_0000011 | |||
| 2374 | Ga0495584_0001422 | |||
| 2375 | Ga0495584_0001472 | |||
| 2376 | Ga0495584_0005508 | |||
| 2377 | Ga0495584_0005815 | |||
| 2378 | Ga0495584_0005912 | |||
| 2379 | Ga0495584_0011529 | |||
| 2380 | Ga0495584_0027406 | |||
| 2381 | Ga0495584_0031834 | |||
| 2382 | Ga0495584_0037508 | |||
| 2383 | Ga0495584_0088559 | |||
| 2384 | Ga0495584_0325461 | |||
| 2385 | Ga0495584_0440124 | |||
| 2386 | Ga0495585_0000231 | |||
| 2387 | Ga0495585_0000661 | |||
| 2388 | Ga0495585_0002388 | |||
| 2389 | Ga0495585_0005416 | |||
| 2390 | Ga0495585_0011649 | |||
| 2391 | Ga0495585_0016127 | |||
| 2392 | Ga0495585_0017357 | |||
| 2393 | Ga0495585_0022952 | |||
| 2394 | Ga0495585_0040248 | |||
| 2395 | Ga0495585_0043165 | |||
| 2396 | Ga0495585_0044484 | |||
| 2397 | Ga0495585_0045810 | |||
| 2398 | Ga0495585_0099299 | |||
| 2399 | Ga0495585_0169492 | |||
| 2400 | Ga0495585_0222060 | |||
| 2401 | Ga0495585_0283329 | |||
| 2402 | Ga0495585_0365608 | |||
| 2403 | Ga0495585_0539679 | |||
| 2404 | Ga0495594_0011833 | |||
| 2405 | Ga0495594_0021249 | |||
| 2406 | Ga0495594_0036723 | |||
| 2407 | Ga0495594_0051108 | |||
| 2408 | Ga0495594_0054367 | |||
| 2409 | Ga0495594_0324754 | |||
| 2410 | Ga0495594_0338716 | |||
| 2411 | Ga0495594_0356054 | |||
| 2412 | Ga0495594_0382486 | |||
| 2413 | Ga0495596_0000167 | |||
| 2414 | Ga0495596_0001014 | |||
| 2415 | Ga0495596_0001935 | |||
| 2416 | Ga0495596_0007949 | |||
| 2417 | Ga0495596_0026810 | |||
| 2418 | Ga0495596_0029308 | |||
| 2419 | Ga0495596_0031074 | |||
| 2420 | Ga0495596_0042041 | |||
| 2421 | Ga0495596_0068204 | |||
| 2422 | Ga0495596_0143485 | |||
| 2423 | Ga0495596_0150353 | |||
| 2424 | Ga0495596_0240678 | |||
| 2425 | Ga0495596_0241420 | |||
| 2426 | Ga0495607_0000541 | |||
| 2427 | Ga0495607_0002543 | |||
| 2428 | Ga0495607_0007152 | |||
| 2429 | Ga0495607_0007566 | |||
| 2430 | Ga0495607_0011135 | |||
| 2431 | Ga0495607_0013308 | |||
| 2432 | Ga0495607_0037147 | |||
| 2433 | Ga0495607_0037367 | |||
| 2434 | Ga0495607_0039743 | |||
| 2435 | Ga0495607_0075265 | |||
| 2436 | Ga0495607_0077343 | |||
| 2437 | Ga0495607_0085457 | |||
| 2438 | Ga0495607_0172731 | |||
| 2439 | Ga0495607_0186214 | |||
| 2440 | Ga0495607_0285720 | |||
| 2441 | Ga0495607_0432634 | |||
| 2442 | Ga0495583_0000973 | |||
| 2443 | Ga0495583_0001039 | |||
| 2444 | Ga0495583_0002475 | |||
| 2445 | Ga0495583_0003003 | |||
| 2446 | Ga0495583_0003424 | |||
| 2447 | Ga0495583_0016509 | |||
| 2448 | Ga0495583_0024796 | |||
| 2449 | Ga0495583_0040804 | |||
| 2450 | Ga0495583_0046883 | |||
| 2451 | Ga0495583_0118288 | |||
| 2452 | Ga0495583_0141923 | |||
| 2453 | Ga0495583_0177964 | |||
| 2454 | Ga0495583_0206862 | |||
| 2455 | Ga0495583_0284704 | |||
| 2456 | Ga0495583_0412657 | |||
| 2457 | Ga0495606_0000044 | |||
| 2458 | Ga0495606_0004147 | |||
| 2459 | Ga0495606_0007667 | |||
| 2460 | Ga0495606_0117704 | |||
| 2461 | Ga0495606_0135869 | |||
| 2462 | Ga0495606_0163968 | |||
| 2463 | Ga0495606_0363673 | |||
| 2464 | Ga0495610_0000021 | |||
| 2465 | Ga0495610_0000670 | |||
| 2466 | Ga0495610_0006470 | |||
