F494672
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1544 | 390 | 3088 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10009963|Ga0105245_100099637 |
| Length | 399 |
| Sequence | LALFDSRKMPGVQGGRYKNNKALRVGRLDLLARQDKATKAEYSRGGAGMSSGAGREPKMEQPSRRIVTGAALDEDARIDASVRPQRFADYIGQSRVKENIEIAIQAARSRGEALDHVLLYGPPGLGKTTLAQIIASELGVTIKTSSGPLLERKGDLTAILTSLEQREVFFLDEIHRLVPAIEEVLYPAMEDYRIDLVIGQGAGARIHPFILNRFTLIGATTRAGLVTAPLRSRFGIVHRLEFYTSEDLVTIIRRSASILGIAVDDDGAFELARRSRGTPRVANRLLRRARDFAQVRAQGHITLAVAKEALQMLGVDEHGLDEVDRTLMLTILQKYAGGPVGLSTLAASISEEEDAIEEIYEPYLMQLGLLDRTQRGRVATALAYKHFGLESPRRQPGLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 246 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 247 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 248 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 249 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 250 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 251 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 252 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 253 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 254 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 255 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 256 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 259 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 367 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 383 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 385 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 386 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 387 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 388 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 390 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.26 |
| Isolates | 0.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.71 |
| Nodule | 0 |
| Rhizoplane | 3.17 |
| Rhizosphere | 95.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105245_10009963 | 3300009098 | Bacteria | 8277 |
| 2 | JGI25406J46586_10013078 | 3300003203 | Bacteria | 3581 |
| 3 | Ga0065712_10003117 | 3300005290 | Bacteria | 3928 |
| 4 | Ga0065712_10067822 | 3300005290 | Bacteria | 28686 |
| 5 | Ga0065712_10068256 | 3300005290 | Bacteria | 12406 |
| 6 | Ga0065712_10069647 | 3300005290 | Bacteria | 6927 |
| 7 | Ga0065712_10086315 | 3300005290 | Bacteria | 2636 |
| 8 | Ga0065712_10092300 | 3300005290 | Bacteria | 2336 |
| 9 | Ga0065712_10096909 | 3300005290 | Bacteria | 2168 |
| 10 | Ga0065712_10117705 | 3300005290 | Bacteria | 1716 |
| 11 | Ga0065715_10010472 | 3300005293 | Bacteria | 2805 |
| 12 | Ga0065715_10090135 | 3300005293 | Bacteria | 7597 |
| 13 | Ga0065715_10093135 | 3300005293 | Bacteria | 4798 |
| 14 | Ga0065715_10093168 | 3300005293 | Bacteria | 4784 |
| 15 | Ga0065715_10094425 | 3300005293 | Bacteria | 4344 |
| 16 | Ga0065715_10113341 | 3300005293 | Bacteria | 2493 |
| 17 | Ga0065715_10117987 | 3300005293 | Bacteria | 2330 |
| 18 | Ga0065707_10001479 | 3300005295 | Bacteria | 9195 |
| 19 | Ga0065707_10082300 | 3300005295 | Bacteria | 17197 |
| 20 | Ga0065707_10114653 | 3300005295 | Bacteria | 2291 |
| 21 | Ga0065707_10132595 | 3300005295 | Bacteria | 1895 |
| 22 | Ga0065707_10162560 | 3300005295 | Bacteria | 1550 |
| 23 | Ga0065707_10167462 | 3300005295 | Bacteria | 1511 |
| 24 | Ga0070676_10007541 | 3300005328 | Bacteria | 5844 |
| 25 | Ga0070676_10026430 | 3300005328 | Bacteria | 3286 |
| 26 | Ga0070676_10042457 | 3300005328 | Bacteria | 2640 |
| 27 | Ga0070683_100000767 | 3300005329 | Bacteria | 23601 |
| 28 | Ga0070683_100200920 | 3300005329 | Bacteria | 1893 |
| 29 | Ga0070690_100016845 | 3300005330 | Bacteria | 4387 |
| 30 | Ga0070690_100047784 | 3300005330 | Bacteria | 2723 |
| 31 | Ga0070690_100137999 | 3300005330 | Bacteria | 1653 |
| 32 | Ga0070670_100004018 | 3300005331 | Bacteria | 12279 |
| 33 | Ga0070670_100005693 | 3300005331 | Bacteria | 10524 |
| 34 | Ga0070670_100006799 | 3300005331 | Bacteria | 9681 |
| 35 | Ga0070670_100014101 | 3300005331 | Bacteria | 6857 |
| 36 | Ga0070670_100053037 | 3300005331 | Bacteria | 3482 |
| 37 | Ga0070670_100068457 | 3300005331 | Bacteria | 3047 |
| 38 | Ga0070670_100082316 | 3300005331 | Bacteria | 2766 |
| 39 | Ga0070670_100117557 | 3300005331 | Bacteria | 2293 |
| 40 | Ga0070677_10001941 | 3300005333 | Bacteria | 6558 |
| 41 | Ga0070677_10016182 | 3300005333 | Bacteria | 2653 |
| 42 | Ga0070677_10051067 | 3300005333 | Bacteria | 1672 |
| 43 | Ga0068869_100001962 | 3300005334 | Bacteria | 12329 |
| 44 | Ga0068869_100019703 | 3300005334 | Bacteria | 4615 |
| 45 | Ga0070666_10016269 | 3300005335 | Bacteria | 4756 |
| 46 | Ga0070666_10063651 | 3300005335 | Bacteria | 2500 |
| 47 | Ga0070666_10112771 | 3300005335 | Bacteria | 1881 |
| 48 | Ga0070682_100000035 | 3300005337 | Bacteria | 150016 |
| 49 | Ga0068868_100043851 | 3300005338 | Bacteria | 3494 |
| 50 | Ga0068868_100141734 | 3300005338 | Bacteria | 1973 |
| 51 | Ga0068868_100144848 | 3300005338 | Bacteria | 1953 |
| 52 | Ga0068868_100194443 | 3300005338 | Bacteria | 1688 |
| 53 | Ga0070660_100154479 | 3300005339 | Bacteria | 1847 |
| 54 | Ga0070689_100016312 | 3300005340 | Bacteria | 5435 |
| 55 | Ga0070689_100020541 | 3300005340 | Bacteria | 4902 |
| 56 | Ga0070689_100023685 | 3300005340 | Bacteria | 4599 |
| 57 | Ga0070689_100059391 | 3300005340 | Bacteria | 2972 |
| 58 | Ga0070689_100100302 | 3300005340 | Bacteria | 2291 |
| 59 | Ga0070689_100172345 | 3300005340 | Bacteria | 1754 |
| 60 | Ga0070691_10005391 | 3300005341 | Bacteria | 5817 |
| 61 | Ga0070687_100003542 | 3300005343 | Bacteria | 6079 |
| 62 | Ga0070687_100006797 | 3300005343 | Bacteria | 4718 |
| 63 | Ga0070687_100186401 | 3300005343 | Bacteria | 1247 |
| 64 | Ga0070687_100246111 | 3300005343 | Bacteria | 1108 |
| 65 | Ga0070661_100023235 | 3300005344 | Bacteria | 4443 |
| 66 | Ga0070661_100032912 | 3300005344 | Bacteria | 3754 |
| 67 | Ga0070661_100067305 | 3300005344 | Bacteria | 2632 |
| 68 | Ga0070668_100025473 | 3300005347 | Bacteria | 4484 |
| 69 | Ga0070669_100002591 | 3300005353 | Bacteria | 13067 |
| 70 | Ga0070669_100027676 | 3300005353 | Bacteria | 4080 |
| 71 | Ga0070669_100040428 | 3300005353 | Bacteria | 3389 |
| 72 | Ga0070669_100058689 | 3300005353 | Bacteria | 2824 |
| 73 | Ga0070669_100103009 | 3300005353 | Bacteria | 2156 |
| 74 | Ga0070669_100136306 | 3300005353 | Bacteria | 1888 |
| 75 | Ga0070669_100189810 | 3300005353 | Bacteria | 1611 |
| 76 | Ga0070675_100000442 | 3300005354 | Bacteria | 28196 |
| 77 | Ga0070675_100001024 | 3300005354 | Bacteria | 20115 |
| 78 | Ga0070675_100012826 | 3300005354 | Bacteria | 6576 |
| 79 | Ga0070675_100024303 | 3300005354 | Bacteria | 4852 |
| 80 | Ga0070675_100031700 | 3300005354 | Bacteria | 4275 |
| 81 | Ga0070675_100035531 | 3300005354 | Bacteria | 4050 |
| 82 | Ga0070675_100037927 | 3300005354 | Bacteria | 3926 |
| 83 | Ga0070675_100049232 | 3300005354 | Bacteria | 3458 |
| 84 | Ga0070675_100064924 | 3300005354 | Bacteria | 3018 |
| 85 | Ga0070675_100072539 | 3300005354 | Bacteria | 2858 |
| 86 | Ga0070675_100106845 | 3300005354 | Bacteria | 2363 |
| 87 | Ga0070675_100126641 | 3300005354 | Bacteria | 2173 |
| 88 | Ga0070675_100159643 | 3300005354 | Bacteria | 1938 |
| 89 | Ga0070675_100171016 | 3300005354 | Bacteria | 1874 |
| 90 | Ga0070675_100254623 | 3300005354 | Bacteria | 1537 |
| 91 | Ga0070671_100022132 | 3300005355 | Bacteria | 5193 |
| 92 | Ga0070671_100359700 | 3300005355 | Bacteria | 1243 |
| 93 | Ga0070674_100004110 | 3300005356 | Bacteria | 8268 |
| 94 | Ga0070674_100016261 | 3300005356 | Bacteria | 4662 |
| 95 | Ga0070674_100052135 | 3300005356 | Bacteria | 2821 |
| 96 | Ga0070674_100052750 | 3300005356 | Bacteria | 2806 |
| 97 | Ga0070674_100071144 | 3300005356 | Bacteria | 2459 |
| 98 | Ga0070674_100080733 | 3300005356 | Bacteria | 2323 |
| 99 | Ga0070674_100098405 | 3300005356 | Bacteria | 2126 |
| 100 | Ga0070674_100100078 | 3300005356 | Bacteria | 2110 |
| 101 | Ga0070673_100007497 | 3300005364 | Bacteria | 7204 |
| 102 | Ga0070673_100008711 | 3300005364 | Bacteria | 6767 |
| 103 | Ga0070673_100011429 | 3300005364 | Bacteria | 6056 |
| 104 | Ga0070673_100039289 | 3300005364 | Bacteria | 3620 |
| 105 | Ga0070673_100045756 | 3300005364 | Bacteria | 3396 |
| 106 | Ga0070673_100052057 | 3300005364 | Bacteria | 3211 |
| 107 | Ga0070673_100054726 | 3300005364 | Bacteria | 3140 |
| 108 | Ga0070673_100058579 | 3300005364 | Bacteria | 3046 |
| 109 | Ga0070673_100074909 | 3300005364 | Bacteria | 2728 |
| 110 | Ga0070673_100082692 | 3300005364 | Bacteria | 2607 |
| 111 | Ga0070673_100272439 | 3300005364 | Bacteria | 1482 |
| 112 | Ga0070688_100009725 | 3300005365 | Bacteria | 5277 |
| 113 | Ga0070688_100021012 | 3300005365 | Bacteria | 3806 |
| 114 | Ga0070688_100085427 | 3300005365 | Bacteria | 2051 |
| 115 | Ga0070688_100101264 | 3300005365 | Bacteria | 1900 |
| 116 | Ga0070688_100118249 | 3300005365 | Bacteria | 1771 |
| 117 | Ga0070688_100206141 | 3300005365 | Bacteria | 1378 |
| 118 | Ga0070667_100014780 | 3300005367 | Bacteria | 6449 |
| 119 | Ga0070667_100106411 | 3300005367 | Bacteria | 2428 |
| 120 | Ga0070667_100156520 | 3300005367 | Bacteria | 2004 |
| 121 | Ga0070667_100207474 | 3300005367 | Bacteria | 1741 |
| 122 | Ga0070667_100262386 | 3300005367 | Bacteria | 1547 |
| 123 | Ga0070703_10003911 | 3300005406 | Bacteria | 4220 |
| 124 | Ga0070703_10019537 | 3300005406 | Bacteria | 1964 |
| 125 | Ga0070709_10004268 | 3300005434 | Bacteria | 7711 |
| 126 | Ga0070709_10037201 | 3300005434 | Bacteria | 2971 |
| 127 | Ga0070709_10069154 | 3300005434 | Bacteria | 2273 |
| 128 | Ga0070714_100165808 | 3300005435 | Bacteria | 2002 |
| 129 | Ga0070713_100028719 | 3300005436 | Bacteria | 4395 |
| 130 | Ga0070713_100031212 | 3300005436 | Bacteria | 4242 |
| 131 | Ga0070713_100097566 | 3300005436 | Bacteria | 2540 |
| 132 | Ga0070713_100199094 | 3300005436 | Bacteria | 1808 |
| 133 | Ga0070701_10007445 | 3300005438 | Bacteria | 4678 |
| 134 | Ga0070701_10025421 | 3300005438 | Bacteria | 2876 |
| 135 | Ga0070701_10025882 | 3300005438 | Bacteria | 2854 |
| 136 | Ga0070711_100009831 | 3300005439 | Bacteria | 5899 |
| 137 | Ga0070711_100083557 | 3300005439 | Bacteria | 2282 |
| 138 | Ga0070711_100212492 | 3300005439 | Bacteria | 1499 |
| 139 | Ga0070705_100000288 | 3300005440 | Bacteria | 30044 |
| 140 | Ga0070705_100000449 | 3300005440 | Bacteria | 23638 |
| 141 | Ga0070705_100026756 | 3300005440 | Bacteria | 3143 |
| 142 | Ga0070705_100057794 | 3300005440 | Bacteria | 2289 |
| 143 | Ga0070705_100115577 | 3300005440 | Bacteria | 1723 |
| 144 | Ga0070700_100003978 | 3300005441 | Bacteria | 7679 |
| 145 | Ga0070700_100010664 | 3300005441 | Bacteria | 5075 |
| 146 | Ga0070700_100011740 | 3300005441 | Bacteria | 4862 |
| 147 | Ga0070700_100153909 | 3300005441 | Bacteria | 1575 |
| 148 | Ga0070694_100000762 | 3300005444 | Bacteria | 17985 |
| 149 | Ga0070694_100020020 | 3300005444 | Bacteria | 4262 |
| 150 | Ga0070694_100028490 | 3300005444 | Bacteria | 3635 |
| 151 | Ga0070694_100032377 | 3300005444 | Bacteria | 3434 |
| 152 | Ga0070694_100180103 | 3300005444 | Bacteria | 1563 |
| 153 | Ga0070694_100335306 | 3300005444 | Bacteria | 1168 |
| 154 | Ga0070708_100019182 | 3300005445 | Bacteria | 5741 |
| 155 | Ga0070708_100028160 | 3300005445 | Bacteria | 4832 |
| 156 | Ga0070708_100048944 | 3300005445 | Bacteria | 3739 |
| 157 | Ga0070708_100057244 | 3300005445 | Bacteria | 3470 |
| 158 | Ga0070708_100205444 | 3300005445 | Bacteria | 1845 |
