F494652

General Info

Members Datasets Scaffolds Average Seq Length
1540 367 1540 170

Family's Representative Sequence

Representative Sequence 3300024225|Ga0224572_1037013|Ga0224572_10370132
Length 172
Sequence MIYPIVKFGNPVLEKPAEPVTVFDDELKKLVEDMFESMYEAHGVGLAAPQIGISQRLAVIDVTFKEDPDAKLVLANPEILHTEGKHTQPEGCLSIPEFREPVSRARKVTIRAQDVNGKWYEKTTKEGEELLARAFLHETEHLNGKLYISHISALKRDLMKRKIRKLMKAGEW

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
132 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
133 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
134 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
135 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
202 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
203 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
212 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
237 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
238 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
239 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
244 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
247 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
248 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
268 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
269 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
270 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
271 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
272 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
348 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
351 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
352 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
353 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
354 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.06
Nodule 0
Rhizoplane 4.35
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11819402 2162886012 Unclassified 1532
2 LJNas_1001454 3300000546 Bacteria 3381
3 JGI24034J26672_10005869 3300002239 Unclassified 1766
4 JGI24751J29686_10014259 3300002459 Unclassified 1641
5 Ga0065712_10152185 3300005290 Unclassified 1361
6 Ga0065712_10173172 3300005290 Unclassified 1232
7 Ga0065715_10037980 3300005293 Unclassified 1581
8 Ga0065715_10103000 3300005293 Bacteria 3068
9 Ga0065715_10178575 3300005293 Unclassified 1493
10 Ga0070658_10005929 3300005327 Bacteria 9915
11 Ga0070658_10418706 3300005327 Unclassified 1152
12 Ga0070658_10701949 3300005327 Bacteria 878
13 Ga0070676_10016811 3300005328 Bacteria 4044
14 Ga0070676_10151440 3300005328 Bacteria 1485
15 Ga0070683_100000035 3300005329 Bacteria 122362
16 Ga0070683_100012627 3300005329 Bacteria 7342
17 Ga0070683_100026713 3300005329 Bacteria 5202
18 Ga0070683_100290670 3300005329 Bacteria 1554
19 Ga0070683_100546070 3300005329 Bacteria 1108
20 Ga0070683_100554868 3300005329 Unclassified 1098
21 Ga0070690_100224183 3300005330 Bacteria 1318
22 Ga0070690_100585602 3300005330 Bacteria 845
23 Ga0070670_100005429 3300005331 Bacteria 10749
24 Ga0070670_100016074 3300005331 Bacteria 6423
25 Ga0070670_100035001 3300005331 Unclassified 4323
26 Ga0068869_100009378 3300005334 Bacteria 6350
27 Ga0068869_100012141 3300005334 Bacteria 5680
28 Ga0068869_100013081 3300005334 Bacteria 5508
29 Ga0068869_101315843 3300005334 Bacteria 638
30 Ga0070666_10008702 3300005335 Bacteria 6312
31 Ga0070666_10104046 3300005335 Bacteria 1959
32 Ga0070680_100135893 3300005336 Bacteria 2060
33 Ga0070680_100443266 3300005336 Bacteria 1109
34 Ga0070682_100011890 3300005337 Bacteria 4980
35 Ga0070682_100025124 3300005337 Unclassified 3553
36 Ga0070682_100383356 3300005337 Bacteria 1058
37 Ga0068868_100002728 3300005338 Bacteria 12233
38 Ga0068868_100002835 3300005338 Bacteria 12010
39 Ga0068868_100022051 3300005338 Bacteria 4802
40 Ga0068868_100036034 3300005338 Bacteria 3827
41 Ga0068868_100125206 3300005338 Bacteria 2099
42 Ga0068868_100155671 3300005338 Unclassified 1885
43 Ga0068868_101028202 3300005338 Bacteria 755
44 Ga0070660_100009702 3300005339 Bacteria 6782
45 Ga0070660_100614258 3300005339 Unclassified 909
46 Ga0070689_100068871 3300005340 Bacteria 2760
47 Ga0070689_100069133 3300005340 Unclassified 2755
48 Ga0070689_100185672 3300005340 Bacteria 1691
49 Ga0070691_10054356 3300005341 Unclassified 1917
50 Ga0070661_100007203 3300005344 Bacteria 7664
51 Ga0070661_100025417 3300005344 Bacteria 4255
52 Ga0070692_10077057 3300005345 Unclassified 1788
53 Ga0070692_10099137 3300005345 Unclassified 1595
54 Ga0070668_100002226 3300005347 Bacteria 14253
55 Ga0070668_100007587 3300005347 Bacteria 8054
56 Ga0070668_100465366 3300005347 Bacteria 1089
57 Ga0070669_100005043 3300005353 Bacteria 9542
58 Ga0070669_100049122 3300005353 Bacteria 3080
59 Ga0070675_100047761 3300005354 Bacteria 3508
60 Ga0070675_100155371 3300005354 Unclassified 1964
61 Ga0070675_100732877 3300005354 Bacteria 901
62 Ga0070675_100737801 3300005354 Unclassified 898
63 Ga0070675_100953992 3300005354 Bacteria 787
64 Ga0070675_100962791 3300005354 Bacteria 783
65 Ga0070675_101060470 3300005354 Bacteria 745
66 Ga0070671_100976174 3300005355 Unclassified 742
67 Ga0070671_101066372 3300005355 Bacteria 709
68 Ga0070674_100221991 3300005356 Unclassified 1470
69 Ga0070674_100462311 3300005356 Unclassified 1050
70 Ga0070674_101026534 3300005356 Bacteria 725
71 Ga0070673_100062580 3300005364 Unclassified 2957
72 Ga0070673_100665248 3300005364 Bacteria 954
73 Ga0070673_101074723 3300005364 Bacteria 751
74 Ga0070688_100013826 3300005365 Unclassified 4564
75 Ga0070688_100357010 3300005365 Bacteria 1071
76 Ga0070659_100001203 3300005366 Bacteria 18844
77 Ga0070659_100080397 3300005366 Bacteria 2602
78 Ga0070667_100116848 3300005367 Bacteria 2317
79 Ga0070709_10018837 3300005434 Bacteria 3983
80 Ga0070709_10020338 3300005434 Bacteria 3849
81 Ga0070709_10031911 3300005434 Bacteria 3173
82 Ga0070709_10040735 3300005434 Bacteria 2858
83 Ga0070709_10065352 3300005434 Bacteria 2329
84 Ga0070709_10087970 3300005434 Unclassified 2042
85 Ga0070709_10119214 3300005434 Bacteria 1786
86 Ga0070709_10162923 3300005434 Bacteria 1552
87 Ga0070709_10176908 3300005434 Bacteria 1495
88 Ga0070709_10206445 3300005434 Bacteria 1394
89 Ga0070709_10276903 3300005434 Bacteria 1218
90 Ga0070709_10472435 3300005434 Bacteria 948
91 Ga0070709_10751656 3300005434 Bacteria 762
92 Ga0070714_100000169 3300005435 Bacteria 52788
93 Ga0070714_100008519 3300005435 Bacteria 8016
94 Ga0070714_100020608 3300005435 Bacteria 5388
95 Ga0070714_100059174 3300005435 Bacteria 3284
96 Ga0070714_100072893 3300005435 Bacteria 2974
97 Ga0070714_100149551 3300005435 Bacteria 2103
98 Ga0070714_100174919 3300005435 Bacteria 1950
99 Ga0070714_100180387 3300005435 Bacteria 1921
100 Ga0070714_100214185 3300005435 Bacteria 1767
101 Ga0070714_100285751 3300005435 Bacteria 1534
102 Ga0070714_100299439 3300005435 Bacteria 1499
103 Ga0070714_100335812 3300005435 Bacteria 1416
104 Ga0070714_100350431 3300005435 Bacteria 1386
105 Ga0070714_100633047 3300005435 Unclassified 1029
106 Ga0070714_100832475 3300005435 Unclassified 894
107 Ga0070713_100000649 3300005436 Bacteria 22243
108 Ga0070713_100002519 3300005436 Bacteria 11974
109 Ga0070713_100005251 3300005436 Bacteria 8830
110 Ga0070713_100012465 3300005436 Bacteria 6237
111 Ga0070713_100020997 3300005436 Bacteria 5014
112 Ga0070713_100061733 3300005436 Bacteria 3136
113 Ga0070713_100068860 3300005436 Bacteria 2983
114 Ga0070713_100084009 3300005436 Unclassified 2723
115 Ga0070713_100086586 3300005436 Unclassified 2686
116 Ga0070713_100101904 3300005436 Bacteria 2488
117 Ga0070713_100136863 3300005436 Bacteria 2165
118 Ga0070713_100228716 3300005436 Bacteria 1690
119 Ga0070713_100272077 3300005436 Bacteria 1551
120 Ga0070713_100308576 3300005436 Bacteria 1458
121 Ga0070713_100425658 3300005436 Bacteria 1243
122 Ga0070713_100551494 3300005436 Bacteria 1091
123 Ga0070713_100559448 3300005436 Bacteria 1083
124 Ga0070713_100652762 3300005436 Bacteria 1002
125 Ga0070713_101459694 3300005436 Bacteria 664
126 Ga0070713_101687081 3300005436 Unclassified 615
127 Ga0070713_101754075 3300005436 Bacteria 602
128 Ga0070710_10027644 3300005437 Bacteria 3027
129 Ga0070710_10035124 3300005437 Unclassified 2732
130 Ga0070710_10069378 3300005437 Bacteria 2028
131 Ga0070710_10073573 3300005437 Bacteria 1976
132 Ga0070710_10082954 3300005437 Unclassified 1875
133 Ga0070710_10416500 3300005437 Bacteria 904
134 Ga0070711_100000293 3300005439 Bacteria 26001
135 Ga0070711_100001830 3300005439 Bacteria 11867
136 Ga0070711_100007650 3300005439 Bacteria 6580
137 Ga0070711_100054373 3300005439 Bacteria 2763
138 Ga0070711_100060645 3300005439 Bacteria 2630
139 Ga0070711_100065489 3300005439 Bacteria 2542
140 Ga0070711_100104622 3300005439 Bacteria 2065
141 Ga0070711_100283720 3300005439 Bacteria 1311
142 Ga0070711_100933380 3300005439 Bacteria 742
143 Ga0070711_101500636 3300005439 Unclassified 588
144 Ga0070705_100038418 3300005440 Unclassified 2708
145 Ga0070705_100107033 3300005440 Bacteria 1779
146 Ga0070705_100194634 3300005440 Bacteria 1385
147 Ga0070700_100366056 3300005441 Bacteria 1073
148 Ga0070694_100530115 3300005444 Bacteria 941
149 Ga0070708_100000242 3300005445 Bacteria 40613
150 Ga0070708_100001715 3300005445 Bacteria 16862
151 Ga0070708_100003584 3300005445 Bacteria 12182
152 Ga0070708_100006436 3300005445 Bacteria 9353
153 Ga0070708_100020572 3300005445 Bacteria 5568
154 Ga0070708_100086330 3300005445 Bacteria 2850
155 Ga0070663_100043712 3300005455 Bacteria 3154
156 Ga0070678_100071377 3300005456 Bacteria 2599
157 Ga0070678_100188708 3300005456 Bacteria 1693
158 Ga0070662_100004575 3300005457 Bacteria 8759
159 Ga0070662_100011008 3300005457 Bacteria 5959
160 Ga0070662_100268491 3300005457 Unclassified 1377
161 Ga0070662_100646416 3300005457 Bacteria 892
162 Ga0070681_10008506 3300005458 Bacteria 10048
163 Ga0070681_10012341 3300005458 Bacteria 8472
164 Ga0070681_10073861 3300005458 Bacteria 3372
165 Ga0070681_10074017 3300005458 Unclassified 3368
166 Ga0070681_10082353 3300005458 Bacteria 3173
167 Ga0070681_10155758 3300005458 Bacteria 2210
168 Ga0070681_10518012 3300005458 Bacteria 1106
169 Ga0070681_10654872 3300005458 Unclassified 965
170 Ga0068867_100001484 3300005459 Bacteria 16236
171 Ga0068867_100013571 3300005459 Bacteria 5769
172 Ga0068867_100024102 3300005459 Bacteria 4361
173 Ga0070685_10031930 3300005466 Bacteria 2946
174 Ga0070706_100001331 3300005467 Bacteria 26271
175 Ga0070706_100001385 3300005467 Bacteria 25705
176 Ga0070706_100002503 3300005467 Bacteria 18507
177 Ga0070706_100013794 3300005467 Bacteria 7474
178 Ga0070706_100044511 3300005467 Bacteria 4101
179 Ga0070706_100233521 3300005467 Unclassified 1717
180 Ga0070706_100280770 3300005467 Bacteria 1554
181 Ga0070707_100002130 3300005468 Bacteria 18942
182 Ga0070707_100002318 3300005468 Bacteria 18176
183 Ga0070707_100012306 3300005468 Bacteria 7988
184 Ga0070707_100137336 3300005468 Bacteria 2378
185 Ga0070707_100384795 3300005468 Bacteria 1363
186 Ga0070707_100400753 3300005468 Bacteria 1332
187 Ga0070698_100000589 3300005471 Bacteria 39008
188 Ga0070698_100000689 3300005471 Bacteria 36131
189 Ga0070698_100040140 3300005471 Bacteria 4813
190 Ga0070699_100000679 3300005518 Bacteria 31766
191 Ga0070699_100000716 3300005518 Bacteria 30815
192 Ga0070699_100025935 3300005518 Bacteria 5054
193 Ga0070699_100027280 3300005518 Bacteria 4928
194 Ga0070699_100639241 3300005518 Bacteria 971
195 Ga0070679_100074471 3300005530 Bacteria 3386
196 Ga0070679_100159877 3300005530 Bacteria 2227
197 Ga0070679_100398877 3300005530 Bacteria 1321
198 Ga0070679_100736401 3300005530 Unclassified 929
199 Ga0070679_101177436 3300005530 Bacteria 711
200 Ga0070684_100000037 3300005535 Bacteria 95058
201 Ga0070684_100083944 3300005535 Bacteria 2823
202 Ga0070684_100086086 3300005535 Bacteria 2788
203 Ga0070684_100128722 3300005535 Bacteria 2283
204 Ga0070684_100401329 3300005535 Unclassified 1264
205 Ga0070697_100000053 3300005536 Bacteria 88025
206 Ga0070697_100000280 3300005536 Bacteria 41171
207 Ga0070697_100000694 3300005536 Bacteria 25190
208 Ga0070697_100001256 3300005536 Bacteria 19162
209 Ga0070697_100013559 3300005536 Bacteria 6393
210 Ga0070697_100018478 3300005536 Bacteria 5496
211 Ga0070697_100111046 3300005536 Bacteria 2285
212 Ga0070697_100414907 3300005536 Bacteria 1169
213 Ga0070697_100430598 3300005536 Bacteria 1147
214 Ga0070697_101383730 3300005536 Unclassified 628
215 Ga0068853_100004040 3300005539 Bacteria 11293
216 Ga0070672_100003042 3300005543 Bacteria 10803
217 Ga0070672_100366589 3300005543 Bacteria 1230
218 Ga0070672_100462223 3300005543 Bacteria 1094
219 Ga0070686_100008692 3300005544 Bacteria 5690
220 Ga0070695_100032361 3300005545 Unclassified 3269
221 Ga0070695_100088098 3300005545 Bacteria 2066
222 Ga0070695_100192023 3300005545 Unclassified 1454
223 Ga0070696_100142696 3300005546 Bacteria 1752
224 Ga0070696_100164097 3300005546 Bacteria 1638
225 Ga0070696_100196285 3300005546 Bacteria 1504
226 Ga0070696_100441270 3300005546 Bacteria 1025
227 Ga0070693_100004450 3300005547 Bacteria 6626
228 Ga0070693_100034556 3300005547 Bacteria 2798
229 Ga0070693_100261979 3300005547 Unclassified 1150
230 Ga0070693_100702313 3300005547 Bacteria 741
231 Ga0070693_101079393 3300005547 Bacteria 611
232 Ga0070665_100023323 3300005548 Bacteria 6229
233 Ga0070704_100120474 3300005549 Bacteria 2015
234 Ga0068855_100010022 3300005563 Bacteria 11420
235 Ga0068855_100011722 3300005563 Bacteria 10595
236 Ga0068855_100012992 3300005563 Bacteria 10049
237 Ga0068855_100074528 3300005563 Bacteria 3941
238 Ga0068855_100080699 3300005563 Unclassified 3772
239 Ga0068855_100151046 3300005563 Bacteria 2641
240 Ga0068855_100248520 3300005563 Unclassified 1984
241 Ga0068855_100347599 3300005563 Bacteria 1634
242 Ga0068855_100449358 3300005563 Unclassified 1406
243 Ga0068855_100487674 3300005563 Bacteria 1341
244 Ga0068855_100972414 3300005563 Unclassified 893
245 Ga0070664_100000972 3300005564 Bacteria 22427
246 Ga0070664_100008272 3300005564 Bacteria 8414
247 Ga0070664_100019355 3300005564 Bacteria 5602
248 Ga0068857_100000259 3300005577 Bacteria 35729
249 Ga0068857_100000335 3300005577 Bacteria 32411
250 Ga0068857_100199313 3300005577 Unclassified 1825
251 Ga0068857_100314612 3300005577 Bacteria 1445
252 Ga0068857_100475411 3300005577 Bacteria 1171
253 Ga0068857_100580462 3300005577 Bacteria 1058
254 Ga0068857_100995258 3300005577 Bacteria 807
255 Ga0068854_100011053 3300005578 Bacteria 5860
256 Ga0068854_100023615 3300005578 Bacteria 4202
257 Ga0068854_100028231 3300005578 Unclassified 3875
258 Ga0068854_100033635 3300005578 Unclassified 3575
259 Ga0068854_100096525 3300005578 Unclassified 2209
260 Ga0068856_100000995 3300005614 Bacteria 30196
261 Ga0068856_100002426 3300005614 Bacteria 19184
262 Ga0068856_100003097 3300005614 Bacteria 16972
263 Ga0068856_100005963 3300005614 Bacteria 11992
264 Ga0068856_100006696 3300005614 Bacteria 11296
265 Ga0068856_100023013 3300005614 Bacteria 6058
266 Ga0068856_100035413 3300005614 Bacteria 4892
267 Ga0068856_100387787 3300005614 Bacteria 1417
268 Ga0068856_100551276 3300005614 Unclassified 1174
269 Ga0068856_100634798 3300005614 Bacteria 1089
270 Ga0068856_100646876 3300005614 Unclassified 1078
271 Ga0068856_100907641 3300005614 Bacteria 900
272 Ga0068856_102109757 3300005614 Bacteria 573
273 Ga0070702_100000387 3300005615 Bacteria 15639
274 Ga0070702_100070013 3300005615 Bacteria 2069
275 Ga0070702_100267006 3300005615 Bacteria 1168
276 Ga0068852_100009501 3300005616 Bacteria 7227
277 Ga0068852_100050228 3300005616 Bacteria 3572
278 Ga0068852_100145329 3300005616 Bacteria 2199
279 Ga0068852_100206105 3300005616 Bacteria 1863
280 Ga0068852_101254597 3300005616 Bacteria 762
281 Ga0068859_100014831 3300005617 Bacteria 7825
282 Ga0068859_100015248 3300005617 Bacteria 7717
283 Ga0068859_100094432 3300005617 Unclassified 3043
284 Ga0068859_100253500 3300005617 Bacteria 1850
285 Ga0068859_100298463 3300005617 Unclassified 1704
286 Ga0068859_100344748 3300005617 Bacteria 1584
287 Ga0068859_101027082 3300005617 Bacteria 906
288 Ga0068864_100003998 3300005618 Bacteria 12141
289 Ga0068864_100034805 3300005618 Bacteria 4286
290 Ga0068866_10000735 3300005718 Bacteria 14853
291 Ga0068866_10003232 3300005718 Bacteria 6714
292 Ga0068866_10008403 3300005718 Bacteria 4351
293 Ga0068866_10036584 3300005718 Bacteria 2406
294 Ga0068866_10044217 3300005718 Bacteria 2227
295 Ga0068866_10367819 3300005718 Unclassified 918
296 Ga0068861_100013572 3300005719 Bacteria 5702
297 Ga0068861_100086221 3300005719 Unclassified 2468
298 Ga0068861_100242727 3300005719 Bacteria 1533
299 Ga0068851_10004069 3300005834 Bacteria 6566
300 Ga0068851_10006547 3300005834 Bacteria 5322
301 Ga0068851_10010242 3300005834 Unclassified 4372
302 Ga0068851_10099054 3300005834 Bacteria 1544
303 Ga0068870_10026876 3300005840 Bacteria 2873
304 Ga0068870_10319471 3300005840 Bacteria 986
305 Ga0068863_100031255 3300005841 Bacteria 5083
306 Ga0068863_100058799 3300005841 Unclassified 3638
307 Ga0068863_100085787 3300005841 Unclassified 2983
308 Ga0068863_100301358 3300005841 Bacteria 1555
309 Ga0068863_100338804 3300005841 Unclassified 1463
310 Ga0068863_101176067 3300005841 Bacteria 772
311 Ga0068858_100000404 3300005842 Bacteria 44997
312 Ga0068858_100004032 3300005842 Bacteria 14492
313 Ga0068858_100274148 3300005842 Bacteria 1606
314 Ga0068858_100473751 3300005842 Bacteria 1208
315 Ga0068860_100012091 3300005843 Bacteria 8501
316 Ga0068860_100038625 3300005843 Unclassified 4567
317 Ga0068860_100405138 3300005843 Bacteria 1350
318 Ga0068862_100151271 3300005844 Bacteria 2066
319 Ga0081540_1093264 3300005983 Bacteria 1319
320 Ga0070717_10001683 3300006028 Bacteria 15379
321 Ga0070717_10004512 3300006028 Bacteria 10057
322 Ga0070717_10005108 3300006028 Bacteria 9573
323 Ga0070717_10005704 3300006028 Bacteria 9102
324 Ga0070717_10011319 3300006028 Bacteria 6771
325 Ga0070717_10032487 3300006028 Bacteria 4206
326 Ga0070717_10051470 3300006028 Unclassified 3390
327 Ga0070717_10064277 3300006028 Bacteria 3047
328 Ga0070717_10111341 3300006028 Unclassified 2336
329 Ga0070717_10148095 3300006028 Bacteria 2029
330 Ga0070717_10207105 3300006028 Bacteria 1720
331 Ga0070717_10221443 3300006028 Unclassified 1663
332 Ga0070717_10237926 3300006028 Bacteria 1605
333 Ga0070717_10255225 3300006028 Bacteria 1550
334 Ga0070717_10262381 3300006028 Bacteria 1528
335 Ga0070717_10315890 3300006028 Bacteria 1391
336 Ga0070717_10342052 3300006028 Bacteria 1336
337 Ga0070717_10423608 3300006028 Bacteria 1197
338 Ga0070717_10752709 3300006028 Unclassified 886
339 Ga0070717_11288950 3300006028 Bacteria 664
340 Ga0070717_11341997 3300006028 Bacteria 650
341 Ga0070715_10002128 3300006163 Bacteria 5989
342 Ga0070715_10013154 3300006163 Bacteria 3032
343 Ga0070715_10094090 3300006163 Bacteria 1385
344 Ga0070715_10099475 3300006163 Unclassified 1354
345 Ga0070715_10112816 3300006163 Bacteria 1285
346 Ga0070715_10178923 3300006163 Bacteria 1062
347 Ga0070715_10320858 3300006163 Bacteria 836
348 Ga0070715_10480664 3300006163 Unclassified 707
349 Ga0070715_10802027 3300006163 Unclassified 571
350 Ga0070716_100013165 3300006173 Bacteria 4212
351 Ga0070716_100015752 3300006173 Bacteria 3890
352 Ga0070716_100026282 3300006173 Unclassified 3116
353 Ga0070716_100034551 3300006173 Unclassified 2773
354 Ga0070716_100039117 3300006173 Bacteria 2630
355 Ga0070716_100155544 3300006173 Bacteria 1476
356 Ga0070716_100181495 3300006173 Bacteria 1382
357 Ga0070716_100215542 3300006173 Bacteria 1286
358 Ga0070716_100228980 3300006173 Bacteria 1253
359 Ga0070716_100252626 3300006173 Bacteria 1202
360 Ga0070716_100272120 3300006173 Bacteria 1164
361 Ga0070716_100319623 3300006173 Bacteria 1087
362 Ga0070716_100913697 3300006173 Bacteria 688
363 Ga0070712_100000188 3300006175 Bacteria 34294
364 Ga0070712_100000723 3300006175 Bacteria 19476
365 Ga0070712_100026038 3300006175 Bacteria 3892
366 Ga0070712_100026743 3300006175 Bacteria 3847
367 Ga0070712_100027377 3300006175 Bacteria 3807
368 Ga0070712_100027607 3300006175 Bacteria 3791
369 Ga0070712_100040986 3300006175 Unclassified 3177
370 Ga0070712_100072539 3300006175 Bacteria 2466
371 Ga0070712_100103103 3300006175 Bacteria 2114
372 Ga0070712_100260476 3300006175 Unclassified 1389
373 Ga0070712_100288502 3300006175 Bacteria 1324
374 Ga0070712_100496834 3300006175 Bacteria 1022
375 Ga0070712_100624568 3300006175 Unclassified 914
376 Ga0070712_101013852 3300006175 Bacteria 719
377 Ga0097621_100013631 3300006237 Bacteria 6066
378 Ga0097621_100024654 3300006237 Bacteria 4700
379 Ga0097621_100039766 3300006237 Bacteria 3779
380 Ga0097621_100076590 3300006237 Unclassified 2775
381 Ga0097621_100121598 3300006237 Bacteria 2214
382 Ga0097621_100139551 3300006237 Bacteria 2070
383 Ga0097621_100158187 3300006237 Bacteria 1946
384 Ga0097621_100459508 3300006237 Unclassified 1148
385 Ga0097621_100565154 3300006237 Unclassified 1036
386 Ga0097621_100567341 3300006237 Bacteria 1034
387 Ga0097621_101100404 3300006237 Unclassified 746
388 Ga0068871_100000389 3300006358 Bacteria 30917
389 Ga0068871_100007884 3300006358 Bacteria 7635
390 Ga0068871_100034094 3300006358 Bacteria 4037
391 Ga0068871_100043390 3300006358 Bacteria 3612
392 Ga0068871_100049645 3300006358 Bacteria 3392
393 Ga0068871_100049912 3300006358 Bacteria 3383
394 Ga0068871_100091844 3300006358 Bacteria 2531
395 Ga0068871_100314305 3300006358 Bacteria 1378
396 Ga0068871_100541172 3300006358 Bacteria 1054
397 Ga0075431_100508146 3300006847 Bacteria 1196
398 Ga0075433_10000636 3300006852 Bacteria 23485