| 2467 | Ga0495610_0290292 | |||
| 2468 | Ga0495616_0000513 | |||
| 2469 | Ga0495616_0001343 | |||
| 2470 | Ga0495616_0014810 | |||
| 2471 | Ga0495616_0026160 | |||
| 2472 | Ga0495616_0026806 | |||
| 2473 | Ga0495616_0030576 | |||
| 2474 | Ga0495616_0033581 | |||
| 2475 | Ga0495616_0050386 | |||
| 2476 | Ga0495616_0059048 | |||
| 2477 | Ga0495616_0070740 | |||
| 2478 | Ga0495616_0111796 | |||
| 2479 | Ga0495616_0180477 | |||
| 2480 | Ga0495616_0193188 | |||
| 2481 | Ga0495628_0113774 | |||
| 2482 | Ga0495630_0034352 | |||
| 2483 | Ga0495630_0128986 | |||
| 2484 | Ga0495631_0001460 | |||
| 2485 | Ga0495631_0002828 | |||
| 2486 | Ga0495631_0009060 | |||
| 2487 | Ga0495631_0010172 | |||
| 2488 | Ga0495631_0016695 | |||
| 2489 | Ga0495631_0017704 | |||
| 2490 | Ga0495631_0017820 | |||
| 2491 | Ga0495631_0022351 | |||
| 2492 | Ga0495631_0039135 | |||
| 2493 | Ga0495631_0040628 | |||
| 2494 | Ga0495631_0047668 | |||
| 2495 | Ga0495631_0057785 | |||
| 2496 | Ga0495631_0060076 | |||
| 2497 | Ga0495631_0073921 | |||
| 2498 | Ga0495631_0087777 | |||
| 2499 | Ga0495632_0001800 | |||
| 2500 | Ga0495632_0002267 | |||
| 2501 | Ga0495632_0005326 | |||
| 2502 | Ga0495632_0008341 | |||
| 2503 | Ga0495632_0010039 | |||
| 2504 | Ga0495632_0038108 | |||
| 2505 | Ga0495632_0047193 | |||
| 2506 | Ga0495632_0243404 | |||
| 2507 | Ga0495632_0246601 | |||
| 2508 | Ga0495637_0002124 | |||
| 2509 | Ga0495637_0036587 | |||
| 2510 | Ga0495637_0112935 | |||
| 2511 | Ga0495637_0162171 | |||
| 2512 | Ga0495643_0000672 | |||
| 2513 | Ga0495643_0009379 | |||
| 2514 | Ga0495643_0014488 | |||
| 2515 | Ga0495643_0036703 | |||
| 2516 | Ga0495643_0081703 | |||
| 2517 | Ga0495643_0089486 | |||
| 2518 | Ga0495643_0097179 | |||
| 2519 | Ga0495643_0120133 | |||
| 2520 | Ga0495643_0129321 | |||
| 2521 | Ga0495644_0011476 | |||
| 2522 | Ga0495644_0025470 | |||
| 2523 | Ga0495644_0026300 | |||
| 2524 | Ga0495644_0029820 | |||
| 2525 | Ga0495644_0105894 | |||
| 2526 | Ga0495644_0164353 | |||
| 2527 | Ga0495644_0203464 | |||
| 2528 | Ga0495644_0310720 | |||
| 2529 | Ga0495648_0000305 | |||
| 2530 | Ga0495648_0001823 | |||
| 2531 | Ga0495648_0006047 | |||
| 2532 | Ga0495648_0010172 | |||
| 2533 | Ga0495648_0013289 | |||
| 2534 | Ga0495648_0028695 | |||
| 2535 | Ga0495648_0044607 | |||
| 2536 | Ga0495648_0085246 | |||
| 2537 | Ga0495648_0088322 | |||
| 2538 | Ga0495648_0154615 | |||
| 2539 | Ga0495648_0252550 | |||
| 2540 | Ga0495663_0011840 | |||
| 2541 | Ga0495663_0078783 | |||
| 2542 | Ga0495663_0356533 | |||
| 2543 | Ga0495666_0001755 | |||
| 2544 | Ga0495666_0007423 | |||
| 2545 | Ga0495666_0016804 | |||
| 2546 | Ga0495666_0091741 | |||
| 2547 | Ga0495666_0394005 | |||
| 2548 | Ga0495642_0000183 | |||
| 2549 | Ga0495642_0001255 | |||
| 2550 | Ga0495642_0007953 | |||
| 2551 | Ga0495642_0012702 | |||
| 2552 | Ga0495642_0014164 | |||
| 2553 | Ga0495642_0016993 | |||
| 2554 | Ga0495642_0025887 | |||
| 2555 | Ga0495642_0033505 | |||
| 2556 | Ga0495642_0034030 | |||
| 2557 | Ga0495642_0065935 | |||
| 2558 | Ga0495642_0115111 | |||
| 2559 | Ga0495642_0117360 | |||
| 2560 | Ga0495642_0267938 | |||