| 159 | Ga0070708_100293505 | 3300005445 | Bacteria | 1531 |
| 160 | Ga0070708_100325323 | 3300005445 | Bacteria | 1448 |
| 161 | Ga0070663_100009691 | 3300005455 | Bacteria | 5975 |
| 162 | Ga0070678_100237450 | 3300005456 | Bacteria | 1522 |
| 163 | Ga0070662_100036324 | 3300005457 | Bacteria | 3484 |
| 164 | Ga0070662_100050184 | 3300005457 | Bacteria | 3010 |
| 165 | Ga0070662_100076829 | 3300005457 | Bacteria | 2476 |
| 166 | Ga0070681_10000926 | 3300005458 | Bacteria | 24766 |
| 167 | Ga0070681_10005093 | 3300005458 | Bacteria | 12679 |
| 168 | Ga0068867_100004543 | 3300005459 | Bacteria | 9755 |
| 169 | Ga0068867_100007110 | 3300005459 | Bacteria | 7911 |
| 170 | Ga0068867_100012153 | 3300005459 | Bacteria | 6083 |
| 171 | Ga0068867_100015273 | 3300005459 | Bacteria | 5443 |
| 172 | Ga0068867_100040773 | 3300005459 | Bacteria | 3391 |
| 173 | Ga0068867_100068142 | 3300005459 | Bacteria | 2655 |
| 174 | Ga0068867_100110181 | 3300005459 | Bacteria | 2114 |
| 175 | Ga0068867_100129921 | 3300005459 | Bacteria | 1956 |
| 176 | Ga0068867_100235012 | 3300005459 | Bacteria | 1483 |
| 177 | Ga0068867_100414885 | 3300005459 | Bacteria | 1139 |
| 178 | Ga0070685_10002548 | 3300005466 | Bacteria | 9333 |
| 179 | Ga0070685_10003010 | 3300005466 | Bacteria | 8594 |
| 180 | Ga0070685_10191722 | 3300005466 | Bacteria | 1323 |
| 181 | Ga0070706_100007364 | 3300005467 | Bacteria | 10323 |
| 182 | Ga0070706_100017811 | 3300005467 | Bacteria | 6553 |
| 183 | Ga0070706_100062834 | 3300005467 | Bacteria | 3431 |
| 184 | Ga0070706_100070232 | 3300005467 | Bacteria | 3239 |
| 185 | Ga0070706_100201483 | 3300005467 | Bacteria | 1859 |
| 186 | Ga0070707_100000011 | 3300005468 | Bacteria | 158252 |
| 187 | Ga0070707_100002468 | 3300005468 | Bacteria | 17624 |
| 188 | Ga0070707_100045214 | 3300005468 | Bacteria | 4215 |
| 189 | Ga0070707_100049961 | 3300005468 | Bacteria | 4009 |
| 190 | Ga0070707_100052066 | 3300005468 | Bacteria | 3924 |
| 191 | Ga0070707_100060347 | 3300005468 | Bacteria | 3637 |
| 192 | Ga0070707_100103657 | 3300005468 | Bacteria | 2757 |
| 193 | Ga0070707_100211057 | 3300005468 | Bacteria | 1892 |
| 194 | Ga0070698_100001654 | 3300005471 | Bacteria | 24859 |
| 195 | Ga0070698_100002474 | 3300005471 | Bacteria | 20388 |
| 196 | Ga0070698_100014002 | 3300005471 | Bacteria | 8483 |
| 197 | Ga0070698_100015006 | 3300005471 | Bacteria | 8189 |
| 198 | Ga0070698_100072730 | 3300005471 | Bacteria | 3446 |
| 199 | Ga0070698_100163544 | 3300005471 | Bacteria | 2169 |
| 200 | Ga0070699_100000558 | 3300005518 | Bacteria | 35133 |
| 201 | Ga0070699_100009920 | 3300005518 | Bacteria | 8250 |
| 202 | Ga0070699_100026285 | 3300005518 | Bacteria | 5021 |
| 203 | Ga0070699_100042605 | 3300005518 | Bacteria | 3929 |
| 204 | Ga0070699_100060971 | 3300005518 | Bacteria | 3269 |
| 205 | Ga0070699_100063016 | 3300005518 | Bacteria | 3214 |
| 206 | Ga0070699_100091306 | 3300005518 | Bacteria | 2662 |
| 207 | Ga0070699_100104888 | 3300005518 | Bacteria | 2479 |
| 208 | Ga0070699_100152609 | 3300005518 | Bacteria | 2044 |
| 209 | Ga0070699_100217634 | 3300005518 | Bacteria | 1702 |
| 210 | Ga0070699_100421623 | 3300005518 | Bacteria | 1208 |
| 211 | Ga0070679_100011918 | 3300005530 | Bacteria | 8298 |
| 212 | Ga0070679_100124285 | 3300005530 | Bacteria | 2563 |
| 213 | Ga0070684_100004962 | 3300005535 | Bacteria | 10158 |
| 214 | Ga0070684_100010485 | 3300005535 | Bacteria | 7343 |
| 215 | Ga0070684_100122918 | 3300005535 | Bacteria | 2336 |
| 216 | Ga0070697_100004983 | 3300005536 | Bacteria | 10194 |
| 217 | Ga0070697_100057979 | 3300005536 | Bacteria | 3151 |
| 218 | Ga0070697_100097400 | 3300005536 | Bacteria | 2441 |
| 219 | Ga0070697_100162709 | 3300005536 | Bacteria | 1886 |
| 220 | Ga0070697_100162949 | 3300005536 | Bacteria | 1884 |
| 221 | Ga0070697_100267488 | 3300005536 | Bacteria | 1465 |
| 222 | Ga0068853_100174627 | 3300005539 | Bacteria | 1946 |
| 223 | Ga0070672_100000360 | 3300005543 | Bacteria | 26221 |
| 224 | Ga0070672_100037705 | 3300005543 | Bacteria | 3689 |
| 225 | Ga0070672_100066328 | 3300005543 | Bacteria | 2858 |
| 226 | Ga0070672_100104885 | 3300005543 | Bacteria | 2297 |
| 227 | Ga0070672_100115218 | 3300005543 | Bacteria | 2194 |
| 228 | Ga0070672_100144402 | 3300005543 | Bacteria | 1965 |
| 229 | Ga0070672_100247639 | 3300005543 | Bacteria | 1500 |
| 230 | Ga0070686_100006747 | 3300005544 | Bacteria | 6388 |
| 231 | Ga0070686_100147924 | 3300005544 | Bacteria | 1642 |
| 232 | Ga0070695_100000582 | 3300005545 | Bacteria | 19251 |
| 233 | Ga0070695_100008733 | 3300005545 | Bacteria | 6021 |
| 234 | Ga0070695_100165990 | 3300005545 | Bacteria | 1554 |
| 235 | Ga0070695_100296084 | 3300005545 | Bacteria | 1194 |
| 236 | Ga0070696_100001518 | 3300005546 | Bacteria | 15229 |
| 237 | Ga0070696_100003257 | 3300005546 | Bacteria | 10825 |
| 238 | Ga0070696_100018392 | 3300005546 | Bacteria | 4722 |
| 239 | Ga0070696_100033671 | 3300005546 | Bacteria | 3522 |
| 240 | Ga0070696_100070820 | 3300005546 | Bacteria | 2453 |
| 241 | Ga0070693_100000004 | 3300005547 | Bacteria | 94899 |
| 242 | Ga0070693_100005655 | 3300005547 | Bacteria | 6029 |
| 243 | Ga0070665_100000122 | 3300005548 | Bacteria | 147483 |
| 244 | Ga0070665_100002388 | 3300005548 | Bacteria | 20707 |
| 245 | Ga0070665_100003370 | 3300005548 | Bacteria | 17092 |
| 246 | Ga0070665_100166571 | 3300005548 | Bacteria | 2206 |
| 247 | Ga0070704_100000802 | 3300005549 | Bacteria | 15581 |
| 248 | Ga0070704_100012627 | 3300005549 | Bacteria | 5223 |
| 249 | Ga0070704_100012700 | 3300005549 | Bacteria | 5210 |
| 250 | Ga0070704_100020062 | 3300005549 | Bacteria | 4303 |
| 251 | Ga0070704_100049606 | 3300005549 | Bacteria | 2946 |
| 252 | Ga0070704_100133034 | 3300005549 | Bacteria | 1931 |
| 253 | Ga0070704_100153527 | 3300005549 | Bacteria | 1813 |
| 254 | Ga0070704_100197329 | 3300005549 | Bacteria | 1622 |
| 255 | Ga0068855_100345507 | 3300005563 | Bacteria | 1640 |
| 256 | Ga0070664_100009155 | 3300005564 | Bacteria | 8040 |
| 257 | Ga0070664_100040446 | 3300005564 | Bacteria | 3930 |
| 258 | Ga0070664_100050239 | 3300005564 | Bacteria | 3529 |
| 259 | Ga0070664_100054162 | 3300005564 | Bacteria | 3403 |
| 260 | Ga0070664_100128131 | 3300005564 | Bacteria | 2228 |
| 261 | Ga0070664_100147749 | 3300005564 | Bacteria | 2074 |
| 262 | Ga0068857_100031800 | 3300005577 | Bacteria | 4663 |
| 263 | Ga0068857_100041841 | 3300005577 | Bacteria | 4063 |
| 264 | Ga0068857_100043627 | 3300005577 | Bacteria | 3977 |
| 265 | Ga0068857_100124417 | 3300005577 | Bacteria | 2323 |
| 266 | Ga0068854_100011543 | 3300005578 | Bacteria | 5758 |
| 267 | Ga0070702_100002550 | 3300005615 | Bacteria | 7914 |
| 268 | Ga0070702_100041188 | 3300005615 | Bacteria | 2589 |
| 269 | Ga0070702_100105012 | 3300005615 | Bacteria | 1740 |
| 270 | Ga0070702_100153084 | 3300005615 | Bacteria | 1482 |
| 271 | Ga0068852_100026364 | 3300005616 | Bacteria | 4723 |
| 272 | Ga0068852_100176540 | 3300005616 | Bacteria | 2006 |
| 273 | Ga0068859_100004358 | 3300005617 | Bacteria | 14441 |
| 274 | Ga0068859_100007450 | 3300005617 | Bacteria | 11108 |
| 275 | Ga0068859_100023926 | 3300005617 | Bacteria | 6129 |
| 276 | Ga0068859_100034044 | 3300005617 | Bacteria | 5115 |
| 277 | Ga0068859_100053436 | 3300005617 | Bacteria | 4063 |
| 278 | Ga0068859_100098046 | 3300005617 | Bacteria | 2985 |
| 279 | Ga0068864_100000007 | 3300005618 | Bacteria | 392187 |
| 280 | Ga0068864_100008459 | 3300005618 | Bacteria | 8492 |
| 281 | Ga0068864_100008524 | 3300005618 | Bacteria | 8459 |
| 282 | Ga0068864_100022414 | 3300005618 | Bacteria | 5296 |
| 283 | Ga0068864_100037340 | 3300005618 | Bacteria | 4146 |
| 284 | Ga0068864_100066381 | 3300005618 | Bacteria | 3131 |
| 285 | Ga0068864_100067698 | 3300005618 | Bacteria | 3101 |
| 286 | Ga0068864_100166898 | 3300005618 | Bacteria | 2005 |
| 287 | Ga0068864_100276282 | 3300005618 | Bacteria | 1567 |
| 288 | Ga0068864_100486886 | 3300005618 | Bacteria | 1185 |
| 289 | Ga0068866_10010430 | 3300005718 | Bacteria | 3982 |
| 290 | Ga0068861_100001024 | 3300005719 | Bacteria | 17105 |
| 291 | Ga0068861_100004253 | 3300005719 | Bacteria | 9595 |
| 292 | Ga0068861_100011191 | 3300005719 | Bacteria | 6229 |
| 293 | Ga0068861_100018977 | 3300005719 | Bacteria | 4905 |
| 294 | Ga0068861_100092894 | 3300005719 | Bacteria | 2385 |
| 295 | Ga0068861_100130396 | 3300005719 | Bacteria | 2040 |
| 296 | Ga0068861_100346505 | 3300005719 | Bacteria | 1301 |
| 297 | Ga0068861_100383676 | 3300005719 | Bacteria | 1242 |
| 298 | Ga0068851_10012457 | 3300005834 | Bacteria | 4009 |
| 299 | Ga0068870_10002841 | 3300005840 | Bacteria | 7291 |
| 300 | Ga0068870_10006109 | 3300005840 | Bacteria | 5293 |
| 301 | Ga0068870_10006855 | 3300005840 | Bacteria | 5052 |
| 302 | Ga0068870_10014126 | 3300005840 | Bacteria | 3766 |
| 303 | Ga0068870_10066587 | 3300005840 | Bacteria | 1951 |
| 304 | Ga0068870_10183760 | 3300005840 | Bacteria | 1257 |
| 305 | Ga0068863_100089191 | 3300005841 | Bacteria | 2923 |
| 306 | Ga0068863_100131497 | 3300005841 | Bacteria | 2390 |
| 307 | Ga0068863_100135370 | 3300005841 | Bacteria | 2354 |
| 308 | Ga0068858_100000717 | 3300005842 | Bacteria | 34513 |
| 309 | Ga0068858_100010084 | 3300005842 | Bacteria | 8969 |
| 310 | Ga0068858_100059383 | 3300005842 | Bacteria | 3535 |
| 311 | Ga0068858_100096421 | 3300005842 | Bacteria | 2756 |
| 312 | Ga0068858_100098730 | 3300005842 | Bacteria | 2722 |
| 313 | Ga0068858_100182368 | 3300005842 | Bacteria | 1982 |
| 314 | Ga0068860_100000658 | 3300005843 | Bacteria | 40219 |
| 315 | Ga0068860_100002851 | 3300005843 | Bacteria | 17951 |
| 316 | Ga0068860_100015659 | 3300005843 | Bacteria | 7403 |
| 317 | Ga0068860_100095866 | 3300005843 | Bacteria | 2828 |
| 318 | Ga0068860_100185812 | 3300005843 | Bacteria | 2010 |
| 319 | Ga0068860_100196091 | 3300005843 | Bacteria | 1956 |
| 320 | Ga0068860_100276596 | 3300005843 | Bacteria | 1640 |
| 321 | Ga0068862_100002475 | 3300005844 | Bacteria | 16354 |
| 322 | Ga0068862_100006398 | 3300005844 | Bacteria | 9794 |
| 323 | Ga0068862_100016709 | 3300005844 | Bacteria | 6110 |
| 324 | Ga0068862_100018886 | 3300005844 | Bacteria | 5744 |
| 325 | Ga0068862_100167988 | 3300005844 | Bacteria | 1962 |
| 326 | Ga0068862_100169822 | 3300005844 | Bacteria | 1952 |
| 327 | Ga0068862_100172065 | 3300005844 | Bacteria | 1939 |
| 328 | Ga0068862_100312083 | 3300005844 | Bacteria | 1449 |
| 329 | Ga0068862_100484977 | 3300005844 | Bacteria | 1171 |
| 330 | Ga0081539_10000025 | 3300005985 | Bacteria | 340255 |
| 331 | Ga0081539_10000134 | 3300005985 | Bacteria | 173625 |
| 332 | Ga0081539_10004230 | 3300005985 | Bacteria | 16158 |
| 333 | Ga0070717_10000160 | 3300006028 | Bacteria | 50638 |
| 334 | Ga0070717_10288392 | 3300006028 | Bacteria | 1457 |
| 335 | Ga0075368_10006201 | 3300006042 | Bacteria | 4165 |
| 336 | Ga0075432_10055177 | 3300006058 | Bacteria | 1407 |
| 337 | Ga0070715_10063972 | 3300006163 | Bacteria | 1623 |
| 338 | Ga0070716_100004009 | 3300006173 | Bacteria | 6991 |
| 339 | Ga0070716_100042123 | 3300006173 | Bacteria | 2547 |
| 340 | Ga0070716_100201173 | 3300006173 | Bacteria | 1324 |
| 341 | Ga0070716_100219253 | 3300006173 | Bacteria | 1277 |
| 342 | Ga0070712_100021014 | 3300006175 | Bacteria | 4280 |
| 343 | Ga0070712_100077573 | 3300006175 | Bacteria | 2395 |
| 344 | Ga0070712_100112029 | 3300006175 | Bacteria | 2038 |