399 Ga0075433_10777035 3300006852 Bacteria 837
400 Ga0075434_100001288 3300006871 Bacteria 20919
401 Ga0075434_100001829 3300006871 Bacteria 18360
402 Ga0075434_100035785 3300006871 Unclassified 4909
403 Ga0068865_100044263 3300006881 Bacteria 3046
404 Ga0068865_100235879 3300006881 Bacteria 1437
405 Ga0068865_100441121 3300006881 Unclassified 1074
406 Ga0075436_100003222 3300006914 Bacteria 11191
407 Ga0075436_100006615 3300006914 Bacteria 7943
408 Ga0075436_100007751 3300006914 Bacteria 7342
409 Ga0075436_100013183 3300006914 Bacteria 5668
410 Ga0075436_100046263 3300006914 Bacteria 3001
411 Ga0075436_100088486 3300006914 Bacteria 2151
412 Ga0075436_100139706 3300006914 Bacteria 1702
413 Ga0075436_100362595 3300006914 Bacteria 1046
414 Ga0075436_100448902 3300006914 Bacteria 939
415 Ga0075436_100526995 3300006914 Bacteria 866
416 Ga0097620_100014831 3300006931 Bacteria 7825
417 Ga0097620_100015253 3300006931 Bacteria 7717
418 Ga0097620_100094426 3300006931 Unclassified 3043
419 Ga0097620_100253503 3300006931 Bacteria 1850
420 Ga0097620_100298470 3300006931 Unclassified 1704
421 Ga0097620_100344743 3300006931 Bacteria 1584
422 Ga0097620_101026981 3300006931 Bacteria 906
423 Ga0097620_101680699 3300006931 Bacteria 701
424 Ga0075435_100002192 3300007076 Bacteria 12887
425 Ga0075435_100016802 3300007076 Bacteria 5522
426 Ga0075435_100101237 3300007076 Unclassified 2387
427 Ga0075435_100427608 3300007076 Bacteria 1141
428 Ga0075435_101252867 3300007076 Bacteria 649
429 Ga0099794_10044594 3300007265 Bacteria 2120
430 Ga0099794_10074135 3300007265 Bacteria 1671
431 Ga0099794_10402595 3300007265 Unclassified 715
432 Ga0099795_10030520 3300007788 Unclassified 1851
433 Ga0105240_10055750 3300009093 Bacteria 4948
434 Ga0105240_10061239 3300009093 Bacteria 4690
435 Ga0105240_10098841 3300009093 Bacteria 3553
436 Ga0105240_10147828 3300009093 Bacteria 2802
437 Ga0105240_10197359 3300009093 Bacteria 2361
438 Ga0105240_10205854 3300009093 Bacteria 2303
439 Ga0105240_10259198 3300009093 Bacteria 2007
440 Ga0105240_10519746 3300009093 Bacteria 1321
441 Ga0105240_10580303 3300009093 Bacteria 1237
442 Ga0105240_10581698 3300009093 Bacteria 1235
443 Ga0105240_10775099 3300009093 Bacteria 1041
444 Ga0105240_10819970 3300009093 Unclassified 1006
445 Ga0105240_11018321 3300009093 Bacteria 885
446 Ga0105240_11148092 3300009093 Bacteria 825
447 Ga0105240_11780744 3300009093 Bacteria 642
448 Ga0111539_10407355 3300009094 Bacteria 1584
449 Ga0111539_11498579 3300009094 Bacteria 782
450 Ga0105245_10003248 3300009098 Bacteria 14574
451 Ga0105245_10007752 3300009098 Bacteria 9401
452 Ga0105245_10007882 3300009098 Bacteria 9316
453 Ga0105245_10018174 3300009098 Bacteria 6148
454 Ga0105245_10052722 3300009098 Bacteria 3648
455 Ga0105245_10064552 3300009098 Bacteria 3309
456 Ga0105245_10093343 3300009098 Unclassified 2773
457 Ga0105245_10179724 3300009098 Bacteria 2020
458 Ga0105245_10423149 3300009098 Bacteria 1335
459 Ga0105245_10481162 3300009098 Bacteria 1255
460 Ga0105245_10778165 3300009098 Bacteria 994
461 Ga0105247_10001594 3300009101 Bacteria 16066
462 Ga0105247_10017504 3300009101 Bacteria 4299
463 Ga0114129_10061374 3300009147 Bacteria 5253
464 Ga0114129_10165885 3300009147 Bacteria 3014
465 Ga0105243_10626305 3300009148 Unclassified 1039
466 Ga0105243_11377270 3300009148 Bacteria 725
467 Ga0105241_10004558 3300009174 Bacteria 10250
468 Ga0105241_10024348 3300009174 Bacteria 4495
469 Ga0105241_10043109 3300009174 Bacteria 3416
470 Ga0105241_10049184 3300009174 Bacteria 3210
471 Ga0105241_10070311 3300009174 Bacteria 2716
472 Ga0105241_10094522 3300009174 Bacteria 2364
473 Ga0105241_10258229 3300009174 Bacteria 1480
474 Ga0105241_10397954 3300009174 Unclassified 1207
475 Ga0105241_10407320 3300009174 Bacteria 1194
476 Ga0105241_11769001 3300009174 Unclassified 602
477 Ga0105242_10006980 3300009176 Bacteria 8717
478 Ga0105242_10171301 3300009176 Bacteria 1908
479 Ga0105242_10274578 3300009176 Bacteria 1528
480 Ga0105242_10449797 3300009176 Unclassified 1214
481 Ga0105242_11373422 3300009176 Unclassified 733
482 Ga0105248_10011433 3300009177 Bacteria 9783
483 Ga0105248_10026687 3300009177 Bacteria 6422
484 Ga0105248_10086566 3300009177 Unclassified 3525
485 Ga0105248_10099247 3300009177 Bacteria 3281
486 Ga0105248_10283297 3300009177 Bacteria 1866
487 Ga0105248_10570011 3300009177 Bacteria 1277
488 Ga0105248_10872668 3300009177 Bacteria 1016
489 Ga0105237_10006364 3300009545 Bacteria 13118
490 Ga0105237_10013796 3300009545 Bacteria 8457
491 Ga0105237_10045567 3300009545 Bacteria 4412
492 Ga0105237_10072667 3300009545 Bacteria 3433
493 Ga0105237_10075837 3300009545 Bacteria 3353
494 Ga0105237_10216179 3300009545 Unclassified 1917
495 Ga0105237_10273158 3300009545 Bacteria 1693
496 Ga0105237_10285608 3300009545 Bacteria 1653
497 Ga0105237_10321170 3300009545 Unclassified 1552
498 Ga0105237_10410467 3300009545 Bacteria 1359
499 Ga0105237_10653280 3300009545 Bacteria 1058
500 Ga0105237_10691100 3300009545 Bacteria 1027
501 Ga0105237_10723015 3300009545 Unclassified 1002
502 Ga0105237_10899599 3300009545 Unclassified 892
503 Ga0105237_11092496 3300009545 Bacteria 804
504 Ga0105237_11725016 3300009545 Bacteria 634
505 Ga0105238_10025430 3300009551 Bacteria 6035
506 Ga0105238_10138524 3300009551 Unclassified 2411
507 Ga0105238_10157265 3300009551 Bacteria 2248
508 Ga0105238_10206998 3300009551 Bacteria 1938
509 Ga0105238_10235107 3300009551 Bacteria 1810
510 Ga0105238_10249507 3300009551 Bacteria 1753
511 Ga0105249_10041603 3300009553 Bacteria 4178
512 Ga0105249_10290290 3300009553 Bacteria 1637
513 Ga0105249_10308379 3300009553 Unclassified 1590
514 Ga0099796_10028145 3300010159 Bacteria 1801
515 Ga0105239_10003652 3300010375 Bacteria 18811
516 Ga0105239_10066583 3300010375 Bacteria 3957
517 Ga0105239_10070525 3300010375 Unclassified 3839
518 Ga0105239_10087659 3300010375 Bacteria 3431
519 Ga0105239_10095971 3300010375 Unclassified 3275
520 Ga0105239_10370397 3300010375 Bacteria 1619
521 Ga0105239_10713671 3300010375 Bacteria 1147
522 Ga0105239_11270780 3300010375 Bacteria 849
523 Ga0105239_12512498 3300010375 Unclassified 600
524 Ga0105246_10004431 3300011119 Bacteria 8546
525 Ga0105246_10251252 3300011119 Unclassified 1403
526 Ga0105246_10487443 3300011119 Bacteria 1044
527 Ga0105246_10726030 3300011119 Unclassified 873
528 Ga0105246_10810470 3300011119 Bacteria 831
529 Ga0157324_1004648 3300012506 Unclassified 959
530 Ga0157373_10002519 3300013100 Bacteria 13955
531 Ga0157373_10007083 3300013100 Bacteria 8360
532 Ga0157373_10030097 3300013100 Unclassified 3907
533 Ga0157373_10108259 3300013100 Bacteria 1954
534 Ga0157373_10116116 3300013100 Bacteria 1881
535 Ga0157373_10182073 3300013100 Bacteria 1479
536 Ga0157373_10338975 3300013100 Unclassified 1071
537 Ga0157373_10470852 3300013100 Bacteria 906
538 Ga0157371_10008414 3300013102 Bacteria 8219
539 Ga0157371_10009414 3300013102 Bacteria 7689
540 Ga0157371_10049901 3300013102 Bacteria 2972
541 Ga0157370_10045645 3300013104 Bacteria 4202
542 Ga0157370_10080214 3300013104 Bacteria 3072
543 Ga0157370_10108342 3300013104 Bacteria 2598
544 Ga0157370_10209613 3300013104 Unclassified 1806
545 Ga0157370_10294890 3300013104 Bacteria 1497
546 Ga0157370_10692587 3300013104 Bacteria 930
547 Ga0157369_10017191 3300013105 Bacteria 8127
548 Ga0157369_10060408 3300013105 Unclassified 4087
549 Ga0157369_10122971 3300013105 Bacteria 2753
550 Ga0157369_10127242 3300013105 Bacteria 2700
551 Ga0157369_10258603 3300013105 Bacteria 1816
552 Ga0157369_10363215 3300013105 Bacteria 1503
553 Ga0157369_10515747 3300013105 Bacteria 1237
554 Ga0157369_11047837 3300013105 Bacteria 834
555 Ga0157374_10000634 3300013296 Bacteria 30935
556 Ga0157374_10001978 3300013296 Bacteria 17189
557 Ga0157374_10002353 3300013296 Bacteria 15957
558 Ga0157374_10007704 3300013296 Bacteria 9195
559 Ga0157374_10020608 3300013296 Bacteria 5854
560 Ga0157374_10059771 3300013296 Unclassified 3565
561 Ga0157374_10113865 3300013296 Bacteria 2603
562 Ga0157374_10140007 3300013296 Unclassified 2348
563 Ga0157374_10392430 3300013296 Unclassified 1383
564 Ga0157374_10650860 3300013296 Bacteria 1066
565 Ga0157374_11987540 3300013296 Bacteria 608
566 Ga0157378_10000202 3300013297 Bacteria 58070
567 Ga0157378_10000725 3300013297 Bacteria 30797
568 Ga0157378_10001795 3300013297 Bacteria 19272
569 Ga0157378_10012660 3300013297 Bacteria 7380
570 Ga0157378_10072136 3300013297 Bacteria 3102
571 Ga0157378_10090402 3300013297 Bacteria 2782
572 Ga0157378_10340913 3300013297 Unclassified 1461
573 Ga0157378_10543179 3300013297 Bacteria 1166
574 Ga0157378_10717651 3300013297 Bacteria 1020
575 Ga0157378_10754322 3300013297 Unclassified 996
576 Ga0157378_11058524 3300013297 Bacteria 847
577 Ga0157378_11443155 3300013297 Bacteria 732
578 Ga0163162_10009643 3300013306 Bacteria 9392
579 Ga0163162_10040280 3300013306 Bacteria 4671
580 Ga0163162_10055031 3300013306 Bacteria 4004
581 Ga0163162_10070409 3300013306 Bacteria 3549
582 Ga0163162_10112681 3300013306 Unclassified 2819
583 Ga0163162_10152829 3300013306 Bacteria 2426
584 Ga0163162_10191003 3300013306 Bacteria 2176
585 Ga0163162_10314703 3300013306 Unclassified 1698
586 Ga0163162_10759984 3300013306 Bacteria 1088
587 Ga0163162_11004324 3300013306 Bacteria 943
588 Ga0163162_11046858 3300013306 Bacteria 923
589 Ga0163162_11072492 3300013306 Bacteria 912
590 Ga0163162_11162495 3300013306 Bacteria 875
591 Ga0163162_12053660 3300013306 Bacteria 655
592 Ga0157372_10000565 3300013307 Bacteria 40736
593 Ga0157372_10002050 3300013307 Bacteria 21927
594 Ga0157372_10003078 3300013307 Bacteria 17961
595 Ga0157372_10015430 3300013307 Bacteria 8187
596 Ga0157372_10016466 3300013307 Bacteria 7935
597 Ga0157372_10022661 3300013307 Bacteria 6798
598 Ga0157372_10030069 3300013307 Bacteria 5939
599 Ga0157372_10053833 3300013307 Bacteria 4487
600 Ga0157372_10054469 3300013307 Bacteria 4462
601 Ga0157372_10059528 3300013307 Bacteria 4272
602 Ga0157372_10188739 3300013307 Bacteria 2387
603 Ga0157372_10352323 3300013307 Bacteria 1715
604 Ga0157372_10390444 3300013307 Bacteria 1622
605 Ga0157372_11356269 3300013307 Bacteria 820
606 Ga0157375_10073401 3300013308 Bacteria 3440
607 Ga0157375_10248755 3300013308 Unclassified 1938
608 Ga0157375_10335458 3300013308 Unclassified 1677
609 Ga0157375_10657732 3300013308 Bacteria 1204
610 Ga0157375_11383542 3300013308 Bacteria 829
611 Ga0157375_11644918 3300013308 Bacteria 760
612 Ga0163163_10003044 3300014325 Bacteria 14194
613 Ga0163163_10040832 3300014325 Bacteria 4533
614 Ga0163163_10051769 3300014325 Bacteria 4048
615 Ga0163163_10192569 3300014325 Bacteria 2087
616 Ga0163163_10340898 3300014325 Unclassified 1554
617 Ga0163163_10445884 3300014325 Bacteria 1354
618 Ga0163163_10563764 3300014325 Bacteria 1202
619 Ga0163163_10937098 3300014325 Bacteria 929
620 Ga0163163_11393492 3300014325 Bacteria 763
621 Ga0163163_11597050 3300014325 Bacteria 713
622 Ga0157380_11681187 3300014326 Bacteria 692
623 Ga0182008_10004678 3300014497 Bacteria 7952
624 Ga0182008_10020896 3300014497 Unclassified 3368
625 Ga0182008_10158242 3300014497 Bacteria 1139
626 Ga0157377_10006706 3300014745 Bacteria 5512
627 Ga0157377_10327853 3300014745 Bacteria 1019
628 Ga0157377_10354088 3300014745 Bacteria 986
629 Ga0157377_11015507 3300014745 Bacteria 629
630 Ga0157379_10003409 3300014968 Bacteria 13441
631 Ga0157379_10034772 3300014968 Bacteria 4494
632 Ga0157379_10151447 3300014968 Bacteria 2092
633 Ga0157379_10171237 3300014968 Bacteria 1960
634 Ga0157379_10349408 3300014968 Bacteria 1353
635 Ga0157379_10656943 3300014968 Unclassified 982
636 Ga0157379_11279596 3300014968 Bacteria 708
637 Ga0157376_10004658 3300014969 Bacteria 9559
638 Ga0157376_10029519 3300014969 Bacteria 4368
639 Ga0157376_10069210 3300014969 Bacteria 2991
640 Ga0157376_10247471 3300014969 Bacteria 1663
641 Ga0157376_10292498 3300014969 Bacteria 1538
642 Ga0157376_10386907 3300014969 Bacteria 1349
643 Ga0157376_10564970 3300014969 Bacteria 1128
644 Ga0157376_11052914 3300014969 Bacteria 838
645 Ga0182007_10024426 3300015262 Bacteria 2114
646 Ga0182007_10227876 3300015262 Bacteria 661
647 Ga0182005_1003699 3300015265 Bacteria 5105
648 Ga0182005_1097660 3300015265 Bacteria 821
649 Ga0163161_10032069 3300017792 Bacteria 3748
650 Ga0163161_10733077 3300017792 Unclassified 825
651 Ga0213876_10246687 3300021384 Bacteria 949
652 Ga0213875_10004172 3300021388 Bacteria 7999
653 Ga0224712_10480315 3300022467 Bacteria 599
654 Ga0224570_100116 3300022730 Bacteria 5034
655 Ga0224569_100063 3300022732 Bacteria 6837
656 Ga0224569_103169 3300022732 Bacteria 1296
657 Ga0224571_100789 3300022734 Bacteria 1866
658 Ga0224572_1015389 3300024225 Bacteria 1464
659 Ga0224572_1018281 3300024225 Bacteria 1347
660 Ga0224572_1037013 3300024225 Unclassified 923
661 Ga0224572_1063119 3300024225 Bacteria 685
662 Ga0228598_1000002 3300024227 Bacteria 37716
663 Ga0228598_1000333 3300024227 Bacteria 9259
664 Ga0228598_1005227 3300024227 Bacteria 2724
665 Ga0207697_10014218 3300025315 Unclassified 3307
666 Ga0207656_10002371 3300025321 Bacteria 6326
667 Ga0207692_10024383 3300025898 Bacteria 2812
668 Ga0207692_10028069 3300025898 Bacteria 2657
669 Ga0207692_10062910 3300025898 Unclassified 1927
670 Ga0207692_10176892 3300025898 Unclassified 1241
671 Ga0207692_10200597 3300025898 Bacteria 1173
672 Ga0207692_10241162 3300025898 Bacteria 1080
673 Ga0207692_10598833 3300025898 Bacteria 708
674 Ga0207692_10683838 3300025898 Bacteria 665
675 Ga0207692_10867374 3300025898 Unclassified 593
676 Ga0207642_10004640 3300025899 Unclassified 4438
677 Ga0207642_10017427 3300025899 Bacteria 2731
678 Ga0207642_10029862 3300025899 Bacteria 2263
679 Ga0207642_10475266 3300025899 Bacteria 761
680 Ga0207710_10023501 3300025900 Bacteria 2649
681 Ga0207710_10097775 3300025900 Unclassified 1381
682 Ga0207710_10113691 3300025900 Bacteria 1287
683 Ga0207688_10055000 3300025901 Bacteria 2233
684 Ga0207680_10081689 3300025903 Bacteria 2032
685 Ga0207680_10236894 3300025903 Unclassified 1256
686 Ga0207680_10393459 3300025903 Bacteria 979
687 Ga0207647_10013732 3300025904 Bacteria 5608
688 Ga0207647_10017367 3300025904 Unclassified 4891
689 Ga0207647_10029904 3300025904 Bacteria 3519
690 Ga0207685_10008705 3300025905 Bacteria 2908
691 Ga0207685_10036045 3300025905 Bacteria 1810
692 Ga0207685_10090705 3300025905 Bacteria 1286
693 Ga0207685_10211595 3300025905 Unclassified 917
694 Ga0207685_10385944 3300025905 Bacteria 715
695 Ga0207699_10010406 3300025906 Bacteria 4667
696 Ga0207699_10013470 3300025906 Unclassified 4188
697 Ga0207699_10026320 3300025906 Bacteria 3204
698 Ga0207699_10074634 3300025906 Unclassified 2084
699 Ga0207699_10079595 3300025906 Bacteria 2028
700 Ga0207699_10120186 3300025906 Bacteria 1698
701 Ga0207699_10124813 3300025906 Bacteria 1670
702 Ga0207699_10311647 3300025906 Bacteria 1101
703 Ga0207699_10463961 3300025906 Bacteria 910
704 Ga0207699_10480103 3300025906 Bacteria 895
705 Ga0207699_10742188 3300025906 Bacteria 720
706 Ga0207645_10000125 3300025907 Bacteria 58051
707 Ga0207645_10142836 3300025907 Unclassified 1560
708 Ga0207645_10483605 3300025907 Bacteria 837
709 Ga0207643_10000488 3300025908 Bacteria 25463
710 Ga0207643_10376564 3300025908 Unclassified 894
711 Ga0207705_10024329 3300025909 Unclassified 4324
712 Ga0207705_10449652 3300025909 Bacteria 999
713 Ga0207684_10000223 3300025910 Bacteria 87514
714 Ga0207684_10003613 3300025910 Bacteria 15050
715 Ga0207684_10005360 3300025910 Bacteria 11848
716 Ga0207684_10027576 3300025910 Bacteria 4837
717 Ga0207684_10051827 3300025910 Bacteria 3482
718 Ga0207684_10503490 3300025910 Bacteria 1038
719 Ga0207654_10003381 3300025911 Bacteria 8076
720 Ga0207654_10008923 3300025911 Bacteria 5086
721 Ga0207654_10012212 3300025911 Bacteria 4397
722 Ga0207654_10018603 3300025911 Bacteria 3649
723 Ga0207654_10057660 3300025911 Bacteria 2258
724 Ga0207654_10059531 3300025911 Bacteria 2228
725 Ga0207654_10078327 3300025911 Bacteria 1983
726 Ga0207654_10473775 3300025911 Bacteria 881
727 Ga0207654_10597928 3300025911 Unclassified 787
728 Ga0207707_10011464 3300025912 Bacteria 7720
729 Ga0207707_10014133 3300025912 Bacteria 6956
730 Ga0207707_10054384 3300025912 Unclassified 3485
731 Ga0207707_10063047 3300025912 Bacteria 3226
732 Ga0207707_10429255 3300025912 Unclassified 1132
733 Ga0207695_10006382 3300025913 Bacteria 15343
734 Ga0207695_10006994 3300025913 Bacteria 14477
735 Ga0207695_10018543 3300025913 Bacteria 8041
736 Ga0207695_10074781 3300025913 Bacteria 3448
737 Ga0207695_10131230 3300025913 Bacteria 2463
738 Ga0207695_10134629 3300025913 Bacteria 2425
739 Ga0207695_10136999 3300025913 Bacteria 2400
740 Ga0207695_10143928 3300025913 Bacteria 2330
741 Ga0207695_10276584 3300025913 Bacteria 1573
742 Ga0207695_10501488 3300025913 Bacteria 1096
743 Ga0207695_10556484 3300025913 Bacteria 1028
744 Ga0207695_10652576 3300025913 Unclassified 933
745 Ga0207695_10754790 3300025913 Bacteria 853
746 Ga0207671_10006781 3300025914 Bacteria 10122
747 Ga0207671_10011713 3300025914 Bacteria 7106
748 Ga0207671_10016797 3300025914 Bacteria 5673
749 Ga0207671_10346429 3300025914 Bacteria 1178
750 Ga0207671_10926364 3300025914 Unclassified 688
751 Ga0207693_10000524 3300025915 Bacteria 34688
752 Ga0207693_10000961 3300025915 Bacteria 25847
753 Ga0207693_10008223 3300025915 Bacteria 8543
754 Ga0207693_10013230 3300025915 Bacteria 6658
755 Ga0207693_10014832 3300025915 Bacteria 6259
756 Ga0207693_10023945 3300025915 Bacteria 4847
757 Ga0207693_10075765 3300025915 Bacteria 2635
758 Ga0207693_10119681 3300025915 Bacteria 2068
759 Ga0207693_10171491 3300025915 Bacteria 1708
760 Ga0207693_10938887 3300025915 Bacteria 663
761 Ga0207663_10001734 3300025916 Bacteria 10244
762 Ga0207663_10001859 3300025916 Bacteria 9984
763 Ga0207663_10004743 3300025916 Bacteria 6793
764 Ga0207663_10015680 3300025916 Bacteria 4187
765 Ga0207663_10026236 3300025916 Bacteria 3379
766 Ga0207663_10028036 3300025916 Bacteria 3291
767 Ga0207663_10125516 3300025916 Bacteria 1765
768 Ga0207663_10138418 3300025916 Bacteria 1692
769 Ga0207663_10155129 3300025916 Bacteria 1610
770 Ga0207663_10210328 3300025916 Bacteria 1409
771 Ga0207663_10270634 3300025916 Unclassified 1258
772 Ga0207663_10593226 3300025916 Bacteria 870
773 Ga0207663_10688618 3300025916 Bacteria 809
774 Ga0207660_10098507 3300025917 Unclassified 2181
775 Ga0207660_10449225 3300025917 Bacteria 1042
776 Ga0207660_10607143 3300025917 Bacteria 891
777 Ga0207660_10607628 3300025917 Unclassified 891
778 Ga0207657_10000242 3300025919 Bacteria 57883
779 Ga0207657_10004544 3300025919 Bacteria 14660
780 Ga0207657_10540098 3300025919 Unclassified 912
781 Ga0207649_10000177 3300025920 Bacteria 52361
782 Ga0207649_10017954 3300025920 Bacteria 4013
783 Ga0207649_10135827 3300025920 Unclassified 1676
784 Ga0207652_10051559 3300025921 Bacteria 3528
785 Ga0207652_10085723 3300025921 Unclassified 2760
786 Ga0207652_10178854 3300025921 Bacteria 1906
787 Ga0207652_10204269 3300025921 Bacteria 1778
788 Ga0207652_10229348 3300025921 Bacteria 1673
789 Ga0207652_10300171 3300025921 Unclassified 1450
790 Ga0207652_11013346 3300025921 Unclassified 729
791 Ga0207646_10000348 3300025922 Bacteria 62738
792 Ga0207646_10001267 3300025922 Bacteria 31649
793 Ga0207646_10033930 3300025922 Bacteria 4612
794 Ga0207646_10180094 3300025922 Bacteria 1909
795 Ga0207646_10519122 3300025922 Bacteria 1072
796 Ga0207681_10137815 3300025923 Unclassified 1813
797 Ga0207681_10274769 3300025923 Unclassified 1324
798 Ga0207694_10019580 3300025924 Bacteria 5117
799 Ga0207694_10078313 3300025924 Bacteria 2591
800 Ga0207694_10152856 3300025924 Unclassified 1860
801 Ga0207694_10158395 3300025924 Bacteria 1828
802 Ga0207694_10164503 3300025924 Bacteria 1793
803 Ga0207694_10333271 3300025924 Unclassified 1254
804 Ga0207650_10000072 3300025925 Bacteria 137765
805 Ga0207650_10000078 3300025925 Bacteria 130954
806 Ga0207650_10020813 3300025925 Bacteria 4632
807 Ga0207650_10259650 3300025925 Bacteria 1409
808 Ga0207650_10376014 3300025925 Bacteria 1172
809 Ga0207659_10092620 3300025926 Unclassified 2260
810 Ga0207659_10138410 3300025926 Unclassified 1887
811 Ga0207659_10143413 3300025926 Bacteria 1857
812 Ga0207659_10683307 3300025926 Bacteria 878
813 Ga0207659_11067929 3300025926 Bacteria 695
814 Ga0207687_10001734 3300025927 Bacteria 15023
815 Ga0207687_10004355 3300025927 Bacteria 9444
816 Ga0207687_10042892 3300025927 Bacteria 3115
817 Ga0207687_10211196 3300025927 Bacteria 1523
818 Ga0207687_10335612 3300025927 Bacteria 1227
819 Ga0207687_10557002 3300025927 Bacteria 962
820 Ga0207700_10001427 3300025928 Bacteria 13541
821 Ga0207700_10021787 3300025928 Bacteria 4382
822 Ga0207700_10022935 3300025928 Bacteria 4292
823 Ga0207700_10027238 3300025928 Unclassified 4000
824 Ga0207700_10028863 3300025928 Bacteria 3909
825 Ga0207700_10034336 3300025928 Bacteria 3641
826 Ga0207700_10041527 3300025928 Bacteria 3366
827 Ga0207700_10063437 3300025928 Bacteria 2810
828 Ga0207700_10104271 3300025928 Bacteria 2269
829 Ga0207700_10104872 3300025928 Unclassified 2263
830 Ga0207700_10106753 3300025928 Bacteria 2245
831 Ga0207700_10191786 3300025928 Bacteria 1717
832 Ga0207700_10206384 3300025928 Bacteria 1659
833 Ga0207700_10207494 3300025928 Bacteria 1654
834 Ga0207700_10221360 3300025928 Bacteria 1604
835 Ga0207700_10259524 3300025928 Bacteria 1487
836 Ga0207700_10428458 3300025928 Unclassified 1163
837 Ga0207700_10483438 3300025928 Bacteria 1094
838 Ga0207700_10562919 3300025928 Bacteria 1012
839 Ga0207700_10652505 3300025928 Bacteria 938
840 Ga0207700_11002775 3300025928 Bacteria 747