| 2561 | Ga0495642_0494475 | |||
| 2562 | Ga0495652_0004868 | |||
| 2563 | Ga0495652_0067329 | |||
| 2564 | Ga0495654_0012134 | |||
| 2565 | Ga0495654_0027865 | |||
| 2566 | Ga0495654_0034900 | |||
| 2567 | Ga0495654_0046888 | |||
| 2568 | Ga0495654_0096931 | |||
| 2569 | Ga0495654_0136419 | |||
| 2570 | Ga0495654_0155184 | |||
| 2571 | Ga0495665_0019946 | |||
| 2572 | Ga0495665_0056383 | |||
| 2573 | Ga0495665_0120444 | |||
| 2574 | Ga0495640_0086504 | |||
| 2575 | Ga0495586_0004976 | |||
| 2576 | Ga0495586_0012825 | |||
| 2577 | Ga0495586_0095563 | |||
| 2578 | Ga0495586_0103072 | |||
| 2579 | Ga0495586_0452278 | |||
| 2580 | Ga0495587_0032789 | |||
| 2581 | Ga0495587_0103788 | |||
| 2582 | Ga0495598_0192449 | |||
| 2583 | Ga0495609_0005634 | |||
| 2584 | Ga0495609_0006036 | |||
| 2585 | Ga0495609_0008274 | |||
| 2586 | Ga0495609_0018251 | |||
| 2587 | Ga0495609_0039214 | |||
| 2588 | Ga0495609_0039663 | |||
| 2589 | Ga0495609_0044547 | |||
| 2590 | Ga0495609_0079497 | |||
| 2591 | Ga0495609_0266738 | |||
| 2592 | Ga0495597_0000750 | |||
| 2593 | Ga0495597_0001696 | |||
| 2594 | Ga0495597_0002408 | |||
| 2595 | Ga0495597_0003492 | |||
| 2596 | Ga0495597_0009047 | |||
| 2597 | Ga0495597_0018655 | |||
| 2598 | Ga0495597_0047011 | |||
| 2599 | Ga0495597_0064538 | |||
| 2600 | Ga0495597_0070070 | |||
| 2601 | Ga0495597_0078307 | |||
| 2602 | Ga0495597_0145064 | |||
| 2603 | Ga0495597_0148938 | |||
| 2604 | Ga0495597_0318896 | |||
| 2605 | Ga0495645_0017268 | |||
| 2606 | Ga0495622_0004031 | |||
| 2607 | Ga0495622_0004396 | |||
| 2608 | Ga0495622_0027134 | |||
| 2609 | Ga0495622_0052977 | |||
| 2610 | Ga0495622_0117707 | |||
| 2611 | Ga0495622_0259833 | |||
| 2612 | Ga0495622_0307603 | |||
| 2613 | Ga0495633_0001801 | |||
| 2614 | Ga0495633_0004010 | |||
| 2615 | Ga0495633_0005029 | |||
| 2616 | Ga0495633_0007250 | |||
| 2617 | Ga0495633_0016596 | |||
| 2618 | Ga0495633_0022110 | |||
| 2619 | Ga0495633_0057402 | |||
| 2620 | Ga0495633_0058811 | |||
| 2621 | Ga0495633_0106076 | |||
| 2622 | Ga0495633_0109078 | |||
| 2623 | Ga0495633_0126302 | |||
| 2624 | Ga0495633_0195211 | |||
| 2625 | Ga0495633_0423340 | |||
| 2626 | Ga0495633_0513054 | |||
| 2627 | Ga0495667_0161036 | |||
| 2628 | Ga0495667_0771660 | |||
| 2629 | Ga0495656_0001534 | |||
| 2630 | Ga0495656_0009091 | |||
| 2631 | Ga0495656_0034549 | |||
| 2632 | Ga0495656_0072976 | |||
| 2633 | Ga0495656_0079357 | |||
| 2634 | Ga0495656_0575212 | |||
| 2635 | Ga0495656_0721638 | |||
| 2636 | Ga0495668_0000008 | |||
| 2637 | Ga0495668_0000147 | |||
| 2638 | Ga0495668_0002087 | |||
| 2639 | Ga0495668_0002663 | |||
| 2640 | Ga0495668_0006725 | |||
| 2641 | Ga0495668_0007013 | |||
| 2642 | Ga0495668_0011308 | |||
| 2643 | Ga0495668_0018876 | |||
| 2644 | Ga0495668_0026166 | |||
| 2645 | Ga0495668_0038446 | |||
| 2646 | Ga0495668_0040587 | |||
| 2647 | Ga0495668_0049125 | |||
| 2648 | Ga0495668_0107267 | |||
| 2649 | Ga0495668_0124011 | |||
| 2650 | Ga0495668_0257876 | |||
| 2651 | Ga0495668_0626220 | |||
| 2652 | Ga0495634_0071133 | |||
| 2653 | Ga0495634_0382547 | |||