| 345 | Ga0075367_10003716 | 3300006178 | Bacteria | 7337 |
| 346 | Ga0075367_10060288 | 3300006178 | Bacteria | 2262 |
| 347 | Ga0097621_100005430 | 3300006237 | Bacteria | 8984 |
| 348 | Ga0097621_100058986 | 3300006237 | Bacteria | 3141 |
| 349 | Ga0097621_100059085 | 3300006237 | Bacteria | 3138 |
| 350 | Ga0097621_100089132 | 3300006237 | Bacteria | 2579 |
| 351 | Ga0097621_100100594 | 3300006237 | Bacteria | 2432 |
| 352 | Ga0075370_10076812 | 3300006353 | Bacteria | 1916 |
| 353 | Ga0068871_100001401 | 3300006358 | Bacteria | 16134 |
| 354 | Ga0068871_100016049 | 3300006358 | Bacteria | 5628 |
| 355 | Ga0068871_100060151 | 3300006358 | Bacteria | 3098 |
| 356 | Ga0068871_100075412 | 3300006358 | Bacteria | 2784 |
| 357 | Ga0068871_100117926 | 3300006358 | Bacteria | 2239 |
| 358 | Ga0075428_100000005 | 3300006844 | Bacteria | 326130 |
| 359 | Ga0075428_100002473 | 3300006844 | Bacteria | 20060 |
| 360 | Ga0075428_100003359 | 3300006844 | Bacteria | 17508 |
| 361 | Ga0075428_100006386 | 3300006844 | Bacteria | 13120 |
| 362 | Ga0075428_100009431 | 3300006844 | Bacteria | 10834 |
| 363 | Ga0075428_100016154 | 3300006844 | Bacteria | 8253 |
| 364 | Ga0075428_100027209 | 3300006844 | Bacteria | 6331 |
| 365 | Ga0075428_100048327 | 3300006844 | Bacteria | 4670 |
| 366 | Ga0075428_100057559 | 3300006844 | Bacteria | 4255 |
| 367 | Ga0075428_100166741 | 3300006844 | Bacteria | 2389 |
| 368 | Ga0075428_100395198 | 3300006844 | Bacteria | 1482 |
| 369 | Ga0075428_100442094 | 3300006844 | Bacteria | 1393 |
| 370 | Ga0075430_100002136 | 3300006846 | Bacteria | 16365 |
| 371 | Ga0075430_100002239 | 3300006846 | Bacteria | 16031 |
| 372 | Ga0075430_100005588 | 3300006846 | Bacteria | 10624 |
| 373 | Ga0075430_100014486 | 3300006846 | Bacteria | 6716 |
| 374 | Ga0075430_100020148 | 3300006846 | Bacteria | 5675 |
| 375 | Ga0075430_100034120 | 3300006846 | Bacteria | 4318 |
| 376 | Ga0075430_100095682 | 3300006846 | Bacteria | 2482 |
| 377 | Ga0075430_100175267 | 3300006846 | Bacteria | 1784 |
| 378 | Ga0075430_100314349 | 3300006846 | Bacteria | 1295 |
| 379 | Ga0075431_100000575 | 3300006847 | Bacteria | 31085 |
| 380 | Ga0075431_100001153 | 3300006847 | Bacteria | 23746 |
| 381 | Ga0075431_100005566 | 3300006847 | Bacteria | 12437 |
| 382 | Ga0075431_100007412 | 3300006847 | Bacteria | 10923 |
| 383 | Ga0075431_100010853 | 3300006847 | Bacteria | 9164 |
| 384 | Ga0075431_100032234 | 3300006847 | Bacteria | 5400 |
| 385 | Ga0075431_100074509 | 3300006847 | Bacteria | 3502 |
| 386 | Ga0075431_100177433 | 3300006847 | Bacteria | 2188 |
| 387 | Ga0075431_100192911 | 3300006847 | Bacteria | 2087 |
| 388 | Ga0075431_100198791 | 3300006847 | Bacteria | 2052 |
| 389 | Ga0075431_100330244 | 3300006847 | Bacteria | 1536 |
| 390 | Ga0075433_10003019 | 3300006852 | Bacteria | 12931 |
| 391 | Ga0075433_10050195 | 3300006852 | Bacteria | 3631 |
| 392 | Ga0075433_10065855 | 3300006852 | Bacteria | 3178 |
| 393 | Ga0075433_10067923 | 3300006852 | Bacteria | 3128 |
| 394 | Ga0075433_10083058 | 3300006852 | Bacteria | 2826 |
| 395 | Ga0075433_10088168 | 3300006852 | Bacteria | 2741 |
| 396 | Ga0075433_10097299 | 3300006852 | Bacteria | 2605 |
| 397 | Ga0075434_100000919 | 3300006871 | Bacteria | 23605 |
| 398 | Ga0075434_100025674 | 3300006871 | Bacteria | 5765 |
| 399 | Ga0075434_100037402 | 3300006871 | Bacteria | 4805 |
| 400 | Ga0075434_100051482 | 3300006871 | Bacteria | 4093 |
| 401 | Ga0075434_100062148 | 3300006871 | Bacteria | 3717 |
| 402 | Ga0075434_100084179 | 3300006871 | Bacteria | 3179 |
| 403 | Ga0075434_100100251 | 3300006871 | Bacteria | 2902 |
| 404 | Ga0075434_100110857 | 3300006871 | Bacteria | 2755 |
| 405 | Ga0075434_100127023 | 3300006871 | Bacteria | 2567 |
| 406 | Ga0075434_100166250 | 3300006871 | Bacteria | 2226 |
| 407 | Ga0075434_100176521 | 3300006871 | Bacteria | 2156 |
| 408 | Ga0075434_100193417 | 3300006871 | Bacteria | 2055 |
| 409 | Ga0075434_100204784 | 3300006871 | Bacteria | 1993 |
| 410 | Ga0075434_100271683 | 3300006871 | Bacteria | 1714 |
| 411 | Ga0075434_100396614 | 3300006871 | Bacteria | 1401 |
| 412 | Ga0075434_100487985 | 3300006871 | Bacteria | 1253 |
| 413 | Ga0075429_100003923 | 3300006880 | Bacteria | 12713 |
| 414 | Ga0075429_100013537 | 3300006880 | Bacteria | 7077 |
| 415 | Ga0075429_100016751 | 3300006880 | Bacteria | 6347 |
| 416 | Ga0075429_100035327 | 3300006880 | Bacteria | 4347 |
| 417 | Ga0075429_100036989 | 3300006880 | Bacteria | 4249 |
| 418 | Ga0075429_100068908 | 3300006880 | Bacteria | 3079 |
| 419 | Ga0075429_100091401 | 3300006880 | Bacteria | 2655 |
| 420 | Ga0075429_100112122 | 3300006880 | Bacteria | 2384 |
| 421 | Ga0075429_100116987 | 3300006880 | Bacteria | 2330 |
| 422 | Ga0068865_100105696 | 3300006881 | Bacteria | 2068 |
| 423 | Ga0075436_100007865 | 3300006914 | Bacteria | 7295 |
| 424 | Ga0075436_100008907 | 3300006914 | Bacteria | 6869 |
| 425 | Ga0075436_100011225 | 3300006914 | Bacteria | 6141 |
| 426 | Ga0075436_100037045 | 3300006914 | Bacteria | 3367 |
| 427 | Ga0075436_100042530 | 3300006914 | Bacteria | 3134 |
| 428 | Ga0075436_100090348 | 3300006914 | Bacteria | 2129 |
| 429 | Ga0097620_100004358 | 3300006931 | Bacteria | 14441 |
| 430 | Ga0097620_100007450 | 3300006931 | Bacteria | 11108 |
| 431 | Ga0097620_100023926 | 3300006931 | Bacteria | 6129 |
| 432 | Ga0097620_100034044 | 3300006931 | Bacteria | 5115 |
| 433 | Ga0097620_100053435 | 3300006931 | Bacteria | 4063 |
| 434 | Ga0097620_100098046 | 3300006931 | Bacteria | 2985 |
| 435 | Ga0075435_100000185 | 3300007076 | Bacteria | 37052 |
| 436 | Ga0075435_100004809 | 3300007076 | Bacteria | 9342 |
| 437 | Ga0075435_100006977 | 3300007076 | Bacteria | 8019 |
| 438 | Ga0075435_100035383 | 3300007076 | Bacteria | 3963 |
| 439 | Ga0075435_100336062 | 3300007076 | Bacteria | 1294 |
| 440 | Ga0099794_10010639 | 3300007265 | Bacteria | 3912 |
| 441 | Ga0099794_10012772 | 3300007265 | Bacteria | 3637 |
| 442 | Ga0099794_10019314 | 3300007265 | Bacteria | 3067 |
| 443 | Ga0099794_10049428 | 3300007265 | Bacteria | 2021 |
| 444 | Ga0099794_10050745 | 3300007265 | Bacteria | 1996 |
| 445 | Ga0099795_10011684 | 3300007788 | Bacteria | 2635 |
| 446 | Ga0105240_10018260 | 3300009093 | Bacteria | 9428 |
| 447 | Ga0105240_10024901 | 3300009093 | Bacteria | 7878 |
| 448 | Ga0105240_10045142 | 3300009093 | Bacteria | 5593 |
| 449 | Ga0105240_10118771 | 3300009093 | Bacteria | 3186 |
| 450 | Ga0111539_10000008 | 3300009094 | Bacteria | 382609 |
| 451 | Ga0111539_10010233 | 3300009094 | Bacteria | 11819 |
| 452 | Ga0111539_10015435 | 3300009094 | Bacteria | 9501 |
| 453 | Ga0111539_10017849 | 3300009094 | Bacteria | 8786 |
| 454 | Ga0111539_10053056 | 3300009094 | Bacteria | 4826 |
| 455 | Ga0111539_10069612 | 3300009094 | Bacteria | 4155 |
| 456 | Ga0111539_10120056 | 3300009094 | Bacteria | 3080 |
| 457 | Ga0111539_10162093 | 3300009094 | Bacteria | 2615 |
| 458 | Ga0111539_10172713 | 3300009094 | Bacteria | 2525 |
| 459 | Ga0111539_10237395 | 3300009094 | Bacteria | 2122 |
| 460 | Ga0111539_10259101 | 3300009094 | Bacteria | 2025 |
| 461 | Ga0111539_10366046 | 3300009094 | Bacteria | 1678 |
| 462 | Ga0111539_10385603 | 3300009094 | Bacteria | 1631 |
| 463 | Ga0111539_10419146 | 3300009094 | Bacteria | 1559 |
| 464 | Ga0111539_10428901 | 3300009094 | Bacteria | 1540 |
| 465 | Ga0111539_10505083 | 3300009094 | Bacteria | 1408 |
| 466 | Ga0111539_10531179 | 3300009094 | Bacteria | 1371 |
| 467 | Ga0105245_10004535 | 3300009098 | Bacteria | 12264 |
| 468 | Ga0105245_10005359 | 3300009098 | Bacteria | 11269 |
| 469 | Ga0105245_10033714 | 3300009098 | Bacteria | 4538 |
| 470 | Ga0105245_10050297 | 3300009098 | Bacteria | 3735 |
| 471 | Ga0105245_10152435 | 3300009098 | Bacteria | 2186 |
| 472 | Ga0114129_10000574 | 3300009147 | Bacteria | 45251 |
| 473 | Ga0114129_10001790 | 3300009147 | Bacteria | 29271 |
| 474 | Ga0114129_10002431 | 3300009147 | Bacteria | 25841 |
| 475 | Ga0114129_10007344 | 3300009147 | Bacteria | 15689 |
| 476 | Ga0114129_10008510 | 3300009147 | Bacteria | 14623 |
| 477 | Ga0114129_10020281 | 3300009147 | Bacteria | 9460 |
| 478 | Ga0114129_10024870 | 3300009147 | Bacteria | 8491 |
| 479 | Ga0114129_10049166 | 3300009147 | Bacteria | 5927 |
| 480 | Ga0114129_10057984 | 3300009147 | Bacteria | 5418 |
| 481 | Ga0114129_10103084 | 3300009147 | Bacteria | 3945 |
| 482 | Ga0114129_10126427 | 3300009147 | Bacteria | 3514 |
| 483 | Ga0114129_10147067 | 3300009147 | Bacteria | 3227 |
| 484 | Ga0114129_10191633 | 3300009147 | Bacteria | 2776 |
| 485 | Ga0114129_10400489 | 3300009147 | Bacteria | 1809 |
| 486 | Ga0114129_10413203 | 3300009147 | Unclassified | 1776 |
| 487 | Ga0105243_10013883 | 3300009148 | Bacteria | 6098 |
| 488 | Ga0105243_10077158 | 3300009148 | Bacteria | 2709 |
| 489 | Ga0105243_10118442 | 3300009148 | Bacteria | 2228 |
| 490 | Ga0105243_10229795 | 3300009148 | Bacteria | 1645 |
| 491 | Ga0105241_10033243 | 3300009174 | Bacteria | 3871 |
| 492 | Ga0105241_10360000 | 3300009174 | Bacteria | 1266 |
| 493 | Ga0105242_10007676 | 3300009176 | Bacteria | 8301 |
| 494 | Ga0105242_10074387 | 3300009176 | Bacteria | 2827 |
| 495 | Ga0105242_10129741 | 3300009176 | Bacteria | 2174 |
| 496 | Ga0105242_10142896 | 3300009176 | Bacteria | 2079 |
| 497 | Ga0105248_10001544 | 3300009177 | Bacteria | 25631 |
| 498 | Ga0105248_10029775 | 3300009177 | Bacteria | 6092 |
| 499 | Ga0105248_10039996 | 3300009177 | Bacteria | 5255 |
| 500 | Ga0105248_10084089 | 3300009177 | Bacteria | 3579 |
| 501 | Ga0105248_10093304 | 3300009177 | Bacteria | 3390 |
| 502 | Ga0105248_10100342 | 3300009177 | Bacteria | 3262 |
| 503 | Ga0105248_10119465 | 3300009177 | Bacteria | 2973 |
| 504 | Ga0105248_10128088 | 3300009177 | Bacteria | 2864 |
| 505 | Ga0105248_10182129 | 3300009177 | Bacteria | 2367 |
| 506 | Ga0105248_10207658 | 3300009177 | Bacteria | 2207 |
| 507 | Ga0105248_10410839 | 3300009177 | Bacteria | 1524 |
| 508 | Ga0105238_10000002 | 3300009551 | Bacteria | 772711 |
| 509 | Ga0105238_10203277 | 3300009551 | Bacteria | 1957 |
| 510 | Ga0105249_10021476 | 3300009553 | Bacteria | 5779 |
| 511 | Ga0105249_10032539 | 3300009553 | Bacteria | 4719 |
| 512 | Ga0105249_10052119 | 3300009553 | Bacteria | 3736 |
| 513 | Ga0105249_10104120 | 3300009553 | Bacteria | 2674 |
| 514 | Ga0105249_10549398 | 3300009553 | Bacteria | 1205 |
| 515 | Ga0099796_10002341 | 3300010159 | Bacteria | 4139 |
| 516 | Ga0105239_10051109 | 3300010375 | Bacteria | 4532 |
| 517 | Ga0105246_10016281 | 3300011119 | Bacteria | 4707 |
| 518 | Ga0157374_10000038 | 3300013296 | Bacteria | 169868 |
| 519 | Ga0157374_10001975 | 3300013296 | Bacteria | 17206 |
| 520 | Ga0157374_10179131 | 3300013296 | Bacteria | 2070 |
| 521 | Ga0157374_10200211 | 3300013296 | Bacteria | 1955 |
| 522 | Ga0157378_10000044 | 3300013297 | Bacteria | 106822 |
| 523 | Ga0157378_10000678 | 3300013297 | Bacteria | 31999 |
| 524 | Ga0157378_10001262 | 3300013297 | Bacteria | 22775 |
| 525 | Ga0157378_10002388 | 3300013297 | Bacteria | 16681 |
| 526 | Ga0157378_10003083 | 3300013297 | Bacteria | 14811 |
| 527 | Ga0157378_10281354 | 3300013297 | Bacteria | 1603 |
| 528 | Ga0157378_10299363 | 3300013297 | Bacteria | 1556 |
| 529 | Ga0163162_10006374 | 3300013306 | Bacteria | 11424 |
| 530 | Ga0163162_10030754 | 3300013306 | Bacteria | 5321 |
| 531 | Ga0163162_10031743 | 3300013306 | Bacteria | 5241 |
| 532 | Ga0163162_10072255 | 3300013306 | Bacteria | 3505 |