841 Ga0207700_11480480 3300025928 Bacteria 603
842 Ga0207700_11604665 3300025928 Bacteria 575
843 Ga0207664_10035117 3300025929 Bacteria 3866
844 Ga0207664_10049398 3300025929 Unclassified 3312
845 Ga0207664_10055328 3300025929 Bacteria 3148
846 Ga0207664_10064901 3300025929 Bacteria 2922
847 Ga0207664_10073009 3300025929 Bacteria 2768
848 Ga0207664_10119385 3300025929 Bacteria 2204
849 Ga0207664_10120971 3300025929 Unclassified 2191
850 Ga0207664_10125915 3300025929 Bacteria 2151
851 Ga0207664_10145912 3300025929 Bacteria 2006
852 Ga0207664_10206778 3300025929 Bacteria 1697
853 Ga0207664_10267429 3300025929 Bacteria 1497
854 Ga0207664_10280458 3300025929 Bacteria 1462
855 Ga0207664_10322698 3300025929 Bacteria 1363
856 Ga0207664_10408277 3300025929 Unclassified 1209
857 Ga0207664_10575630 3300025929 Bacteria 1011
858 Ga0207664_10810414 3300025929 Bacteria 842
859 Ga0207664_10874765 3300025929 Bacteria 807
860 Ga0207664_10920441 3300025929 Bacteria 785
861 Ga0207644_10088536 3300025931 Unclassified 2303
862 Ga0207644_11014172 3300025931 Unclassified 697
863 Ga0207690_10022280 3300025932 Unclassified 3938
864 Ga0207690_10655260 3300025932 Unclassified 861
865 Ga0207706_10003412 3300025933 Bacteria 15181
866 Ga0207706_10020486 3300025933 Bacteria 5944
867 Ga0207706_10022082 3300025933 Bacteria 5712
868 Ga0207686_10060006 3300025934 Bacteria 2406
869 Ga0207686_10084322 3300025934 Bacteria 2082
870 Ga0207686_10095150 3300025934 Bacteria 1976
871 Ga0207709_10277959 3300025935 Bacteria 1235
872 Ga0207670_10035848 3300025936 Bacteria 3221
873 Ga0207670_10290118 3300025936 Unclassified 1278
874 Ga0207670_11168690 3300025936 Bacteria 651
875 Ga0207669_10871523 3300025937 Unclassified 750
876 Ga0207704_10016976 3300025938 Bacteria 3759
877 Ga0207704_10077655 3300025938 Bacteria 2133
878 Ga0207704_10162300 3300025938 Bacteria 1592
879 Ga0207704_10313466 3300025938 Unclassified 1207
880 Ga0207665_10008885 3300025939 Bacteria 6598
881 Ga0207665_10011904 3300025939 Bacteria 5713
882 Ga0207665_10026521 3300025939 Bacteria 3825
883 Ga0207665_10029957 3300025939 Bacteria 3596
884 Ga0207665_10059495 3300025939 Bacteria 2586
885 Ga0207665_10062057 3300025939 Bacteria 2535
886 Ga0207665_10102172 3300025939 Bacteria 2003
887 Ga0207665_10151101 3300025939 Bacteria 1663
888 Ga0207665_10152393 3300025939 Unclassified 1657
889 Ga0207665_10222969 3300025939 Unclassified 1382
890 Ga0207665_10310186 3300025939 Bacteria 1182
891 Ga0207665_10435044 3300025939 Bacteria 1004
892 Ga0207665_10518534 3300025939 Bacteria 923
893 Ga0207665_10661700 3300025939 Bacteria 819
894 Ga0207665_10883712 3300025939 Bacteria 708
895 Ga0207691_10000853 3300025940 Bacteria 30247
896 Ga0207691_10386750 3300025940 Bacteria 1194
897 Ga0207691_10769395 3300025940 Unclassified 810
898 Ga0207711_10006085 3300025941 Bacteria 10191
899 Ga0207711_10020209 3300025941 Bacteria 5549
900 Ga0207711_10025091 3300025941 Bacteria 5001
901 Ga0207711_10031024 3300025941 Unclassified 4509
902 Ga0207711_10486305 3300025941 Bacteria 1150
903 Ga0207711_10705534 3300025941 Bacteria 941
904 Ga0207711_11238307 3300025941 Bacteria 688
905 Ga0207711_11251049 3300025941 Bacteria 684
906 Ga0207689_10000495 3300025942 Bacteria 37206
907 Ga0207689_10000707 3300025942 Bacteria 31997
908 Ga0207689_10020706 3300025942 Bacteria 5530
909 Ga0207661_10000008 3300025944 Bacteria 451211
910 Ga0207661_10001451 3300025944 Bacteria 16007
911 Ga0207661_10159466 3300025944 Unclassified 1956
912 Ga0207661_10840439 3300025944 Bacteria 845
913 Ga0207661_11007782 3300025944 Bacteria 767
914 Ga0207679_10000177 3300025945 Bacteria 52657
915 Ga0207679_10038189 3300025945 Unclassified 3419
916 Ga0207667_10002400 3300025949 Bacteria 23462
917 Ga0207667_10016688 3300025949 Bacteria 8287
918 Ga0207667_10046866 3300025949 Bacteria 4577
919 Ga0207667_10064709 3300025949 Bacteria 3816
920 Ga0207667_10121862 3300025949 Bacteria 2687
921 Ga0207667_10317984 3300025949 Bacteria 1590
922 Ga0207667_10331765 3300025949 Unclassified 1553
923 Ga0207667_10493290 3300025949 Bacteria 1243
924 Ga0207667_10544159 3300025949 Bacteria 1175
925 Ga0207651_10004381 3300025960 Bacteria 7103
926 Ga0207651_10037247 3300025960 Unclassified 3185
927 Ga0207651_10569137 3300025960 Bacteria 987
928 Ga0207651_10569485 3300025960 Bacteria 987
929 Ga0207712_11015935 3300025961 Bacteria 736
930 Ga0207668_10019365 3300025972 Bacteria 4301
931 Ga0207640_10000843 3300025981 Bacteria 17434
932 Ga0207640_10002817 3300025981 Bacteria 9326
933 Ga0207640_10048913 3300025981 Bacteria 2736
934 Ga0207640_10068120 3300025981 Bacteria 2384
935 Ga0207640_10079331 3300025981 Bacteria 2237
936 Ga0207640_10625896 3300025981 Bacteria 914
937 Ga0207658_10127573 3300025986 Unclassified 2038
938 Ga0207658_10367425 3300025986 Bacteria 1257
939 Ga0207658_10477139 3300025986 Bacteria 1108
940 Ga0207677_10001146 3300026023 Bacteria 14471
941 Ga0207677_10004684 3300026023 Bacteria 7369
942 Ga0207677_10039291 3300026023 Bacteria 3110
943 Ga0207677_10111614 3300026023 Bacteria 2037
944 Ga0207677_10136790 3300026023 Unclassified 1869
945 Ga0207677_10860316 3300026023 Unclassified 815
946 Ga0207677_10970364 3300026023 Bacteria 769
947 Ga0207703_10007481 3300026035 Bacteria 8674
948 Ga0207703_10014707 3300026035 Bacteria 6107
949 Ga0207703_10029526 3300026035 Bacteria 4327
950 Ga0207703_10071736 3300026035 Bacteria 2861
951 Ga0207703_10253027 3300026035 Bacteria 1589
952 Ga0207703_10690093 3300026035 Bacteria 970
953 Ga0207703_10852301 3300026035 Bacteria 871
954 Ga0207703_11341010 3300026035 Bacteria 688
955 Ga0207639_10298587 3300026041 Bacteria 1423
956 Ga0207639_10464596 3300026041 Bacteria 1151
957 Ga0207639_10566526 3300026041 Bacteria 1044
958 Ga0207678_10001196 3300026067 Bacteria 23816
959 Ga0207678_10001295 3300026067 Bacteria 23151
960 Ga0207708_10323073 3300026075 Unclassified 1260
961 Ga0207702_10001116 3300026078 Bacteria 27436
962 Ga0207702_10006348 3300026078 Bacteria 10211
963 Ga0207702_10027482 3300026078 Bacteria 4725
964 Ga0207702_10030402 3300026078 Bacteria 4501
965 Ga0207702_10118325 3300026078 Bacteria 2367
966 Ga0207702_10173068 3300026078 Bacteria 1982
967 Ga0207702_10256585 3300026078 Bacteria 1644
968 Ga0207702_10579191 3300026078 Bacteria 1100
969 Ga0207702_10600752 3300026078 Bacteria 1080
970 Ga0207702_10606411 3300026078 Unclassified 1074
971 Ga0207702_10698639 3300026078 Bacteria 999
972 Ga0207641_10000237 3300026088 Bacteria 71168
973 Ga0207641_10022076 3300026088 Bacteria 5236
974 Ga0207641_10052884 3300026088 Bacteria 3441
975 Ga0207641_10071506 3300026088 Unclassified 2984
976 Ga0207641_10132612 3300026088 Bacteria 2239
977 Ga0207641_10199655 3300026088 Unclassified 1843
978 Ga0207641_10224754 3300026088 Bacteria 1743
979 Ga0207641_10286867 3300026088 Bacteria 1550
980 Ga0207641_10404294 3300026088 Unclassified 1312
981 Ga0207648_10010733 3300026089 Bacteria 8660
982 Ga0207648_10014004 3300026089 Bacteria 7430
983 Ga0207648_10731050 3300026089 Bacteria 918
984 Ga0207648_11660121 3300026089 Bacteria 600
985 Ga0207676_10000050 3300026095 Bacteria 133298
986 Ga0207676_10012503 3300026095 Bacteria 6085
987 Ga0207676_10081753 3300026095 Bacteria 2625
988 Ga0207674_10000130 3300026116 Bacteria 88123
989 Ga0207674_10000269 3300026116 Bacteria 65505
990 Ga0207674_10048042 3300026116 Bacteria 4371
991 Ga0207674_10238253 3300026116 Bacteria 1766
992 Ga0207674_10358129 3300026116 Bacteria 1410
993 Ga0207674_10538057 3300026116 Bacteria 1128
994 Ga0207674_10898673 3300026116 Unclassified 854
995 Ga0207675_100191788 3300026118 Bacteria 1960
996 Ga0207675_100715655 3300026118 Unclassified 1011
997 Ga0207683_10000139 3300026121 Bacteria 59769
998 Ga0207683_10082676 3300026121 Bacteria 2853
999 Ga0207683_10112642 3300026121 Bacteria 2436
1000 Ga0207683_10187805 3300026121 Bacteria 1875
1001 Ga0207683_10294985 3300026121 Bacteria 1483
1002 Ga0207698_10055373 3300026142 Bacteria 3057
1003 Ga0207698_10060280 3300026142 Unclassified 2950
1004 Ga0207698_10080622 3300026142 Bacteria 2623
1005 Ga0207698_10696240 3300026142 Bacteria 1011
1006 Ga0207698_10717698 3300026142 Bacteria 996
1007 Ga0265354_1007310 3300028016 Bacteria 1082
1008 Ga0265356_1000067 3300028017 Bacteria 17129
1009 Ga0265356_1007396 3300028017 Bacteria 1267
1010 Ga0265355_1002063 3300028036 Bacteria 1374
1011 Ga0265355_1008363 3300028036 Unclassified 827
1012 Ga0268266_10004469 3300028379 Bacteria 13368
1013 Ga0268266_10079038 3300028379 Bacteria 2863
1014 Ga0268266_10614477 3300028379 Unclassified 1045
1015 Ga0268265_10022237 3300028380 Unclassified 4452
1016 Ga0268265_10593707 3300028380 Bacteria 1057
1017 Ga0268264_10004223 3300028381 Bacteria 12261
1018 Ga0268264_10171272 3300028381 Bacteria 1964
1019 Ga0268264_10238198 3300028381 Bacteria 1684
1020 Ga0268264_10453458 3300028381 Bacteria 1243
1021 Ga0265326_10102496 3300028558 Bacteria 812
1022 Ga0265319_1042553 3300028563 Bacteria 1528
1023 Ga0265318_10030718 3300028577 Bacteria 2088
1024 Ga0265338_10003647 3300028800 Bacteria 21449
1025 Ga0265338_10062736 3300028800 Bacteria 3246
1026 Ga0265338_10068968 3300028800 Bacteria 3042
1027 Ga0265338_10094425 3300028800 Bacteria 2460
1028 Ga0265338_10160055 3300028800 Bacteria 1740
1029 Ga0265338_10191003 3300028800 Bacteria 1553
1030 Ga0265324_10008993 3300029957 Bacteria 3926
1031 Ga0265762_1004268 3300030760 Bacteria 2562
1032 Ga0265770_1010176 3300030878 Bacteria 1362
1033 Ga0265765_1000153 3300030879 Bacteria 4352
1034 Ga0265760_10002485 3300031090 Bacteria 5380
1035 Ga0265760_10005151 3300031090 Bacteria 3746
1036 Ga0265760_10014930 3300031090 Bacteria 2226
1037 Ga0265760_10048912 3300031090 Unclassified 1271
1038 Ga0265330_10033168 3300031235 Bacteria 2311
1039 Ga0265330_10163731 3300031235 Unclassified 944
1040 Ga0265332_10028089 3300031238 Bacteria 2464
1041 Ga0265332_10072165 3300031238 Bacteria 1470
1042 Ga0265332_10072223 3300031238 Bacteria 1469
1043 Ga0265328_10005736 3300031239 Bacteria 5304
1044 Ga0265328_10047778 3300031239 Bacteria 1573
1045 Ga0265320_10009889 3300031240 Bacteria 5714
1046 Ga0265325_10000515 3300031241 Bacteria 28005
1047 Ga0265325_10056890 3300031241 Bacteria 1996
1048 Ga0265325_10095371 3300031241 Bacteria 1462
1049 Ga0265325_10131863 3300031241 Unclassified 1196
1050 Ga0265325_10184316 3300031241 Bacteria 971
1051 Ga0265329_10048292 3300031242 Bacteria 1357
1052 Ga0265340_10001090 3300031247 Bacteria 15466
1053 Ga0265340_10024598 3300031247 Bacteria 3057
1054 Ga0265340_10069313 3300031247 Bacteria 1674
1055 Ga0265339_10026663 3300031249 Bacteria 3308
1056 Ga0265339_10027470 3300031249 Unclassified 3248
1057 Ga0265339_10034507 3300031249 Bacteria 2842
1058 Ga0265339_10072131 3300031249 Bacteria 1838
1059 Ga0265339_10234287 3300031249 Bacteria 894
1060 Ga0265331_10003381 3300031250 Bacteria 10345
1061 Ga0265331_10006153 3300031250 Bacteria 7136
1062 Ga0265331_10048760 3300031250 Unclassified 2035
1063 Ga0265331_10105229 3300031250 Unclassified 1296
1064 Ga0265316_10001130 3300031344 Bacteria 28937
1065 Ga0265316_10003692 3300031344 Bacteria 15426
1066 Ga0265316_10006205 3300031344 Bacteria 11456
1067 Ga0265316_10009598 3300031344 Bacteria 8891
1068 Ga0265316_10030197 3300031344 Bacteria 4446
1069 Ga0265316_10041585 3300031344 Bacteria 3677
1070 Ga0265316_10144087 3300031344 Bacteria 1788
1071 Ga0265316_10203343 3300031344 Unclassified 1467
1072 Ga0265316_10523500 3300031344 Bacteria 845
1073 Ga0265313_10002383 3300031595 Bacteria 16313
1074 Ga0265314_10001611 3300031711 Bacteria 24771
1075 Ga0265314_10008835 3300031711 Bacteria 8606
1076 Ga0265314_10103896 3300031711 Unclassified 1820
1077 Ga0265342_10056404 3300031712 Bacteria 2328
1078 Ga0307405_10251639 3300031731 Unclassified 1315
1079 Ga0307405_10365018 3300031731 Bacteria 1119
1080 Ga0307410_10001021 3300031852 Bacteria 12145
1081 Ga0307406_10037832 3300031901 Bacteria 2983
1082 Ga0307406_10445054 3300031901 Bacteria 1038
1083 Ga0307407_10307731 3300031903 Bacteria 1107
1084 Ga0307416_100093784 3300032002 Unclassified 2587
1085 Ga0307416_100224104 3300032002 Bacteria 1806
1086 Ga0307414_10074236 3300032004 Bacteria 2463
1087 Ga0307415_101099249 3300032126 Unclassified 744
1088 Ga0373930_0002114 3300034816 Unclassified 3043
1089 Ga0373926_0007641 3300035083 Bacteria 3599
1090 Ga0373926_0020857 3300035083 Bacteria 2266
1091 Ga0373926_0028374 3300035083 Unclassified 1964
1092 Ga0373926_0187838 3300035083 Bacteria 793
1093 Ga0373928_0028357 3300035084 Bacteria 1225
1094 Ga0373934_0031847 3300035086 Bacteria 2066
1095 Ga0373934_0232490 3300035086 Bacteria 761
1096 Ga0373940_0056696 3300035088 Bacteria 1112
1097 Ga0373944_0011305 3300035089 Bacteria 2444
1098 Ga0373923_0068497 3300035111 Bacteria 1520
1099 Ga0373923_0085489 3300035111 Bacteria 1373
1100 Ga0373923_0194956 3300035111 Bacteria 935
1101 Ga0373932_0091587 3300035112 Bacteria 976
1102 Ga0373936_0000172 3300035113 Bacteria 21486
1103 Ga0373936_0012995 3300035113 Bacteria 3175
1104 Ga0373936_0102549 3300035113 Bacteria 1208
1105 Ga0373936_0410490 3300035113 Bacteria 623
1106 Ga0373939_0123489 3300035114 Bacteria 916
1107 Ga0373941_0074815 3300035115 Bacteria 1132
1108 Ga0373945_0001375 3300035116 Bacteria 7385
1109 Ga0373945_0002395 3300035116 Bacteria 5881
1110 Ga0373945_0128264 3300035116 Bacteria 1014
1111 Ga0373945_0134718 3300035116 Unclassified 992
1112 Ga0373953_0003772 3300035117 Bacteria 4764
1113 Ga0373953_0192043 3300035117 Bacteria 882
1114 Ga0373954_0007793 3300035118 Bacteria 4688
1115 Ga0373954_0013276 3300035118 Bacteria 3670
1116 Ga0373954_0169065 3300035118 Bacteria 1070
1117 Ga0373956_0036548 3300035119 Bacteria 2168
1118 Ga0373956_0039447 3300035119 Bacteria 2093
1119 Ga0373956_0054467 3300035119 Bacteria 1802
1120 Ga0373957_0017752 3300035120 Bacteria 2484
1121 Ga0373943_0000055 3300035170 Bacteria 38929
1122 Ga0373943_0003910 3300035170 Bacteria 6779
1123 Ga0373943_0020297 3300035170 Bacteria 3062
1124 Ga0373943_0226425 3300035170 Bacteria 1043
1125 Ga0373943_0344765 3300035170 Unclassified 853
1126 Ga0373946_0029038 3300035171 Unclassified 2198
1127 Ga0373946_0194772 3300035171 Bacteria 968
1128 Ga0373955_0008998 3300035172 Bacteria 4661
1129 Ga0373955_0420749 3300035172 Bacteria 813
1130 Ga0373955_0429442 3300035172 Bacteria 804
1131 Ga0373961_0008159 3300035241 Bacteria 2544
1132 Ga0373961_0025165 3300035241 Bacteria 1616
1133 Ga0373924_0000091 3300035410 Bacteria 24866
1134 Ga0373924_0014882 3300035410 Bacteria 2945
1135 Ga0373924_0026543 3300035410 Bacteria 2298
1136 Ga0373924_0090317 3300035410 Bacteria 1310
1137 Ga0373931_0053587 3300035691 Bacteria 2153
1138 Ga0373931_0059959 3300035691 Unclassified 2047
1139 Ga0373931_0081062 3300035691 Bacteria 1791
1140 Ga0373931_0084890 3300035691 Bacteria 1754
1141 Ga0373931_0504067 3300035691 Unclassified 781
1142 Ga0373931_0602238 3300035691 Bacteria 718
1143 Ga0373935_0002091 3300035692 Bacteria 11335
1144 Ga0373935_0010861 3300035692 Bacteria 5470
1145 Ga0373935_0020803 3300035692 Bacteria 4012
1146 Ga0373935_0052573 3300035692 Bacteria 2590
1147 Ga0373935_0082770 3300035692 Bacteria 2088
1148 Ga0373935_0108297 3300035692 Bacteria 1841
1149 Ga0373935_0126285 3300035692 Bacteria 1714
1150 Ga0373935_0199832 3300035692 Bacteria 1381
1151 Ga0373935_0218085 3300035692 Bacteria 1324
1152 Ga0373935_0309731 3300035692 Unclassified 1118
1153 Ga0373935_0423798 3300035692 Bacteria 958
1154 Ga0373935_1157644 3300035692 Bacteria 576
1155 Ga0373927_0000378 3300035695 Bacteria 34466
1156 Ga0373927_0001571 3300035695 Bacteria 17119
1157 Ga0373927_0005079 3300035695 Bacteria 9105
1158 Ga0373927_0013728 3300035695 Bacteria 5378
1159 Ga0373927_0096748 3300035695 Unclassified 1919
1160 Ga0373927_0153053 3300035695 Bacteria 1510
1161 Ga0373927_0198094 3300035695 Unclassified 1318
1162 Ga0373927_0416032 3300035695 Bacteria 887
1163 Ga0373927_0499868 3300035695 Bacteria 803
1164 Ga0373927_0621639 3300035695 Bacteria 714
1165 Ga0373933_0016430 3300035724 Bacteria 4139
1166 Ga0373933_0192365 3300035724 Bacteria 1303
1167 Ga0373933_0331569 3300035724 Bacteria 987
1168 Ga0373933_0359390 3300035724 Unclassified 947
1169 Ga0373933_0506434 3300035724 Bacteria 791
1170 Ga0373933_0680214 3300035724 Bacteria 676
1171 Ga0373947_0000167 3300035725 Bacteria 35438
1172 Ga0373947_0001658 3300035725 Bacteria 13619
1173 Ga0373947_0008836 3300035725 Bacteria 5794
1174 Ga0373947_0050887 3300035725 Bacteria 2491
1175 Ga0373947_0057197 3300035725 Bacteria 2359
1176 Ga0373947_0061444 3300035725 Bacteria 2283
1177 Ga0373947_0100146 3300035725 Bacteria 1820
1178 Ga0373947_0471052 3300035725 Bacteria 852
1179 Ga0373947_0530924 3300035725 Bacteria 800
1180 Ga0373947_0668456 3300035725 Bacteria 708
1181 Ga0373947_0989113 3300035725 Unclassified 574
1182 Ga0373937_0000027 3300036401 Bacteria 123975
1183 Ga0373937_0014721 3300036401 Bacteria 6904
1184 Ga0373937_0018754 3300036401 Bacteria 6184
1185 Ga0373937_0020676 3300036401 Bacteria 5903
1186 Ga0373937_0041141 3300036401 Bacteria 4216
1187 Ga0373937_0047249 3300036401 Bacteria 3938
1188 Ga0373937_0076681 3300036401 Bacteria 3088
1189 Ga0373937_0094328 3300036401 Unclassified 2775
1190 Ga0373937_0105712 3300036401 Bacteria 2616
1191 Ga0373937_0238504 3300036401 Bacteria 1713
1192 Ga0373937_0310966 3300036401 Bacteria 1490
1193 Ga0373937_0360043 3300036401 Bacteria 1379
1194 Ga0373937_0374832 3300036401 Unclassified 1349
1195 Ga0373937_0832647 3300036401 Bacteria 871
1196 Ga0373937_1055870 3300036401 Bacteria 761
1197 Ga0373937_1312534 3300036401 Bacteria 672
1198 Ga0373925_0000224 3300037068 Bacteria 60518
1199 Ga0373925_0015611 3300037068 Bacteria 5494
1200 Ga0373925_0030136 3300037068 Bacteria 3981
1201 Ga0373925_0034052 3300037068 Bacteria 3755
1202 Ga0373925_0038481 3300037068 Bacteria 3537
1203 Ga0373925_0073647 3300037068 Bacteria 2585
1204 Ga0373925_0085587 3300037068 Bacteria 2403
1205 Ga0373925_0111187 3300037068 Bacteria 2116
1206 Ga0373925_0122640 3300037068 Bacteria 2019
1207 Ga0373925_0124740 3300037068 Bacteria 2002
1208 Ga0373925_0176346 3300037068 Bacteria 1690
1209 Ga0373925_0180170 3300037068 Bacteria 1672
1210 Ga0373925_0280191 3300037068 Bacteria 1343
1211 Ga0373925_1142123 3300037068 Unclassified 641
1212 Ga0436364_0135933 3300037853 Bacteria 793
1213 Ga0436364_1194151 3300037853 Bacteria 7993
1214 Ga0395901_0380383 3300038443 Unclassified 1453
1215 Ga0436365_1136717 3300039437 Bacteria 1154
1216 Ga0436365_1311817 3300039437 Unclassified 733
1217 Ga0436365_1314150 3300039437 Bacteria 563
1218 Ga0436365_1559181 3300039437 Bacteria 1256
1219 Ga0436365_1751127 3300039437 Bacteria 5277
1220 Ga0436360_0673759 3300039438 Bacteria 863
1221 Ga0436361_0293375 3300039447 Unclassified 639
1222 Ga0436363_0356673 3300039450 Bacteria 1835
1223 Ga0436363_0862048 3300039450 Bacteria 1149
1224 Ga0436363_1295381 3300039450 Bacteria 3791
1225 Ga0436362_1047223 3300039453 Bacteria 1129
1226 Ga0451849_1404825 3300041505 Bacteria 736
1227 Ga0451853_1241128 3300041512 Bacteria 762
1228 Ga0451577_1169536 3300042876 Bacteria 687
1229 Ga0466969_0257031 3300044656 Bacteria 792
1230 Ga0466966_0147888 3300044684 Bacteria 1434
1231 Ga0466966_0228892 3300044684 Bacteria 1122
1232 Ga0466961_0263248 3300044693 Bacteria 1057
1233 Ga0466963_0003772 3300044694 Bacteria 8731
1234 Ga0466963_0039609 3300044694 Bacteria 3087
1235 Ga0466963_0147368 3300044694 Bacteria 1633
1236 Ga0466964_0060019 3300044706 Bacteria 1581
1237 Ga0466964_0130794 3300044706 Unclassified 1143
1238 Ga0466971_0314619 3300044719 Bacteria 754
1239 Ga0466957_0076950 3300044842 Unclassified 2073
1240 Ga0466957_0314525 3300044842 Bacteria 1055
1241 Ga0466959_0183933 3300045049 Bacteria 1461
1242 Ga0451576_0097819 3300045051 Unclassified 3052
1243 Ga0451576_0220984 3300045051 Unclassified 1978
1244 Ga0451576_0288790 3300045051 Bacteria 1715
1245 Ga0451576_1428665 3300045051 Bacteria 720
1246 Ga0466967_0017316 3300045976 Bacteria 5716
1247 Ga0466967_0046110 3300045976 Bacteria 3793
1248 Ga0466967_0055367 3300045976 Bacteria 3494
1249 Ga0466967_0093669 3300045976 Bacteria 2734
1250 Ga0466967_0105221 3300045976 Bacteria 2585
1251 Ga0466967_0338174 3300045976 Bacteria 1455
1252 Ga0466967_0678854 3300045976 Bacteria 1020
1253 Ga0495629_0256515 3300046459 Bacteria 1202
1254 Ga0495629_0698185 3300046459 Unclassified 674
1255 Ga0495651_0008434 3300046462 Bacteria 7900
1256 Ga0495651_0050799 3300046462 Bacteria 3198
1257 Ga0495651_0119950 3300046462 Bacteria 1934
1258 Ga0495651_0140835 3300046462 Bacteria 1749
1259 Ga0495651_0265564 3300046462 Bacteria 1166
1260 Ga0495651_0449636 3300046462 Bacteria 833
1261 Ga0495653_0045879 3300046463 Bacteria 3386
1262 Ga0495653_0107349 3300046463 Bacteria 2012
1263 Ga0495653_0427750 3300046463 Unclassified 837
1264 Ga0495580_0001464 3300046472 Bacteria 20696
1265 Ga0495580_0003534 3300046472 Bacteria 13276
1266 Ga0495580_0006199 3300046472 Bacteria 9779
1267 Ga0495580_0006438 3300046472 Bacteria 9560
1268 Ga0495580_0017479 3300046472 Bacteria 5364
1269 Ga0495580_0017970 3300046472 Bacteria 5273
1270 Ga0495580_0018597 3300046472 Bacteria 5172
1271 Ga0495580_0022698 3300046472 Bacteria 4614
1272 Ga0495580_0026438 3300046472 Bacteria 4231
1273 Ga0495580_0046088 3300046472 Bacteria 3095
1274 Ga0495580_0056536 3300046472 Unclassified 2763
1275 Ga0495580_0063028 3300046472 Bacteria 2601
1276 Ga0495580_0063517 3300046472 Bacteria 2589
1277 Ga0495580_0089990 3300046472 Bacteria 2137
1278 Ga0495580_0111264 3300046472 Bacteria 1902
1279 Ga0495580_0161973 3300046472 Bacteria 1548
1280 Ga0495580_0224717 3300046472 Bacteria 1290
1281 Ga0495580_0262763 3300046472 Bacteria 1180