| 2654 | Ga0495634_0414708 | |||
| 2655 | Ga0495611_0004165 | |||
| 2656 | Ga0495611_0008787 | |||
| 2657 | Ga0495611_0013099 | |||
| 2658 | Ga0495611_0018491 | |||
| 2659 | Ga0495611_0027894 | |||
| 2660 | Ga0495611_0037430 | |||
| 2661 | Ga0495611_0061736 | |||
| 2662 | Ga0495611_0377273 | |||
| 2663 | Ga0495625_0004860 | |||
| 2664 | Ga0495625_0006363 | |||
| 2665 | Ga0495625_0009751 | |||
| 2666 | Ga0495625_0071803 | |||
| 2667 | Ga0495625_0120141 | |||
| 2668 | Ga0495625_0165047 | |||
| 2669 | Ga0495625_0374666 | |||
| 2670 | Ga0495635_0061833 | |||
| 2671 | Ga0495635_0253179 | |||
| 2672 | Ga0495659_0006683 | |||
| 2673 | Ga0495659_0063289 | |||
| 2674 | Ga0495659_0096027 | |||
| 2675 | Ga0495661_0002137 | |||
| 2676 | Ga0495661_0007102 | |||
| 2677 | Ga0495661_0007586 | |||
| 2678 | Ga0495661_0009450 | |||
| 2679 | Ga0495661_0010426 | |||
| 2680 | Ga0495661_0013323 | |||
| 2681 | Ga0495661_0021589 | |||
| 2682 | Ga0495661_0027087 | |||
| 2683 | Ga0495661_0033130 | |||
| 2684 | Ga0495661_0036060 | |||
| 2685 | Ga0495661_0039437 | |||
| 2686 | Ga0495661_0044737 | |||
| 2687 | Ga0495661_0047611 | |||
| 2688 | Ga0495661_0051913 | |||
| 2689 | Ga0495661_0059915 | |||
| 2690 | Ga0495661_0076266 | |||
| 2691 | Ga0495661_0076505 | |||
| 2692 | Ga0495661_0080102 | |||
| 2693 | Ga0495661_0090702 | |||
| 2694 | Ga0495661_0149782 | |||
| 2695 | Ga0495661_0216054 | |||
| 2696 | Ga0495661_0247407 | |||
| 2697 | Ga0495661_0445173 | |||
| 2698 | Ga0495661_0554911 | |||
| 2699 | Ga0495588_0000070 | |||
| 2700 | Ga0495588_0021639 | |||
| 2701 | Ga0495588_0024022 | |||
| 2702 | Ga0495588_0028284 | |||
| 2703 | Ga0495588_0036330 | |||
| 2704 | Ga0495588_0037675 | |||
| 2705 | Ga0495588_0056773 | |||
| 2706 | Ga0495588_0087644 | |||
| 2707 | Ga0495588_0131471 | |||
| 2708 | Ga0495588_0134741 | |||
| 2709 | Ga0495623_0005716 | |||
| 2710 | Ga0495623_0016901 | |||
| 2711 | Ga0495623_0072479 | |||
| 2712 | Ga0495623_0194837 | |||
| 2713 | Ga0495623_0211900 | |||
| 2714 | Ga0495646_0118017 | |||
| 2715 | Ga0495646_0567688 | |||
| 2716 | Ga0495669_0003622 | |||
| 2717 | Ga0495669_0005289 | |||
| 2718 | Ga0495669_0006862 | |||
| 2719 | Ga0495669_0010378 | |||
| 2720 | Ga0495669_0010911 | |||
| 2721 | Ga0495669_0013578 | |||
| 2722 | Ga0495669_0029766 | |||
| 2723 | Ga0495669_0070653 | |||
| 2724 | Ga0495669_0082095 | |||
| 2725 | Ga0495669_0555180 | |||
| 2726 | Ga0495669_0566692 | |||
| 2727 | Ga0495613_0008593 | |||
| 2728 | Ga0495613_0077562 | |||
| 2729 | Ga0495613_0472519 | |||
| 2730 | Ga0495624_0053063 | |||
| 2731 | Ga0495670_0000858 | |||
| 2732 | Ga0495670_0007604 | |||
| 2733 | Ga0495670_0010624 | |||
| 2734 | Ga0495670_0020705 | |||
| 2735 | Ga0495670_0024382 | |||
| 2736 | Ga0495670_0037875 | |||
| 2737 | Ga0495670_0055003 | |||
| 2738 | Ga0495670_0089031 | |||
| 2739 | Ga0495670_0212799 | |||
| 2740 | Ga0495670_0333239 | |||
| 2741 | Ga0495670_0474476 | |||
| 2742 | Ga0495671_0000024 | |||
| 2743 | Ga0495671_0001399 | |||
| 2744 | Ga0495671_0001573 | |||
| 2745 | Ga0495671_0010899 | |||
| 2746 | Ga0495671_0031350 | |||
| 2747 | Ga0495671_0077072 | |||