| 533 | Ga0157375_10000003 | 3300013308 | Bacteria | 476325 |
| 534 | Ga0157375_10000010 | 3300013308 | Bacteria | 361011 |
| 535 | Ga0157375_10006844 | 3300013308 | Bacteria | 9934 |
| 536 | Ga0157375_10046618 | 3300013308 | Bacteria | 4228 |
| 537 | Ga0157375_10094436 | 3300013308 | Bacteria | 3060 |
| 538 | Ga0163163_10000023 | 3300014325 | Bacteria | 185843 |
| 539 | Ga0163163_10007293 | 3300014325 | Bacteria | 9753 |
| 540 | Ga0163163_10015982 | 3300014325 | Bacteria | 6956 |
| 541 | Ga0163163_10074644 | 3300014325 | Bacteria | 3383 |
| 542 | Ga0163163_10347387 | 3300014325 | Bacteria | 1539 |
| 543 | Ga0157380_10007520 | 3300014326 | Bacteria | 7739 |
| 544 | Ga0157380_10008698 | 3300014326 | Bacteria | 7257 |
| 545 | Ga0157380_10011997 | 3300014326 | Bacteria | 6270 |
| 546 | Ga0157380_10013898 | 3300014326 | Bacteria | 5878 |
| 547 | Ga0157380_10015991 | 3300014326 | Bacteria | 5524 |
| 548 | Ga0157380_10044711 | 3300014326 | Bacteria | 3472 |
| 549 | Ga0157380_10049170 | 3300014326 | Bacteria | 3324 |
| 550 | Ga0157380_10068673 | 3300014326 | Bacteria | 2857 |
| 551 | Ga0157380_10084766 | 3300014326 | Bacteria | 2599 |
| 552 | Ga0157380_10196324 | 3300014326 | Bacteria | 1786 |
| 553 | Ga0157380_10204107 | 3300014326 | Bacteria | 1756 |
| 554 | Ga0157380_10303700 | 3300014326 | Bacteria | 1471 |
| 555 | Ga0157380_10331615 | 3300014326 | Bacteria | 1415 |
| 556 | Ga0157377_10000004 | 3300014745 | Bacteria | 430019 |
| 557 | Ga0157377_10000074 | 3300014745 | Bacteria | 77443 |
| 558 | Ga0157377_10002734 | 3300014745 | Bacteria | 7847 |
| 559 | Ga0157377_10008196 | 3300014745 | Bacteria | 5085 |
| 560 | Ga0157379_10005070 | 3300014968 | Bacteria | 11291 |
| 561 | Ga0157379_10207188 | 3300014968 | Bacteria | 1774 |
| 562 | Ga0157376_10000003 | 3300014969 | Bacteria | 568634 |
| 563 | Ga0157376_10000008 | 3300014969 | Bacteria | 351192 |
| 564 | Ga0157376_10000231 | 3300014969 | Bacteria | 38978 |
| 565 | Ga0157376_10055323 | 3300014969 | Bacteria | 3310 |
| 566 | Ga0157376_10138252 | 3300014969 | Bacteria | 2182 |
| 567 | Ga0157376_10325007 | 3300014969 | Bacteria | 1464 |
| 568 | Ga0157376_10610909 | 3300014969 | Bacteria | 1086 |
| 569 | Ga0163161_10024629 | 3300017792 | Bacteria | 4253 |
| 570 | Ga0163161_10072790 | 3300017792 | Bacteria | 2517 |
| 571 | Ga0228598_1000166 | 3300024227 | Bacteria | 11590 |
| 572 | Ga0207697_10007162 | 3300025315 | Bacteria | 4990 |
| 573 | Ga0207697_10025607 | 3300025315 | Bacteria | 2411 |
| 574 | Ga0207653_10000691 | 3300025885 | Bacteria | 11593 |
| 575 | Ga0207682_10002808 | 3300025893 | Bacteria | 7700 |
| 576 | Ga0207682_10008627 | 3300025893 | Bacteria | 4029 |
| 577 | Ga0207682_10026000 | 3300025893 | Bacteria | 2323 |
| 578 | Ga0207682_10035209 | 3300025893 | Bacteria | 2021 |
| 579 | Ga0207642_10002113 | 3300025899 | Bacteria | 6145 |
| 580 | Ga0207642_10072235 | 3300025899 | Bacteria | 1646 |
| 581 | Ga0207688_10000078 | 3300025901 | Bacteria | 37290 |
| 582 | Ga0207688_10023905 | 3300025901 | Bacteria | 3350 |
| 583 | Ga0207688_10122377 | 3300025901 | Bacteria | 1519 |
| 584 | Ga0207685_10048472 | 3300025905 | Bacteria | 1627 |
| 585 | Ga0207699_10001243 | 3300025906 | Bacteria | 12111 |
| 586 | Ga0207699_10021854 | 3300025906 | Bacteria | 3458 |
| 587 | Ga0207699_10044858 | 3300025906 | Bacteria | 2576 |
| 588 | Ga0207699_10056021 | 3300025906 | Bacteria | 2348 |
| 589 | Ga0207699_10060540 | 3300025906 | Bacteria | 2274 |
| 590 | Ga0207645_10000374 | 3300025907 | Bacteria | 37092 |
| 591 | Ga0207645_10001092 | 3300025907 | Bacteria | 22384 |
| 592 | Ga0207645_10010985 | 3300025907 | Bacteria | 6195 |
| 593 | Ga0207645_10034102 | 3300025907 | Bacteria | 3270 |
| 594 | Ga0207645_10047816 | 3300025907 | Bacteria | 2732 |
| 595 | Ga0207643_10003058 | 3300025908 | Bacteria | 8996 |
| 596 | Ga0207643_10006513 | 3300025908 | Bacteria | 6254 |
| 597 | Ga0207643_10038368 | 3300025908 | Bacteria | 2690 |
| 598 | Ga0207643_10064690 | 3300025908 | Bacteria | 2093 |
| 599 | Ga0207643_10101174 | 3300025908 | Bacteria | 1690 |
| 600 | Ga0207643_10168825 | 3300025908 | Bacteria | 1320 |
| 601 | Ga0207643_10186244 | 3300025908 | Bacteria | 1258 |
| 602 | Ga0207684_10002227 | 3300025910 | Bacteria | 19778 |
| 603 | Ga0207684_10048144 | 3300025910 | Bacteria | 3615 |
| 604 | Ga0207684_10051922 | 3300025910 | Bacteria | 3479 |
| 605 | Ga0207707_10008909 | 3300025912 | Bacteria | 8713 |
| 606 | Ga0207707_10022422 | 3300025912 | Bacteria | 5520 |
| 607 | Ga0207695_10034283 | 3300025913 | Bacteria | 5523 |
| 608 | Ga0207695_10119515 | 3300025913 | Bacteria | 2605 |
| 609 | Ga0207671_10147123 | 3300025914 | Bacteria | 1818 |
| 610 | Ga0207693_10003389 | 3300025915 | Bacteria | 13619 |
| 611 | Ga0207693_10015404 | 3300025915 | Bacteria | 6135 |
| 612 | Ga0207693_10015622 | 3300025915 | Bacteria | 6087 |
| 613 | Ga0207693_10034863 | 3300025915 | Bacteria | 3969 |
| 614 | Ga0207693_10194445 | 3300025915 | Bacteria | 1596 |
| 615 | Ga0207663_10006081 | 3300025916 | Bacteria | 6139 |
| 616 | Ga0207663_10059865 | 3300025916 | Bacteria | 2411 |
| 617 | Ga0207663_10066980 | 3300025916 | Bacteria | 2301 |
| 618 | Ga0207660_10108613 | 3300025917 | Bacteria | 2084 |
| 619 | Ga0207662_10007437 | 3300025918 | Bacteria | 5966 |
| 620 | Ga0207662_10034763 | 3300025918 | Bacteria | 2941 |
| 621 | Ga0207662_10056672 | 3300025918 | Bacteria | 2341 |
| 622 | Ga0207662_10068771 | 3300025918 | Bacteria | 2139 |
| 623 | Ga0207657_10131981 | 3300025919 | Bacteria | 2046 |
| 624 | Ga0207649_10005573 | 3300025920 | Bacteria | 6809 |
| 625 | Ga0207649_10085622 | 3300025920 | Bacteria | 2051 |
| 626 | Ga0207652_10015551 | 3300025921 | Bacteria | 6190 |
| 627 | Ga0207646_10000055 | 3300025922 | Bacteria | 158886 |
| 628 | Ga0207646_10000122 | 3300025922 | Bacteria | 105908 |
| 629 | Ga0207646_10001764 | 3300025922 | Bacteria | 26210 |
| 630 | Ga0207646_10044362 | 3300025922 | Bacteria | 3991 |
| 631 | Ga0207646_10051322 | 3300025922 | Bacteria | 3691 |
| 632 | Ga0207646_10089322 | 3300025922 | Bacteria | 2758 |
| 633 | Ga0207646_10115678 | 3300025922 | Bacteria | 2409 |
| 634 | Ga0207646_10407768 | 3300025922 | Bacteria | 1227 |
| 635 | Ga0207681_10000705 | 3300025923 | Bacteria | 21963 |
| 636 | Ga0207681_10030851 | 3300025923 | Bacteria | 3497 |
| 637 | Ga0207681_10048185 | 3300025923 | Bacteria | 2875 |
| 638 | Ga0207681_10048216 | 3300025923 | Bacteria | 2874 |
| 639 | Ga0207681_10049316 | 3300025923 | Bacteria | 2845 |
| 640 | Ga0207681_10057761 | 3300025923 | Bacteria | 2653 |
| 641 | Ga0207681_10080337 | 3300025923 | Bacteria | 2300 |
| 642 | Ga0207681_10095641 | 3300025923 | Bacteria | 2131 |
| 643 | Ga0207681_10164773 | 3300025923 | Bacteria | 1674 |
| 644 | Ga0207681_10167476 | 3300025923 | Bacteria | 1662 |
| 645 | Ga0207681_10372897 | 3300025923 | Bacteria | 1147 |
| 646 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 647 | Ga0207650_10010475 | 3300025925 | Bacteria | 6358 |
| 648 | Ga0207650_10015200 | 3300025925 | Bacteria | 5357 |
| 649 | Ga0207650_10017612 | 3300025925 | Bacteria | 5003 |
| 650 | Ga0207650_10019816 | 3300025925 | Bacteria | 4733 |
| 651 | Ga0207650_10030655 | 3300025925 | Bacteria | 3876 |
| 652 | Ga0207650_10119526 | 3300025925 | Bacteria | 2050 |
| 653 | Ga0207650_10223524 | 3300025925 | Bacteria | 1516 |
| 654 | Ga0207659_10000501 | 3300025926 | Bacteria | 23548 |
| 655 | Ga0207659_10003555 | 3300025926 | Bacteria | 9373 |
| 656 | Ga0207659_10014754 | 3300025926 | Bacteria | 5049 |
| 657 | Ga0207659_10020760 | 3300025926 | Bacteria | 4348 |
| 658 | Ga0207659_10064234 | 3300025926 | Bacteria | 2656 |
| 659 | Ga0207659_10073756 | 3300025926 | Bacteria | 2500 |
| 660 | Ga0207659_10098749 | 3300025926 | Bacteria | 2196 |
| 661 | Ga0207659_10139943 | 3300025926 | Bacteria | 1878 |
| 662 | Ga0207687_10000771 | 3300025927 | Bacteria | 21608 |
| 663 | Ga0207687_10008609 | 3300025927 | Bacteria | 6672 |
| 664 | Ga0207687_10034362 | 3300025927 | Bacteria | 3442 |
| 665 | Ga0207687_10067081 | 3300025927 | Bacteria | 2551 |
| 666 | Ga0207687_10067321 | 3300025927 | Bacteria | 2547 |
| 667 | Ga0207700_10044131 | 3300025928 | Bacteria | 3280 |
| 668 | Ga0207700_10063685 | 3300025928 | Bacteria | 2806 |
| 669 | Ga0207700_10078610 | 3300025928 | Bacteria | 2567 |
| 670 | Ga0207700_10097605 | 3300025928 | Bacteria | 2335 |
| 671 | Ga0207700_10141252 | 3300025928 | Bacteria | 1979 |
| 672 | Ga0207700_10178810 | 3300025928 | Bacteria | 1775 |
| 673 | Ga0207664_10109716 | 3300025929 | Bacteria | 2293 |
| 674 | Ga0207644_10046516 | 3300025931 | Bacteria | 3092 |
| 675 | Ga0207644_10050148 | 3300025931 | Bacteria | 2991 |
| 676 | Ga0207644_10067758 | 3300025931 | Bacteria | 2602 |
| 677 | Ga0207644_10078777 | 3300025931 | Bacteria | 2430 |
| 678 | Ga0207644_10181615 | 3300025931 | Bacteria | 1649 |
| 679 | Ga0207690_10010646 | 3300025932 | Bacteria | 5480 |
| 680 | Ga0207690_10082194 | 3300025932 | Bacteria | 2253 |
| 681 | Ga0207690_10106393 | 3300025932 | Bacteria | 2013 |
| 682 | Ga0207690_10134218 | 3300025932 | Bacteria | 1816 |
| 683 | Ga0207706_10005517 | 3300025933 | Bacteria | 11795 |
| 684 | Ga0207706_10039316 | 3300025933 | Bacteria | 4193 |
| 685 | Ga0207706_10042267 | 3300025933 | Bacteria | 4040 |
| 686 | Ga0207706_10054366 | 3300025933 | Bacteria | 3534 |
| 687 | Ga0207706_10075480 | 3300025933 | Bacteria | 2964 |
| 688 | Ga0207706_10075776 | 3300025933 | Bacteria | 2959 |
| 689 | Ga0207686_10017235 | 3300025934 | Bacteria | 4067 |
| 690 | Ga0207686_10046039 | 3300025934 | Bacteria | 2688 |
| 691 | Ga0207686_10085013 | 3300025934 | Bacteria | 2074 |
| 692 | Ga0207686_10099192 | 3300025934 | Bacteria | 1941 |
| 693 | Ga0207686_10106152 | 3300025934 | Bacteria | 1885 |
| 694 | Ga0207686_10235655 | 3300025934 | Bacteria | 1329 |
| 695 | Ga0207709_10007327 | 3300025935 | Bacteria | 6151 |
| 696 | Ga0207709_10025497 | 3300025935 | Bacteria | 3385 |
| 697 | Ga0207709_10040623 | 3300025935 | Bacteria | 2786 |
| 698 | Ga0207709_10058837 | 3300025935 | Bacteria | 2390 |
| 699 | Ga0207709_10125183 | 3300025935 | Bacteria | 1742 |
| 700 | Ga0207670_10011233 | 3300025936 | Bacteria | 5191 |
| 701 | Ga0207670_10022933 | 3300025936 | Bacteria | 3877 |
| 702 | Ga0207670_10048147 | 3300025936 | Bacteria | 2843 |
| 703 | Ga0207670_10051749 | 3300025936 | Bacteria | 2759 |
| 704 | Ga0207670_10051766 | 3300025936 | Bacteria | 2759 |
| 705 | Ga0207670_10068660 | 3300025936 | Bacteria | 2443 |
| 706 | Ga0207670_10113522 | 3300025936 | Bacteria | 1957 |
| 707 | Ga0207670_10240256 | 3300025936 | Bacteria | 1395 |
| 708 | Ga0207670_10317870 | 3300025936 | Bacteria | 1224 |
| 709 | Ga0207669_10010135 | 3300025937 | Bacteria | 4526 |
| 710 | Ga0207669_10010275 | 3300025937 | Bacteria | 4501 |
| 711 | Ga0207669_10022027 | 3300025937 | Bacteria | 3377 |
| 712 | Ga0207669_10139147 | 3300025937 | Bacteria | 1682 |
| 713 | Ga0207669_10177867 | 3300025937 | Bacteria | 1522 |
| 714 | Ga0207704_10011415 | 3300025938 | Bacteria | 4374 |
| 715 | Ga0207704_10225874 | 3300025938 | Bacteria | 1389 |
| 716 | Ga0207704_10261912 | 3300025938 | Bacteria | 1304 |
| 717 | Ga0207665_10000008 | 3300025939 | Bacteria | 173434 |
| 718 | Ga0207665_10008235 | 3300025939 | Bacteria | 6883 |
| 719 | Ga0207665_10050032 | 3300025939 | Bacteria | 2809 |
| 720 | Ga0207665_10052689 | 3300025939 | Bacteria | 2742 |
| 721 | Ga0207665_10080243 | 3300025939 | Bacteria | 2244 |
| 722 | Ga0207665_10136108 | 3300025939 | Bacteria | 1748 |