1282 Ga0495580_0286305 3300046472 Bacteria 1123
1283 Ga0495580_0362672 3300046472 Bacteria 980
1284 Ga0495580_0416062 3300046472 Bacteria 905
1285 Ga0495582_0012871 3300046473 Bacteria 4609
1286 Ga0495582_0074764 3300046473 Bacteria 1876
1287 Ga0495582_0101868 3300046473 Bacteria 1608
1288 Ga0495582_0214216 3300046473 Bacteria 1101
1289 Ga0495582_0521101 3300046473 Unclassified 687
1290 Ga0495605_0166527 3300046474 Bacteria 976
1291 Ga0495639_0074315 3300046475 Bacteria 1575
1292 Ga0495662_0030179 3300046476 Bacteria 2617
1293 Ga0495662_0245639 3300046476 Bacteria 882
1294 Ga0495664_0003847 3300046477 Bacteria 8192
1295 Ga0495664_0094774 3300046477 Unclassified 1797
1296 Ga0495664_0164274 3300046477 Bacteria 1347
1297 Ga0495664_0212461 3300046477 Bacteria 1172
1298 Ga0495664_0333026 3300046477 Bacteria 915
1299 Ga0495585_0441807 3300046492 Unclassified 623
1300 Ga0495594_0152024 3300046499 Bacteria 1314
1301 Ga0495608_0082532 3300046511 Bacteria 2087
1302 Ga0495608_0108032 3300046511 Bacteria 1790
1303 Ga0495608_0159226 3300046511 Bacteria 1436
1304 Ga0495618_0221675 3300046514 Bacteria 1193
1305 Ga0495618_0253768 3300046514 Bacteria 1103
1306 Ga0495628_0023575 3300046516 Bacteria 5050
1307 Ga0495628_0244132 3300046516 Unclassified 1343
1308 Ga0495628_0428850 3300046516 Bacteria 963
1309 Ga0495628_0489103 3300046516 Bacteria 890
1310 Ga0495628_0748032 3300046516 Bacteria 687
1311 Ga0495630_0013505 3300046517 Bacteria 5939
1312 Ga0495630_0051815 3300046517 Bacteria 3072
1313 Ga0495630_0058816 3300046517 Bacteria 2882
1314 Ga0495630_0109713 3300046517 Bacteria 2090
1315 Ga0495630_0299420 3300046517 Bacteria 1229
1316 Ga0495666_0208869 3300046526 Bacteria 896
1317 Ga0495666_0227609 3300046526 Bacteria 853
1318 Ga0495642_0237719 3300046528 Bacteria 796
1319 Ga0495642_0340052 3300046528 Bacteria 659
1320 Ga0495652_0168939 3300046529 Bacteria 1690
1321 Ga0495652_0349477 3300046529 Bacteria 1060
1322 Ga0495652_0395440 3300046529 Bacteria 980
1323 Ga0495665_0021545 3300046531 Bacteria 3463
1324 Ga0495665_0025270 3300046531 Bacteria 3191
1325 Ga0495665_0034989 3300046531 Bacteria 2685
1326 Ga0495665_0088377 3300046531 Bacteria 1629
1327 Ga0495665_0203784 3300046531 Bacteria 1025
1328 Ga0495665_0236414 3300046531 Bacteria 942
1329 Ga0495665_0428360 3300046531 Unclassified 670
1330 Ga0495640_0058921 3300046533 Bacteria 2618
1331 Ga0495640_0085863 3300046533 Bacteria 2085
1332 Ga0495640_0433249 3300046533 Bacteria 805
1333 Ga0495640_0583376 3300046533 Bacteria 676
1334 Ga0495586_0133604 3300046535 Unclassified 1390
1335 Ga0495587_0066973 3300046536 Bacteria 2094
1336 Ga0495587_0072064 3300046536 Bacteria 2009
1337 Ga0495587_0292904 3300046536 Bacteria 911
1338 Ga0495587_0373681 3300046536 Bacteria 793
1339 Ga0495645_0022167 3300046543 Bacteria 4593
1340 Ga0495645_0035649 3300046543 Bacteria 3626
1341 Ga0495645_0071844 3300046543 Unclassified 2494
1342 Ga0495645_0096994 3300046543 Bacteria 2100
1343 Ga0495645_0170135 3300046543 Bacteria 1500
1344 Ga0495645_0171349 3300046543 Bacteria 1494
1345 Ga0495645_0210936 3300046543 Bacteria 1311
1346 Ga0495645_0239024 3300046543 Unclassified 1213
1347 Ga0495667_0024521 3300046559 Bacteria 4062
1348 Ga0495667_0052413 3300046559 Bacteria 2688
1349 Ga0495667_0069290 3300046559 Bacteria 2302
1350 Ga0495667_0080351 3300046559 Bacteria 2120
1351 Ga0495667_0249252 3300046559 Bacteria 1130
1352 Ga0495668_0097647 3300046616 Bacteria 1608
1353 Ga0495634_0029185 3300046642 Bacteria 3820
1354 Ga0495634_0093797 3300046642 Bacteria 1946
1355 Ga0495635_0033329 3300046663 Bacteria 3573
1356 Ga0495635_0073100 3300046663 Bacteria 2349
1357 Ga0495635_0128451 3300046663 Bacteria 1728
1358 Ga0495635_0380479 3300046663 Bacteria 939
1359 Ga0495635_0429997 3300046663 Archaea 874
1360 Ga0495635_0539678 3300046663 Bacteria 765
1361 Ga0495635_0540406 3300046663 Bacteria 765
1362 Ga0495588_0051739 3300046674 Bacteria 2116
1363 Ga0495657_0338759 3300046675 Bacteria 892
1364 Ga0495657_0361939 3300046675 Unclassified 857
1365 Ga0495657_0417701 3300046675 Bacteria 788
1366 Ga0495657_0733268 3300046675 Unclassified 567
1367 Ga0495599_0223933 3300046678 Archaea 1150
1368 Ga0495599_0358715 3300046678 Bacteria 873
1369 Ga0495599_0367222 3300046678 Bacteria 861
1370 Ga0495623_0030436 3300046679 Bacteria 3472
1371 Ga0495623_0049156 3300046679 Bacteria 2673
1372 Ga0495623_0053782 3300046679 Bacteria 2542
1373 Ga0495623_0053948 3300046679 Bacteria 2537
1374 Ga0495623_0092747 3300046679 Bacteria 1850
1375 Ga0495623_0157856 3300046679 Unclassified 1335
1376 Ga0495646_0216913 3300046680 Bacteria 1036
1377 Ga0495646_0472851 3300046680 Bacteria 646
1378 Ga0495658_0148169 3300046683 Bacteria 1440
1379 Ga0495658_0293942 3300046683 Bacteria 1027
1380 Ga0495669_0093846 3300046684 Bacteria 1388
1381 Ga0495669_0096014 3300046684 Bacteria 1373
1382 Ga0495669_0235678 3300046684 Bacteria 878
1383 Ga0495613_0129225 3300046689 Bacteria 1810
1384 Ga0495613_0219233 3300046689 Bacteria 1336
1385 Ga0495613_0252098 3300046689 Bacteria 1231
1386 Ga0495624_0079166 3300046690 Bacteria 2038
1387 Ga0495624_0207276 3300046690 Bacteria 1190
1388 Ga0495624_0482240 3300046690 Bacteria 742
1389 Ga0495600_0105863 3300046809 Unclassified 1833
1390 Ga0495600_0209420 3300046809 Bacteria 1250
1391 Ga0495581_0346156 3300047315 Unclassified 868
1392 Ga0495581_0448424 3300047315 Unclassified 751
1393 Ga0495604_0028727 3300047317 Bacteria 4425
1394 Ga0495604_0223775 3300047317 Unclassified 1294
1395 Ga0495604_0315374 3300047317 Bacteria 1046
1396 Ga0495604_0328327 3300047317 Bacteria 1021
1397 Ga0495604_0378280 3300047317 Bacteria 936
1398 Ga0495604_0463835 3300047317 Bacteria 826
1399 Ga0495674_0018563 3300047319 Bacteria 6474
1400 Ga0495674_0049400 3300047319 Bacteria 3718
1401 Ga0495674_0053968 3300047319 Bacteria 3531
1402 Ga0495674_0076241 3300047319 Bacteria 2884
1403 Ga0495674_0214478 3300047319 Bacteria 1593
1404 Ga0495674_0299726 3300047319 Bacteria 1313
1405 Ga0495674_0334738 3300047319 Bacteria 1231
1406 Ga0495674_0578558 3300047319 Bacteria 891
1407 Ga0495676_0152757 3300047321 Bacteria 1641
1408 Ga0495675_0015725 3300047444 Bacteria 4785
1409 Ga0495675_0034121 3300047444 Unclassified 3247
1410 Ga0495675_0116060 3300047444 Bacteria 1669
1411 Ga0495675_0128649 3300047444 Bacteria 1575
1412 Ga0495675_0204648 3300047444 Bacteria 1200
1413 Ga0495675_0208231 3300047444 Bacteria 1188
1414 Ga0495675_0383412 3300047444 Bacteria 822
1415 Ga0495675_0414371 3300047444 Bacteria 784
1416 Ga0495675_0760431 3300047444 Bacteria 539
1417 Ga0495677_0034216 3300047445 Bacteria 1853
1418 Ga0495684_0016103 3300047471 Bacteria 5755
1419 Ga0495684_0054549 3300047471 Unclassified 3049
1420 Ga0495684_0083283 3300047471 Bacteria 2426
1421 Ga0495684_0112561 3300047471 Bacteria 2052
1422 Ga0495684_0220029 3300047471 Bacteria 1392
1423 Ga0495684_0460381 3300047471 Bacteria 882
1424 Ga0495593_0018737 3300047673 Bacteria 3887
1425 Ga0495593_0050171 3300047673 Bacteria 2212
1426 Ga0495602_0087286 3300048088 Bacteria 2601
1427 Ga0495602_0104306 3300048088 Bacteria 2320
1428 Ga0495602_0185006 3300048088 Bacteria 1603
1429 Ga0495602_0233374 3300048088 Bacteria 1381
1430 Ga0495602_0310671 3300048088 Bacteria 1150
1431 Ga0495602_0496241 3300048088 Bacteria 854
1432 Ga0495602_0630559 3300048088 Bacteria 734
1433 Ga0495614_0111573 3300048089 Bacteria 1201
1434 Ga0495614_0339422 3300048089 Bacteria 699
1435 Ga0496100_0090533 3300048903 Bacteria 2086
1436 Ga0496100_0121910 3300048903 Bacteria 1825
1437 Ga0496100_0172721 3300048903 Unclassified 1558
1438 Ga0496100_0208629 3300048903 Unclassified 1428
1439 Ga0496100_0335090 3300048903 Unclassified 1140
1440 Ga0496100_0495284 3300048903 Unclassified 941
1441 Ga0496101_0032991 3300048904 Bacteria 3649
1442 Ga0496101_0120052 3300048904 Unclassified 1987
1443 Ga0496101_0275424 3300048904 Bacteria 1314
1444 Ga0496101_0390554 3300048904 Unclassified 1095
1445 Ga0496101_0650150 3300048904 Unclassified 833
1446 Ga0496102_0020175 3300048905 Bacteria 5885
1447 Ga0496102_0089212 3300048905 Bacteria 2852
1448 Ga0496102_0152540 3300048905 Bacteria 2172
1449 Ga0496102_0203032 3300048905 Unclassified 1868
1450 Ga0496102_0335279 3300048905 Unclassified 1424
1451 Ga0496102_0503319 3300048905 Bacteria 1134
1452 Ga0496102_0611992 3300048905 Bacteria 1012
1453 Ga0496103_0022488 3300048906 Bacteria 3797
1454 Ga0496103_0032022 3300048906 Unclassified 3207
1455 Ga0496103_0061583 3300048906 Bacteria 2334
1456 Ga0496103_0616247 3300048906 Bacteria 691
1457 Ga0496104_0003663 3300048907 Bacteria 13265
1458 Ga0496104_0017687 3300048907 Bacteria 6498
1459 Ga0496104_0093755 3300048907 Bacteria 2872
1460 Ga0496104_0209709 3300048907 Unclassified 1860
1461 Ga0496104_0325362 3300048907 Bacteria 1450
1462 Ga0496104_0338449 3300048907 Unclassified 1418
1463 Ga0496104_0777467 3300048907 Bacteria 864
1464 Ga0496105_0008105 3300048908 Bacteria 8169
1465 Ga0496105_0040114 3300048908 Bacteria 3860
1466 Ga0496105_0603685 3300048908 Unclassified 851
1467 Ga0496105_0666460 3300048908 Bacteria 801
1468 Ga0496106_0034342 3300048909 Unclassified 3787
1469 Ga0496106_0063470 3300048909 Bacteria 2807
1470 Ga0496106_0641193 3300048909 Bacteria 849
1471 Ga0496107_0223273 3300048910 Unclassified 1402
1472 Ga0496108_0000106 3300048911 Bacteria 87028
1473 Ga0496108_0216047 3300048911 Bacteria 1665
1474 Ga0496109_0000133 3300048912 Bacteria 76299
1475 Ga0496109_0167149 3300048912 Bacteria 2063
1476 Ga0496109_0332953 3300048912 Unclassified 1433
1477 Ga0496109_0370111 3300048912 Unclassified 1354
1478 Ga0496109_1041215 3300048912 Bacteria 756
1479 Ga0496110_0002218 3300048913 Bacteria 14511
1480 Ga0496110_0186389 3300048913 Bacteria 1884
1481 Ga0496110_0890889 3300048913 Unclassified 796
1482 Ga0496111_0004591 3300048914 Bacteria 8744
1483 Ga0496112_0000028 3300048915 Bacteria 130942
1484 Ga0496112_0014386 3300048915 Bacteria 7336
1485 Ga0496112_0030600 3300048915 Bacteria 5211
1486 Ga0496112_0043741 3300048915 Bacteria 4386
1487 Ga0496112_0055340 3300048915 Bacteria 3901
1488 Ga0496112_0099017 3300048915 Unclassified 2885
1489 Ga0496112_0162289 3300048915 Bacteria 2201
1490 Ga0496112_0217038 3300048915 Bacteria 1869
1491 Ga0496112_0331081 3300048915 Bacteria 1467
1492 Ga0496112_0368375 3300048915 Bacteria 1378
1493 Ga0496112_1137669 3300048915 Bacteria 698
1494 Ga0496112_1320429 3300048915 Bacteria 637
1495 Ga0496113_0000179 3300048916 Bacteria 28343
1496 Ga0496113_0013416 3300048916 Bacteria 5551
1497 Ga0496113_0091882 3300048916 Unclassified 2340
1498 Ga0496113_0326988 3300048916 Unclassified 1229
1499 Ga0496114_0062374 3300048917 Unclassified 3120
1500 Ga0496115_0030865 3300048918 Bacteria 4219
1501 Ga0496115_1078642 3300048918 Bacteria 610
1502 Ga0501292_039726 3300049515 Unclassified 810
1503 Ga0501299_013919 3300049522 Bacteria 1393
1504 Ga0501073_0087107 3300049589 Bacteria 2172
1505 Ga0501216_060176 3300049660 Unclassified 764
1506 Ga0501217_115749 3300049661 Unclassified 774
1507 Ga0501261_021495 3300049690 Unclassified 928
1508 Ga0501221_038951 3300049704 Bacteria 1029
1509 Ga0501225_0030165 3300049705 Unclassified 1491
1510 Ga0501083_0114773 3300049744 Bacteria 1769
1511 Ga0501268_083469 3300049765 Unclassified 663
1512 nmdc:mga05p37_668048_c1 3300050507 Unclassified 1160
1513 nmdc:mga05p37_887748_c1 3300050507 Bacteria 963
1514 nmdc:mga08y16_962509_c1 3300050511 Bacteria 836
1515 nmdc:mga0n895_1051089_c1 3300050512 Bacteria 793
1516 nmdc:mga0n895_123435_c1 3300050512 Unclassified 2612
1517 nmdc:mga0n895_1547_c1 3300050512 Bacteria 17269
1518 nmdc:mga0n895_4579_c1 3300050512 Bacteria 11389
1519 nmdc:mga0rr50_16895_c1 3300050513 Unclassified 4859
1520 nmdc:mga0rr50_433943_c1 3300050513 Bacteria 1112
1521 nmdc:mga08x19_14306_c1 3300050514 Bacteria 4813
1522 nmdc:mga08x19_178361_c1 3300050514 Bacteria 1449
1523 nmdc:mga08x19_191779_c1 3300050514 Bacteria 1398
1524 nmdc:mga08x19_2368_c1 3300050514 Bacteria 11425
1525 nmdc:mga08x19_27172_c1 3300050514 Bacteria 3578
1526 nmdc:mga08x19_6108_c1 3300050514 Bacteria 7121
1527 nmdc:mga08x19_761213_c1 3300050514 Bacteria 688
1528 nmdc:mga08x19_7696_c1 3300050514 Bacteria 6397
1529 nmdc:mga0a205_806225_c1 3300050515 Unclassified 787
1530 nmdc:mga0a205_947_c1 3300050515 Bacteria 23925
1531 Ga0495601_0217699 3300053077 Bacteria 1247
1532 Ga0495619_0064914 3300053085 Unclassified 2435
1533 Ga0495619_0596418 3300053085 Bacteria 756
1534 Ga0495619_0597208 3300053085 Bacteria 755
1535 Ga0495619_0615705 3300053085 Archaea 742
1536 Ga0495619_0899215 3300053085 Bacteria 596
1537 Ga0500590_059292 3300053148 Bacteria 1926
1538 Ga0501084_0080902 3300054114 Bacteria 2724
1539 Ga0501082_0002389 3300060353 Bacteria 16456
1540 Ga0501082_0129551 3300060353 Bacteria 2189

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041505 Ga0451849_1404825 Ga0451849_1404825_264_695 143
2 3300048911 Ga0496108_0216047 Ga0496108_0216047_1158_1652 164
3 3300025935 Ga0207709_10277959 Ga0207709_102779592 167
4 3300009553 Ga0105249_10290290 Ga0105249_102902902 168
5 3300035086 Ga0373934_0031847 Ga0373934_0031847_1511_2023 168
6 3300035111 Ga0373923_0068497 Ga0373923_0068497_887_1399 168
7 3300035118 Ga0373954_0013276 Ga0373954_0013276_1596_2108 168
8 3300035692 Ga0373935_0082770 Ga0373935_0082770_22_534 168
9 3300035695 Ga0373927_0001571 Ga0373927_0001571_15215_15727 168
10 3300035725 Ga0373947_0530924 Ga0373947_0530924_129_641 168
11 3300036401 Ga0373937_1055870 Ga0373937_1055870_29_541 168
12 3300037068 Ga0373925_0034052 Ga0373925_0034052_1148_1660 168
13 3300046472 Ga0495580_0362672 Ga0495580_0362672_294_806 168
14 3300046511 Ga0495608_0108032 Ga0495608_0108032_1221_1733 168
15 3300047444 Ga0495675_0208231 Ga0495675_0208231_49_561 168
16 2162886012 MBSR1b_contig_11819402 MBSR1b_0690.00000180 169
17 3300000546 LJNas_1001454 LJNas_10014542 169
18 3300002239 JGI24034J26672_10005869 JGI24034J26672_100058692 169
19 3300002459 JGI24751J29686_10014259 JGI24751J29686_100142592 169
20 3300005290 Ga0065712_10152185 Ga0065712_101521852 169
21 3300005290 Ga0065712_10173172 Ga0065712_101731722 169
22 3300005293 Ga0065715_10037980 Ga0065715_100379802 169
23 3300005293 Ga0065715_10103000 Ga0065715_101030002 169
24 3300005293 Ga0065715_10178575 Ga0065715_101785752 169
25 3300005327 Ga0070658_10005929 Ga0070658_100059293 169
26 3300005327 Ga0070658_10418706 Ga0070658_104187062 169
27 3300005327 Ga0070658_10701949 Ga0070658_107019491 169
28 3300005328 Ga0070676_10016811 Ga0070676_100168115 169
29 3300005328 Ga0070676_10151440 Ga0070676_101514402 169
30 3300005329 Ga0070683_100000035 Ga0070683_10000003515 169
31 3300005329 Ga0070683_100012627 Ga0070683_1000126271 169
32 3300005329 Ga0070683_100026713 Ga0070683_1000267133 169
33 3300005329 Ga0070683_100290670 Ga0070683_1002906701 169
34 3300005329 Ga0070683_100546070 Ga0070683_1005460702 169
35 3300005329 Ga0070683_100554868 Ga0070683_1005548682 169
36 3300005330 Ga0070690_100224183 Ga0070690_1002241831 169
37 3300005330 Ga0070690_100585602 Ga0070690_1005856021 169
38 3300005331 Ga0070670_100005429 Ga0070670_1000054294 169
39 3300005331 Ga0070670_100016074 Ga0070670_1000160742 169
40 3300005331 Ga0070670_100035001 Ga0070670_1000350012 169
41 3300005334 Ga0068869_100009378 Ga0068869_1000093786 169
42 3300005334 Ga0068869_100012141 Ga0068869_1000121415 169
43 3300005334 Ga0068869_100013081 Ga0068869_1000130812 169
44 3300005334 Ga0068869_101315843 Ga0068869_1013158431 169
45 3300005335 Ga0070666_10008702 Ga0070666_100087022 169
46 3300005335 Ga0070666_10104046 Ga0070666_101040463 169
47 3300005336 Ga0070680_100135893 Ga0070680_1001358932 169
48 3300005336 Ga0070680_100443266 Ga0070680_1004432662 169
49 3300005337 Ga0070682_100011890 Ga0070682_1000118902 169
50 3300005337 Ga0070682_100025124 Ga0070682_1000251242 169
51 3300005337 Ga0070682_100383356 Ga0070682_1003833561 169
52 3300005338 Ga0068868_100002728 Ga0068868_1000027288 169
53 3300005338 Ga0068868_100002835 Ga0068868_1000028359 169
54 3300005338 Ga0068868_100022051 Ga0068868_1000220513 169
55 3300005338 Ga0068868_100036034 Ga0068868_1000360342 169
56 3300005338 Ga0068868_100125206 Ga0068868_1001252063 169
57 3300005338 Ga0068868_100155671 Ga0068868_1001556712 169
58 3300005338 Ga0068868_101028202 Ga0068868_1010282022 169
59 3300005339 Ga0070660_100009702 Ga0070660_1000097026 169
60 3300005339 Ga0070660_100614258 Ga0070660_1006142582 169
61 3300005340 Ga0070689_100068871 Ga0070689_1000688713 169
62 3300005340 Ga0070689_100069133 Ga0070689_1000691332 169
63 3300005340 Ga0070689_100185672 Ga0070689_1001856722 169
64 3300005341 Ga0070691_10054356 Ga0070691_100543562 169
65 3300005344 Ga0070661_100007203 Ga0070661_1000072035 169
66 3300005344 Ga0070661_100025417 Ga0070661_1000254173 169
67 3300005345 Ga0070692_10077057 Ga0070692_100770573 169
68 3300005345 Ga0070692_10099137 Ga0070692_100991372 169
69 3300005347 Ga0070668_100002226 Ga0070668_1000022269 169
70 3300005347 Ga0070668_100007587 Ga0070668_1000075873 169
71 3300005347 Ga0070668_100465366 Ga0070668_1004653662 169
72 3300005353 Ga0070669_100005043 Ga0070669_1000050436 169
73 3300005353 Ga0070669_100049122 Ga0070669_1000491222 169
74 3300005354 Ga0070675_100047761 Ga0070675_1000477613 169
75 3300005354 Ga0070675_100155371 Ga0070675_1001553712 169
76 3300005354 Ga0070675_100732877 Ga0070675_1007328772 169
77 3300005354 Ga0070675_100737801 Ga0070675_1007378012 169
78 3300005354 Ga0070675_100953992 Ga0070675_1009539921 169
79 3300005354 Ga0070675_100962791 Ga0070675_1009627912 169
80 3300005354 Ga0070675_101060470 Ga0070675_1010604701 169
81 3300005355 Ga0070671_100976174 Ga0070671_1009761742 169
82 3300005355 Ga0070671_101066372 Ga0070671_1010663721 169
83 3300005356 Ga0070674_100221991 Ga0070674_1002219912 169
84 3300005356 Ga0070674_100462311 Ga0070674_1004623112 169
85 3300005356 Ga0070674_101026534 Ga0070674_1010265341 169
86 3300005364 Ga0070673_100062580 Ga0070673_1000625802 169
87 3300005364 Ga0070673_100665248 Ga0070673_1006652481 169
88 3300005364 Ga0070673_101074723 Ga0070673_1010747232 169
89 3300005365 Ga0070688_100013826 Ga0070688_1000138262 169
90 3300005365 Ga0070688_100357010 Ga0070688_1003570102 169
91 3300005366 Ga0070659_100001203 Ga0070659_10000120315 169
92 3300005366 Ga0070659_100080397 Ga0070659_1000803973 169
93 3300005367 Ga0070667_100116848 Ga0070667_1001168483 169
94 3300005434 Ga0070709_10018837 Ga0070709_100188372 169
95 3300005434 Ga0070709_10020338 Ga0070709_100203382 169
96 3300005434 Ga0070709_10031911 Ga0070709_100319112 169
97 3300005434 Ga0070709_10040735 Ga0070709_100407353 169
98 3300005434 Ga0070709_10065352 Ga0070709_100653523 169
99 3300005434 Ga0070709_10087970 Ga0070709_100879702 169
100 3300005434 Ga0070709_10119214 Ga0070709_101192142 169
101 3300005434 Ga0070709_10162923 Ga0070709_101629231 169
102 3300005434 Ga0070709_10176908 Ga0070709_101769081 169
103 3300005434 Ga0070709_10206445 Ga0070709_102064451 169
104 3300005434 Ga0070709_10276903 Ga0070709_102769032 169
105 3300005434 Ga0070709_10472435 Ga0070709_104724351 169
106 3300005434 Ga0070709_10751656 Ga0070709_107516561 169
107 3300005435 Ga0070714_100000169 Ga0070714_10000016921 169
108 3300005435 Ga0070714_100008519 Ga0070714_1000085195 169
109 3300005435 Ga0070714_100020608 Ga0070714_1000206083 169
110 3300005435 Ga0070714_100059174 Ga0070714_1000591743 169
111 3300005435 Ga0070714_100072893 Ga0070714_1000728933 169
112 3300005435 Ga0070714_100149551 Ga0070714_1001495512 169
113 3300005435 Ga0070714_100174919 Ga0070714_1001749192 169
114 3300005435 Ga0070714_100180387 Ga0070714_1001803872 169
115 3300005435 Ga0070714_100214185 Ga0070714_1002141851 169
116 3300005435 Ga0070714_100285751 Ga0070714_1002857512 169
117 3300005435 Ga0070714_100299439 Ga0070714_1002994392 169
118 3300005435 Ga0070714_100335812 Ga0070714_1003358122 169
119 3300005435 Ga0070714_100350431 Ga0070714_1003504312 169
120 3300005435 Ga0070714_100633047 Ga0070714_1006330472 169
121 3300005435 Ga0070714_100832475 Ga0070714_1008324752 169
122 3300005436 Ga0070713_100000649 Ga0070713_1000006495 169
123 3300005436 Ga0070713_100002519 Ga0070713_10000251911 169
124 3300005436 Ga0070713_100005251 Ga0070713_1000052513 169
125 3300005436 Ga0070713_100012465 Ga0070713_1000124652 169
126 3300005436 Ga0070713_100020997 Ga0070713_1000209972 169
127 3300005436 Ga0070713_100061733 Ga0070713_1000617333 169
128 3300005436 Ga0070713_100068860 Ga0070713_1000688603 169
129 3300005436 Ga0070713_100084009 Ga0070713_1000840093 169
130 3300005436 Ga0070713_100086586 Ga0070713_1000865863 169
131 3300005436 Ga0070713_100101904 Ga0070713_1001019043 169
132 3300005436 Ga0070713_100136863 Ga0070713_1001368632 169
133 3300005436 Ga0070713_100228716 Ga0070713_1002287162 169
134 3300005436 Ga0070713_100272077 Ga0070713_1002720772 169
135 3300005436 Ga0070713_100308576 Ga0070713_1003085762 169
136 3300005436 Ga0070713_100425658 Ga0070713_1004256582 169
137 3300005436 Ga0070713_100551494 Ga0070713_1005514942 169
138 3300005436 Ga0070713_100559448 Ga0070713_1005594482 169
139 3300005436 Ga0070713_100652762 Ga0070713_1006527621 169
140 3300005436 Ga0070713_101459694 Ga0070713_1014596941 169
141 3300005436 Ga0070713_101687081 Ga0070713_1016870811 169
142 3300005436 Ga0070713_101754075 Ga0070713_1017540751 169
143 3300005437 Ga0070710_10027644 Ga0070710_100276442 169
144 3300005437 Ga0070710_10035124 Ga0070710_100351244 169
145 3300005437 Ga0070710_10069378 Ga0070710_100693783 169
146 3300005437 Ga0070710_10073573 Ga0070710_100735732 169
147 3300005437 Ga0070710_10082954 Ga0070710_100829542 169
148 3300005437 Ga0070710_10416500 Ga0070710_104165001 169