| 2748 | Ga0495671_0105022 | |||
| 2749 | Ga0495671_0114595 | |||
| 2750 | Ga0495671_0147315 | |||
| 2751 | Ga0495649_0001152 | |||
| 2752 | Ga0495649_0001587 | |||
| 2753 | Ga0495649_0005680 | |||
| 2754 | Ga0495649_0023517 | |||
| 2755 | Ga0495649_0070020 | |||
| 2756 | Ga0495649_0070599 | |||
| 2757 | Ga0495649_0083163 | |||
| 2758 | Ga0495649_0212700 | |||
| 2759 | Ga0495649_0241260 | |||
| 2760 | Ga0495649_0420604 | |||
| 2761 | Ga0495649_0548529 | |||
| 2762 | Ga0495589_0000175 | |||
| 2763 | Ga0495589_0006172 | |||
| 2764 | Ga0495589_0008611 | |||
| 2765 | Ga0495589_0015652 | |||
| 2766 | Ga0495589_0029680 | |||
| 2767 | Ga0495589_0059859 | |||
| 2768 | Ga0495589_0096445 | |||
| 2769 | Ga0495589_0100072 | |||
| 2770 | Ga0495589_0111488 | |||
| 2771 | Ga0495589_0133853 | |||
| 2772 | Ga0495589_0149748 | |||
| 2773 | Ga0495589_0428732 | |||
| 2774 | Ga0495589_0509956 | |||
| 2775 | Ga0495600_0029364 | |||
| 2776 | Ga0495600_0077432 | |||
| 2777 | Ga0495660_0000113 | |||
| 2778 | Ga0495660_0007231 | |||
| 2779 | Ga0495660_0008596 | |||
| 2780 | Ga0495660_0011822 | |||
| 2781 | Ga0495660_0013074 | |||
| 2782 | Ga0495660_0018065 | |||
| 2783 | Ga0495660_0058835 | |||
| 2784 | Ga0495660_0087344 | |||
| 2785 | Ga0495660_0089041 | |||
| 2786 | Ga0495660_0091058 | |||
| 2787 | Ga0495660_0119957 | |||
| 2788 | Ga0495660_0191455 | |||
| 2789 | Ga0495581_0036204 | |||
| 2790 | Ga0495581_0106183 | |||
| 2791 | Ga0495581_0128311 | |||
| 2792 | Ga0495581_0239874 | |||
| 2793 | Ga0495581_0326300 | |||
| 2794 | Ga0495604_0037771 | |||
| 2795 | Ga0495604_0104486 | |||
| 2796 | Ga0495604_0215908 | |||
| 2797 | Ga0495604_0994598 | |||
| 2798 | Ga0495636_0002635 | |||
| 2799 | Ga0495636_0024504 | |||
| 2800 | Ga0495636_0024928 | |||
| 2801 | Ga0495636_0094257 | |||
| 2802 | Ga0495636_0459209 | |||
| 2803 | Ga0495674_0126304 | |||
| 2804 | Ga0495674_1463061 | |||
| 2805 | Ga0495672_0000014 | |||
| 2806 | Ga0495672_0000802 | |||
| 2807 | Ga0495672_0001524 | |||
| 2808 | Ga0495672_0008898 | |||
| 2809 | Ga0495672_0049785 | |||
| 2810 | Ga0495672_0075371 | |||
| 2811 | Ga0495672_0081406 | |||
| 2812 | Ga0495672_0091240 | |||
| 2813 | Ga0495672_0232320 | |||
| 2814 | Ga0495672_0293467 | |||
| 2815 | Ga0495672_0371481 | |||
| 2816 | Ga0495676_0000635 | |||
| 2817 | Ga0495676_0024556 | |||
| 2818 | Ga0495680_0007985 | |||
| 2819 | Ga0495680_0886271 | |||
| 2820 | Ga0495683_0004597 | |||
| 2821 | Ga0495683_0014426 | |||
| 2822 | Ga0495683_0018374 | |||
| 2823 | Ga0495683_0051367 | |||
| 2824 | Ga0495683_0084867 | |||
| 2825 | Ga0495683_0092427 | |||
| 2826 | Ga0495683_0123858 | |||
| 2827 | Ga0495683_0131796 | |||
| 2828 | Ga0495683_0300778 | |||
| 2829 | Ga0495687_000256 | |||
| 2830 | Ga0495687_001662 | |||
| 2831 | Ga0495687_002171 | |||
| 2832 | Ga0495687_002621 | |||
| 2833 | Ga0495687_012555 | |||
| 2834 | Ga0495687_081327 | |||
| 2835 | Ga0495675_0004484 | |||
| 2836 | Ga0495675_0009446 | |||
| 2837 | Ga0495675_0083856 | |||
| 2838 | Ga0495675_0283877 | |||
| 2839 | Ga0495677_0000285 | |||
| 2840 | Ga0495677_0000526 | |||
| 2841 | Ga0495677_0002208 | |||