| 723 | Ga0207665_10197299 | 3300025939 | Bacteria | 1465 |
| 724 | Ga0207665_10246000 | 3300025939 | Bacteria | 1320 |
| 725 | Ga0207665_10260036 | 3300025939 | Bacteria | 1286 |
| 726 | Ga0207691_10006666 | 3300025940 | Bacteria | 11139 |
| 727 | Ga0207691_10008868 | 3300025940 | Bacteria | 9654 |
| 728 | Ga0207691_10010705 | 3300025940 | Bacteria | 8805 |
| 729 | Ga0207691_10036965 | 3300025940 | Bacteria | 4524 |
| 730 | Ga0207691_10040373 | 3300025940 | Bacteria | 4312 |
| 731 | Ga0207691_10043122 | 3300025940 | Bacteria | 4158 |
| 732 | Ga0207691_10064984 | 3300025940 | Bacteria | 3304 |
| 733 | Ga0207691_10067224 | 3300025940 | Bacteria | 3241 |
| 734 | Ga0207691_10104004 | 3300025940 | Bacteria | 2531 |
| 735 | Ga0207691_10200543 | 3300025940 | Bacteria | 1737 |
| 736 | Ga0207711_10070974 | 3300025941 | Bacteria | 3021 |
| 737 | Ga0207711_10076066 | 3300025941 | Bacteria | 2923 |
| 738 | Ga0207711_10078675 | 3300025941 | Bacteria | 2877 |
| 739 | Ga0207711_10121043 | 3300025941 | Bacteria | 2336 |
| 740 | Ga0207689_10004769 | 3300025942 | Bacteria | 12231 |
| 741 | Ga0207689_10006874 | 3300025942 | Bacteria | 10004 |
| 742 | Ga0207689_10023079 | 3300025942 | Bacteria | 5225 |
| 743 | Ga0207689_10066454 | 3300025942 | Bacteria | 2965 |
| 744 | Ga0207689_10094010 | 3300025942 | Bacteria | 2462 |
| 745 | Ga0207689_10136530 | 3300025942 | Bacteria | 2020 |
| 746 | Ga0207689_10148118 | 3300025942 | Bacteria | 1934 |
| 747 | Ga0207689_10300848 | 3300025942 | Bacteria | 1330 |
| 748 | Ga0207689_10365401 | 3300025942 | Bacteria | 1200 |
| 749 | Ga0207661_10000567 | 3300025944 | Bacteria | 23624 |
| 750 | Ga0207661_10076026 | 3300025944 | Bacteria | 2757 |
| 751 | Ga0207661_10225408 | 3300025944 | Bacteria | 1658 |
| 752 | Ga0207679_10002887 | 3300025945 | Bacteria | 10658 |
| 753 | Ga0207679_10008110 | 3300025945 | Bacteria | 6680 |
| 754 | Ga0207679_10038680 | 3300025945 | Bacteria | 3401 |
| 755 | Ga0207679_10061002 | 3300025945 | Bacteria | 2805 |
| 756 | Ga0207679_10080569 | 3300025945 | Bacteria | 2486 |
| 757 | Ga0207679_10195768 | 3300025945 | Bacteria | 1684 |
| 758 | Ga0207679_10345999 | 3300025945 | Bacteria | 1294 |
| 759 | Ga0207679_10466302 | 3300025945 | Bacteria | 1122 |
| 760 | Ga0207651_10003088 | 3300025960 | Bacteria | 8094 |
| 761 | Ga0207651_10013243 | 3300025960 | Bacteria | 4710 |
| 762 | Ga0207651_10017893 | 3300025960 | Bacteria | 4200 |
| 763 | Ga0207651_10017894 | 3300025960 | Bacteria | 4200 |
| 764 | Ga0207651_10025651 | 3300025960 | Bacteria | 3667 |
| 765 | Ga0207651_10068350 | 3300025960 | Bacteria | 2504 |
| 766 | Ga0207651_10079593 | 3300025960 | Bacteria | 2355 |
| 767 | Ga0207651_10093640 | 3300025960 | Bacteria | 2207 |
| 768 | Ga0207651_10136320 | 3300025960 | Bacteria | 1888 |
| 769 | Ga0207651_10164201 | 3300025960 | Bacteria | 1744 |
| 770 | Ga0207651_10328403 | 3300025960 | Bacteria | 1281 |
| 771 | Ga0207712_10020761 | 3300025961 | Bacteria | 4306 |
| 772 | Ga0207712_10026599 | 3300025961 | Bacteria | 3856 |
| 773 | Ga0207712_10033799 | 3300025961 | Bacteria | 3459 |
| 774 | Ga0207712_10135594 | 3300025961 | Bacteria | 1882 |
| 775 | Ga0207712_10179426 | 3300025961 | Bacteria | 1662 |
| 776 | Ga0207668_10172199 | 3300025972 | Bacteria | 1699 |
| 777 | Ga0207640_10005632 | 3300025981 | Bacteria | 6828 |
| 778 | Ga0207640_10018088 | 3300025981 | Bacteria | 4134 |
| 779 | Ga0207640_10053034 | 3300025981 | Bacteria | 2645 |
| 780 | Ga0207658_10085333 | 3300025986 | Bacteria | 2432 |
| 781 | Ga0207677_10030076 | 3300026023 | Bacteria | 3461 |
| 782 | Ga0207677_10112640 | 3300026023 | Bacteria | 2029 |
| 783 | Ga0207677_10259951 | 3300026023 | Bacteria | 1415 |
| 784 | Ga0207703_10111147 | 3300026035 | Bacteria | 2338 |
| 785 | Ga0207703_10183813 | 3300026035 | Bacteria | 1846 |
| 786 | Ga0207703_10251546 | 3300026035 | Bacteria | 1593 |
| 787 | Ga0207703_10365100 | 3300026035 | Bacteria | 1332 |
| 788 | Ga0207639_10000028 | 3300026041 | Bacteria | 197736 |
| 789 | Ga0207639_10078745 | 3300026041 | Bacteria | 2602 |
| 790 | Ga0207678_10019603 | 3300026067 | Bacteria | 5946 |
| 791 | Ga0207678_10064943 | 3300026067 | Bacteria | 3135 |
| 792 | Ga0207708_10030417 | 3300026075 | Bacteria | 4093 |
| 793 | Ga0207708_10052944 | 3300026075 | Bacteria | 3091 |
| 794 | Ga0207708_10060418 | 3300026075 | Bacteria | 2893 |
| 795 | Ga0207708_10077717 | 3300026075 | Bacteria | 2548 |
| 796 | Ga0207708_10078793 | 3300026075 | Bacteria | 2530 |
| 797 | Ga0207708_10087996 | 3300026075 | Bacteria | 2392 |
| 798 | Ga0207708_10109996 | 3300026075 | Bacteria | 2138 |
| 799 | Ga0207708_10352092 | 3300026075 | Bacteria | 1208 |
| 800 | Ga0207641_10068952 | 3300026088 | Bacteria | 3034 |
| 801 | Ga0207641_10176334 | 3300026088 | Bacteria | 1954 |
| 802 | Ga0207648_10003537 | 3300026089 | Bacteria | 16338 |
| 803 | Ga0207648_10006736 | 3300026089 | Bacteria | 11394 |
| 804 | Ga0207648_10014255 | 3300026089 | Bacteria | 7349 |
| 805 | Ga0207648_10026662 | 3300026089 | Bacteria | 5133 |
| 806 | Ga0207648_10037009 | 3300026089 | Bacteria | 4298 |
| 807 | Ga0207648_10040076 | 3300026089 | Bacteria | 4116 |
| 808 | Ga0207648_10055320 | 3300026089 | Bacteria | 3464 |
| 809 | Ga0207648_10061425 | 3300026089 | Bacteria | 3277 |
| 810 | Ga0207676_10000015 | 3300026095 | Bacteria | 329100 |
| 811 | Ga0207676_10036130 | 3300026095 | Bacteria | 3756 |
| 812 | Ga0207676_10082326 | 3300026095 | Bacteria | 2617 |
| 813 | Ga0207676_10082601 | 3300026095 | Bacteria | 2614 |
| 814 | Ga0207676_10084144 | 3300026095 | Bacteria | 2592 |
| 815 | Ga0207676_10116410 | 3300026095 | Bacteria | 2246 |
| 816 | Ga0207676_10130061 | 3300026095 | Bacteria | 2139 |
| 817 | Ga0207676_10272370 | 3300026095 | Bacteria | 1534 |
| 818 | Ga0207674_10035104 | 3300026116 | Bacteria | 5235 |
| 819 | Ga0207674_10067461 | 3300026116 | Bacteria | 3601 |
| 820 | Ga0207674_10137541 | 3300026116 | Bacteria | 2404 |
| 821 | Ga0207674_10197575 | 3300026116 | Bacteria | 1961 |
| 822 | Ga0207674_10288408 | 3300026116 | Bacteria | 1590 |
| 823 | Ga0207675_100001961 | 3300026118 | Bacteria | 20530 |
| 824 | Ga0207675_100002780 | 3300026118 | Bacteria | 17190 |
| 825 | Ga0207675_100023842 | 3300026118 | Bacteria | 5691 |
| 826 | Ga0207675_100027174 | 3300026118 | Bacteria | 5330 |
| 827 | Ga0207675_100034443 | 3300026118 | Bacteria | 4722 |
| 828 | Ga0207675_100048944 | 3300026118 | Bacteria | 3945 |
| 829 | Ga0207675_100179457 | 3300026118 | Bacteria | 2027 |
| 830 | Ga0207675_100196272 | 3300026118 | Bacteria | 1937 |
| 831 | Ga0207675_100281120 | 3300026118 | Bacteria | 1617 |
| 832 | Ga0207675_100302616 | 3300026118 | Bacteria | 1558 |
| 833 | Ga0207675_100321919 | 3300026118 | Bacteria | 1510 |
| 834 | Ga0207683_10048058 | 3300026121 | Bacteria | 3737 |
| 835 | Ga0207683_10072444 | 3300026121 | Bacteria | 3047 |
| 836 | Ga0207683_10075713 | 3300026121 | Bacteria | 2979 |
| 837 | Ga0207683_10116065 | 3300026121 | Bacteria | 2400 |
| 838 | Ga0207683_10200125 | 3300026121 | Bacteria | 1815 |
| 839 | Ga0207683_10220060 | 3300026121 | Bacteria | 1730 |
| 840 | Ga0207683_10490057 | 3300026121 | Bacteria | 1135 |
| 841 | Ga0209179_1015421 | 3300027512 | Bacteria | 1419 |
| 842 | Ga0209588_1005892 | 3300027671 | Bacteria | 3533 |
| 843 | Ga0209588_1013432 | 3300027671 | Bacteria | 2496 |
| 844 | Ga0209971_1006519 | 3300027682 | Bacteria | 2761 |
| 845 | Ga0207428_10000285 | 3300027907 | Bacteria | 68342 |
| 846 | Ga0207428_10005347 | 3300027907 | Bacteria | 11972 |
| 847 | Ga0207428_10009579 | 3300027907 | Bacteria | 8675 |
| 848 | Ga0207428_10019994 | 3300027907 | Bacteria | 5702 |
| 849 | Ga0207428_10049425 | 3300027907 | Bacteria | 3370 |
| 850 | Ga0207428_10104509 | 3300027907 | Bacteria | 2185 |
| 851 | Ga0207428_10246372 | 3300027907 | Bacteria | 1334 |
| 852 | Ga0207428_10253670 | 3300027907 | Bacteria | 1311 |
| 853 | Ga0265354_1001565 | 3300028016 | Bacteria | 3212 |
| 854 | Ga0265354_1001601 | 3300028016 | Bacteria | 3167 |
| 855 | Ga0268266_10000153 | 3300028379 | Bacteria | 131887 |
| 856 | Ga0268266_10000217 | 3300028379 | Bacteria | 100718 |
| 857 | Ga0268266_10357377 | 3300028379 | Bacteria | 1374 |
| 858 | Ga0268265_10000714 | 3300028380 | Bacteria | 32686 |
| 859 | Ga0268265_10010217 | 3300028380 | Bacteria | 6337 |
| 860 | Ga0268265_10100882 | 3300028380 | Bacteria | 2331 |
| 861 | Ga0268265_10201002 | 3300028380 | Bacteria | 1729 |
| 862 | Ga0268265_10214148 | 3300028380 | Bacteria | 1681 |
| 863 | Ga0268265_10292863 | 3300028380 | Bacteria | 1462 |
| 864 | Ga0268265_10316410 | 3300028380 | Bacteria | 1411 |
| 865 | Ga0268264_10001337 | 3300028381 | Bacteria | 23185 |
| 866 | Ga0268264_10001966 | 3300028381 | Bacteria | 18469 |
| 867 | Ga0268264_10032193 | 3300028381 | Bacteria | 4302 |
| 868 | Ga0268264_10092137 | 3300028381 | Bacteria | 2615 |
| 869 | Ga0268264_10225569 | 3300028381 | Bacteria | 1727 |
| 870 | Ga0268264_10355430 | 3300028381 | Bacteria | 1396 |
| 871 | Ga0265319_1002464 | 3300028563 | Bacteria | 10098 |
| 872 | Ga0265318_10000320 | 3300028577 | Bacteria | 38387 |
| 873 | Ga0265338_10032726 | 3300028800 | Bacteria | 5062 |
| 874 | Ga0265338_10038545 | 3300028800 | Bacteria | 4525 |
| 875 | Ga0307511_10003746 | 3300030521 | Bacteria | 15547 |
| 876 | Ga0265770_1001477 | 3300030878 | Bacteria | 3232 |
| 877 | Ga0265765_1001239 | 3300030879 | Bacteria | 2317 |
| 878 | Ga0265760_10000020 | 3300031090 | Bacteria | 71420 |
| 879 | Ga0265760_10018513 | 3300031090 | Bacteria | 2007 |
| 880 | Ga0265328_10028844 | 3300031239 | Bacteria | 2075 |
| 881 | Ga0265328_10062127 | 3300031239 | Bacteria | 1371 |
| 882 | Ga0265320_10000139 | 3300031240 | Bacteria | 61536 |
| 883 | Ga0265320_10028961 | 3300031240 | Bacteria | 2870 |
| 884 | Ga0265320_10059973 | 3300031240 | Bacteria | 1818 |
| 885 | Ga0265325_10019621 | 3300031241 | Bacteria | 3734 |
| 886 | Ga0265329_10000050 | 3300031242 | Bacteria | 51098 |
| 887 | Ga0265329_10013066 | 3300031242 | Bacteria | 2970 |
| 888 | Ga0265340_10025923 | 3300031247 | Bacteria | 2966 |
| 889 | Ga0265339_10004465 | 3300031249 | Bacteria | 9546 |
| 890 | Ga0265339_10156312 | 3300031249 | Bacteria | 1150 |
| 891 | Ga0265331_10000135 | 3300031250 | Bacteria | 96750 |
| 892 | Ga0265331_10006194 | 3300031250 | Bacteria | 7099 |
| 893 | Ga0265331_10017191 | 3300031250 | Bacteria | 3778 |
| 894 | Ga0265331_10026792 | 3300031250 | Bacteria | 2894 |
| 895 | Ga0265316_10000531 | 3300031344 | Bacteria | 42984 |
| 896 | Ga0265316_10000752 | 3300031344 | Bacteria | 35775 |
| 897 | Ga0265316_10031452 | 3300031344 | Bacteria | 4339 |
| 898 | Ga0265316_10067052 | 3300031344 | Bacteria | 2776 |
| 899 | Ga0265316_10088298 | 3300031344 | Bacteria | 2367 |
| 900 | Ga0307408_100019683 | 3300031548 | Bacteria | 4547 |
| 901 | Ga0307408_100061025 | 3300031548 | Bacteria | 2751 |
| 902 | Ga0307408_100130347 | 3300031548 | Bacteria | 1961 |
| 903 | Ga0307408_100228101 | 3300031548 | Bacteria | 1523 |
| 904 | Ga0265313_10001857 | 3300031595 | Bacteria | 19236 |
| 905 | Ga0265313_10017309 | 3300031595 | Bacteria | 4101 |
| 906 | Ga0307508_10019767 | 3300031616 | Bacteria | 6119 |
| 907 | Ga0265314_10023524 | 3300031711 | Bacteria | 4695 |
| 908 | Ga0265314_10029100 | 3300031711 | Bacteria | 4110 |
| 909 | Ga0265314_10060442 | 3300031711 | Bacteria | 2586 |
| 910 | Ga0265342_10000694 | 3300031712 | Bacteria | 35309 |
| 911 | Ga0316576_10076797 | 3300031727 | Bacteria | 2472 |