149 3300005439 Ga0070711_100000293 Ga0070711_10000029311 169
150 3300005439 Ga0070711_100001830 Ga0070711_1000018305 169
151 3300005439 Ga0070711_100007650 Ga0070711_1000076505 169
152 3300005439 Ga0070711_100054373 Ga0070711_1000543732 169
153 3300005439 Ga0070711_100060645 Ga0070711_1000606452 169
154 3300005439 Ga0070711_100065489 Ga0070711_1000654892 169
155 3300005439 Ga0070711_100104622 Ga0070711_1001046222 169
156 3300005439 Ga0070711_100283720 Ga0070711_1002837202 169
157 3300005439 Ga0070711_100933380 Ga0070711_1009333801 169
158 3300005439 Ga0070711_101500636 Ga0070711_1015006361 169
159 3300005440 Ga0070705_100038418 Ga0070705_1000384183 169
160 3300005440 Ga0070705_100107033 Ga0070705_1001070332 169
161 3300005440 Ga0070705_100194634 Ga0070705_1001946341 169
162 3300005441 Ga0070700_100366056 Ga0070700_1003660561 169
163 3300005444 Ga0070694_100530115 Ga0070694_1005301151 169
164 3300005445 Ga0070708_100000242 Ga0070708_10000024210 169
165 3300005445 Ga0070708_100001715 Ga0070708_1000017158 169
166 3300005445 Ga0070708_100003584 Ga0070708_1000035845 169
167 3300005445 Ga0070708_100006436 Ga0070708_1000064363 169
168 3300005445 Ga0070708_100020572 Ga0070708_1000205722 169
169 3300005445 Ga0070708_100086330 Ga0070708_1000863302 169
170 3300005455 Ga0070663_100043712 Ga0070663_1000437123 169
171 3300005456 Ga0070678_100071377 Ga0070678_1000713772 169
172 3300005456 Ga0070678_100188708 Ga0070678_1001887082 169
173 3300005457 Ga0070662_100004575 Ga0070662_1000045753 169
174 3300005457 Ga0070662_100011008 Ga0070662_1000110083 169
175 3300005457 Ga0070662_100268491 Ga0070662_1002684912 169
176 3300005457 Ga0070662_100646416 Ga0070662_1006464162 169
177 3300005458 Ga0070681_10008506 Ga0070681_100085063 169
178 3300005458 Ga0070681_10012341 Ga0070681_100123413 169
179 3300005458 Ga0070681_10073861 Ga0070681_100738611 169
180 3300005458 Ga0070681_10074017 Ga0070681_100740173 169
181 3300005458 Ga0070681_10082353 Ga0070681_100823532 169
182 3300005458 Ga0070681_10155758 Ga0070681_101557582 169
183 3300005458 Ga0070681_10518012 Ga0070681_105180122 169
184 3300005458 Ga0070681_10654872 Ga0070681_106548721 169
185 3300005459 Ga0068867_100001484 Ga0068867_1000014845 169
186 3300005459 Ga0068867_100013571 Ga0068867_1000135713 169
187 3300005459 Ga0068867_100024102 Ga0068867_1000241025 169
188 3300005466 Ga0070685_10031930 Ga0070685_100319302 169
189 3300005467 Ga0070706_100001331 Ga0070706_1000013317 169
190 3300005467 Ga0070706_100001385 Ga0070706_10000138514 169
191 3300005467 Ga0070706_100002503 Ga0070706_10000250314 169
192 3300005467 Ga0070706_100013794 Ga0070706_1000137948 169
193 3300005467 Ga0070706_100044511 Ga0070706_1000445114 169
194 3300005467 Ga0070706_100233521 Ga0070706_1002335212 169
195 3300005467 Ga0070706_100280770 Ga0070706_1002807701 169
196 3300005468 Ga0070707_100002130 Ga0070707_10000213014 169
197 3300005468 Ga0070707_100002318 Ga0070707_10000231813 169
198 3300005468 Ga0070707_100012306 Ga0070707_1000123065 169
199 3300005468 Ga0070707_100137336 Ga0070707_1001373362 169
200 3300005468 Ga0070707_100384795 Ga0070707_1003847951 169
201 3300005468 Ga0070707_100400753 Ga0070707_1004007532 169
202 3300005471 Ga0070698_100000589 Ga0070698_10000058929 169
203 3300005471 Ga0070698_100000689 Ga0070698_10000068913 169
204 3300005471 Ga0070698_100040140 Ga0070698_1000401405 169
205 3300005518 Ga0070699_100000679 Ga0070699_10000067910 169
206 3300005518 Ga0070699_100000716 Ga0070699_1000007168 169
207 3300005518 Ga0070699_100025935 Ga0070699_1000259354 169
208 3300005518 Ga0070699_100027280 Ga0070699_1000272802 169
209 3300005518 Ga0070699_100639241 Ga0070699_1006392411 169
210 3300005530 Ga0070679_100074471 Ga0070679_1000744712 169
211 3300005530 Ga0070679_100159877 Ga0070679_1001598772 169
212 3300005530 Ga0070679_100398877 Ga0070679_1003988772 169
213 3300005530 Ga0070679_100736401 Ga0070679_1007364012 169
214 3300005530 Ga0070679_101177436 Ga0070679_1011774361 169
215 3300005535 Ga0070684_100000037 Ga0070684_10000003771 169
216 3300005535 Ga0070684_100083944 Ga0070684_1000839443 169
217 3300005535 Ga0070684_100086086 Ga0070684_1000860862 169
218 3300005535 Ga0070684_100128722 Ga0070684_1001287223 169
219 3300005535 Ga0070684_100401329 Ga0070684_1004013291 169
220 3300005536 Ga0070697_100000053 Ga0070697_10000005345 169
221 3300005536 Ga0070697_100000280 Ga0070697_1000002806 169
222 3300005536 Ga0070697_100000694 Ga0070697_1000006948 169
223 3300005536 Ga0070697_100001256 Ga0070697_10000125614 169
224 3300005536 Ga0070697_100013559 Ga0070697_1000135594 169
225 3300005536 Ga0070697_100018478 Ga0070697_1000184782 169
226 3300005536 Ga0070697_100111046 Ga0070697_1001110462 169
227 3300005536 Ga0070697_100414907 Ga0070697_1004149072 169
228 3300005536 Ga0070697_100430598 Ga0070697_1004305982 169
229 3300005536 Ga0070697_101383730 Ga0070697_1013837301 169
230 3300005539 Ga0068853_100004040 Ga0068853_1000040409 169
231 3300005543 Ga0070672_100003042 Ga0070672_1000030422 169
232 3300005543 Ga0070672_100366589 Ga0070672_1003665892 169
233 3300005543 Ga0070672_100462223 Ga0070672_1004622232 169
234 3300005544 Ga0070686_100008692 Ga0070686_1000086923 169
235 3300005545 Ga0070695_100032361 Ga0070695_1000323612 169
236 3300005545 Ga0070695_100088098 Ga0070695_1000880982 169
237 3300005545 Ga0070695_100192023 Ga0070695_1001920231 169
238 3300005546 Ga0070696_100142696 Ga0070696_1001426962 169
239 3300005546 Ga0070696_100164097 Ga0070696_1001640972 169
240 3300005546 Ga0070696_100196285 Ga0070696_1001962852 169
241 3300005546 Ga0070696_100441270 Ga0070696_1004412702 169
242 3300005547 Ga0070693_100004450 Ga0070693_1000044503 169
243 3300005547 Ga0070693_100034556 Ga0070693_1000345562 169
244 3300005547 Ga0070693_100261979 Ga0070693_1002619792 169
245 3300005547 Ga0070693_100702313 Ga0070693_1007023131 169
246 3300005547 Ga0070693_101079393 Ga0070693_1010793931 169
247 3300005548 Ga0070665_100023323 Ga0070665_1000233232 169
248 3300005549 Ga0070704_100120474 Ga0070704_1001204742 169
249 3300005563 Ga0068855_100010022 Ga0068855_1000100228 169
250 3300005563 Ga0068855_100011722 Ga0068855_1000117227 169
251 3300005563 Ga0068855_100012992 Ga0068855_10001299214 169
252 3300005563 Ga0068855_100074528 Ga0068855_1000745282 169
253 3300005563 Ga0068855_100080699 Ga0068855_1000806993 169
254 3300005563 Ga0068855_100151046 Ga0068855_1001510462 169
255 3300005563 Ga0068855_100248520 Ga0068855_1002485202 169
256 3300005563 Ga0068855_100347599 Ga0068855_1003475992 169
257 3300005563 Ga0068855_100449358 Ga0068855_1004493582 169
258 3300005563 Ga0068855_100487674 Ga0068855_1004876742 169
259 3300005563 Ga0068855_100972414 Ga0068855_1009724142 169
260 3300005564 Ga0070664_100000972 Ga0070664_10000097216 169
261 3300005564 Ga0070664_100008272 Ga0070664_1000082722 169
262 3300005564 Ga0070664_100019355 Ga0070664_1000193556 169
263 3300005577 Ga0068857_100000259 Ga0068857_10000025917 169
264 3300005577 Ga0068857_100000335 Ga0068857_10000033516 169
265 3300005577 Ga0068857_100199313 Ga0068857_1001993132 169
266 3300005577 Ga0068857_100314612 Ga0068857_1003146122 169
267 3300005577 Ga0068857_100475411 Ga0068857_1004754112 169
268 3300005577 Ga0068857_100580462 Ga0068857_1005804622 169
269 3300005577 Ga0068857_100995258 Ga0068857_1009952581 169
270 3300005578 Ga0068854_100011053 Ga0068854_1000110535 169
271 3300005578 Ga0068854_100023615 Ga0068854_1000236153 169
272 3300005578 Ga0068854_100028231 Ga0068854_1000282313 169
273 3300005578 Ga0068854_100033635 Ga0068854_1000336354 169
274 3300005578 Ga0068854_100096525 Ga0068854_1000965252 169
275 3300005614 Ga0068856_100000995 Ga0068856_10000099528 169
276 3300005614 Ga0068856_100002426 Ga0068856_10000242613 169
277 3300005614 Ga0068856_100003097 Ga0068856_1000030979 169
278 3300005614 Ga0068856_100005963 Ga0068856_1000059632 169
279 3300005614 Ga0068856_100006696 Ga0068856_1000066968 169
280 3300005614 Ga0068856_100023013 Ga0068856_1000230134 169
281 3300005614 Ga0068856_100035413 Ga0068856_1000354134 169
282 3300005614 Ga0068856_100387787 Ga0068856_1003877872 169
283 3300005614 Ga0068856_100551276 Ga0068856_1005512762 169
284 3300005614 Ga0068856_100634798 Ga0068856_1006347982 169
285 3300005614 Ga0068856_100646876 Ga0068856_1006468762 169
286 3300005614 Ga0068856_100907641 Ga0068856_1009076412 169
287 3300005614 Ga0068856_102109757 Ga0068856_1021097571 169
288 3300005615 Ga0070702_100000387 Ga0070702_10000038712 169
289 3300005615 Ga0070702_100070013 Ga0070702_1000700132 169
290 3300005615 Ga0070702_100267006 Ga0070702_1002670062 169
291 3300005616 Ga0068852_100009501 Ga0068852_1000095014 169
292 3300005616 Ga0068852_100050228 Ga0068852_1000502283 169
293 3300005616 Ga0068852_100145329 Ga0068852_1001453292 169
294 3300005616 Ga0068852_100206105 Ga0068852_1002061052 169
295 3300005616 Ga0068852_101254597 Ga0068852_1012545972 169
296 3300005617 Ga0068859_100014831 Ga0068859_1000148314 169
297 3300005617 Ga0068859_100015248 Ga0068859_1000152483 169
298 3300005617 Ga0068859_100094432 Ga0068859_1000944322 169
299 3300005617 Ga0068859_100253500 Ga0068859_1002535003 169
300 3300005617 Ga0068859_100298463 Ga0068859_1002984632 169
301 3300005617 Ga0068859_100344748 Ga0068859_1003447481 169
302 3300005617 Ga0068859_101027082 Ga0068859_1010270822 169
303 3300005618 Ga0068864_100003998 Ga0068864_1000039984 169
304 3300005618 Ga0068864_100034805 Ga0068864_1000348053 169
305 3300005718 Ga0068866_10000735 Ga0068866_1000073513 169
306 3300005718 Ga0068866_10003232 Ga0068866_100032325 169
307 3300005718 Ga0068866_10008403 Ga0068866_100084033 169
308 3300005718 Ga0068866_10036584 Ga0068866_100365842 169
309 3300005718 Ga0068866_10044217 Ga0068866_100442172 169
310 3300005718 Ga0068866_10367819 Ga0068866_103678191 169
311 3300005719 Ga0068861_100013572 Ga0068861_1000135724 169
312 3300005719 Ga0068861_100086221 Ga0068861_1000862212 169
313 3300005719 Ga0068861_100242727 Ga0068861_1002427272 169
314 3300005834 Ga0068851_10004069 Ga0068851_100040696 169
315 3300005834 Ga0068851_10006547 Ga0068851_100065475 169
316 3300005834 Ga0068851_10010242 Ga0068851_100102425 169
317 3300005834 Ga0068851_10099054 Ga0068851_100990541 169
318 3300005840 Ga0068870_10026876 Ga0068870_100268762 169
319 3300005840 Ga0068870_10319471 Ga0068870_103194712 169
320 3300005841 Ga0068863_100031255 Ga0068863_1000312553 169
321 3300005841 Ga0068863_100058799 Ga0068863_1000587993 169
322 3300005841 Ga0068863_100085787 Ga0068863_1000857872 169
323 3300005841 Ga0068863_100301358 Ga0068863_1003013582 169
324 3300005841 Ga0068863_100338804 Ga0068863_1003388042 169
325 3300005841 Ga0068863_101176067 Ga0068863_1011760672 169
326 3300005842 Ga0068858_100000404 Ga0068858_10000040411 169
327 3300005842 Ga0068858_100004032 Ga0068858_1000040326 169
328 3300005842 Ga0068858_100274148 Ga0068858_1002741482 169
329 3300005842 Ga0068858_100473751 Ga0068858_1004737512 169
330 3300005843 Ga0068860_100012091 Ga0068860_1000120913 169
331 3300005843 Ga0068860_100038625 Ga0068860_1000386255 169
332 3300005843 Ga0068860_100405138 Ga0068860_1004051382 169
333 3300005844 Ga0068862_100151271 Ga0068862_1001512713 169
334 3300005983 Ga0081540_1093264 Ga0081540_10932642 169
335 3300006028 Ga0070717_10001683 Ga0070717_1000168310 169
336 3300006028 Ga0070717_10004512 Ga0070717_100045129 169
337 3300006028 Ga0070717_10005108 Ga0070717_100051087 169
338 3300006028 Ga0070717_10005704 Ga0070717_100057046 169
339 3300006028 Ga0070717_10011319 Ga0070717_100113194 169
340 3300006028 Ga0070717_10032487 Ga0070717_100324876 169
341 3300006028 Ga0070717_10051470 Ga0070717_100514702 169
342 3300006028 Ga0070717_10064277 Ga0070717_100642773 169
343 3300006028 Ga0070717_10111341 Ga0070717_101113412 169
344 3300006028 Ga0070717_10148095 Ga0070717_101480953 169
345 3300006028 Ga0070717_10207105 Ga0070717_102071052 169
346 3300006028 Ga0070717_10221443 Ga0070717_102214432 169
347 3300006028 Ga0070717_10237926 Ga0070717_102379262 169
348 3300006028 Ga0070717_10255225 Ga0070717_102552251 169
349 3300006028 Ga0070717_10262381 Ga0070717_102623812 169
350 3300006028 Ga0070717_10315890 Ga0070717_103158902 169
351 3300006028 Ga0070717_10342052 Ga0070717_103420522 169
352 3300006028 Ga0070717_10423608 Ga0070717_104236082 169
353 3300006028 Ga0070717_10752709 Ga0070717_107527091 169
354 3300006028 Ga0070717_11288950 Ga0070717_112889501 169
355 3300006028 Ga0070717_11341997 Ga0070717_113419971 169
356 3300006163 Ga0070715_10002128 Ga0070715_100021286 169
357 3300006163 Ga0070715_10013154 Ga0070715_100131542 169
358 3300006163 Ga0070715_10094090 Ga0070715_100940902 169
359 3300006163 Ga0070715_10099475 Ga0070715_100994752 169
360 3300006163 Ga0070715_10112816 Ga0070715_101128162 169
361 3300006163 Ga0070715_10178923 Ga0070715_101789231 169
362 3300006163 Ga0070715_10320858 Ga0070715_103208582 169
363 3300006163 Ga0070715_10480664 Ga0070715_104806642 169
364 3300006163 Ga0070715_10802027 Ga0070715_108020271 169
365 3300006173 Ga0070716_100013165 Ga0070716_1000131652 169
366 3300006173 Ga0070716_100015752 Ga0070716_1000157522 169
367 3300006173 Ga0070716_100026282 Ga0070716_1000262824 169
368 3300006173 Ga0070716_100034551 Ga0070716_1000345514 169
369 3300006173 Ga0070716_100039117 Ga0070716_1000391173 169
370 3300006173 Ga0070716_100155544 Ga0070716_1001555442 169
371 3300006173 Ga0070716_100181495 Ga0070716_1001814952 169
372 3300006173 Ga0070716_100215542 Ga0070716_1002155422 169
373 3300006173 Ga0070716_100228980 Ga0070716_1002289802 169
374 3300006173 Ga0070716_100252626 Ga0070716_1002526262 169
375 3300006173 Ga0070716_100272120 Ga0070716_1002721202 169
376 3300006173 Ga0070716_100319623 Ga0070716_1003196231 169
377 3300006173 Ga0070716_100913697 Ga0070716_1009136971 169
378 3300006175 Ga0070712_100000188 Ga0070712_10000018824 169
379 3300006175 Ga0070712_100000723 Ga0070712_10000072311 169
380 3300006175 Ga0070712_100026038 Ga0070712_1000260382 169
381 3300006175 Ga0070712_100026743 Ga0070712_1000267432 169
382 3300006175 Ga0070712_100027377 Ga0070712_1000273773 169
383 3300006175 Ga0070712_100027607 Ga0070712_1000276075 169
384 3300006175 Ga0070712_100040986 Ga0070712_1000409863 169
385 3300006175 Ga0070712_100072539 Ga0070712_1000725393 169
386 3300006175 Ga0070712_100103103 Ga0070712_1001031032 169
387 3300006175 Ga0070712_100260476 Ga0070712_1002604762 169
388 3300006175 Ga0070712_100288502 Ga0070712_1002885021 169
389 3300006175 Ga0070712_100496834 Ga0070712_1004968341 169
390 3300006175 Ga0070712_100624568 Ga0070712_1006245682 169
391 3300006175 Ga0070712_101013852 Ga0070712_1010138521 169
392 3300006237 Ga0097621_100013631 Ga0097621_1000136313 169
393 3300006237 Ga0097621_100024654 Ga0097621_1000246542 169
394 3300006237 Ga0097621_100039766 Ga0097621_1000397664 169
395 3300006237 Ga0097621_100076590 Ga0097621_1000765902 169
396 3300006237 Ga0097621_100121598 Ga0097621_1001215983 169
397 3300006237 Ga0097621_100139551 Ga0097621_1001395512 169
398 3300006237 Ga0097621_100158187 Ga0097621_1001581872 169
399 3300006237 Ga0097621_100459508 Ga0097621_1004595082 169
400 3300006237 Ga0097621_100565154 Ga0097621_1005651542 169
401 3300006237 Ga0097621_100567341 Ga0097621_1005673412 169
402 3300006237 Ga0097621_101100404 Ga0097621_1011004041 169
403 3300006358 Ga0068871_100000389 Ga0068871_10000038928 169
404 3300006358 Ga0068871_100007884 Ga0068871_1000078841 169
405 3300006358 Ga0068871_100034094 Ga0068871_1000340944 169
406 3300006358 Ga0068871_100043390 Ga0068871_1000433902 169
407 3300006358 Ga0068871_100049645 Ga0068871_1000496452 169
408 3300006358 Ga0068871_100049912 Ga0068871_1000499123 169
409 3300006358 Ga0068871_100091844 Ga0068871_1000918442 169
410 3300006358 Ga0068871_100314305 Ga0068871_1003143051 169
411 3300006358 Ga0068871_100541172 Ga0068871_1005411721 169
412 3300006847 Ga0075431_100508146 Ga0075431_1005081462 169
413 3300006852 Ga0075433_10000636 Ga0075433_100006365 169
414 3300006852 Ga0075433_10777035 Ga0075433_107770352 169
415 3300006871 Ga0075434_100001288 Ga0075434_10000128819 169
416 3300006871 Ga0075434_100001829 Ga0075434_1000018293 169
417 3300006871 Ga0075434_100035785 Ga0075434_1000357852 169
418 3300006881 Ga0068865_100044263 Ga0068865_1000442633 169
419 3300006881 Ga0068865_100235879 Ga0068865_1002358791 169
420 3300006881 Ga0068865_100441121 Ga0068865_1004411212 169
421 3300006914 Ga0075436_100003222 Ga0075436_1000032228 169
422 3300006914 Ga0075436_100006615 Ga0075436_1000066158 169
423 3300006914 Ga0075436_100007751 Ga0075436_1000077518 169
424 3300006914 Ga0075436_100013183 Ga0075436_1000131832 169
425 3300006914 Ga0075436_100046263 Ga0075436_1000462633 169
426 3300006914 Ga0075436_100088486 Ga0075436_1000884862 169
427 3300006914 Ga0075436_100139706 Ga0075436_1001397062 169
428 3300006914 Ga0075436_100362595 Ga0075436_1003625952 169
429 3300006914 Ga0075436_100448902 Ga0075436_1004489022 169
430 3300006914 Ga0075436_100526995 Ga0075436_1005269952 169
431 3300006931 Ga0097620_100014831 Ga0097620_1000148314 169
432 3300006931 Ga0097620_100015253 Ga0097620_1000152533 169
433 3300006931 Ga0097620_100094426 Ga0097620_1000944262 169
434 3300006931 Ga0097620_100253503 Ga0097620_1002535032 169
435 3300006931 Ga0097620_100298470 Ga0097620_1002984702 169
436 3300006931 Ga0097620_100344743 Ga0097620_1003447432 169
437 3300006931 Ga0097620_101026981 Ga0097620_1010269812 169
438 3300006931 Ga0097620_101680699 Ga0097620_1016806991 169
439 3300007076 Ga0075435_100002192 Ga0075435_1000021924 169
440 3300007076 Ga0075435_100016802 Ga0075435_1000168022 169
441 3300007076 Ga0075435_100101237 Ga0075435_1001012373 169
442 3300007076 Ga0075435_100427608 Ga0075435_1004276082 169
443 3300007076 Ga0075435_101252867 Ga0075435_1012528672 169
444 3300007265 Ga0099794_10044594 Ga0099794_100445942 169
445 3300007265 Ga0099794_10074135 Ga0099794_100741352 169
446 3300007265 Ga0099794_10402595 Ga0099794_104025952 169
447 3300007788 Ga0099795_10030520 Ga0099795_100305202 169
448 3300009093 Ga0105240_10055750 Ga0105240_100557506 169
449 3300009093 Ga0105240_10061239 Ga0105240_100612395 169
450 3300009093 Ga0105240_10098841 Ga0105240_100988413 169
451 3300009093 Ga0105240_10147828 Ga0105240_101478282 169
452 3300009093 Ga0105240_10197359 Ga0105240_101973592 169
453 3300009093 Ga0105240_10205854 Ga0105240_102058543 169
454 3300009093 Ga0105240_10259198 Ga0105240_102591981 169
455 3300009093 Ga0105240_10519746 Ga0105240_105197461 169
456 3300009093 Ga0105240_10580303 Ga0105240_105803031 169
457 3300009093 Ga0105240_10581698 Ga0105240_105816982 169
458 3300009093 Ga0105240_10775099 Ga0105240_107750992 169
459 3300009093 Ga0105240_10819970 Ga0105240_108199701 169
460 3300009093 Ga0105240_11018321 Ga0105240_110183212 169
461 3300009093 Ga0105240_11148092 Ga0105240_111480921 169
462 3300009093 Ga0105240_11780744 Ga0105240_117807441 169
463 3300009094 Ga0111539_10407355 Ga0111539_104073552 169
464 3300009094 Ga0111539_11498579 Ga0111539_114985792 169
465 3300009098 Ga0105245_10003248 Ga0105245_1000324812 169
466 3300009098 Ga0105245_10007752 Ga0105245_100077527 169
467 3300009098 Ga0105245_10007882 Ga0105245_100078826 169
468 3300009098 Ga0105245_10018174 Ga0105245_100181743 169
469 3300009098 Ga0105245_10052722 Ga0105245_100527222 169
470 3300009098 Ga0105245_10064552 Ga0105245_100645524 169
471 3300009098 Ga0105245_10093343 Ga0105245_100933432 169
472 3300009098 Ga0105245_10179724 Ga0105245_101797242 169
473 3300009098 Ga0105245_10423149 Ga0105245_104231492 169
474 3300009098 Ga0105245_10481162 Ga0105245_104811622 169
475 3300009098 Ga0105245_10778165 Ga0105245_107781651 169
476 3300009101 Ga0105247_10001594 Ga0105247_100015946 169
477 3300009101 Ga0105247_10017504 Ga0105247_100175043 169
478 3300009147 Ga0114129_10061374 Ga0114129_100613746 169
479 3300009147 Ga0114129_10165885 Ga0114129_101658853 169
480 3300009148 Ga0105243_10626305 Ga0105243_106263052 169
481 3300009148 Ga0105243_11377270 Ga0105243_113772702 169
482 3300009174 Ga0105241_10004558 Ga0105241_1000455811 169
483 3300009174 Ga0105241_10024348 Ga0105241_100243482 169
484 3300009174 Ga0105241_10043109 Ga0105241_100431094 169
485 3300009174 Ga0105241_10049184 Ga0105241_100491842 169
486 3300009174 Ga0105241_10070311 Ga0105241_100703112 169
487 3300009174 Ga0105241_10094522 Ga0105241_100945222 169
488 3300009174 Ga0105241_10258229 Ga0105241_102582292 169
489 3300009174 Ga0105241_10397954 Ga0105241_103979542 169
490 3300009174 Ga0105241_10407320 Ga0105241_104073201 169
491 3300009174 Ga0105241_11769001 Ga0105241_117690011 169
492 3300009176 Ga0105242_10006980 Ga0105242_100069806 169
493 3300009176 Ga0105242_10171301 Ga0105242_101713012 169
494 3300009176 Ga0105242_10274578 Ga0105242_102745783 169
495 3300009176 Ga0105242_10449797 Ga0105242_104497972 169
496 3300009176 Ga0105242_11373422 Ga0105242_113734221 169
497 3300009177 Ga0105248_10011433 Ga0105248_100114339 169
498 3300009177 Ga0105248_10026687 Ga0105248_100266875 169
499 3300009177 Ga0105248_10086566 Ga0105248_100865664 169
500 3300009177 Ga0105248_10099247 Ga0105248_100992475 169
501 3300009177 Ga0105248_10283297 Ga0105248_102832972 169
502 3300009177 Ga0105248_10570011 Ga0105248_105700113 169
503 3300009177 Ga0105248_10872668 Ga0105248_108726682 169
504 3300009545 Ga0105237_10006364 Ga0105237_100063648 169
505 3300009545 Ga0105237_10013796 Ga0105237_100137965 169
506 3300009545 Ga0105237_10045567 Ga0105237_100455674 169
507 3300009545 Ga0105237_10072667 Ga0105237_100726674 169
508 3300009545 Ga0105237_10075837 Ga0105237_100758371 169
509 3300009545 Ga0105237_10216179 Ga0105237_102161792 169
510 3300009545 Ga0105237_10273158 Ga0105237_102731582 169