| 2842 | Ga0495677_0002393 | |||
| 2843 | Ga0495677_0004272 | |||
| 2844 | Ga0495677_0006101 | |||
| 2845 | Ga0495677_0013292 | |||
| 2846 | Ga0495677_0022540 | |||
| 2847 | Ga0495677_0023041 | |||
| 2848 | Ga0495677_0081451 | |||
| 2849 | Ga0495677_0133912 | |||
| 2850 | Ga0495677_0153867 | |||
| 2851 | Ga0495679_001976 | |||
| 2852 | Ga0495679_008571 | |||
| 2853 | Ga0495679_021490 | |||
| 2854 | Ga0495679_038226 | |||
| 2855 | Ga0495679_042065 | |||
| 2856 | Ga0495679_050380 | |||
| 2857 | Ga0495679_085372 | |||
| 2858 | Ga0495679_090044 | |||
| 2859 | Ga0495685_001659 | |||
| 2860 | Ga0495685_017258 | |||
| 2861 | Ga0495685_023277 | |||
| 2862 | Ga0495685_042836 | |||
| 2863 | Ga0495685_101556 | |||
| 2864 | Ga0495685_223931 | |||
| 2865 | Ga0495673_0000033 | |||
| 2866 | Ga0495673_0000219 | |||
| 2867 | Ga0495673_0026744 | |||
| 2868 | Ga0495681_0002303 | |||
| 2869 | Ga0495681_0002957 | |||
| 2870 | Ga0495681_0003979 | |||
| 2871 | Ga0495681_0004255 | |||
| 2872 | Ga0495681_0009090 | |||
| 2873 | Ga0495681_0016882 | |||
| 2874 | Ga0495681_0016966 | |||
| 2875 | Ga0495681_0026169 | |||
| 2876 | Ga0495681_0045254 | |||
| 2877 | Ga0495681_0046523 | |||
| 2878 | Ga0495681_0087970 | |||
| 2879 | Ga0495681_0116679 | |||
| 2880 | Ga0495681_0149333 | |||
| 2881 | Ga0495681_0166863 | |||
| 2882 | Ga0495681_0224552 | |||
| 2883 | Ga0495681_0233152 | |||
| 2884 | Ga0495686_0000612 | |||
| 2885 | Ga0495686_0007392 | |||
| 2886 | Ga0495686_0007517 | |||
| 2887 | Ga0495686_0026052 | |||
| 2888 | Ga0495686_0040407 | |||
| 2889 | Ga0495686_0052739 | |||
| 2890 | Ga0495686_0057652 | |||
| 2891 | Ga0495593_0065585 | |||
| 2892 | Ga0495593_0090787 | |||
| 2893 | Ga0495593_0191581 | |||
| 2894 | Ga0495593_0199628 | |||
| 2895 | Ga0495593_0240489 | |||
| 2896 | Ga0495602_0006516 | |||
| 2897 | Ga0495602_0129568 | |||
| 2898 | Ga0495614_0010297 | |||
| 2899 | Ga0495614_0034116 | |||
| 2900 | Ga0495614_0078450 | |||
| 2901 | Ga0495615_0277052 | |||
| 2902 | Ga0495626_0000030 | |||
| 2903 | Ga0495626_0001112 | |||
| 2904 | Ga0495626_0003446 | |||
| 2905 | Ga0495626_0008158 | |||
| 2906 | Ga0495626_0013319 | |||
| 2907 | Ga0495626_0017773 | |||
| 2908 | Ga0495626_0019121 | |||
| 2909 | Ga0495626_0037898 | |||
| 2910 | Ga0495626_0050532 | |||
| 2911 | Ga0495626_0069697 | |||
| 2912 | Ga0495626_0118822 | |||
| 2913 | Ga0495626_0129870 | |||
| 2914 | Ga0495626_0147652 | |||
| 2915 | Ga0495626_0182393 | |||
| 2916 | Ga0496100_0015402 | |||
| 2917 | Ga0496100_0522339 | |||
| 2918 | Ga0496100_0731895 | |||
| 2919 | Ga0496100_0748557 | |||
| 2920 | Ga0496100_0775748 | |||
| 2921 | Ga0496101_0022303 | |||
| 2922 | Ga0496101_1151843 | |||
| 2923 | Ga0496102_0000107 | |||
| 2924 | Ga0496102_0002399 | |||
| 2925 | Ga0496102_0131601 | |||
| 2926 | Ga0496102_0154892 | |||
| 2927 | Ga0496102_0281805 | |||
| 2928 | Ga0496102_0360849 | |||
| 2929 | Ga0496102_0471576 | |||
| 2930 | Ga0496102_0905887 | |||
| 2931 | Ga0496103_0013925 | |||
| 2932 | Ga0496103_0024228 | |||
| 2933 | Ga0496103_0027712 | |||
| 2934 | Ga0496103_0114725 | |||
| 2935 | Ga0496103_0272794 | |||