| 912 | Ga0307405_10000638 | 3300031731 | Bacteria | 13469 |
| 913 | Ga0307413_10002032 | 3300031824 | Bacteria | 8053 |
| 914 | Ga0307413_10017654 | 3300031824 | Bacteria | 3722 |
| 915 | Ga0307410_10005295 | 3300031852 | Bacteria | 6809 |
| 916 | Ga0307410_10005377 | 3300031852 | Bacteria | 6771 |
| 917 | Ga0307410_10013809 | 3300031852 | Bacteria | 4727 |
| 918 | Ga0307410_10026539 | 3300031852 | Bacteria | 3648 |
| 919 | Ga0307406_10023741 | 3300031901 | Bacteria | 3653 |
| 920 | Ga0307406_10033035 | 3300031901 | Bacteria | 3164 |
| 921 | Ga0307407_10010455 | 3300031903 | Bacteria | 4378 |
| 922 | Ga0307407_10010616 | 3300031903 | Bacteria | 4352 |
| 923 | Ga0307407_10047429 | 3300031903 | Bacteria | 2438 |
| 924 | Ga0307407_10066880 | 3300031903 | Bacteria | 2121 |
| 925 | Ga0307407_10188770 | 3300031903 | Bacteria | 1372 |
| 926 | Ga0307412_10022746 | 3300031911 | Bacteria | 3848 |
| 927 | Ga0307412_10155456 | 3300031911 | Bacteria | 1692 |
| 928 | Ga0307412_10330698 | 3300031911 | Bacteria | 1216 |
| 929 | Ga0307409_100003656 | 3300031995 | Bacteria | 8414 |
| 930 | Ga0307409_100065126 | 3300031995 | Bacteria | 2866 |
| 931 | Ga0307409_100179543 | 3300031995 | Bacteria | 1872 |
| 932 | Ga0307416_100003391 | 3300032002 | Bacteria | 9341 |
| 933 | Ga0307416_100024508 | 3300032002 | Bacteria | 4406 |
| 934 | Ga0307416_100027297 | 3300032002 | Bacteria | 4225 |
| 935 | Ga0307416_100033527 | 3300032002 | Bacteria | 3894 |
| 936 | Ga0307416_100046069 | 3300032002 | Bacteria | 3439 |
| 937 | Ga0307416_100046391 | 3300032002 | Bacteria | 3428 |
| 938 | Ga0307416_100129459 | 3300032002 | Bacteria | 2268 |
| 939 | Ga0307416_100252380 | 3300032002 | Bacteria | 1718 |
| 940 | Ga0307416_100423376 | 3300032002 | Bacteria | 1376 |
| 941 | Ga0307416_100452523 | 3300032002 | Bacteria | 1337 |
| 942 | Ga0307416_100495620 | 3300032002 | Bacteria | 1285 |
| 943 | Ga0307414_10022618 | 3300032004 | Bacteria | 3970 |
| 944 | Ga0307414_10030123 | 3300032004 | Bacteria | 3542 |
| 945 | Ga0307414_10047654 | 3300032004 | Bacteria | 2951 |
| 946 | Ga0307411_10025874 | 3300032005 | Bacteria | 3523 |
| 947 | Ga0307411_10026725 | 3300032005 | Bacteria | 3479 |
| 948 | Ga0307411_10069895 | 3300032005 | Bacteria | 2373 |
| 949 | Ga0307411_10127043 | 3300032005 | Bacteria | 1856 |
| 950 | Ga0307411_10171712 | 3300032005 | Bacteria | 1636 |
| 951 | Ga0307415_100008737 | 3300032126 | Bacteria | 5634 |
| 952 | Ga0307415_100041972 | 3300032126 | Bacteria | 3041 |
| 953 | Ga0307415_100079332 | 3300032126 | Bacteria | 2338 |
| 954 | Ga0316212_1008675 | 3300033547 | Bacteria | 1460 |
| 955 | Ga0373926_0000176 | 3300035083 | Bacteria | 14340 |
| 956 | Ga0373926_0004885 | 3300035083 | Bacteria | 4406 |
| 957 | Ga0373929_0000003 | 3300035085 | Bacteria | 575058 |
| 958 | Ga0373934_0001676 | 3300035086 | Bacteria | 8135 |
| 959 | Ga0373949_0005553 | 3300035090 | Bacteria | 2812 |
| 960 | Ga0373923_0022394 | 3300035111 | Bacteria | 2478 |
| 961 | Ga0373932_0000061 | 3300035112 | Bacteria | 26428 |
| 962 | Ga0373939_0011753 | 3300035114 | Bacteria | 2217 |
| 963 | Ga0373945_0081489 | 3300035116 | Bacteria | 1240 |
| 964 | Ga0373953_0028136 | 3300035117 | Bacteria | 2165 |
| 965 | Ga0373954_0000648 | 3300035118 | Bacteria | 13316 |
| 966 | Ga0373956_0001011 | 3300035119 | Bacteria | 11600 |
| 967 | Ga0373956_0052747 | 3300035119 | Bacteria | 1829 |
| 968 | Ga0373943_0093778 | 3300035170 | Bacteria | 1559 |
| 969 | Ga0373946_0003193 | 3300035171 | Bacteria | 5812 |
| 970 | Ga0373946_0041329 | 3300035171 | Bacteria | 1891 |
| 971 | Ga0373946_0043801 | 3300035171 | Bacteria | 1845 |
| 972 | Ga0373946_0073681 | 3300035171 | Bacteria | 1481 |
| 973 | Ga0373955_0001645 | 3300035172 | Bacteria | 9559 |
| 974 | Ga0373955_0014880 | 3300035172 | Bacteria | 3796 |
| 975 | Ga0373955_0033421 | 3300035172 | Bacteria | 2709 |
| 976 | Ga0373955_0087608 | 3300035172 | Bacteria | 1770 |
| 977 | Ga0373961_0029778 | 3300035241 | Bacteria | 1514 |
| 978 | Ga0373924_0017810 | 3300035410 | Bacteria | 2731 |
| 979 | Ga0373924_0106313 | 3300035410 | Bacteria | 1210 |
| 980 | Ga0373935_0000906 | 3300035692 | Bacteria | 16014 |
| 981 | Ga0373927_0002502 | 3300035695 | Bacteria | 13413 |
| 982 | Ga0373927_0023331 | 3300035695 | Bacteria | 4051 |
| 983 | Ga0373927_0073760 | 3300035695 | Bacteria | 2210 |
| 984 | Ga0373933_0001863 | 3300035724 | Bacteria | 12192 |
| 985 | Ga0373933_0003491 | 3300035724 | Bacteria | 8752 |
| 986 | Ga0373933_0129955 | 3300035724 | Bacteria | 1583 |
| 987 | Ga0373947_0006424 | 3300035725 | Bacteria | 6830 |
| 988 | Ga0373947_0044879 | 3300035725 | Bacteria | 2644 |
| 989 | Ga0373947_0193851 | 3300035725 | Bacteria | 1327 |
| 990 | Ga0373937_0000001 | 3300036401 | Bacteria | 478903 |
| 991 | Ga0373937_0002907 | 3300036401 | Bacteria | 14312 |
| 992 | Ga0373937_0006161 | 3300036401 | Bacteria | 10328 |
| 993 | Ga0373937_0075873 | 3300036401 | Bacteria | 3104 |
| 994 | Ga0373937_0339566 | 3300036401 | Bacteria | 1422 |
| 995 | Ga0373937_0517493 | 3300036401 | Bacteria | 1134 |
| 996 | Ga0373925_0002897 | 3300037068 | Bacteria | 13553 |
| 997 | Ga0373925_0016760 | 3300037068 | Bacteria | 5307 |
| 998 | Ga0373925_0313476 | 3300037068 | Bacteria | 1268 |
| 999 | Ga0395905_0201526 | 3300037471 | Bacteria | 1866 |
| 1000 | Ga0400487_55885 | 3300039110 | Bacteria | 37403 |
| 1001 | Ga0436365_1139438 | 3300039437 | Bacteria | 14911 |
| 1002 | Ga0436365_1884859 | 3300039437 | Bacteria | 3301 |
| 1003 | Ga0439453_0004367 | 3300041408 | Bacteria | 2099 |
| 1004 | Ga0439453_0007620 | 3300041408 | Bacteria | 1722 |
| 1005 | Ga0439431_0009100 | 3300041997 | Bacteria | 2239 |
| 1006 | Ga0439433_0018593 | 3300041999 | Bacteria | 1548 |
| 1007 | Ga0439441_005229 | 3300042001 | Bacteria | 2005 |
| 1008 | Ga0450894_000401 | 3300042131 | Bacteria | 7413 |
| 1009 | Ga0450898_003741 | 3300042134 | Bacteria | 2203 |
| 1010 | Ga0439446_0007852 | 3300042156 | Bacteria | 2815 |
| 1011 | Ga0439434_0027623 | 3300042435 | Bacteria | 1716 |
| 1012 | Ga0439434_0053512 | 3300042435 | Bacteria | 1254 |
| 1013 | Ga0439435_0010606 | 3300042436 | Bacteria | 2192 |
| 1014 | Ga0439435_0018526 | 3300042436 | Bacteria | 1773 |
| 1015 | Ga0439444_0004188 | 3300042437 | Bacteria | 2082 |
| 1016 | Ga0439464_0014996 | 3300042439 | Bacteria | 2089 |
| 1017 | Ga0439460_0021550 | 3300042461 | Bacteria | 1762 |
| 1018 | Ga0451577_0003196 | 3300042876 | Bacteria | 18409 |
| 1019 | Ga0451577_0005031 | 3300042876 | Bacteria | 13669 |
| 1020 | Ga0451577_0029633 | 3300042876 | Bacteria | 4947 |
| 1021 | Ga0451577_0049163 | 3300042876 | Bacteria | 3766 |
| 1022 | Ga0451577_0128653 | 3300042876 | Bacteria | 2271 |
| 1023 | Ga0451577_0210331 | 3300042876 | Bacteria | 1757 |
| 1024 | Ga0451577_0253283 | 3300042876 | Bacteria | 1594 |
| 1025 | Ga0453683_0004141 | 3300044673 | Bacteria | 10399 |
| 1026 | Ga0453683_0011579 | 3300044673 | Bacteria | 5810 |
| 1027 | Ga0453683_0012309 | 3300044673 | Bacteria | 5608 |
| 1028 | Ga0453683_0025434 | 3300044673 | Bacteria | 3761 |
| 1029 | Ga0453684_0018139 | 3300044712 | Bacteria | 10832 |
| 1030 | Ga0453684_0023641 | 3300044712 | Bacteria | 9032 |
| 1031 | Ga0453684_0048534 | 3300044712 | Bacteria | 5611 |
| 1032 | Ga0453684_0138370 | 3300044712 | Bacteria | 2912 |
| 1033 | Ga0451576_0007133 | 3300045051 | Bacteria | 13485 |
| 1034 | Ga0451576_0011820 | 3300045051 | Bacteria | 9882 |
| 1035 | Ga0451576_0013194 | 3300045051 | Bacteria | 9246 |
| 1036 | Ga0451576_0013267 | 3300045051 | Bacteria | 9220 |
| 1037 | Ga0451576_0013998 | 3300045051 | Bacteria | 8945 |
| 1038 | Ga0451576_0017863 | 3300045051 | Bacteria | 7792 |
| 1039 | Ga0451576_0063613 | 3300045051 | Bacteria | 3845 |
| 1040 | Ga0451576_0133886 | 3300045051 | Bacteria | 2584 |
| 1041 | Ga0451576_0166417 | 3300045051 | Bacteria | 2301 |
| 1042 | Ga0495592_0033147 | 3300046454 | Unclassified | 3897 |
| 1043 | Ga0495592_0037134 | 3300046454 | Bacteria | 3668 |
| 1044 | Ga0495592_0044739 | 3300046454 | Bacteria | 3306 |
| 1045 | Ga0495603_0021187 | 3300046455 | Bacteria | 3936 |
| 1046 | Ga0495629_0009367 | 3300046459 | Bacteria | 7162 |
| 1047 | Ga0495629_0131506 | 3300046459 | Bacteria | 1743 |
| 1048 | Ga0495638_0001740 | 3300046460 | Bacteria | 19123 |
| 1049 | Ga0495638_0047352 | 3300046460 | Bacteria | 2695 |
| 1050 | Ga0495651_0000059 | 3300046462 | Bacteria | 81986 |
| 1051 | Ga0495651_0001481 | 3300046462 | Bacteria | 18160 |
| 1052 | Ga0495651_0010905 | 3300046462 | Bacteria | 6991 |
| 1053 | Ga0495651_0045238 | 3300046462 | Bacteria | 3410 |
| 1054 | Ga0495653_0005508 | 3300046463 | Bacteria | 10313 |
| 1055 | Ga0495653_0018250 | 3300046463 | Bacteria | 5701 |
| 1056 | Ga0495653_0053917 | 3300046463 | Bacteria | 3074 |
| 1057 | Ga0495653_0060335 | 3300046463 | Bacteria | 2874 |
| 1058 | Ga0495653_0091792 | 3300046463 | Bacteria | 2219 |
| 1059 | Ga0495653_0159876 | 3300046463 | Bacteria | 1565 |
| 1060 | Ga0495580_0007354 | 3300046472 | Bacteria | 8856 |
| 1061 | Ga0495580_0017978 | 3300046472 | Bacteria | 5271 |
| 1062 | Ga0495580_0029073 | 3300046472 | Bacteria | 4013 |
| 1063 | Ga0495580_0075697 | 3300046472 | Bacteria | 2348 |
| 1064 | Ga0495582_0008789 | 3300046473 | Bacteria | 5570 |
| 1065 | Ga0495582_0009955 | 3300046473 | Bacteria | 5234 |
| 1066 | Ga0495582_0039499 | 3300046473 | Bacteria | 2598 |
| 1067 | Ga0495582_0044965 | 3300046473 | Bacteria | 2432 |
| 1068 | Ga0495639_0006368 | 3300046475 | Bacteria | 5074 |
| 1069 | Ga0495662_0070371 | 3300046476 | Bacteria | 1695 |
| 1070 | Ga0495664_0022141 | 3300046477 | Unclassified | 3680 |
| 1071 | Ga0495664_0048340 | 3300046477 | Bacteria | 2525 |
| 1072 | Ga0495664_0146681 | 3300046477 | Bacteria | 1431 |
| 1073 | Ga0495584_0074747 | 3300046491 | Bacteria | 1703 |
| 1074 | Ga0495584_0189663 | 3300046491 | Bacteria | 1045 |
| 1075 | Ga0495594_0013813 | 3300046499 | Bacteria | 4221 |
| 1076 | Ga0495594_0018400 | 3300046499 | Bacteria | 3700 |
| 1077 | Ga0495594_0020639 | 3300046499 | Bacteria | 3510 |
| 1078 | Ga0495608_0006754 | 3300046511 | Bacteria | 8135 |
| 1079 | Ga0495608_0011876 | 3300046511 | Bacteria | 6059 |
| 1080 | Ga0495608_0023053 | 3300046511 | Bacteria | 4268 |
| 1081 | Ga0495608_0126526 | 3300046511 | Bacteria | 1636 |
| 1082 | Ga0495618_0032478 | 3300046514 | Bacteria | 3269 |
| 1083 | Ga0495618_0050503 | 3300046514 | Bacteria | 2627 |
| 1084 | Ga0495618_0145286 | 3300046514 | Bacteria | 1516 |
| 1085 | Ga0495618_0172507 | 3300046514 | Bacteria | 1376 |
| 1086 | Ga0495628_0000167 | 3300046516 | Bacteria | 57173 |
| 1087 | Ga0495628_0006133 | 3300046516 | Bacteria | 10513 |
| 1088 | Ga0495628_0023006 | 3300046516 | Bacteria | 5116 |
| 1089 | Ga0495628_0026102 | 3300046516 | Bacteria | 4769 |
| 1090 | Ga0495628_0034713 | 3300046516 | Bacteria | 4056 |
| 1091 | Ga0495628_0174473 | 3300046516 | Bacteria | 1629 |
| 1092 | Ga0495630_0012486 | 3300046517 | Bacteria | 6168 |
| 1093 | Ga0495630_0039810 | 3300046517 | Bacteria | 3513 |
| 1094 | Ga0495630_0060214 | 3300046517 | Bacteria | 2849 |
| 1095 | Ga0495630_0097031 | 3300046517 | Bacteria | 2229 |
| 1096 | Ga0495630_0239205 | 3300046517 | Bacteria | 1387 |
| 1097 | Ga0495643_0039860 | 3300046522 | Bacteria | 2567 |
| 1098 | Ga0495663_0012376 | 3300046525 | Bacteria | 2377 |
| 1099 | Ga0495666_0015665 | 3300046526 | Bacteria | 3776 |
| 1100 | Ga0495666_0034741 | 3300046526 | Bacteria | 2459 |
| 1101 | Ga0495666_0121370 | 3300046526 | Bacteria | 1224 |