511 3300009545 Ga0105237_10285608 Ga0105237_102856082 169
512 3300009545 Ga0105237_10321170 Ga0105237_103211702 169
513 3300009545 Ga0105237_10410467 Ga0105237_104104672 169
514 3300009545 Ga0105237_10653280 Ga0105237_106532801 169
515 3300009545 Ga0105237_10691100 Ga0105237_106911002 169
516 3300009545 Ga0105237_10723015 Ga0105237_107230152 169
517 3300009545 Ga0105237_10899599 Ga0105237_108995992 169
518 3300009545 Ga0105237_11092496 Ga0105237_110924962 169
519 3300009545 Ga0105237_11725016 Ga0105237_117250161 169
520 3300009551 Ga0105238_10025430 Ga0105238_100254305 169
521 3300009551 Ga0105238_10138524 Ga0105238_101385242 169
522 3300009551 Ga0105238_10157265 Ga0105238_101572652 169
523 3300009551 Ga0105238_10206998 Ga0105238_102069982 169
524 3300009551 Ga0105238_10235107 Ga0105238_102351072 169
525 3300009551 Ga0105238_10249507 Ga0105238_102495072 169
526 3300009553 Ga0105249_10041603 Ga0105249_100416033 169
527 3300009553 Ga0105249_10308379 Ga0105249_103083792 169
528 3300010159 Ga0099796_10028145 Ga0099796_100281452 169
529 3300010375 Ga0105239_10003652 Ga0105239_100036524 169
530 3300010375 Ga0105239_10066583 Ga0105239_100665832 169
531 3300010375 Ga0105239_10070525 Ga0105239_100705254 169
532 3300010375 Ga0105239_10087659 Ga0105239_100876592 169
533 3300010375 Ga0105239_10095971 Ga0105239_100959712 169
534 3300010375 Ga0105239_10370397 Ga0105239_103703972 169
535 3300010375 Ga0105239_10713671 Ga0105239_107136712 169
536 3300010375 Ga0105239_11270780 Ga0105239_112707802 169
537 3300010375 Ga0105239_12512498 Ga0105239_125124981 169
538 3300011119 Ga0105246_10004431 Ga0105246_100044313 169
539 3300011119 Ga0105246_10251252 Ga0105246_102512522 169
540 3300011119 Ga0105246_10487443 Ga0105246_104874432 169
541 3300011119 Ga0105246_10726030 Ga0105246_107260301 169
542 3300011119 Ga0105246_10810470 Ga0105246_108104702 169
543 3300012506 Ga0157324_1004648 Ga0157324_10046481 169
544 3300013100 Ga0157373_10002519 Ga0157373_1000251912 169
545 3300013100 Ga0157373_10007083 Ga0157373_100070836 169
546 3300013100 Ga0157373_10030097 Ga0157373_100300972 169
547 3300013100 Ga0157373_10108259 Ga0157373_101082592 169
548 3300013100 Ga0157373_10116116 Ga0157373_101161162 169
549 3300013100 Ga0157373_10182073 Ga0157373_101820732 169
550 3300013100 Ga0157373_10338975 Ga0157373_103389751 169
551 3300013100 Ga0157373_10470852 Ga0157373_104708521 169
552 3300013102 Ga0157371_10008414 Ga0157371_100084147 169
553 3300013102 Ga0157371_10009414 Ga0157371_100094146 169
554 3300013102 Ga0157371_10049901 Ga0157371_100499013 169
555 3300013104 Ga0157370_10045645 Ga0157370_100456452 169
556 3300013104 Ga0157370_10080214 Ga0157370_100802142 169
557 3300013104 Ga0157370_10108342 Ga0157370_101083422 169
558 3300013104 Ga0157370_10209613 Ga0157370_102096132 169
559 3300013104 Ga0157370_10294890 Ga0157370_102948902 169
560 3300013104 Ga0157370_10692587 Ga0157370_106925872 169
561 3300013105 Ga0157369_10017191 Ga0157369_100171919 169
562 3300013105 Ga0157369_10060408 Ga0157369_100604082 169
563 3300013105 Ga0157369_10122971 Ga0157369_101229712 169
564 3300013105 Ga0157369_10127242 Ga0157369_101272422 169
565 3300013105 Ga0157369_10258603 Ga0157369_102586032 169
566 3300013105 Ga0157369_10363215 Ga0157369_103632152 169
567 3300013105 Ga0157369_10515747 Ga0157369_105157471 169
568 3300013105 Ga0157369_11047837 Ga0157369_110478371 169
569 3300013296 Ga0157374_10000634 Ga0157374_1000063427 169
570 3300013296 Ga0157374_10001978 Ga0157374_1000197818 169
571 3300013296 Ga0157374_10002353 Ga0157374_100023537 169
572 3300013296 Ga0157374_10007704 Ga0157374_100077043 169
573 3300013296 Ga0157374_10020608 Ga0157374_100206086 169
574 3300013296 Ga0157374_10059771 Ga0157374_100597714 169
575 3300013296 Ga0157374_10113865 Ga0157374_101138652 169
576 3300013296 Ga0157374_10140007 Ga0157374_101400073 169
577 3300013296 Ga0157374_10392430 Ga0157374_103924302 169
578 3300013296 Ga0157374_10650860 Ga0157374_106508602 169
579 3300013296 Ga0157374_11987540 Ga0157374_119875401 169
580 3300013297 Ga0157378_10000202 Ga0157378_1000020255 169
581 3300013297 Ga0157378_10000725 Ga0157378_100007254 169
582 3300013297 Ga0157378_10001795 Ga0157378_1000179517 169
583 3300013297 Ga0157378_10012660 Ga0157378_100126608 169
584 3300013297 Ga0157378_10072136 Ga0157378_100721362 169
585 3300013297 Ga0157378_10090402 Ga0157378_100904023 169
586 3300013297 Ga0157378_10340913 Ga0157378_103409132 169
587 3300013297 Ga0157378_10543179 Ga0157378_105431792 169
588 3300013297 Ga0157378_10717651 Ga0157378_107176511 169
589 3300013297 Ga0157378_10754322 Ga0157378_107543222 169
590 3300013297 Ga0157378_11058524 Ga0157378_110585242 169
591 3300013297 Ga0157378_11443155 Ga0157378_114431551 169
592 3300013306 Ga0163162_10009643 Ga0163162_100096438 169
593 3300013306 Ga0163162_10040280 Ga0163162_100402803 169
594 3300013306 Ga0163162_10055031 Ga0163162_100550313 169
595 3300013306 Ga0163162_10070409 Ga0163162_100704092 169
596 3300013306 Ga0163162_10112681 Ga0163162_101126812 169
597 3300013306 Ga0163162_10152829 Ga0163162_101528292 169
598 3300013306 Ga0163162_10191003 Ga0163162_101910032 169
599 3300013306 Ga0163162_10314703 Ga0163162_103147032 169
600 3300013306 Ga0163162_10759984 Ga0163162_107599842 169
601 3300013306 Ga0163162_11004324 Ga0163162_110043242 169
602 3300013306 Ga0163162_11046858 Ga0163162_110468582 169
603 3300013306 Ga0163162_11072492 Ga0163162_110724922 169
604 3300013306 Ga0163162_11162495 Ga0163162_111624952 169
605 3300013306 Ga0163162_12053660 Ga0163162_120536601 169
606 3300013307 Ga0157372_10000565 Ga0157372_1000056525 169
607 3300013307 Ga0157372_10002050 Ga0157372_100020509 169
608 3300013307 Ga0157372_10003078 Ga0157372_1000307813 169
609 3300013307 Ga0157372_10015430 Ga0157372_100154305 169
610 3300013307 Ga0157372_10016466 Ga0157372_100164662 169
611 3300013307 Ga0157372_10022661 Ga0157372_100226612 169
612 3300013307 Ga0157372_10030069 Ga0157372_100300697 169
613 3300013307 Ga0157372_10053833 Ga0157372_100538332 169
614 3300013307 Ga0157372_10054469 Ga0157372_100544692 169
615 3300013307 Ga0157372_10059528 Ga0157372_100595282 169
616 3300013307 Ga0157372_10188739 Ga0157372_101887393 169
617 3300013307 Ga0157372_10352323 Ga0157372_103523231 169
618 3300013307 Ga0157372_10390444 Ga0157372_103904442 169
619 3300013307 Ga0157372_11356269 Ga0157372_113562692 169
620 3300013308 Ga0157375_10073401 Ga0157375_100734011 169
621 3300013308 Ga0157375_10248755 Ga0157375_102487552 169
622 3300013308 Ga0157375_10335458 Ga0157375_103354582 169
623 3300013308 Ga0157375_10657732 Ga0157375_106577322 169
624 3300013308 Ga0157375_11383542 Ga0157375_113835422 169
625 3300013308 Ga0157375_11644918 Ga0157375_116449182 169
626 3300014325 Ga0163163_10003044 Ga0163163_100030446 169
627 3300014325 Ga0163163_10040832 Ga0163163_100408324 169
628 3300014325 Ga0163163_10051769 Ga0163163_100517693 169
629 3300014325 Ga0163163_10192569 Ga0163163_101925692 169
630 3300014325 Ga0163163_10340898 Ga0163163_103408982 169
631 3300014325 Ga0163163_10445884 Ga0163163_104458841 169
632 3300014325 Ga0163163_10563764 Ga0163163_105637641 169
633 3300014325 Ga0163163_10937098 Ga0163163_109370981 169
634 3300014325 Ga0163163_11393492 Ga0163163_113934921 169
635 3300014325 Ga0163163_11597050 Ga0163163_115970502 169
636 3300014326 Ga0157380_11681187 Ga0157380_116811872 169
637 3300014497 Ga0182008_10004678 Ga0182008_100046785 169
638 3300014497 Ga0182008_10020896 Ga0182008_100208962 169
639 3300014497 Ga0182008_10158242 Ga0182008_101582422 169
640 3300014745 Ga0157377_10006706 Ga0157377_100067063 169
641 3300014745 Ga0157377_10327853 Ga0157377_103278532 169
642 3300014745 Ga0157377_10354088 Ga0157377_103540882 169
643 3300014745 Ga0157377_11015507 Ga0157377_110155071 169
644 3300014968 Ga0157379_10003409 Ga0157379_100034094 169
645 3300014968 Ga0157379_10034772 Ga0157379_100347723 169
646 3300014968 Ga0157379_10151447 Ga0157379_101514472 169
647 3300014968 Ga0157379_10171237 Ga0157379_101712372 169
648 3300014968 Ga0157379_10349408 Ga0157379_103494082 169
649 3300014968 Ga0157379_10656943 Ga0157379_106569432 169
650 3300014968 Ga0157379_11279596 Ga0157379_112795961 169
651 3300014969 Ga0157376_10004658 Ga0157376_100046589 169
652 3300014969 Ga0157376_10029519 Ga0157376_100295192 169
653 3300014969 Ga0157376_10069210 Ga0157376_100692103 169
654 3300014969 Ga0157376_10247471 Ga0157376_102474712 169
655 3300014969 Ga0157376_10292498 Ga0157376_102924982 169
656 3300014969 Ga0157376_10386907 Ga0157376_103869071 169
657 3300014969 Ga0157376_10564970 Ga0157376_105649702 169
658 3300014969 Ga0157376_11052914 Ga0157376_110529142 169
659 3300015262 Ga0182007_10024426 Ga0182007_100244263 169
660 3300015262 Ga0182007_10227876 Ga0182007_102278761 169
661 3300015265 Ga0182005_1003699 Ga0182005_10036995 169
662 3300015265 Ga0182005_1097660 Ga0182005_10976602 169
663 3300017792 Ga0163161_10032069 Ga0163161_100320692 169
664 3300017792 Ga0163161_10733077 Ga0163161_107330771 169
665 3300021384 Ga0213876_10246687 Ga0213876_102466872 169
666 3300021388 Ga0213875_10004172 Ga0213875_100041726 169
667 3300022467 Ga0224712_10480315 Ga0224712_104803151 169
668 3300022730 Ga0224570_100116 Ga0224570_1001164 169
669 3300022732 Ga0224569_100063 Ga0224569_1000635 169
670 3300022732 Ga0224569_103169 Ga0224569_1031692 169
671 3300022734 Ga0224571_100789 Ga0224571_1007892 169
672 3300024225 Ga0224572_1015389 Ga0224572_10153892 169
673 3300024225 Ga0224572_1018281 Ga0224572_10182812 169
674 3300024225 Ga0224572_1037013 Ga0224572_10370132 169
675 3300024225 Ga0224572_1063119 Ga0224572_10631191 169
676 3300024227 Ga0228598_1000002 Ga0228598_10000027 169
677 3300024227 Ga0228598_1000333 Ga0228598_10003335 169
678 3300024227 Ga0228598_1005227 Ga0228598_10052274 169
679 3300025315 Ga0207697_10014218 Ga0207697_100142184 169
680 3300025321 Ga0207656_10002371 Ga0207656_100023716 169
681 3300025898 Ga0207692_10024383 Ga0207692_100243832 169
682 3300025898 Ga0207692_10028069 Ga0207692_100280691 169
683 3300025898 Ga0207692_10062910 Ga0207692_100629102 169
684 3300025898 Ga0207692_10176892 Ga0207692_101768922 169
685 3300025898 Ga0207692_10200597 Ga0207692_102005972 169
686 3300025898 Ga0207692_10241162 Ga0207692_102411621 169
687 3300025898 Ga0207692_10598833 Ga0207692_105988331 169
688 3300025898 Ga0207692_10683838 Ga0207692_106838382 169
689 3300025898 Ga0207692_10867374 Ga0207692_108673741 169
690 3300025899 Ga0207642_10004640 Ga0207642_100046404 169
691 3300025899 Ga0207642_10017427 Ga0207642_100174272 169
692 3300025899 Ga0207642_10029862 Ga0207642_100298622 169
693 3300025899 Ga0207642_10475266 Ga0207642_104752662 169
694 3300025900 Ga0207710_10023501 Ga0207710_100235013 169
695 3300025900 Ga0207710_10097775 Ga0207710_100977752 169
696 3300025900 Ga0207710_10113691 Ga0207710_101136912 169
697 3300025901 Ga0207688_10055000 Ga0207688_100550002 169
698 3300025903 Ga0207680_10081689 Ga0207680_100816892 169
699 3300025903 Ga0207680_10236894 Ga0207680_102368942 169
700 3300025903 Ga0207680_10393459 Ga0207680_103934592 169
701 3300025904 Ga0207647_10013732 Ga0207647_100137323 169
702 3300025904 Ga0207647_10017367 Ga0207647_100173675 169
703 3300025904 Ga0207647_10029904 Ga0207647_100299043 169
704 3300025905 Ga0207685_10008705 Ga0207685_100087053 169
705 3300025905 Ga0207685_10036045 Ga0207685_100360452 169
706 3300025905 Ga0207685_10090705 Ga0207685_100907052 169
707 3300025905 Ga0207685_10211595 Ga0207685_102115952 169
708 3300025905 Ga0207685_10385944 Ga0207685_103859441 169
709 3300025906 Ga0207699_10010406 Ga0207699_100104065 169
710 3300025906 Ga0207699_10013470 Ga0207699_100134704 169
711 3300025906 Ga0207699_10026320 Ga0207699_100263202 169
712 3300025906 Ga0207699_10074634 Ga0207699_100746341 169
713 3300025906 Ga0207699_10079595 Ga0207699_100795952 169
714 3300025906 Ga0207699_10120186 Ga0207699_101201862 169
715 3300025906 Ga0207699_10124813 Ga0207699_101248131 169
716 3300025906 Ga0207699_10311647 Ga0207699_103116472 169
717 3300025906 Ga0207699_10463961 Ga0207699_104639611 169
718 3300025906 Ga0207699_10480103 Ga0207699_104801032 169
719 3300025906 Ga0207699_10742188 Ga0207699_107421882 169
720 3300025907 Ga0207645_10000125 Ga0207645_1000012541 169
721 3300025907 Ga0207645_10142836 Ga0207645_101428362 169
722 3300025907 Ga0207645_10483605 Ga0207645_104836052 169
723 3300025908 Ga0207643_10000488 Ga0207643_1000048812 169
724 3300025908 Ga0207643_10376564 Ga0207643_103765641 169
725 3300025909 Ga0207705_10024329 Ga0207705_100243293 169
726 3300025909 Ga0207705_10449652 Ga0207705_104496522 169
727 3300025910 Ga0207684_10000223 Ga0207684_1000022327 169
728 3300025910 Ga0207684_10003613 Ga0207684_100036135 169
729 3300025910 Ga0207684_10005360 Ga0207684_100053608 169
730 3300025910 Ga0207684_10027576 Ga0207684_100275763 169
731 3300025910 Ga0207684_10051827 Ga0207684_100518272 169
732 3300025910 Ga0207684_10503490 Ga0207684_105034902 169
733 3300025911 Ga0207654_10003381 Ga0207654_100033811 169
734 3300025911 Ga0207654_10008923 Ga0207654_100089232 169
735 3300025911 Ga0207654_10012212 Ga0207654_100122123 169
736 3300025911 Ga0207654_10018603 Ga0207654_100186032 169
737 3300025911 Ga0207654_10057660 Ga0207654_100576603 169
738 3300025911 Ga0207654_10059531 Ga0207654_100595312 169
739 3300025911 Ga0207654_10078327 Ga0207654_100783273 169
740 3300025911 Ga0207654_10473775 Ga0207654_104737751 169
741 3300025911 Ga0207654_10597928 Ga0207654_105979281 169
742 3300025912 Ga0207707_10011464 Ga0207707_100114643 169
743 3300025912 Ga0207707_10014133 Ga0207707_100141336 169
744 3300025912 Ga0207707_10054384 Ga0207707_100543842 169
745 3300025912 Ga0207707_10063047 Ga0207707_100630472 169
746 3300025912 Ga0207707_10429255 Ga0207707_104292552 169
747 3300025913 Ga0207695_10006382 Ga0207695_100063825 169
748 3300025913 Ga0207695_10006994 Ga0207695_1000699411 169
749 3300025913 Ga0207695_10018543 Ga0207695_100185435 169
750 3300025913 Ga0207695_10074781 Ga0207695_100747815 169
751 3300025913 Ga0207695_10131230 Ga0207695_101312301 169
752 3300025913 Ga0207695_10134629 Ga0207695_101346292 169
753 3300025913 Ga0207695_10136999 Ga0207695_101369993 169
754 3300025913 Ga0207695_10143928 Ga0207695_101439282 169
755 3300025913 Ga0207695_10276584 Ga0207695_102765842 169
756 3300025913 Ga0207695_10501488 Ga0207695_105014881 169
757 3300025913 Ga0207695_10556484 Ga0207695_105564841 169
758 3300025913 Ga0207695_10652576 Ga0207695_106525762 169
759 3300025913 Ga0207695_10754790 Ga0207695_107547902 169
760 3300025914 Ga0207671_10006781 Ga0207671_100067811 169
761 3300025914 Ga0207671_10011713 Ga0207671_100117136 169
762 3300025914 Ga0207671_10016797 Ga0207671_100167972 169
763 3300025914 Ga0207671_10346429 Ga0207671_103464291 169
764 3300025914 Ga0207671_10926364 Ga0207671_109263641 169
765 3300025915 Ga0207693_10000524 Ga0207693_1000052417 169
766 3300025915 Ga0207693_10000961 Ga0207693_1000096115 169
767 3300025915 Ga0207693_10008223 Ga0207693_100082239 169
768 3300025915 Ga0207693_10013230 Ga0207693_100132305 169
769 3300025915 Ga0207693_10014832 Ga0207693_100148327 169
770 3300025915 Ga0207693_10023945 Ga0207693_100239453 169
771 3300025915 Ga0207693_10075765 Ga0207693_100757652 169
772 3300025915 Ga0207693_10119681 Ga0207693_101196812 169
773 3300025915 Ga0207693_10171491 Ga0207693_101714912 169
774 3300025915 Ga0207693_10938887 Ga0207693_109388871 169
775 3300025916 Ga0207663_10001734 Ga0207663_100017344 169
776 3300025916 Ga0207663_10001859 Ga0207663_1000185910 169
777 3300025916 Ga0207663_10004743 Ga0207663_100047436 169
778 3300025916 Ga0207663_10015680 Ga0207663_100156804 169
779 3300025916 Ga0207663_10026236 Ga0207663_100262363 169
780 3300025916 Ga0207663_10028036 Ga0207663_100280362 169
781 3300025916 Ga0207663_10125516 Ga0207663_101255162 169
782 3300025916 Ga0207663_10138418 Ga0207663_101384182 169
783 3300025916 Ga0207663_10155129 Ga0207663_101551292 169
784 3300025916 Ga0207663_10210328 Ga0207663_102103282 169
785 3300025916 Ga0207663_10270634 Ga0207663_102706342 169
786 3300025916 Ga0207663_10593226 Ga0207663_105932262 169
787 3300025916 Ga0207663_10688618 Ga0207663_106886181 169
788 3300025917 Ga0207660_10098507 Ga0207660_100985073 169
789 3300025917 Ga0207660_10449225 Ga0207660_104492252 169
790 3300025917 Ga0207660_10607143 Ga0207660_106071432 169
791 3300025917 Ga0207660_10607628 Ga0207660_106076282 169
792 3300025919 Ga0207657_10000242 Ga0207657_1000024215 169
793 3300025919 Ga0207657_10004544 Ga0207657_100045447 169
794 3300025919 Ga0207657_10540098 Ga0207657_105400981 169
795 3300025920 Ga0207649_10000177 Ga0207649_1000017734 169
796 3300025920 Ga0207649_10017954 Ga0207649_100179543 169
797 3300025920 Ga0207649_10135827 Ga0207649_101358272 169
798 3300025921 Ga0207652_10051559 Ga0207652_100515594 169
799 3300025921 Ga0207652_10085723 Ga0207652_100857232 169
800 3300025921 Ga0207652_10178854 Ga0207652_101788542 169
801 3300025921 Ga0207652_10204269 Ga0207652_102042693 169
802 3300025921 Ga0207652_10229348 Ga0207652_102293482 169
803 3300025921 Ga0207652_10300171 Ga0207652_103001711 169
804 3300025921 Ga0207652_11013346 Ga0207652_110133461 169
805 3300025922 Ga0207646_10000348 Ga0207646_1000034842 169
806 3300025922 Ga0207646_10001267 Ga0207646_1000126719 169
807 3300025922 Ga0207646_10033930 Ga0207646_100339305 169
808 3300025922 Ga0207646_10180094 Ga0207646_101800942 169
809 3300025922 Ga0207646_10519122 Ga0207646_105191222 169
810 3300025923 Ga0207681_10137815 Ga0207681_101378152 169
811 3300025923 Ga0207681_10274769 Ga0207681_102747692 169
812 3300025924 Ga0207694_10019580 Ga0207694_100195802 169
813 3300025924 Ga0207694_10078313 Ga0207694_100783134 169
814 3300025924 Ga0207694_10152856 Ga0207694_101528562 169
815 3300025924 Ga0207694_10158395 Ga0207694_101583951 169
816 3300025924 Ga0207694_10164503 Ga0207694_101645032 169
817 3300025924 Ga0207694_10333271 Ga0207694_103332713 169
818 3300025925 Ga0207650_10000072 Ga0207650_1000007246 169
819 3300025925 Ga0207650_10000078 Ga0207650_1000007871 169
820 3300025925 Ga0207650_10020813 Ga0207650_100208132 169
821 3300025925 Ga0207650_10259650 Ga0207650_102596502 169
822 3300025925 Ga0207650_10376014 Ga0207650_103760142 169
823 3300025926 Ga0207659_10092620 Ga0207659_100926202 169
824 3300025926 Ga0207659_10138410 Ga0207659_101384102 169
825 3300025926 Ga0207659_10143413 Ga0207659_101434132 169
826 3300025926 Ga0207659_10683307 Ga0207659_106833072 169
827 3300025926 Ga0207659_11067929 Ga0207659_110679292 169
828 3300025927 Ga0207687_10001734 Ga0207687_100017349 169
829 3300025927 Ga0207687_10004355 Ga0207687_100043555 169
830 3300025927 Ga0207687_10042892 Ga0207687_100428921 169
831 3300025927 Ga0207687_10211196 Ga0207687_102111962 169
832 3300025927 Ga0207687_10335612 Ga0207687_103356122 169
833 3300025927 Ga0207687_10557002 Ga0207687_105570022 169
834 3300025928 Ga0207700_10001427 Ga0207700_100014275 169
835 3300025928 Ga0207700_10021787 Ga0207700_100217872 169
836 3300025928 Ga0207700_10022935 Ga0207700_100229355 169
837 3300025928 Ga0207700_10027238 Ga0207700_100272382 169
838 3300025928 Ga0207700_10028863 Ga0207700_100288633 169
839 3300025928 Ga0207700_10034336 Ga0207700_100343363 169
840 3300025928 Ga0207700_10041527 Ga0207700_100415271 169
841 3300025928 Ga0207700_10063437 Ga0207700_100634372 169
842 3300025928 Ga0207700_10104271 Ga0207700_101042712 169
843 3300025928 Ga0207700_10104872 Ga0207700_101048721 169
844 3300025928 Ga0207700_10106753 Ga0207700_101067533 169
845 3300025928 Ga0207700_10191786 Ga0207700_101917863 169
846 3300025928 Ga0207700_10206384 Ga0207700_102063842 169
847 3300025928 Ga0207700_10207494 Ga0207700_102074942 169
848 3300025928 Ga0207700_10221360 Ga0207700_102213602 169
849 3300025928 Ga0207700_10259524 Ga0207700_102595242 169
850 3300025928 Ga0207700_10428458 Ga0207700_104284582 169
851 3300025928 Ga0207700_10483438 Ga0207700_104834382 169
852 3300025928 Ga0207700_10562919 Ga0207700_105629192 169
853 3300025928 Ga0207700_10652505 Ga0207700_106525051 169
854 3300025928 Ga0207700_11002775 Ga0207700_110027752 169
855 3300025928 Ga0207700_11480480 Ga0207700_114804802 169
856 3300025928 Ga0207700_11604665 Ga0207700_116046651 169
857 3300025929 Ga0207664_10035117 Ga0207664_100351172 169
858 3300025929 Ga0207664_10049398 Ga0207664_100493982 169
859 3300025929 Ga0207664_10055328 Ga0207664_100553283 169
860 3300025929 Ga0207664_10064901 Ga0207664_100649012 169
861 3300025929 Ga0207664_10073009 Ga0207664_100730092 169
862 3300025929 Ga0207664_10119385 Ga0207664_101193851 169
863 3300025929 Ga0207664_10120971 Ga0207664_101209712 169
864 3300025929 Ga0207664_10125915 Ga0207664_101259152 169
865 3300025929 Ga0207664_10145912 Ga0207664_101459122 169
866 3300025929 Ga0207664_10206778 Ga0207664_102067783 169
867 3300025929 Ga0207664_10267429 Ga0207664_102674292 169
868 3300025929 Ga0207664_10280458 Ga0207664_102804582 169
869 3300025929 Ga0207664_10322698 Ga0207664_103226982 169
870 3300025929 Ga0207664_10408277 Ga0207664_104082772 169
871 3300025929 Ga0207664_10575630 Ga0207664_105756302 169
872 3300025929 Ga0207664_10810414 Ga0207664_108104141 169
873 3300025929 Ga0207664_10874765 Ga0207664_108747652 169
874 3300025929 Ga0207664_10920441 Ga0207664_109204411 169
875 3300025931 Ga0207644_10088536 Ga0207644_100885362 169
876 3300025931 Ga0207644_11014172 Ga0207644_110141722 169
877 3300025932 Ga0207690_10022280 Ga0207690_100222802 169
878 3300025932 Ga0207690_10655260 Ga0207690_106552602 169
879 3300025933 Ga0207706_10003412 Ga0207706_100034126 169
880 3300025933 Ga0207706_10020486 Ga0207706_100204864 169