| 2936 | Ga0496103_0459573 | |||
| 2937 | Ga0496103_0547058 | |||
| 2938 | Ga0496104_0514006 | |||
| 2939 | Ga0496104_1176458 | |||
| 2940 | Ga0496105_0423836 | |||
| 2941 | Ga0496105_0715560 | |||
| 2942 | Ga0496106_0415535 | |||
| 2943 | Ga0496106_1048597 | |||
| 2944 | Ga0496107_0045165 | |||
| 2945 | Ga0496107_0089723 | |||
| 2946 | Ga0496107_0131886 | |||
| 2947 | Ga0496108_0041836 | |||
| 2948 | Ga0496108_0173153 | |||
| 2949 | Ga0496108_1079097 | |||
| 2950 | Ga0496109_0022473 | |||
| 2951 | Ga0496109_1039118 | |||
| 2952 | Ga0496109_1433848 | |||
| 2953 | Ga0496110_0000073 | |||
| 2954 | Ga0496110_0017013 | |||
| 2955 | Ga0496110_0215525 | |||
| 2956 | Ga0496110_0408481 | |||
| 2957 | Ga0496110_0729724 | |||
| 2958 | Ga0496110_1500749 | |||
| 2959 | Ga0496110_1800402 | |||
| 2960 | Ga0496111_0023601 | |||
| 2961 | Ga0496111_0076108 | |||
| 2962 | Ga0496111_0243968 | |||
| 2963 | Ga0496111_0244250 | |||
| 2964 | Ga0496111_0308709 | |||
| 2965 | Ga0496111_0342449 | |||
| 2966 | Ga0496111_0419145 | |||
| 2967 | Ga0496113_0006791 | |||
| 2968 | Ga0496113_0115806 | |||
| 2969 | Ga0496113_0534784 | |||
| 2970 | Ga0496114_0819080 | |||
| 2971 | Ga0496115_0005153 | |||
| 2972 | Ga0496115_0131387 | |||
| 2973 | Ga0496115_0367281 | |||
| 2974 | Ga0496115_0648522 | |||
| 2975 | Ga0496121_0010080 | |||
| 2976 | Ga0496121_0319154 | |||
| 2977 | Ga0496121_0397102 | |||
| 2978 | Ga0496122_0004240 | |||
| 2979 | Ga0496122_0005480 | |||
| 2980 | Ga0496122_0014909 | |||
| 2981 | Ga0496122_0166992 | |||
| 2982 | Ga0496123_0004584 | |||
| 2983 | Ga0496123_0004651 | |||
| 2984 | Ga0496123_0093325 | |||
| 2985 | Ga0496124_0025849 | |||
| 2986 | Ga0496124_0042104 | |||
| 2987 | Ga0496124_0045034 | |||
| 2988 | Ga0496124_0073546 | |||
| 2989 | Ga0496124_0088863 | |||
| 2990 | Ga0496124_0158903 | |||
| 2991 | Ga0496124_0221766 | |||
| 2992 | Ga0496124_0348273 | |||
| 2993 | Ga0496124_0923772 | |||
| 2994 | Ga0496124_0989646 | |||
| 2995 | Ga0496125_0005966 | |||
| 2996 | Ga0496125_0166028 | |||
| 2997 | Ga0496125_0272016 | |||
| 2998 | Ga0496126_0039407 | |||
| 2999 | Ga0501308_029752 | |||
| 3000 | Ga0495678_000230 | |||
| 3001 | Ga0495678_000523 | |||
| 3002 | Ga0495678_001473 | |||
| 3003 | Ga0495678_004643 | |||
| 3004 | Ga0495678_011801 | |||
| 3005 | Ga0495678_031893 | |||
| 3006 | Ga0495678_071428 | |||
| 3007 | Ga0495678_141569 | |||
| 3008 | Ga0495678_166213 | |||
| 3009 | Ga0495682_0001242 | |||
| 3010 | Ga0495682_0008310 | |||
| 3011 | Ga0495682_0008772 | |||
| 3012 | Ga0495682_0017767 | |||
| 3013 | Ga0495682_0169457 | |||
| 3014 | Ga0495682_0285193 | |||
| 3015 | Ga0501336_012305 | |||
| 3016 | Ga0501034_0039455 | |||
| 3017 | Ga0501036_0231432 | |||
| 3018 | Ga0501036_0966774 | |||
| 3019 | Ga0501042_0915141 | |||
| 3020 | Ga0501043_1185868 | |||
| 3021 | Ga0501047_0481759 | |||
| 3022 | Ga0501047_0512813 | |||
| 3023 | Ga0501048_1072039 | |||
| 3024 | Ga0501067_0011741 | |||
| 3025 | Ga0501067_0578406 | |||
| 3026 | Ga0501069_0464898 | |||
| 3027 | Ga0501070_0022870 | |||
| 3028 | Ga0501070_0734491 | |||
| 3029 | Ga0501072_0296063 | |||