| 1102 | Ga0495652_0004609 | 3300046529 | Bacteria | 13141 |
| 1103 | Ga0495652_0022463 | 3300046529 | Bacteria | 5598 |
| 1104 | Ga0495652_0028614 | 3300046529 | Unclassified | 4901 |
| 1105 | Ga0495652_0229127 | 3300046529 | Bacteria | 1391 |
| 1106 | Ga0495665_0002242 | 3300046531 | Bacteria | 10469 |
| 1107 | Ga0495640_0013332 | 3300046533 | Bacteria | 6247 |
| 1108 | Ga0495640_0137294 | 3300046533 | Bacteria | 1578 |
| 1109 | Ga0495640_0155162 | 3300046533 | Bacteria | 1469 |
| 1110 | Ga0495586_0015110 | 3300046535 | Bacteria | 4107 |
| 1111 | Ga0495586_0091128 | 3300046535 | Bacteria | 1684 |
| 1112 | Ga0495587_0000433 | 3300046536 | Bacteria | 29356 |
| 1113 | Ga0495587_0002851 | 3300046536 | Bacteria | 11583 |
| 1114 | Ga0495587_0003324 | 3300046536 | Bacteria | 10734 |
| 1115 | Ga0495587_0009418 | 3300046536 | Bacteria | 6259 |
| 1116 | Ga0495587_0017789 | 3300046536 | Bacteria | 4409 |
| 1117 | Ga0495587_0126171 | 3300046536 | Bacteria | 1464 |
| 1118 | Ga0495587_0200610 | 3300046536 | Bacteria | 1128 |
| 1119 | Ga0495598_0026235 | 3300046537 | Bacteria | 1596 |
| 1120 | Ga0495621_0039227 | 3300046539 | Bacteria | 1656 |
| 1121 | Ga0495645_0001627 | 3300046543 | Bacteria | 15209 |
| 1122 | Ga0495645_0008122 | 3300046543 | Bacteria | 7317 |
| 1123 | Ga0495645_0012788 | 3300046543 | Bacteria | 5922 |
| 1124 | Ga0495645_0067573 | 3300046543 | Bacteria | 2581 |
| 1125 | Ga0495667_0015159 | 3300046559 | Bacteria | 5203 |
| 1126 | Ga0495667_0026551 | 3300046559 | Bacteria | 3903 |
| 1127 | Ga0495667_0070065 | 3300046559 | Bacteria | 2288 |
| 1128 | Ga0495634_0008535 | 3300046642 | Bacteria | 7615 |
| 1129 | Ga0495634_0088712 | 3300046642 | Bacteria | 2011 |
| 1130 | Ga0495634_0149287 | 3300046642 | Bacteria | 1479 |
| 1131 | Ga0495635_0019091 | 3300046663 | Bacteria | 4786 |
| 1132 | Ga0495588_0007178 | 3300046674 | Bacteria | 5054 |
| 1133 | Ga0495588_0139565 | 3300046674 | Bacteria | 1280 |
| 1134 | Ga0495657_0024248 | 3300046675 | Bacteria | 4323 |
| 1135 | Ga0495657_0031177 | 3300046675 | Bacteria | 3728 |
| 1136 | Ga0495657_0058349 | 3300046675 | Bacteria | 2563 |
| 1137 | Ga0495657_0137593 | 3300046675 | Bacteria | 1525 |
| 1138 | Ga0495623_0001017 | 3300046679 | Bacteria | 18952 |
| 1139 | Ga0495623_0064206 | 3300046679 | Bacteria | 2298 |
| 1140 | Ga0495646_0008681 | 3300046680 | Bacteria | 6460 |
| 1141 | Ga0495647_0017713 | 3300046681 | Bacteria | 2524 |
| 1142 | Ga0495658_0016100 | 3300046683 | Bacteria | 3847 |
| 1143 | Ga0495658_0020937 | 3300046683 | Bacteria | 3441 |
| 1144 | Ga0495658_0155381 | 3300046683 | Bacteria | 1408 |
| 1145 | Ga0495669_0001134 | 3300046684 | Bacteria | 11020 |
| 1146 | Ga0495613_0006297 | 3300046689 | Bacteria | 8877 |
| 1147 | Ga0495613_0020315 | 3300046689 | Bacteria | 4952 |
| 1148 | Ga0495613_0143099 | 3300046689 | Bacteria | 1707 |
| 1149 | Ga0495624_0032778 | 3300046690 | Bacteria | 3366 |
| 1150 | Ga0495624_0065425 | 3300046690 | Bacteria | 2271 |
| 1151 | Ga0495670_0057819 | 3300046691 | Bacteria | 1947 |
| 1152 | Ga0495670_0121659 | 3300046691 | Bacteria | 1356 |
| 1153 | Ga0495600_0001754 | 3300046809 | Bacteria | 12130 |
| 1154 | Ga0495581_0167760 | 3300047315 | Bacteria | 1284 |
| 1155 | Ga0495604_0000934 | 3300047317 | Bacteria | 24332 |
| 1156 | Ga0495604_0006656 | 3300047317 | Bacteria | 9155 |
| 1157 | Ga0495604_0010097 | 3300047317 | Bacteria | 7478 |
| 1158 | Ga0495604_0045587 | 3300047317 | Bacteria | 3421 |
| 1159 | Ga0495604_0197137 | 3300047317 | Bacteria | 1399 |
| 1160 | Ga0495636_0010751 | 3300047318 | Bacteria | 3619 |
| 1161 | Ga0495674_0010778 | 3300047319 | Bacteria | 8648 |
| 1162 | Ga0495674_0015359 | 3300047319 | Bacteria | 7162 |
| 1163 | Ga0495674_0034699 | 3300047319 | Bacteria | 4558 |
| 1164 | Ga0495674_0141469 | 3300047319 | Bacteria | 2022 |
| 1165 | Ga0495676_0005978 | 3300047321 | Bacteria | 11182 |
| 1166 | Ga0495676_0061862 | 3300047321 | Bacteria | 2926 |
| 1167 | Ga0495680_0003912 | 3300047322 | Bacteria | 14410 |
| 1168 | Ga0495680_0007293 | 3300047322 | Bacteria | 10176 |
| 1169 | Ga0495680_0039676 | 3300047322 | Bacteria | 3754 |
| 1170 | Ga0495680_0058882 | 3300047322 | Bacteria | 2967 |
| 1171 | Ga0495675_0000289 | 3300047444 | Bacteria | 36410 |
| 1172 | Ga0495675_0003236 | 3300047444 | Bacteria | 9789 |
| 1173 | Ga0495675_0035585 | 3300047444 | Bacteria | 3179 |
| 1174 | Ga0495675_0067611 | 3300047444 | Bacteria | 2258 |
| 1175 | Ga0495679_022289 | 3300047446 | Bacteria | 2170 |
| 1176 | Ga0495684_0000504 | 3300047471 | Bacteria | 31616 |
| 1177 | Ga0495684_0006592 | 3300047471 | Bacteria | 9007 |
| 1178 | Ga0495684_0008127 | 3300047471 | Bacteria | 8114 |
| 1179 | Ga0495684_0137297 | 3300047471 | Bacteria | 1835 |
| 1180 | Ga0495684_0249058 | 3300047471 | Bacteria | 1293 |
| 1181 | Ga0495593_0008338 | 3300047673 | Bacteria | 6030 |
| 1182 | Ga0495593_0103662 | 3300047673 | Bacteria | 1457 |
| 1183 | Ga0495593_0138100 | 3300047673 | Bacteria | 1235 |
| 1184 | Ga0495602_0000056 | 3300048088 | Bacteria | 109741 |
| 1185 | Ga0495602_0004170 | 3300048088 | Bacteria | 15040 |
| 1186 | Ga0495602_0011475 | 3300048088 | Bacteria | 9158 |
| 1187 | Ga0495602_0015880 | 3300048088 | Bacteria | 7585 |
| 1188 | Ga0495602_0054834 | 3300048088 | Bacteria | 3516 |
| 1189 | Ga0495602_0143378 | 3300048088 | Bacteria | 1888 |
| 1190 | Ga0495614_0020037 | 3300048089 | Bacteria | 2893 |
| 1191 | Ga0495614_0021255 | 3300048089 | Bacteria | 2803 |
| 1192 | Ga0496100_0012885 | 3300048903 | Bacteria | 4807 |
| 1193 | Ga0496100_0043019 | 3300048903 | Bacteria | 2887 |
| 1194 | Ga0496100_0049289 | 3300048903 | Bacteria | 2723 |
| 1195 | Ga0496100_0098137 | 3300048903 | Bacteria | 2013 |
| 1196 | Ga0496101_0006912 | 3300048904 | Bacteria | 7325 |
| 1197 | Ga0496101_0087788 | 3300048904 | Bacteria | 2309 |
| 1198 | Ga0496102_0010134 | 3300048905 | Bacteria | 8105 |
| 1199 | Ga0496102_0012507 | 3300048905 | Bacteria | 7349 |
| 1200 | Ga0496102_0021614 | 3300048905 | Bacteria | 5692 |
| 1201 | Ga0496103_0029718 | 3300048906 | Bacteria | 3322 |
| 1202 | Ga0496104_0000157 | 3300048907 | Bacteria | 61755 |
| 1203 | Ga0496104_0097552 | 3300048907 | Bacteria | 2813 |
| 1204 | Ga0496104_0115609 | 3300048907 | Bacteria | 2574 |
| 1205 | Ga0496104_0130858 | 3300048907 | Bacteria | 2410 |
| 1206 | Ga0496105_0083326 | 3300048908 | Bacteria | 2641 |
| 1207 | Ga0496105_0100535 | 3300048908 | Bacteria | 2388 |
| 1208 | Ga0496105_0129031 | 3300048908 | Bacteria | 2085 |
| 1209 | Ga0496106_0015998 | 3300048909 | Bacteria | 5548 |
| 1210 | Ga0496106_0028722 | 3300048909 | Bacteria | 4143 |
| 1211 | Ga0496106_0046663 | 3300048909 | Bacteria | 3258 |
| 1212 | Ga0496106_0222372 | 3300048909 | Bacteria | 1506 |
| 1213 | Ga0496107_0038246 | 3300048910 | Bacteria | 3444 |
| 1214 | Ga0496107_0045403 | 3300048910 | Bacteria | 3160 |
| 1215 | Ga0496108_0003499 | 3300048911 | Bacteria | 12586 |
| 1216 | Ga0496108_0148824 | 3300048911 | Bacteria | 2020 |
| 1217 | Ga0496108_0421290 | 3300048911 | Bacteria | 1166 |
| 1218 | Ga0496109_0009476 | 3300048912 | Bacteria | 8302 |
| 1219 | Ga0496109_0047093 | 3300048912 | Bacteria | 3919 |
| 1220 | Ga0496110_0000063 | 3300048913 | Bacteria | 53033 |
| 1221 | Ga0496110_0377941 | 3300048913 | Bacteria | 1291 |
| 1222 | Ga0496111_0004348 | 3300048914 | Bacteria | 8942 |
| 1223 | Ga0496111_0073612 | 3300048914 | Bacteria | 2488 |
| 1224 | Ga0496112_0000245 | 3300048915 | Bacteria | 34580 |
| 1225 | Ga0496112_0024556 | 3300048915 | Bacteria | 5774 |
| 1226 | Ga0496112_0031622 | 3300048915 | Bacteria | 5135 |
| 1227 | Ga0496112_0045209 | 3300048915 | Bacteria | 4316 |
| 1228 | Ga0496112_0060475 | 3300048915 | Bacteria | 3734 |
| 1229 | Ga0496112_0131460 | 3300048915 | Bacteria | 2474 |
| 1230 | Ga0496113_0009126 | 3300048916 | Bacteria | 6498 |
| 1231 | Ga0496113_0245604 | 3300048916 | Bacteria | 1428 |
| 1232 | Ga0496113_0264357 | 3300048916 | Bacteria | 1375 |
| 1233 | Ga0496114_0000005 | 3300048917 | Bacteria | 564262 |
| 1234 | Ga0496114_0000371 | 3300048917 | Bacteria | 33092 |
| 1235 | Ga0496114_0017463 | 3300048917 | Bacteria | 5790 |
| 1236 | Ga0496114_0048633 | 3300048917 | Bacteria | 3528 |
| 1237 | Ga0496114_0079649 | 3300048917 | Bacteria | 2766 |
| 1238 | Ga0496115_0017958 | 3300048918 | Bacteria | 5420 |
| 1239 | Ga0496115_0038548 | 3300048918 | Bacteria | 3792 |
| 1240 | Ga0496115_0050776 | 3300048918 | Bacteria | 3324 |
| 1241 | Ga0501031_0081626 | 3300049568 | Bacteria | 2108 |
| 1242 | Ga0501032_0063932 | 3300049569 | Bacteria | 2463 |
| 1243 | Ga0501033_0001797 | 3300049570 | Bacteria | 18718 |
| 1244 | Ga0501033_0108440 | 3300049570 | Bacteria | 2022 |
| 1245 | Ga0501034_0014607 | 3300049571 | Bacteria | 8085 |
| 1246 | Ga0501034_0015307 | 3300049571 | Bacteria | 7884 |
| 1247 | Ga0501034_0029877 | 3300049571 | Bacteria | 5540 |
| 1248 | Ga0501034_0083279 | 3300049571 | Bacteria | 3200 |
| 1249 | Ga0501034_0087907 | 3300049571 | Bacteria | 3106 |
| 1250 | Ga0501036_0005695 | 3300049572 | Bacteria | 10106 |
| 1251 | Ga0501036_0014261 | 3300049572 | Bacteria | 6613 |
| 1252 | Ga0501036_0020670 | 3300049572 | Bacteria | 5530 |
| 1253 | Ga0501036_0023391 | 3300049572 | Bacteria | 5206 |
| 1254 | Ga0501036_0097060 | 3300049572 | Bacteria | 2491 |
| 1255 | Ga0501036_0185089 | 3300049572 | Bacteria | 1753 |
| 1256 | Ga0501036_0218816 | 3300049572 | Bacteria | 1599 |
| 1257 | Ga0501036_0285531 | 3300049572 | Bacteria | 1381 |
| 1258 | Ga0501037_0001960 | 3300049573 | Bacteria | 14869 |
| 1259 | Ga0501037_0021899 | 3300049573 | Bacteria | 4731 |
| 1260 | Ga0501037_0054273 | 3300049573 | Bacteria | 2930 |
| 1261 | Ga0501038_0043872 | 3300049574 | Bacteria | 3887 |
| 1262 | Ga0501038_0075827 | 3300049574 | Bacteria | 2842 |
| 1263 | Ga0501038_0110687 | 3300049574 | Bacteria | 2275 |
| 1264 | Ga0501038_0117291 | 3300049574 | Bacteria | 2199 |
| 1265 | Ga0501039_0003641 | 3300049575 | Bacteria | 11550 |
| 1266 | Ga0501039_0024578 | 3300049575 | Bacteria | 4628 |
| 1267 | Ga0501040_0009429 | 3300049576 | Bacteria | 6364 |
| 1268 | Ga0501040_0047419 | 3300049576 | Bacteria | 2934 |
| 1269 | Ga0501040_0059430 | 3300049576 | Bacteria | 2626 |
| 1270 | Ga0501040_0198859 | 3300049576 | Bacteria | 1423 |
| 1271 | Ga0501041_0010123 | 3300049577 | Bacteria | 5557 |
| 1272 | Ga0501041_0018828 | 3300049577 | Bacteria | 4112 |
| 1273 | Ga0501041_0133848 | 3300049577 | Bacteria | 1544 |
| 1274 | Ga0501042_0025593 | 3300049578 | Bacteria | 4146 |
| 1275 | Ga0501042_0028146 | 3300049578 | Bacteria | 3956 |
| 1276 | Ga0501042_0034060 | 3300049578 | Bacteria | 3612 |
| 1277 | Ga0501042_0038051 | 3300049578 | Bacteria | 3416 |
| 1278 | Ga0501042_0058854 | 3300049578 | Bacteria | 2743 |
| 1279 | Ga0501042_0063708 | 3300049578 | Bacteria | 2635 |
| 1280 | Ga0501042_0084812 | 3300049578 | Bacteria | 2272 |
| 1281 | Ga0501042_0181805 | 3300049578 | Bacteria | 1517 |
| 1282 | Ga0501042_0195047 | 3300049578 | Bacteria | 1460 |
| 1283 | Ga0501042_0224376 | 3300049578 | Bacteria | 1355 |
| 1284 | Ga0501043_0013132 | 3300049579 | Bacteria | 6476 |
| 1285 | Ga0501043_0118058 | 3300049579 | Bacteria | 2081 |
| 1286 | Ga0501043_0146656 | 3300049579 | Bacteria | 1848 |
| 1287 | Ga0501046_0014479 | 3300049580 | Bacteria | 6654 |
| 1288 | Ga0501046_0014990 | 3300049580 | Bacteria | 6520 |
| 1289 | Ga0501046_0046634 | 3300049580 | Bacteria | 3438 |
| 1290 | Ga0501046_0368956 | 3300049580 | Bacteria | 1040 |
| 1291 | Ga0501047_0006564 | 3300049581 | Bacteria | 10952 |