881 3300025933 Ga0207706_10022082 Ga0207706_100220826 169
882 3300025934 Ga0207686_10060006 Ga0207686_100600062 169
883 3300025934 Ga0207686_10084322 Ga0207686_100843222 169
884 3300025934 Ga0207686_10095150 Ga0207686_100951502 169
885 3300025936 Ga0207670_10035848 Ga0207670_100358482 169
886 3300025936 Ga0207670_10290118 Ga0207670_102901182 169
887 3300025936 Ga0207670_11168690 Ga0207670_111686901 169
888 3300025937 Ga0207669_10871523 Ga0207669_108715231 169
889 3300025938 Ga0207704_10016976 Ga0207704_100169763 169
890 3300025938 Ga0207704_10077655 Ga0207704_100776552 169
891 3300025938 Ga0207704_10162300 Ga0207704_101623002 169
892 3300025938 Ga0207704_10313466 Ga0207704_103134662 169
893 3300025939 Ga0207665_10008885 Ga0207665_100088853 169
894 3300025939 Ga0207665_10011904 Ga0207665_100119047 169
895 3300025939 Ga0207665_10026521 Ga0207665_100265213 169
896 3300025939 Ga0207665_10029957 Ga0207665_100299573 169
897 3300025939 Ga0207665_10059495 Ga0207665_100594953 169
898 3300025939 Ga0207665_10062057 Ga0207665_100620573 169
899 3300025939 Ga0207665_10102172 Ga0207665_101021722 169
900 3300025939 Ga0207665_10151101 Ga0207665_101511012 169
901 3300025939 Ga0207665_10152393 Ga0207665_101523932 169
902 3300025939 Ga0207665_10222969 Ga0207665_102229692 169
903 3300025939 Ga0207665_10310186 Ga0207665_103101862 169
904 3300025939 Ga0207665_10435044 Ga0207665_104350442 169
905 3300025939 Ga0207665_10518534 Ga0207665_105185342 169
906 3300025939 Ga0207665_10661700 Ga0207665_106617001 169
907 3300025939 Ga0207665_10883712 Ga0207665_108837121 169
908 3300025940 Ga0207691_10000853 Ga0207691_1000085315 169
909 3300025940 Ga0207691_10386750 Ga0207691_103867502 169
910 3300025940 Ga0207691_10769395 Ga0207691_107693952 169
911 3300025941 Ga0207711_10006085 Ga0207711_100060855 169
912 3300025941 Ga0207711_10020209 Ga0207711_100202092 169
913 3300025941 Ga0207711_10025091 Ga0207711_100250915 169
914 3300025941 Ga0207711_10031024 Ga0207711_100310244 169
915 3300025941 Ga0207711_10486305 Ga0207711_104863051 169
916 3300025941 Ga0207711_10705534 Ga0207711_107055342 169
917 3300025941 Ga0207711_11238307 Ga0207711_112383072 169
918 3300025941 Ga0207711_11251049 Ga0207711_112510491 169
919 3300025942 Ga0207689_10000495 Ga0207689_1000049515 169
920 3300025942 Ga0207689_10000707 Ga0207689_1000070722 169
921 3300025942 Ga0207689_10020706 Ga0207689_100207066 169
922 3300025944 Ga0207661_10000008 Ga0207661_10000008375 169
923 3300025944 Ga0207661_10001451 Ga0207661_100014516 169
924 3300025944 Ga0207661_10159466 Ga0207661_101594661 169
925 3300025944 Ga0207661_10840439 Ga0207661_108404391 169
926 3300025944 Ga0207661_11007782 Ga0207661_110077821 169
927 3300025945 Ga0207679_10000177 Ga0207679_1000017713 169
928 3300025945 Ga0207679_10038189 Ga0207679_100381892 169
929 3300025949 Ga0207667_10002400 Ga0207667_100024009 169
930 3300025949 Ga0207667_10016688 Ga0207667_100166887 169
931 3300025949 Ga0207667_10046866 Ga0207667_100468662 169
932 3300025949 Ga0207667_10064709 Ga0207667_100647093 169
933 3300025949 Ga0207667_10121862 Ga0207667_101218622 169
934 3300025949 Ga0207667_10317984 Ga0207667_103179842 169
935 3300025949 Ga0207667_10331765 Ga0207667_103317652 169
936 3300025949 Ga0207667_10493290 Ga0207667_104932902 169
937 3300025949 Ga0207667_10544159 Ga0207667_105441591 169
938 3300025960 Ga0207651_10004381 Ga0207651_100043813 169
939 3300025960 Ga0207651_10037247 Ga0207651_100372472 169
940 3300025960 Ga0207651_10569137 Ga0207651_105691372 169
941 3300025960 Ga0207651_10569485 Ga0207651_105694852 169
942 3300025961 Ga0207712_11015935 Ga0207712_110159351 169
943 3300025972 Ga0207668_10019365 Ga0207668_100193653 169
944 3300025981 Ga0207640_10000843 Ga0207640_100008439 169
945 3300025981 Ga0207640_10002817 Ga0207640_100028175 169
946 3300025981 Ga0207640_10048913 Ga0207640_100489131 169
947 3300025981 Ga0207640_10068120 Ga0207640_100681203 169
948 3300025981 Ga0207640_10079331 Ga0207640_100793313 169
949 3300025981 Ga0207640_10625896 Ga0207640_106258962 169
950 3300025986 Ga0207658_10127573 Ga0207658_101275732 169
951 3300025986 Ga0207658_10367425 Ga0207658_103674252 169
952 3300025986 Ga0207658_10477139 Ga0207658_104771392 169
953 3300026023 Ga0207677_10001146 Ga0207677_100011469 169
954 3300026023 Ga0207677_10004684 Ga0207677_100046844 169
955 3300026023 Ga0207677_10039291 Ga0207677_100392913 169
956 3300026023 Ga0207677_10111614 Ga0207677_101116142 169
957 3300026023 Ga0207677_10136790 Ga0207677_101367902 169
958 3300026023 Ga0207677_10860316 Ga0207677_108603161 169
959 3300026023 Ga0207677_10970364 Ga0207677_109703641 169
960 3300026035 Ga0207703_10007481 Ga0207703_100074815 169
961 3300026035 Ga0207703_10014707 Ga0207703_100147073 169
962 3300026035 Ga0207703_10029526 Ga0207703_100295262 169
963 3300026035 Ga0207703_10071736 Ga0207703_100717363 169
964 3300026035 Ga0207703_10253027 Ga0207703_102530272 169
965 3300026035 Ga0207703_10690093 Ga0207703_106900931 169
966 3300026035 Ga0207703_10852301 Ga0207703_108523012 169
967 3300026035 Ga0207703_11341010 Ga0207703_113410101 169
968 3300026041 Ga0207639_10298587 Ga0207639_102985872 169
969 3300026041 Ga0207639_10464596 Ga0207639_104645962 169
970 3300026041 Ga0207639_10566526 Ga0207639_105665262 169
971 3300026067 Ga0207678_10001196 Ga0207678_1000119614 169
972 3300026067 Ga0207678_10001295 Ga0207678_100012957 169
973 3300026075 Ga0207708_10323073 Ga0207708_103230732 169
974 3300026078 Ga0207702_10001116 Ga0207702_1000111614 169
975 3300026078 Ga0207702_10006348 Ga0207702_100063486 169
976 3300026078 Ga0207702_10027482 Ga0207702_100274824 169
977 3300026078 Ga0207702_10030402 Ga0207702_100304021 169
978 3300026078 Ga0207702_10118325 Ga0207702_101183252 169
979 3300026078 Ga0207702_10173068 Ga0207702_101730682 169
980 3300026078 Ga0207702_10256585 Ga0207702_102565852 169
981 3300026078 Ga0207702_10579191 Ga0207702_105791912 169
982 3300026078 Ga0207702_10600752 Ga0207702_106007521 169
983 3300026078 Ga0207702_10606411 Ga0207702_106064112 169
984 3300026078 Ga0207702_10698639 Ga0207702_106986392 169
985 3300026088 Ga0207641_10000237 Ga0207641_100002373 169
986 3300026088 Ga0207641_10022076 Ga0207641_100220763 169
987 3300026088 Ga0207641_10052884 Ga0207641_100528842 169
988 3300026088 Ga0207641_10071506 Ga0207641_100715062 169
989 3300026088 Ga0207641_10132612 Ga0207641_101326123 169
990 3300026088 Ga0207641_10199655 Ga0207641_101996552 169
991 3300026088 Ga0207641_10224754 Ga0207641_102247542 169
992 3300026088 Ga0207641_10286867 Ga0207641_102868672 169
993 3300026088 Ga0207641_10404294 Ga0207641_104042942 169
994 3300026089 Ga0207648_10010733 Ga0207648_100107336 169
995 3300026089 Ga0207648_10014004 Ga0207648_100140042 169
996 3300026089 Ga0207648_10731050 Ga0207648_107310502 169
997 3300026089 Ga0207648_11660121 Ga0207648_116601211 169
998 3300026095 Ga0207676_10000050 Ga0207676_1000005046 169
999 3300026095 Ga0207676_10012503 Ga0207676_100125034 169
1000 3300026095 Ga0207676_10081753 Ga0207676_100817532 169
1001 3300026116 Ga0207674_10000130 Ga0207674_1000013017 169
1002 3300026116 Ga0207674_10000269 Ga0207674_1000026917 169
1003 3300026116 Ga0207674_10048042 Ga0207674_100480425 169
1004 3300026116 Ga0207674_10238253 Ga0207674_102382532 169
1005 3300026116 Ga0207674_10358129 Ga0207674_103581292 169
1006 3300026116 Ga0207674_10538057 Ga0207674_105380572 169
1007 3300026116 Ga0207674_10898673 Ga0207674_108986732 169
1008 3300026118 Ga0207675_100191788 Ga0207675_1001917882 169
1009 3300026118 Ga0207675_100715655 Ga0207675_1007156552 169
1010 3300026121 Ga0207683_10000139 Ga0207683_1000013943 169
1011 3300026121 Ga0207683_10082676 Ga0207683_100826763 169
1012 3300026121 Ga0207683_10112642 Ga0207683_101126422 169
1013 3300026121 Ga0207683_10187805 Ga0207683_101878052 169
1014 3300026121 Ga0207683_10294985 Ga0207683_102949852 169
1015 3300026142 Ga0207698_10055373 Ga0207698_100553733 169
1016 3300026142 Ga0207698_10060280 Ga0207698_100602802 169
1017 3300026142 Ga0207698_10080622 Ga0207698_100806221 169
1018 3300026142 Ga0207698_10696240 Ga0207698_106962402 169
1019 3300026142 Ga0207698_10717698 Ga0207698_107176982 169
1020 3300028016 Ga0265354_1007310 Ga0265354_10073102 169
1021 3300028017 Ga0265356_1000067 Ga0265356_10000675 169
1022 3300028017 Ga0265356_1007396 Ga0265356_10073962 169
1023 3300028036 Ga0265355_1002063 Ga0265355_10020632 169
1024 3300028036 Ga0265355_1008363 Ga0265355_10083632 169
1025 3300028379 Ga0268266_10004469 Ga0268266_1000446913 169
1026 3300028379 Ga0268266_10079038 Ga0268266_100790383 169
1027 3300028379 Ga0268266_10614477 Ga0268266_106144772 169
1028 3300028380 Ga0268265_10022237 Ga0268265_100222375 169
1029 3300028380 Ga0268265_10593707 Ga0268265_105937071 169
1030 3300028381 Ga0268264_10004223 Ga0268264_1000422311 169
1031 3300028381 Ga0268264_10171272 Ga0268264_101712722 169
1032 3300028381 Ga0268264_10238198 Ga0268264_102381982 169
1033 3300028381 Ga0268264_10453458 Ga0268264_104534582 169
1034 3300028558 Ga0265326_10102496 Ga0265326_101024962 169
1035 3300028563 Ga0265319_1042553 Ga0265319_10425532 169
1036 3300028577 Ga0265318_10030718 Ga0265318_100307182 169
1037 3300028800 Ga0265338_10003647 Ga0265338_100036472 169
1038 3300028800 Ga0265338_10062736 Ga0265338_100627363 169
1039 3300028800 Ga0265338_10068968 Ga0265338_100689683 169
1040 3300028800 Ga0265338_10094425 Ga0265338_100944251 169
1041 3300028800 Ga0265338_10160055 Ga0265338_101600552 169
1042 3300028800 Ga0265338_10191003 Ga0265338_101910032 169
1043 3300029957 Ga0265324_10008993 Ga0265324_100089932 169
1044 3300030760 Ga0265762_1004268 Ga0265762_10042684 169
1045 3300030878 Ga0265770_1010176 Ga0265770_10101762 169
1046 3300030879 Ga0265765_1000153 Ga0265765_10001534 169
1047 3300031090 Ga0265760_10002485 Ga0265760_100024854 169
1048 3300031090 Ga0265760_10005151 Ga0265760_100051515 169
1049 3300031090 Ga0265760_10014930 Ga0265760_100149302 169
1050 3300031090 Ga0265760_10048912 Ga0265760_100489122 169
1051 3300031235 Ga0265330_10033168 Ga0265330_100331682 169
1052 3300031235 Ga0265330_10163731 Ga0265330_101637312 169
1053 3300031238 Ga0265332_10028089 Ga0265332_100280893 169
1054 3300031238 Ga0265332_10072165 Ga0265332_100721652 169
1055 3300031238 Ga0265332_10072223 Ga0265332_100722231 169
1056 3300031239 Ga0265328_10005736 Ga0265328_100057365 169
1057 3300031239 Ga0265328_10047778 Ga0265328_100477781 169
1058 3300031240 Ga0265320_10009889 Ga0265320_100098894 169
1059 3300031241 Ga0265325_10000515 Ga0265325_1000051518 169
1060 3300031241 Ga0265325_10056890 Ga0265325_100568902 169
1061 3300031241 Ga0265325_10095371 Ga0265325_100953712 169
1062 3300031241 Ga0265325_10131863 Ga0265325_101318632 169
1063 3300031241 Ga0265325_10184316 Ga0265325_101843162 169
1064 3300031242 Ga0265329_10048292 Ga0265329_100482921 169
1065 3300031247 Ga0265340_10001090 Ga0265340_100010908 169
1066 3300031247 Ga0265340_10024598 Ga0265340_100245983 169
1067 3300031247 Ga0265340_10069313 Ga0265340_100693132 169
1068 3300031249 Ga0265339_10026663 Ga0265339_100266634 169
1069 3300031249 Ga0265339_10027470 Ga0265339_100274703 169
1070 3300031249 Ga0265339_10034507 Ga0265339_100345072 169
1071 3300031249 Ga0265339_10072131 Ga0265339_100721312 169
1072 3300031249 Ga0265339_10234287 Ga0265339_102342872 169
1073 3300031250 Ga0265331_10003381 Ga0265331_100033814 169
1074 3300031250 Ga0265331_10006153 Ga0265331_100061534 169
1075 3300031250 Ga0265331_10048760 Ga0265331_100487601 169
1076 3300031250 Ga0265331_10105229 Ga0265331_101052292 169
1077 3300031344 Ga0265316_10001130 Ga0265316_1000113018 169
1078 3300031344 Ga0265316_10003692 Ga0265316_100036929 169
1079 3300031344 Ga0265316_10006205 Ga0265316_100062053 169
1080 3300031344 Ga0265316_10009598 Ga0265316_100095984 169
1081 3300031344 Ga0265316_10030197 Ga0265316_100301973 169
1082 3300031344 Ga0265316_10041585 Ga0265316_100415853 169
1083 3300031344 Ga0265316_10144087 Ga0265316_101440872 169
1084 3300031344 Ga0265316_10203343 Ga0265316_102033432 169
1085 3300031344 Ga0265316_10523500 Ga0265316_105235001 169
1086 3300031595 Ga0265313_10002383 Ga0265313_100023834 169
1087 3300031711 Ga0265314_10001611 Ga0265314_1000161114 169
1088 3300031711 Ga0265314_10008835 Ga0265314_100088352 169
1089 3300031711 Ga0265314_10103896 Ga0265314_101038961 169
1090 3300031712 Ga0265342_10056404 Ga0265342_100564043 169
1091 3300031731 Ga0307405_10251639 Ga0307405_102516392 169
1092 3300031731 Ga0307405_10365018 Ga0307405_103650182 169
1093 3300031852 Ga0307410_10001021 Ga0307410_100010218 169
1094 3300031901 Ga0307406_10037832 Ga0307406_100378323 169
1095 3300031901 Ga0307406_10445054 Ga0307406_104450541 169
1096 3300031903 Ga0307407_10307731 Ga0307407_103077312 169
1097 3300032002 Ga0307416_100093784 Ga0307416_1000937842 169
1098 3300032002 Ga0307416_100224104 Ga0307416_1002241042 169
1099 3300032004 Ga0307414_10074236 Ga0307414_100742361 169
1100 3300032126 Ga0307415_101099249 Ga0307415_1010992491 169
1101 3300034816 Ga0373930_0002114 Ga0373930_0002114_1508_2017 169
1102 3300035083 Ga0373926_0007641 Ga0373926_0007641_601_1113 169
1103 3300035083 Ga0373926_0020857 Ga0373926_0020857_1727_2236 169
1104 3300035083 Ga0373926_0028374 Ga0373926_0028374_1401_1910 169
1105 3300035083 Ga0373926_0187838 Ga0373926_0187838_111_626 169
1106 3300035084 Ga0373928_0028357 Ga0373928_0028357_613_1122 169
1107 3300035086 Ga0373934_0232490 Ga0373934_0232490_127_642 169
1108 3300035088 Ga0373940_0056696 Ga0373940_0056696_202_744 169
1109 3300035089 Ga0373944_0011305 Ga0373944_0011305_1473_1982 169
1110 3300035111 Ga0373923_0085489 Ga0373923_0085489_826_1335 169
1111 3300035111 Ga0373923_0194956 Ga0373923_0194956_21_530 169
1112 3300035112 Ga0373932_0091587 Ga0373932_0091587_79_588 169
1113 3300035113 Ga0373936_0000172 Ga0373936_0000172_5647_6156 169
1114 3300035113 Ga0373936_0012995 Ga0373936_0012995_478_990 169
1115 3300035113 Ga0373936_0102549 Ga0373936_0102549_64_576 169
1116 3300035113 Ga0373936_0410490 Ga0373936_0410490_94_609 169
1117 3300035114 Ga0373939_0123489 Ga0373939_0123489_49_558 169
1118 3300035115 Ga0373941_0074815 Ga0373941_0074815_346_855 169
1119 3300035116 Ga0373945_0001375 Ga0373945_0001375_1845_2354 169
1120 3300035116 Ga0373945_0002395 Ga0373945_0002395_4006_4518 169
1121 3300035116 Ga0373945_0128264 Ga0373945_0128264_160_669 169
1122 3300035116 Ga0373945_0134718 Ga0373945_0134718_360_869 169
1123 3300035117 Ga0373953_0003772 Ga0373953_0003772_3713_4222 169
1124 3300035117 Ga0373953_0192043 Ga0373953_0192043_42_551 169
1125 3300035118 Ga0373954_0007793 Ga0373954_0007793_2762_3271 169
1126 3300035118 Ga0373954_0169065 Ga0373954_0169065_466_978 169
1127 3300035119 Ga0373956_0036548 Ga0373956_0036548_882_1394 169
1128 3300035119 Ga0373956_0039447 Ga0373956_0039447_510_1025 169
1129 3300035119 Ga0373956_0054467 Ga0373956_0054467_417_926 169
1130 3300035120 Ga0373957_0017752 Ga0373957_0017752_1847_2356 169
1131 3300035170 Ga0373943_0000055 Ga0373943_0000055_21979_22488 169
1132 3300035170 Ga0373943_0003910 Ga0373943_0003910_5371_5883 169
1133 3300035170 Ga0373943_0020297 Ga0373943_0020297_1335_1844 169
1134 3300035170 Ga0373943_0226425 Ga0373943_0226425_377_892 169
1135 3300035170 Ga0373943_0344765 Ga0373943_0344765_212_721 169
1136 3300035171 Ga0373946_0029038 Ga0373946_0029038_1425_1937 169
1137 3300035171 Ga0373946_0194772 Ga0373946_0194772_160_669 169
1138 3300035172 Ga0373955_0008998 Ga0373955_0008998_2803_3315 169
1139 3300035172 Ga0373955_0420749 Ga0373955_0420749_101_610 169
1140 3300035172 Ga0373955_0429442 Ga0373955_0429442_140_649 169
1141 3300035241 Ga0373961_0008159 Ga0373961_0008159_266_775 169
1142 3300035241 Ga0373961_0025165 Ga0373961_0025165_76_618 169
1143 3300035410 Ga0373924_0000091 Ga0373924_0000091_5962_6474 169
1144 3300035410 Ga0373924_0014882 Ga0373924_0014882_79_588 169
1145 3300035410 Ga0373924_0026543 Ga0373924_0026543_554_1066 169
1146 3300035410 Ga0373924_0090317 Ga0373924_0090317_690_1205 169
1147 3300035691 Ga0373931_0053587 Ga0373931_0053587_1251_1760 169
1148 3300035691 Ga0373931_0059959 Ga0373931_0059959_921_1430 169
1149 3300035691 Ga0373931_0081062 Ga0373931_0081062_60_575 169
1150 3300035691 Ga0373931_0084890 Ga0373931_0084890_927_1469 169
1151 3300035691 Ga0373931_0504067 Ga0373931_0504067_148_657 169
1152 3300035691 Ga0373931_0602238 Ga0373931_0602238_37_546 169
1153 3300035692 Ga0373935_0002091 Ga0373935_0002091_6094_6603 169
1154 3300035692 Ga0373935_0010861 Ga0373935_0010861_3540_4049 169
1155 3300035692 Ga0373935_0020803 Ga0373935_0020803_763_1275 169
1156 3300035692 Ga0373935_0052573 Ga0373935_0052573_671_1183 169
1157 3300035692 Ga0373935_0108297 Ga0373935_0108297_681_1190 169
1158 3300035692 Ga0373935_0126285 Ga0373935_0126285_872_1384 169
1159 3300035692 Ga0373935_0199832 Ga0373935_0199832_394_909 169
1160 3300035692 Ga0373935_0218085 Ga0373935_0218085_17_532 169
1161 3300035692 Ga0373935_0309731 Ga0373935_0309731_394_903 169
1162 3300035692 Ga0373935_0423798 Ga0373935_0423798_307_816 169
1163 3300035692 Ga0373935_1157644 Ga0373935_1157644_38_547 169
1164 3300035695 Ga0373927_0000378 Ga0373927_0000378_22683_23198 169
1165 3300035695 Ga0373927_0005079 Ga0373927_0005079_5647_6156 169
1166 3300035695 Ga0373927_0013728 Ga0373927_0013728_3579_4091 169
1167 3300035695 Ga0373927_0096748 Ga0373927_0096748_1281_1790 169
1168 3300035695 Ga0373927_0153053 Ga0373927_0153053_457_972 169
1169 3300035695 Ga0373927_0198094 Ga0373927_0198094_796_1308 169
1170 3300035695 Ga0373927_0416032 Ga0373927_0416032_44_553 169
1171 3300035695 Ga0373927_0499868 Ga0373927_0499868_160_669 169
1172 3300035695 Ga0373927_0621639 Ga0373927_0621639_56_565 169
1173 3300035724 Ga0373933_0016430 Ga0373933_0016430_2688_3200 169
1174 3300035724 Ga0373933_0192365 Ga0373933_0192365_39_548 169
1175 3300035724 Ga0373933_0331569 Ga0373933_0331569_226_738 169
1176 3300035724 Ga0373933_0359390 Ga0373933_0359390_150_659 169
1177 3300035724 Ga0373933_0506434 Ga0373933_0506434_119_631 169
1178 3300035724 Ga0373933_0680214 Ga0373933_0680214_37_549 169
1179 3300035725 Ga0373947_0000167 Ga0373947_0000167_8281_8790 169
1180 3300035725 Ga0373947_0001658 Ga0373947_0001658_3579_4091 169
1181 3300035725 Ga0373947_0008836 Ga0373947_0008836_2825_3334 169
1182 3300035725 Ga0373947_0050887 Ga0373947_0050887_1112_1621 169
1183 3300035725 Ga0373947_0057197 Ga0373947_0057197_1449_1958 169
1184 3300035725 Ga0373947_0061444 Ga0373947_0061444_1391_1903 169
1185 3300035725 Ga0373947_0100146 Ga0373947_0100146_673_1182 169
1186 3300035725 Ga0373947_0471052 Ga0373947_0471052_15_530 169
1187 3300035725 Ga0373947_0668456 Ga0373947_0668456_50_562 169
1188 3300035725 Ga0373947_0989113 Ga0373947_0989113_22_531 169
1189 3300036401 Ga0373937_0000027 Ga0373937_0000027_60032_60544 169
1190 3300036401 Ga0373937_0014721 Ga0373937_0014721_910_1419 169
1191 3300036401 Ga0373937_0018754 Ga0373937_0018754_775_1290 169
1192 3300036401 Ga0373937_0020676 Ga0373937_0020676_5245_5757 169
1193 3300036401 Ga0373937_0041141 Ga0373937_0041141_2181_2693 169
1194 3300036401 Ga0373937_0047249 Ga0373937_0047249_512_1024 169
1195 3300036401 Ga0373937_0076681 Ga0373937_0076681_2338_2853 169
1196 3300036401 Ga0373937_0094328 Ga0373937_0094328_2038_2547 169
1197 3300036401 Ga0373937_0105712 Ga0373937_0105712_1517_2029 169
1198 3300036401 Ga0373937_0238504 Ga0373937_0238504_1023_1538 169
1199 3300036401 Ga0373937_0310966 Ga0373937_0310966_669_1181 169
1200 3300036401 Ga0373937_0360043 Ga0373937_0360043_546_1055 169
1201 3300036401 Ga0373937_0374832 Ga0373937_0374832_214_726 169
1202 3300036401 Ga0373937_0832647 Ga0373937_0832647_178_693 169
1203 3300036401 Ga0373937_1312534 Ga0373937_1312534_145_654 169
1204 3300037068 Ga0373925_0000224 Ga0373925_0000224_7213_7722 169
1205 3300037068 Ga0373925_0015611 Ga0373925_0015611_3365_3877 169
1206 3300037068 Ga0373925_0030136 Ga0373925_0030136_2995_3504 169
1207 3300037068 Ga0373925_0038481 Ga0373925_0038481_941_1456 169
1208 3300037068 Ga0373925_0073647 Ga0373925_0073647_154_663 169
1209 3300037068 Ga0373925_0085587 Ga0373925_0085587_1425_1934 169
1210 3300037068 Ga0373925_0111187 Ga0373925_0111187_529_1041 169
1211 3300037068 Ga0373925_0122640 Ga0373925_0122640_23_538 169
1212 3300037068 Ga0373925_0124740 Ga0373925_0124740_470_979 169
1213 3300037068 Ga0373925_0176346 Ga0373925_0176346_403_918 169
1214 3300037068 Ga0373925_0180170 Ga0373925_0180170_636_1151 169
1215 3300037068 Ga0373925_0280191 Ga0373925_0280191_275_784 169
1216 3300037068 Ga0373925_1142123 Ga0373925_1142123_53_568 169
1217 3300037853 Ga0436364_0135933 Ga0436364_0135933_48_563 169
1218 3300037853 Ga0436364_1194151 Ga0436364_1194151_1812_2327 169
1219 3300038443 Ga0395901_0380383 Ga0395901_0380383_718_1227 169
1220 3300039437 Ga0436365_1136717 Ga0436365_1136717_214_729 169
1221 3300039437 Ga0436365_1311817 Ga0436365_1311817_163_681 169
1222 3300039437 Ga0436365_1314150 Ga0436365_1314150_20_529 169
1223 3300039437 Ga0436365_1559181 Ga0436365_1559181_488_997 169
1224 3300039437 Ga0436365_1751127 Ga0436365_1751127_4204_4719 169
1225 3300039438 Ga0436360_0673759 Ga0436360_0673759_39_548 169
1226 3300039447 Ga0436361_0293375 Ga0436361_0293375_89_598 169
1227 3300039450 Ga0436363_0356673 Ga0436363_0356673_1291_1800 169
1228 3300039450 Ga0436363_0862048 Ga0436363_0862048_539_1048 169
1229 3300039450 Ga0436363_1295381 Ga0436363_1295381_2738_3247 169
1230 3300039453 Ga0436362_1047223 Ga0436362_1047223_38_547 169
1231 3300041512 Ga0451853_1241128 Ga0451853_1241128_83_595 169
1232 3300042876 Ga0451577_1169536 Ga0451577_1169536_97_606 169
1233 3300044656 Ga0466969_0257031 Ga0466969_0257031_140_649 169