| 3030 | Ga0501072_0324694 | |||
| 3031 | Ga0501073_0036699 | |||
| 3032 | Ga0501076_1489561 | |||
| 3033 | Ga0501238_005850 | |||
| 3034 | Ga0501240_087372 | |||
| 3035 | Ga0501249_081265 | |||
| 3036 | Ga0501079_0396811 | |||
| 3037 | Ga0501080_0020160 | |||
| 3038 | Ga0501080_0332827 | |||
| 3039 | Ga0501083_0083255 | |||
| 3040 | Ga0501263_050956 | |||
| 3041 | Ga0501035_0024716 | |||
| 3042 | Ga0501044_0484661 | |||
| 3043 | nmdc:mga0k408_690643_c1 | |||
| 3044 | nmdc:mga05p37_1300868_c1 | |||
| 3045 | nmdc:mga05p37_2069381_c1 | |||
| 3046 | nmdc:mga06r32_1483801_c1 | |||
| 3047 | nmdc:mga08y16_1491405_c1 | |||
| 3048 | nmdc:mga0n895_143557_c1 | |||
| 3049 | nmdc:mga0n895_148088_c1 | |||
| 3050 | nmdc:mga0rr50_46757_c1 | |||
| 3051 | nmdc:mga0a205_241953_c1 | |||
| 3052 | Ga0587070_108964 | |||
| 3053 | Ga0587083_0063905 | |||
| 3054 | Ga0587088_084515 | |||
| 3055 | Ga0587091_144887 | |||
| 3056 | Ga0587098_051426 | |||
| 3057 | Ga0587101_092632 | |||
| 3058 | Ga0587079_051086 | |||
| 3059 | Ga0501082_0631383 | |||
| 3060 | Ga0466962_0090693 | |||
| 3061 | Ga0466962_0099875 | |||
| 3062 | Ga0466962_0119251 | |||
| 3063 | 2643790940 | |||
| 3064 | 2644214932 | |||
| 3065 | 2644249437 | |||
| 3066 | 2738740854 | |||
| 3067 | 2738825740 | |||
| 3068 | 2738845175 | |||
| 3069 | 2739149537 | |||
| 3070 | 2739191456 | |||
| 3071 | 2739274770 | |||
| 3072 | 2739317933 | |||
| 3073 | 2739336174 | |||
| 3074 | 2739343814 | |||
| 3075 | 2842713761 | |||
| 3076 | 2857554895 | |||
| 3077 | 2857562271 | |||
| 3078 | 2919479016 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zki-assembly1.cif.gz_b | complex i with nadh, open2 | 0.7632 | 30 | 52 |
| 7ak5-assembly1.cif.gz_R | cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a | 0.7462 | 30 | 52 |
| 8ca3-assembly1.cif.gz_R | cryo-em structure ndufs4 knockout complex i from mus musculus heart (class 2). | 0.7418 | 28 | 53 |
| 6zkt-assembly1.cif.gz_b | deactive complex i, open2 | 0.6851 | 30 | 55 |
| 8buu-assembly1.cif.gz_0 | are-abcf vmlr2 bound to a 70s ribosome | 0.6437 | 40 | 52 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SXD2_1_92_2.20.25.30 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.9213 | 40 | 52 | 2.20.25.30 |
| af_Q8I5N0_14_80_3.10.660.10 | Alpha Beta;Roll;Microbial ribonuclease fold;DPH Zinc finger | 0.8837 | 40 | 53 | 3.10.660.10 |
| af_I1NHN5_48_134_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8375 | 41 | 52 | 3.30.40.10 |
| af_Q9TZ74_129_204_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8195 | 39 | 50 | 3.30.40.10 |
| af_K7KKY2_751_958_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7575 | 40 | 52 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P7BFP8-F1-model_v4 | deleted | 0.9252 | 1 | 62 |
|
| AF-G0AFW4-F1-model_v4 | Zinc finger CHCC-type domain-containing protein | 0.9204 | 1 | 62 |
|
| AF-A0A3S9HFV4-F1-model_v4 | Zinc-finger domain-containing protein | 0.9153 | 1 | 62 |
|
| AF-A0A6L8KRJ3-F1-model_v4 | Zinc-finger domain-containing protein | 0.9149 | 1 | 62 |
|
| AF-A0A4P7BFP8-F1-model_v4 | deleted | 0.9114 | 1 | 62 |
|