1234 3300044684 Ga0466966_0147888 Ga0466966_0147888_679_1188 169
1235 3300044684 Ga0466966_0228892 Ga0466966_0228892_532_1041 169
1236 3300044693 Ga0466961_0263248 Ga0466961_0263248_24_533 169
1237 3300044694 Ga0466963_0003772 Ga0466963_0003772_7047_7556 169
1238 3300044694 Ga0466963_0039609 Ga0466963_0039609_1950_2459 169
1239 3300044694 Ga0466963_0147368 Ga0466963_0147368_1010_1519 169
1240 3300044706 Ga0466964_0060019 Ga0466964_0060019_684_1193 169
1241 3300044706 Ga0466964_0130794 Ga0466964_0130794_560_1069 169
1242 3300044719 Ga0466971_0314619 Ga0466971_0314619_33_542 169
1243 3300044842 Ga0466957_0076950 Ga0466957_0076950_988_1497 169
1244 3300044842 Ga0466957_0314525 Ga0466957_0314525_15_524 169
1245 3300045049 Ga0466959_0183933 Ga0466959_0183933_76_585 169
1246 3300045051 Ga0451576_0097819 Ga0451576_0097819_1217_1729 169
1247 3300045051 Ga0451576_0220984 Ga0451576_0220984_266_775 169
1248 3300045051 Ga0451576_0288790 Ga0451576_0288790_667_1182 169
1249 3300045051 Ga0451576_1428665 Ga0451576_1428665_188_697 169
1250 3300045976 Ga0466967_0017316 Ga0466967_0017316_3003_3512 169
1251 3300045976 Ga0466967_0046110 Ga0466967_0046110_972_1481 169
1252 3300045976 Ga0466967_0055367 Ga0466967_0055367_66_575 169
1253 3300045976 Ga0466967_0093669 Ga0466967_0093669_1743_2258 169
1254 3300045976 Ga0466967_0105221 Ga0466967_0105221_52_561 169
1255 3300045976 Ga0466967_0338174 Ga0466967_0338174_526_1035 169
1256 3300045976 Ga0466967_0678854 Ga0466967_0678854_168_677 169
1257 3300046459 Ga0495629_0256515 Ga0495629_0256515_44_553 169
1258 3300046459 Ga0495629_0698185 Ga0495629_0698185_72_581 169
1259 3300046462 Ga0495651_0008434 Ga0495651_0008434_3145_3660 169
1260 3300046462 Ga0495651_0050799 Ga0495651_0050799_1302_1814 169
1261 3300046462 Ga0495651_0119950 Ga0495651_0119950_417_926 169
1262 3300046462 Ga0495651_0140835 Ga0495651_0140835_766_1281 169
1263 3300046462 Ga0495651_0265564 Ga0495651_0265564_417_932 169
1264 3300046462 Ga0495651_0449636 Ga0495651_0449636_296_805 169
1265 3300046463 Ga0495653_0045879 Ga0495653_0045879_948_1457 169
1266 3300046463 Ga0495653_0107349 Ga0495653_0107349_773_1288 169
1267 3300046463 Ga0495653_0427750 Ga0495653_0427750_223_738 169
1268 3300046472 Ga0495580_0001464 Ga0495580_0001464_16357_16866 169
1269 3300046472 Ga0495580_0003534 Ga0495580_0003534_9248_9763 169
1270 3300046472 Ga0495580_0006199 Ga0495580_0006199_2326_2835 169
1271 3300046472 Ga0495580_0006438 Ga0495580_0006438_1483_1992 169
1272 3300046472 Ga0495580_0017479 Ga0495580_0017479_3578_4090 169
1273 3300046472 Ga0495580_0017970 Ga0495580_0017970_4622_5131 169
1274 3300046472 Ga0495580_0018597 Ga0495580_0018597_2533_3048 169
1275 3300046472 Ga0495580_0022698 Ga0495580_0022698_1887_2396 169
1276 3300046472 Ga0495580_0026438 Ga0495580_0026438_3272_3781 169
1277 3300046472 Ga0495580_0046088 Ga0495580_0046088_43_558 169
1278 3300046472 Ga0495580_0056536 Ga0495580_0056536_2161_2670 169
1279 3300046472 Ga0495580_0063028 Ga0495580_0063028_165_680 169
1280 3300046472 Ga0495580_0063517 Ga0495580_0063517_1422_1931 169
1281 3300046472 Ga0495580_0089990 Ga0495580_0089990_1314_1826 169
1282 3300046472 Ga0495580_0111264 Ga0495580_0111264_937_1452 169
1283 3300046472 Ga0495580_0161973 Ga0495580_0161973_577_1092 169
1284 3300046472 Ga0495580_0224717 Ga0495580_0224717_177_692 169
1285 3300046472 Ga0495580_0262763 Ga0495580_0262763_292_801 169
1286 3300046472 Ga0495580_0286305 Ga0495580_0286305_298_807 169
1287 3300046472 Ga0495580_0416062 Ga0495580_0416062_350_859 169
1288 3300046473 Ga0495582_0012871 Ga0495582_0012871_1447_1956 169
1289 3300046473 Ga0495582_0074764 Ga0495582_0074764_118_633 169
1290 3300046473 Ga0495582_0101868 Ga0495582_0101868_600_1109 169
1291 3300046473 Ga0495582_0214216 Ga0495582_0214216_320_832 169
1292 3300046473 Ga0495582_0521101 Ga0495582_0521101_84_593 169
1293 3300046474 Ga0495605_0166527 Ga0495605_0166527_421_933 169
1294 3300046475 Ga0495639_0074315 Ga0495639_0074315_33_545 169
1295 3300046476 Ga0495662_0030179 Ga0495662_0030179_277_792 169
1296 3300046476 Ga0495662_0245639 Ga0495662_0245639_300_815 169
1297 3300046477 Ga0495664_0003847 Ga0495664_0003847_2843_3352 169
1298 3300046477 Ga0495664_0094774 Ga0495664_0094774_1231_1743 169
1299 3300046477 Ga0495664_0164274 Ga0495664_0164274_535_1050 169
1300 3300046477 Ga0495664_0212461 Ga0495664_0212461_311_823 169
1301 3300046477 Ga0495664_0333026 Ga0495664_0333026_318_833 169
1302 3300046492 Ga0495585_0441807 Ga0495585_0441807_73_582 169
1303 3300046499 Ga0495594_0152024 Ga0495594_0152024_744_1256 169
1304 3300046511 Ga0495608_0082532 Ga0495608_0082532_763_1278 169
1305 3300046511 Ga0495608_0159226 Ga0495608_0159226_814_1329 169
1306 3300046514 Ga0495618_0221675 Ga0495618_0221675_596_1111 169
1307 3300046514 Ga0495618_0253768 Ga0495618_0253768_283_798 169
1308 3300046516 Ga0495628_0023575 Ga0495628_0023575_665_1180 169
1309 3300046516 Ga0495628_0244132 Ga0495628_0244132_506_1015 169
1310 3300046516 Ga0495628_0428850 Ga0495628_0428850_64_579 169
1311 3300046516 Ga0495628_0489103 Ga0495628_0489103_82_597 169
1312 3300046516 Ga0495628_0748032 Ga0495628_0748032_58_573 169
1313 3300046517 Ga0495630_0013505 Ga0495630_0013505_4658_5170 169
1314 3300046517 Ga0495630_0051815 Ga0495630_0051815_2170_2679 169
1315 3300046517 Ga0495630_0058816 Ga0495630_0058816_1079_1588 169
1316 3300046517 Ga0495630_0109713 Ga0495630_0109713_99_614 169
1317 3300046517 Ga0495630_0299420 Ga0495630_0299420_221_736 169
1318 3300046526 Ga0495666_0208869 Ga0495666_0208869_170_679 169
1319 3300046526 Ga0495666_0227609 Ga0495666_0227609_204_719 169
1320 3300046528 Ga0495642_0237719 Ga0495642_0237719_52_567 169
1321 3300046528 Ga0495642_0340052 Ga0495642_0340052_21_533 169
1322 3300046529 Ga0495652_0168939 Ga0495652_0168939_117_632 169
1323 3300046529 Ga0495652_0349477 Ga0495652_0349477_211_726 169
1324 3300046529 Ga0495652_0395440 Ga0495652_0395440_378_890 169
1325 3300046531 Ga0495665_0021545 Ga0495665_0021545_2426_2938 169
1326 3300046531 Ga0495665_0025270 Ga0495665_0025270_2045_2560 169
1327 3300046531 Ga0495665_0034989 Ga0495665_0034989_1030_1545 169
1328 3300046531 Ga0495665_0088377 Ga0495665_0088377_61_573 169
1329 3300046531 Ga0495665_0203784 Ga0495665_0203784_227_736 169
1330 3300046531 Ga0495665_0236414 Ga0495665_0236414_290_802 169
1331 3300046531 Ga0495665_0428360 Ga0495665_0428360_20_532 169
1332 3300046533 Ga0495640_0058921 Ga0495640_0058921_1514_2029 169
1333 3300046533 Ga0495640_0085863 Ga0495640_0085863_1540_2055 169
1334 3300046533 Ga0495640_0433249 Ga0495640_0433249_62_574 169
1335 3300046533 Ga0495640_0583376 Ga0495640_0583376_149_664 169
1336 3300046535 Ga0495586_0133604 Ga0495586_0133604_351_863 169
1337 3300046536 Ga0495587_0066973 Ga0495587_0066973_1294_1809 169
1338 3300046536 Ga0495587_0072064 Ga0495587_0072064_1146_1661 169
1339 3300046536 Ga0495587_0292904 Ga0495587_0292904_64_576 169
1340 3300046536 Ga0495587_0373681 Ga0495587_0373681_164_676 169
1341 3300046543 Ga0495645_0022167 Ga0495645_0022167_2089_2604 169
1342 3300046543 Ga0495645_0035649 Ga0495645_0035649_1612_2127 169
1343 3300046543 Ga0495645_0071844 Ga0495645_0071844_1151_1663 169
1344 3300046543 Ga0495645_0096994 Ga0495645_0096994_277_786 169
1345 3300046543 Ga0495645_0170135 Ga0495645_0170135_923_1438 169
1346 3300046543 Ga0495645_0171349 Ga0495645_0171349_802_1317 169
1347 3300046543 Ga0495645_0210936 Ga0495645_0210936_357_872 169
1348 3300046543 Ga0495645_0239024 Ga0495645_0239024_592_1101 169
1349 3300046559 Ga0495667_0024521 Ga0495667_0024521_1554_2069 169
1350 3300046559 Ga0495667_0052413 Ga0495667_0052413_48_563 169
1351 3300046559 Ga0495667_0069290 Ga0495667_0069290_967_1482 169
1352 3300046559 Ga0495667_0080351 Ga0495667_0080351_1229_1744 169
1353 3300046559 Ga0495667_0249252 Ga0495667_0249252_280_789 169
1354 3300046616 Ga0495668_0097647 Ga0495668_0097647_393_905 169
1355 3300046642 Ga0495634_0029185 Ga0495634_0029185_2467_2982 169
1356 3300046642 Ga0495634_0093797 Ga0495634_0093797_1172_1681 169
1357 3300046663 Ga0495635_0033329 Ga0495635_0033329_2659_3174 169
1358 3300046663 Ga0495635_0073100 Ga0495635_0073100_722_1231 169
1359 3300046663 Ga0495635_0128451 Ga0495635_0128451_727_1239 169
1360 3300046663 Ga0495635_0380479 Ga0495635_0380479_138_650 169
1361 3300046663 Ga0495635_0429997 Ga0495635_0429997_337_852 169
1362 3300046663 Ga0495635_0539678 Ga0495635_0539678_198_713 169
1363 3300046663 Ga0495635_0540406 Ga0495635_0540406_213_725 169
1364 3300046674 Ga0495588_0051739 Ga0495588_0051739_891_1403 169
1365 3300046675 Ga0495657_0338759 Ga0495657_0338759_286_795 169
1366 3300046675 Ga0495657_0361939 Ga0495657_0361939_331_843 169
1367 3300046675 Ga0495657_0417701 Ga0495657_0417701_202_711 169
1368 3300046675 Ga0495657_0733268 Ga0495657_0733268_12_524 169
1369 3300046678 Ga0495599_0223933 Ga0495599_0223933_336_851 169
1370 3300046678 Ga0495599_0358715 Ga0495599_0358715_107_622 169
1371 3300046678 Ga0495599_0367222 Ga0495599_0367222_316_831 169
1372 3300046679 Ga0495623_0030436 Ga0495623_0030436_1097_1612 169
1373 3300046679 Ga0495623_0049156 Ga0495623_0049156_1030_1545 169
1374 3300046679 Ga0495623_0053782 Ga0495623_0053782_1613_2128 169
1375 3300046679 Ga0495623_0053948 Ga0495623_0053948_1984_2496 169
1376 3300046679 Ga0495623_0092747 Ga0495623_0092747_439_954 169
1377 3300046679 Ga0495623_0157856 Ga0495623_0157856_668_1180 169
1378 3300046680 Ga0495646_0216913 Ga0495646_0216913_110_625 169
1379 3300046680 Ga0495646_0472851 Ga0495646_0472851_26_541 169
1380 3300046683 Ga0495658_0148169 Ga0495658_0148169_903_1415 169
1381 3300046683 Ga0495658_0293942 Ga0495658_0293942_289_798 169
1382 3300046684 Ga0495669_0093846 Ga0495669_0093846_139_648 169
1383 3300046684 Ga0495669_0096014 Ga0495669_0096014_702_1214 169
1384 3300046684 Ga0495669_0235678 Ga0495669_0235678_280_792 169
1385 3300046689 Ga0495613_0129225 Ga0495613_0129225_258_773 169
1386 3300046689 Ga0495613_0219233 Ga0495613_0219233_626_1135 169
1387 3300046689 Ga0495613_0252098 Ga0495613_0252098_135_650 169
1388 3300046690 Ga0495624_0079166 Ga0495624_0079166_917_1426 169
1389 3300046690 Ga0495624_0207276 Ga0495624_0207276_159_671 169
1390 3300046690 Ga0495624_0482240 Ga0495624_0482240_116_625 169
1391 3300046809 Ga0495600_0105863 Ga0495600_0105863_405_917 169
1392 3300046809 Ga0495600_0209420 Ga0495600_0209420_199_711 169
1393 3300047315 Ga0495581_0346156 Ga0495581_0346156_262_771 169
1394 3300047315 Ga0495581_0448424 Ga0495581_0448424_55_567 169
1395 3300047317 Ga0495604_0028727 Ga0495604_0028727_997_1509 169
1396 3300047317 Ga0495604_0223775 Ga0495604_0223775_464_976 169
1397 3300047317 Ga0495604_0315374 Ga0495604_0315374_266_781 169
1398 3300047317 Ga0495604_0328327 Ga0495604_0328327_493_1008 169
1399 3300047317 Ga0495604_0378280 Ga0495604_0378280_246_761 169
1400 3300047317 Ga0495604_0463835 Ga0495604_0463835_115_630 169
1401 3300047319 Ga0495674_0018563 Ga0495674_0018563_2830_3339 169
1402 3300047319 Ga0495674_0049400 Ga0495674_0049400_3170_3685 169
1403 3300047319 Ga0495674_0053968 Ga0495674_0053968_625_1140 169
1404 3300047319 Ga0495674_0076241 Ga0495674_0076241_1907_2422 169
1405 3300047319 Ga0495674_0214478 Ga0495674_0214478_321_830 169
1406 3300047319 Ga0495674_0299726 Ga0495674_0299726_33_548 169
1407 3300047319 Ga0495674_0334738 Ga0495674_0334738_286_801 169
1408 3300047319 Ga0495674_0578558 Ga0495674_0578558_258_773 169
1409 3300047321 Ga0495676_0152757 Ga0495676_0152757_305_814 169
1410 3300047444 Ga0495675_0015725 Ga0495675_0015725_4177_4692 169
1411 3300047444 Ga0495675_0034121 Ga0495675_0034121_1649_2161 169
1412 3300047444 Ga0495675_0116060 Ga0495675_0116060_268_783 169
1413 3300047444 Ga0495675_0128649 Ga0495675_0128649_955_1467 169
1414 3300047444 Ga0495675_0204648 Ga0495675_0204648_22_537 169
1415 3300047444 Ga0495675_0383412 Ga0495675_0383412_190_702 169
1416 3300047444 Ga0495675_0414371 Ga0495675_0414371_58_573 169
1417 3300047444 Ga0495675_0760431 Ga0495675_0760431_12_527 169
1418 3300047445 Ga0495677_0034216 Ga0495677_0034216_715_1227 169
1419 3300047471 Ga0495684_0016103 Ga0495684_0016103_3557_4072 169
1420 3300047471 Ga0495684_0054549 Ga0495684_0054549_372_884 169
1421 3300047471 Ga0495684_0083283 Ga0495684_0083283_1663_2178 169
1422 3300047471 Ga0495684_0112561 Ga0495684_0112561_36_551 169
1423 3300047471 Ga0495684_0220029 Ga0495684_0220029_113_628 169
1424 3300047471 Ga0495684_0460381 Ga0495684_0460381_307_816 169
1425 3300047673 Ga0495593_0018737 Ga0495593_0018737_2357_2869 169
1426 3300047673 Ga0495593_0050171 Ga0495593_0050171_1687_2196 169
1427 3300048088 Ga0495602_0087286 Ga0495602_0087286_560_1075 169
1428 3300048088 Ga0495602_0104306 Ga0495602_0104306_1274_1786 169
1429 3300048088 Ga0495602_0185006 Ga0495602_0185006_937_1449 169
1430 3300048088 Ga0495602_0233374 Ga0495602_0233374_482_997 169
1431 3300048088 Ga0495602_0310671 Ga0495602_0310671_103_612 169
1432 3300048088 Ga0495602_0496241 Ga0495602_0496241_115_624 169
1433 3300048088 Ga0495602_0630559 Ga0495602_0630559_42_551 169
1434 3300048089 Ga0495614_0111573 Ga0495614_0111573_663_1175 169
1435 3300048089 Ga0495614_0339422 Ga0495614_0339422_158_667 169
1436 3300048903 Ga0496100_0090533 Ga0496100_0090533_893_1402 169
1437 3300048903 Ga0496100_0121910 Ga0496100_0121910_1202_1711 169
1438 3300048903 Ga0496100_0172721 Ga0496100_0172721_172_684 169
1439 3300048903 Ga0496100_0208629 Ga0496100_0208629_694_1203 169
1440 3300048903 Ga0496100_0335090 Ga0496100_0335090_519_1028 169
1441 3300048903 Ga0496100_0495284 Ga0496100_0495284_167_676 169
1442 3300048904 Ga0496101_0032991 Ga0496101_0032991_1645_2154 169
1443 3300048904 Ga0496101_0120052 Ga0496101_0120052_371_880 169
1444 3300048904 Ga0496101_0275424 Ga0496101_0275424_568_1077 169
1445 3300048904 Ga0496101_0390554 Ga0496101_0390554_85_594 169
1446 3300048904 Ga0496101_0650150 Ga0496101_0650150_181_690 169
1447 3300048905 Ga0496102_0020175 Ga0496102_0020175_4853_5362 169
1448 3300048905 Ga0496102_0089212 Ga0496102_0089212_58_567 169
1449 3300048905 Ga0496102_0152540 Ga0496102_0152540_1508_2050 169
1450 3300048905 Ga0496102_0203032 Ga0496102_0203032_146_655 169
1451 3300048905 Ga0496102_0335279 Ga0496102_0335279_106_615 169
1452 3300048905 Ga0496102_0503319 Ga0496102_0503319_391_903 169
1453 3300048905 Ga0496102_0611992 Ga0496102_0611992_415_924 169
1454 3300048906 Ga0496103_0022488 Ga0496103_0022488_2260_2769 169
1455 3300048906 Ga0496103_0032022 Ga0496103_0032022_2498_3007 169
1456 3300048906 Ga0496103_0061583 Ga0496103_0061583_650_1159 169
1457 3300048906 Ga0496103_0616247 Ga0496103_0616247_155_664 169
1458 3300048907 Ga0496104_0003663 Ga0496104_0003663_10279_10788 169
1459 3300048907 Ga0496104_0017687 Ga0496104_0017687_5929_6441 169
1460 3300048907 Ga0496104_0093755 Ga0496104_0093755_334_843 169
1461 3300048907 Ga0496104_0209709 Ga0496104_0209709_1043_1552 169
1462 3300048907 Ga0496104_0325362 Ga0496104_0325362_536_1045 169
1463 3300048907 Ga0496104_0338449 Ga0496104_0338449_11_520 169
1464 3300048907 Ga0496104_0777467 Ga0496104_0777467_318_833 169
1465 3300048908 Ga0496105_0008105 Ga0496105_0008105_6713_7225 169
1466 3300048908 Ga0496105_0040114 Ga0496105_0040114_375_884 169
1467 3300048908 Ga0496105_0603685 Ga0496105_0603685_35_544 169
1468 3300048908 Ga0496105_0666460 Ga0496105_0666460_225_734 169
1469 3300048909 Ga0496106_0034342 Ga0496106_0034342_2083_2592 169
1470 3300048909 Ga0496106_0063470 Ga0496106_0063470_692_1201 169
1471 3300048909 Ga0496106_0641193 Ga0496106_0641193_307_816 169
1472 3300048910 Ga0496107_0223273 Ga0496107_0223273_577_1086 169
1473 3300048911 Ga0496108_0000106 Ga0496108_0000106_65988_66497 169
1474 3300048912 Ga0496109_0000133 Ga0496109_0000133_67857_68366 169
1475 3300048912 Ga0496109_0167149 Ga0496109_0167149_373_882 169
1476 3300048912 Ga0496109_0332953 Ga0496109_0332953_117_626 169
1477 3300048912 Ga0496109_0370111 Ga0496109_0370111_52_564 169
1478 3300048912 Ga0496109_1041215 Ga0496109_1041215_186_698 169
1479 3300048913 Ga0496110_0002218 Ga0496110_0002218_11558_12067 169
1480 3300048913 Ga0496110_0186389 Ga0496110_0186389_185_697 169
1481 3300048913 Ga0496110_0890889 Ga0496110_0890889_204_716 169
1482 3300048914 Ga0496111_0004591 Ga0496111_0004591_5264_5776 169
1483 3300048915 Ga0496112_0000028 Ga0496112_0000028_59643_60152 169
1484 3300048915 Ga0496112_0014386 Ga0496112_0014386_4922_5434 169
1485 3300048915 Ga0496112_0030600 Ga0496112_0030600_1142_1651 169
1486 3300048915 Ga0496112_0043741 Ga0496112_0043741_558_1067 169
1487 3300048915 Ga0496112_0055340 Ga0496112_0055340_1914_2423 169
1488 3300048915 Ga0496112_0099017 Ga0496112_0099017_1888_2397 169
1489 3300048915 Ga0496112_0162289 Ga0496112_0162289_1183_1695 169
1490 3300048915 Ga0496112_0217038 Ga0496112_0217038_19_528 169
1491 3300048915 Ga0496112_0331081 Ga0496112_0331081_449_961 169
1492 3300048915 Ga0496112_0368375 Ga0496112_0368375_427_939 169
1493 3300048915 Ga0496112_1137669 Ga0496112_1137669_98_610 169
1494 3300048915 Ga0496112_1320429 Ga0496112_1320429_48_557 169
1495 3300048916 Ga0496113_0000179 Ga0496113_0000179_11929_12438 169
1496 3300048916 Ga0496113_0013416 Ga0496113_0013416_1501_2013 169
1497 3300048916 Ga0496113_0091882 Ga0496113_0091882_744_1253 169
1498 3300048916 Ga0496113_0326988 Ga0496113_0326988_12_521 169
1499 3300048917 Ga0496114_0062374 Ga0496114_0062374_2345_2854 169
1500 3300048918 Ga0496115_0030865 Ga0496115_0030865_95_604 169
1501 3300048918 Ga0496115_1078642 Ga0496115_1078642_47_559 169
1502 3300049515 Ga0501292_039726 Ga0501292_039726_168_680 169
1503 3300049522 Ga0501299_013919 Ga0501299_013919_138_650 169
1504 3300049589 Ga0501073_0087107 Ga0501073_0087107_880_1389 169
1505 3300049660 Ga0501216_060176 Ga0501216_060176_119_631 169
1506 3300049661 Ga0501217_115749 Ga0501217_115749_66_578 169
1507 3300049690 Ga0501261_021495 Ga0501261_021495_338_850 169
1508 3300049704 Ga0501221_038951 Ga0501221_038951_178_690 169
1509 3300049705 Ga0501225_0030165 Ga0501225_0030165_617_1129 169
1510 3300049744 Ga0501083_0114773 Ga0501083_0114773_103_612 169
1511 3300049765 Ga0501268_083469 Ga0501268_083469_67_579 169
1512 3300050507 nmdc:mga05p37_668048_c1 nmdc:mga05p37_668048_c1_141_656 169
1513 3300050507 nmdc:mga05p37_887748_c1 nmdc:mga05p37_887748_c1_297_806 169
1514 3300050511 nmdc:mga08y16_962509_c1 nmdc:mga08y16_962509_c1_89_604 169
1515 3300050512 nmdc:mga0n895_1051089_c1 nmdc:mga0n895_1051089_c1_91_600 169
1516 3300050512 nmdc:mga0n895_123435_c1 nmdc:mga0n895_123435_c1_255_764 169
1517 3300050512 nmdc:mga0n895_1547_c1 nmdc:mga0n895_1547_c1_4372_4881 169
1518 3300050512 nmdc:mga0n895_4579_c1 nmdc:mga0n895_4579_c1_1089_1598 169
1519 3300050513 nmdc:mga0rr50_16895_c1 nmdc:mga0rr50_16895_c1_2887_3396 169
1520 3300050513 nmdc:mga0rr50_433943_c1 nmdc:mga0rr50_433943_c1_389_898 169
1521 3300050514 nmdc:mga08x19_14306_c1 nmdc:mga08x19_14306_c1_1122_1637 169
1522 3300050514 nmdc:mga08x19_178361_c1 nmdc:mga08x19_178361_c1_813_1322 169
1523 3300050514 nmdc:mga08x19_191779_c1 nmdc:mga08x19_191779_c1_864_1379 169
1524 3300050514 nmdc:mga08x19_2368_c1 nmdc:mga08x19_2368_c1_7778_8287 169
1525 3300050514 nmdc:mga08x19_27172_c1 nmdc:mga08x19_27172_c1_495_1010 169
1526 3300050514 nmdc:mga08x19_6108_c1 nmdc:mga08x19_6108_c1_2848_3357 169
1527 3300050514 nmdc:mga08x19_761213_c1 nmdc:mga08x19_761213_c1_103_618 169
1528 3300050514 nmdc:mga08x19_7696_c1 nmdc:mga08x19_7696_c1_5816_6331 169
1529 3300050515 nmdc:mga0a205_806225_c1 nmdc:mga0a205_806225_c1_213_722 169
1530 3300050515 nmdc:mga0a205_947_c1 nmdc:mga0a205_947_c1_19203_19712 169
1531 3300053077 Ga0495601_0217699 Ga0495601_0217699_193_702 169
1532 3300053085 Ga0495619_0064914 Ga0495619_0064914_338_847 169
1533 3300053085 Ga0495619_0596418 Ga0495619_0596418_209_721 169
1534 3300053085 Ga0495619_0597208 Ga0495619_0597208_207_719 169
1535 3300053085 Ga0495619_0615705 Ga0495619_0615705_10_525 169
1536 3300053085 Ga0495619_0899215 Ga0495619_0899215_65_574 169
1537 3300053148 Ga0500590_059292 Ga0500590_059292_844_1353 169
1538 3300054114 Ga0501084_0080902 Ga0501084_0080902_898_1407 169
1539 3300060353 Ga0501082_0002389 Ga0501082_0002389_2641_3156 169
1540 3300060353 Ga0501082_0129551 Ga0501082_0129551_472_981 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

2

157

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.9698 1 149
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9597 1 149
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9477 2 160
6jf5-assembly1.cif.gz_A k2u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9464 1 146
3k6l-assembly1.cif.gz_A the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9444 1 165
ID Description Score Start End Superfamily
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9698 1 149 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9595 1 149 3.90.45.10
af_A0A0R0ELH1_60_189_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9543 3 105 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9404 1 149 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9322 1 149 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A1G7GEZ1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9971 1 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2V9AZN5-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9965 2 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2V9T8P9-F1-model_v4 Peptide deformylase 0.9961 72 169 GO:0042586
GO:0043686
GO:0046872
AF-A0A2W0B433-F1-model_v4 Peptide deformylase 0.9951 25 169 GO:0042586
GO:0043686
AF-A0A7D8BBN9-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9944 1 169 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.2 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map