| 1292 | Ga0501047_0088501 | 3300049581 | Bacteria | 2973 |
| 1293 | Ga0501047_0139369 | 3300049581 | Bacteria | 2304 |
| 1294 | Ga0501047_0147499 | 3300049581 | Bacteria | 2229 |
| 1295 | Ga0501047_0250265 | 3300049581 | Bacteria | 1620 |
| 1296 | Ga0501048_0004103 | 3300049582 | Bacteria | 11093 |
| 1297 | Ga0501048_0008075 | 3300049582 | Bacteria | 7966 |
| 1298 | Ga0501048_0033095 | 3300049582 | Bacteria | 3736 |
| 1299 | Ga0501048_0037754 | 3300049582 | Bacteria | 3469 |
| 1300 | Ga0501048_0082182 | 3300049582 | Bacteria | 2272 |
| 1301 | Ga0501048_0140527 | 3300049582 | Bacteria | 1707 |
| 1302 | Ga0501067_0001385 | 3300049583 | Bacteria | 13146 |
| 1303 | Ga0501068_0012541 | 3300049584 | Bacteria | 4810 |
| 1304 | Ga0501068_0015357 | 3300049584 | Bacteria | 4395 |
| 1305 | Ga0501069_0022414 | 3300049585 | Bacteria | 3435 |
| 1306 | Ga0501069_0027751 | 3300049585 | Bacteria | 3103 |
| 1307 | Ga0501069_0147209 | 3300049585 | Bacteria | 1352 |
| 1308 | Ga0501070_0005646 | 3300049586 | Bacteria | 10669 |
| 1309 | Ga0501070_0022268 | 3300049586 | Bacteria | 5309 |
| 1310 | Ga0501071_0019087 | 3300049587 | Bacteria | 4757 |
| 1311 | Ga0501071_0019377 | 3300049587 | Bacteria | 4721 |
| 1312 | Ga0501071_0024253 | 3300049587 | Bacteria | 4241 |
| 1313 | Ga0501071_0136639 | 3300049587 | Bacteria | 1824 |
| 1314 | Ga0501071_0196801 | 3300049587 | Bacteria | 1513 |
| 1315 | Ga0501071_0286187 | 3300049587 | Bacteria | 1248 |
| 1316 | Ga0501072_0015475 | 3300049588 | Bacteria | 5848 |
| 1317 | Ga0501072_0026441 | 3300049588 | Bacteria | 4525 |
| 1318 | Ga0501072_0052203 | 3300049588 | Bacteria | 3219 |
| 1319 | Ga0501072_0108375 | 3300049588 | Bacteria | 2210 |
| 1320 | Ga0501072_0110579 | 3300049588 | Bacteria | 2187 |
| 1321 | Ga0501072_0233175 | 3300049588 | Bacteria | 1466 |
| 1322 | Ga0501072_0357101 | 3300049588 | Bacteria | 1160 |
| 1323 | Ga0501073_0003168 | 3300049589 | Bacteria | 12344 |
| 1324 | Ga0501073_0008693 | 3300049589 | Bacteria | 7520 |
| 1325 | Ga0501073_0039425 | 3300049589 | Bacteria | 3347 |
| 1326 | Ga0501073_0062776 | 3300049589 | Bacteria | 2591 |
| 1327 | Ga0501074_0003931 | 3300049590 | Bacteria | 10589 |
| 1328 | Ga0501074_0044209 | 3300049590 | Bacteria | 3225 |
| 1329 | Ga0501074_0055892 | 3300049590 | Bacteria | 2844 |
| 1330 | Ga0501074_0079253 | 3300049590 | Bacteria | 2357 |
| 1331 | Ga0501074_0098437 | 3300049590 | Bacteria | 2093 |
| 1332 | Ga0501074_0143634 | 3300049590 | Bacteria | 1707 |
| 1333 | Ga0501075_0001850 | 3300049591 | Bacteria | 13973 |
| 1334 | Ga0501075_0005672 | 3300049591 | Bacteria | 8543 |
| 1335 | Ga0501075_0014357 | 3300049591 | Bacteria | 5675 |
| 1336 | Ga0501075_0034386 | 3300049591 | Bacteria | 3774 |
| 1337 | Ga0501075_0078796 | 3300049591 | Bacteria | 2494 |
| 1338 | Ga0501075_0096760 | 3300049591 | Bacteria | 2240 |
| 1339 | Ga0501075_0128859 | 3300049591 | Bacteria | 1927 |
| 1340 | Ga0501075_0203219 | 3300049591 | Bacteria | 1511 |
| 1341 | Ga0501076_0000633 | 3300049592 | Bacteria | 22451 |
| 1342 | Ga0501076_0005874 | 3300049592 | Bacteria | 8852 |
| 1343 | Ga0501076_0041328 | 3300049592 | Bacteria | 3627 |
| 1344 | Ga0501076_0050221 | 3300049592 | Bacteria | 3299 |
| 1345 | Ga0501076_0072157 | 3300049592 | Bacteria | 2763 |
| 1346 | Ga0501076_0091921 | 3300049592 | Bacteria | 2441 |
| 1347 | Ga0501076_0143057 | 3300049592 | Bacteria | 1944 |
| 1348 | Ga0501076_0145643 | 3300049592 | Bacteria | 1926 |
| 1349 | Ga0501076_0214337 | 3300049592 | Bacteria | 1574 |
| 1350 | Ga0501076_0286645 | 3300049592 | Bacteria | 1349 |
| 1351 | Ga0501076_0303554 | 3300049592 | Bacteria | 1309 |
| 1352 | Ga0501077_0021021 | 3300049593 | Bacteria | 4129 |
| 1353 | Ga0501249_011801 | 3300049679 | Bacteria | 1840 |
| 1354 | Ga0501079_0009681 | 3300049741 | Bacteria | 7306 |
| 1355 | Ga0501079_0015604 | 3300049741 | Bacteria | 5800 |
| 1356 | Ga0501079_0017966 | 3300049741 | Bacteria | 5399 |
| 1357 | Ga0501079_0021979 | 3300049741 | Bacteria | 4887 |
| 1358 | Ga0501079_0136919 | 3300049741 | Bacteria | 1907 |
| 1359 | Ga0501079_0202661 | 3300049741 | Bacteria | 1550 |
| 1360 | Ga0501079_0211349 | 3300049741 | Bacteria | 1515 |
| 1361 | Ga0501079_0297257 | 3300049741 | Bacteria | 1263 |
| 1362 | Ga0501080_0001466 | 3300049742 | Bacteria | 19854 |
| 1363 | Ga0501080_0046033 | 3300049742 | Bacteria | 4063 |
| 1364 | Ga0501080_0128544 | 3300049742 | Bacteria | 2346 |
| 1365 | Ga0501080_0141101 | 3300049742 | Bacteria | 2227 |
| 1366 | Ga0501080_0209310 | 3300049742 | Bacteria | 1787 |
| 1367 | Ga0501080_0249396 | 3300049742 | Bacteria | 1619 |
| 1368 | Ga0501080_0304333 | 3300049742 | Bacteria | 1445 |
| 1369 | Ga0501081_0007223 | 3300049743 | Bacteria | 7222 |
| 1370 | Ga0501081_0018947 | 3300049743 | Bacteria | 4575 |
| 1371 | Ga0501081_0040573 | 3300049743 | Bacteria | 3187 |
| 1372 | Ga0501081_0073426 | 3300049743 | Bacteria | 2386 |
| 1373 | Ga0501081_0083342 | 3300049743 | Bacteria | 2241 |
| 1374 | Ga0501081_0085253 | 3300049743 | Bacteria | 2217 |
| 1375 | Ga0501081_0085428 | 3300049743 | Bacteria | 2215 |
| 1376 | Ga0501081_0155177 | 3300049743 | Bacteria | 1647 |
| 1377 | Ga0501081_0184799 | 3300049743 | Bacteria | 1508 |
| 1378 | Ga0501083_0011031 | 3300049744 | Bacteria | 6349 |
| 1379 | Ga0501083_0026727 | 3300049744 | Bacteria | 3987 |
| 1380 | Ga0501083_0028261 | 3300049744 | Bacteria | 3866 |
| 1381 | Ga0501035_0027160 | 3300049822 | Bacteria | 5233 |
| 1382 | Ga0501035_0098220 | 3300049822 | Bacteria | 2571 |
| 1383 | Ga0501044_0009040 | 3300049823 | Bacteria | 10890 |
| 1384 | Ga0501044_0063277 | 3300049823 | Bacteria | 3780 |
| 1385 | Ga0501044_0092305 | 3300049823 | Bacteria | 3053 |
| 1386 | Ga0501044_0105112 | 3300049823 | Bacteria | 2836 |
| 1387 | Ga0501045_0006147 | 3300049824 | Bacteria | 8319 |
| 1388 | Ga0501045_0008164 | 3300049824 | Bacteria | 7293 |
| 1389 | Ga0501045_0015928 | 3300049824 | Bacteria | 5333 |
| 1390 | Ga0501045_0018451 | 3300049824 | Bacteria | 4963 |
| 1391 | Ga0501045_0021060 | 3300049824 | Bacteria | 4661 |
| 1392 | Ga0501045_0069439 | 3300049824 | Bacteria | 2590 |
| 1393 | Ga0501045_0095660 | 3300049824 | Bacteria | 2197 |
| 1394 | nmdc:mga00v17_132837_c1 | 3300050491 | Bacteria | 1592 |
| 1395 | nmdc:mga0k408_24845_c1 | 3300050493 | Bacteria | 3389 |
| 1396 | nmdc:mga0k408_25943_c1 | 3300050493 | Bacteria | 3321 |
| 1397 | nmdc:mga0k408_70841_c1 | 3300050493 | Bacteria | 2034 |
| 1398 | nmdc:mga06z11_85054_c1 | 3300050494 | Bacteria | 1706 |
| 1399 | nmdc:mga05p37_11748_c1 | 3300050507 | Bacteria | 10439 |
| 1400 | nmdc:mga05p37_13533_c1 | 3300050507 | Bacteria | 9781 |
| 1401 | nmdc:mga05p37_167522_c1 | 3300050507 | Bacteria | 2681 |
| 1402 | nmdc:mga05p37_18779_c1 | 3300050507 | Bacteria | 8355 |
| 1403 | nmdc:mga05p37_22849_c1 | 3300050507 | Bacteria | 7584 |
| 1404 | nmdc:mga05p37_2888_c1 | 3300050507 | Bacteria | 19926 |
| 1405 | nmdc:mga05p37_29_c1 | 3300050507 | Bacteria | 114400 |
| 1406 | nmdc:mga05p37_351913_c1 | 3300050507 | Bacteria | 1734 |
| 1407 | nmdc:mga05p37_357395_c1 | 3300050507 | Bacteria | 1718 |
| 1408 | nmdc:mga05p37_368307_c1 | 3300050507 | Unclassified | 1687 |
| 1409 | nmdc:mga05p37_39052_c1 | 3300050507 | Bacteria | 5824 |
| 1410 | nmdc:mga05p37_39487_c2 | 3300050507 | Bacteria | 4017 |
| 1411 | nmdc:mga05p37_39668_c1 | 3300050507 | Bacteria | 5782 |
| 1412 | nmdc:mga05p37_416935_c1 | 3300050507 | Bacteria | 1564 |
| 1413 | nmdc:mga05p37_420241_c1 | 3300050507 | Bacteria | 1556 |
| 1414 | nmdc:mga05p37_56321_c1 | 3300050507 | Bacteria | 4840 |
| 1415 | nmdc:mga05p37_569_c2 | 3300050507 | Bacteria | 24307 |
| 1416 | nmdc:mga05p37_610996_c1 | 3300050507 | Bacteria | 1229 |
| 1417 | nmdc:mga05p37_73587_c1 | 3300050507 | Bacteria | 4205 |
| 1418 | nmdc:mga05p37_90897_c1 | 3300050507 | Bacteria | 3762 |
| 1419 | nmdc:mga09592_10035_c1 | 3300050508 | Bacteria | 7699 |
| 1420 | nmdc:mga09592_12714_c1 | 3300050508 | Bacteria | 6861 |
| 1421 | nmdc:mga09592_14921_c1 | 3300050508 | Bacteria | 6346 |
| 1422 | nmdc:mga09592_15438_c1 | 3300050508 | Bacteria | 6240 |
| 1423 | nmdc:mga09592_1848_c1 | 3300050508 | Bacteria | 17028 |
| 1424 | nmdc:mga09592_20949_c1 | 3300050508 | Bacteria | 5383 |
| 1425 | nmdc:mga09592_25857_c1 | 3300050508 | Bacteria | 4861 |
| 1426 | nmdc:mga09592_33010_c1 | 3300050508 | Bacteria | 4318 |
| 1427 | nmdc:mga0qj67_118605_c2 | 3300050509 | Bacteria | 1822 |
| 1428 | nmdc:mga0qj67_122428_c1 | 3300050509 | Bacteria | 2104 |
| 1429 | nmdc:mga0qj67_171285_c1 | 3300050509 | Bacteria | 1763 |
| 1430 | nmdc:mga0qj67_21098_c1 | 3300050509 | Bacteria | 4995 |
| 1431 | nmdc:mga0qj67_234549_c1 | 3300050509 | Bacteria | 1489 |
| 1432 | nmdc:mga0qj67_32771_c1 | 3300050509 | Bacteria | 4053 |
| 1433 | nmdc:mga0qj67_397745_c1 | 3300050509 | Bacteria | 1112 |
| 1434 | nmdc:mga0qj67_41245_c1 | 3300050509 | Bacteria | 3630 |
| 1435 | nmdc:mga0qj67_7069_c1 | 3300050509 | Bacteria | 8281 |
| 1436 | nmdc:mga0qj67_88608_c1 | 3300050509 | Bacteria | 2484 |
| 1437 | nmdc:mga06r32_101775_c1 | 3300050510 | Bacteria | 2820 |
| 1438 | nmdc:mga06r32_107864_c1 | 3300050510 | Bacteria | 2737 |
| 1439 | nmdc:mga06r32_23263_c1 | 3300050510 | Bacteria | 5731 |
| 1440 | nmdc:mga06r32_310264_c1 | 3300050510 | Bacteria | 1563 |
| 1441 | nmdc:mga06r32_33345_c1 | 3300050510 | Bacteria | 4850 |
| 1442 | nmdc:mga06r32_34703_c1 | 3300050510 | Bacteria | 4758 |
| 1443 | nmdc:mga06r32_46528_c1 | 3300050510 | Bacteria | 4140 |
| 1444 | nmdc:mga06r32_58764_c1 | 3300050510 | Bacteria | 3696 |
| 1445 | nmdc:mga06r32_82552_c1 | 3300050510 | Bacteria | 3131 |
| 1446 | nmdc:mga08y16_120436_c1 | 3300050511 | Bacteria | 2731 |
| 1447 | nmdc:mga08y16_148914_c1 | 3300050511 | Bacteria | 2433 |
| 1448 | nmdc:mga08y16_154608_c1 | 3300050511 | Bacteria | 2384 |
| 1449 | nmdc:mga08y16_158977_c1 | 3300050511 | Bacteria | 2348 |
| 1450 | nmdc:mga08y16_164841_c1 | 3300050511 | Bacteria | 2302 |
| 1451 | nmdc:mga08y16_173829_c1 | 3300050511 | Bacteria | 2237 |
| 1452 | nmdc:mga08y16_178964_c1 | 3300050511 | Bacteria | 2202 |
| 1453 | nmdc:mga08y16_17_c1 | 3300050511 | Bacteria | 382598 |
| 1454 | nmdc:mga08y16_182208_c1 | 3300050511 | Bacteria | 2181 |
| 1455 | nmdc:mga08y16_212203_c1 | 3300050511 | Bacteria | 2005 |
| 1456 | nmdc:mga08y16_242780_c1 | 3300050511 | Bacteria | 1862 |
| 1457 | nmdc:mga08y16_252016_c1 | 3300050511 | Bacteria | 1824 |
| 1458 | nmdc:mga08y16_338041_c1 | 3300050511 | Bacteria | 1548 |
| 1459 | nmdc:mga08y16_4308_c1 | 3300050511 | Bacteria | 14860 |
| 1460 | nmdc:mga08y16_46776_c1 | 3300050511 | Bacteria | 4529 |
| 1461 | nmdc:mga08y16_513071_c1 | 3300050511 | Bacteria | 1217 |
| 1462 | nmdc:mga08y16_54011_c1 | 3300050511 | Bacteria | 4199 |
| 1463 | nmdc:mga08y16_57474_c1 | 3300050511 | Bacteria | 4065 |
| 1464 | nmdc:mga08y16_65734_c1 | 3300050511 | Bacteria | 3785 |
| 1465 | nmdc:mga08y16_6614_c1 | 3300050511 | Bacteria | 12156 |
| 1466 | nmdc:mga08y16_82537_c1 | 3300050511 | Bacteria | 3351 |
| 1467 | nmdc:mga0n895_1110_c1 | 3300050512 | Bacteria | 19640 |
| 1468 | nmdc:mga0n895_116876_c1 | 3300050512 | Bacteria | 2686 |
| 1469 | nmdc:mga0n895_123625_c1 | 3300050512 | Bacteria | 2610 |
| 1470 | nmdc:mga0n895_123811_c1 | 3300050512 | Bacteria | 2608 |
| 1471 | nmdc:mga0n895_135327_c1 | 3300050512 | Bacteria | 2491 |
| 1472 | nmdc:mga0n895_13860_c1 | 3300050512 | Bacteria | 7297 |
| 1473 | nmdc:mga0n895_145362_c1 | 3300050512 | Bacteria | 2401 |
| 1474 | nmdc:mga0n895_148879_c1 | 3300050512 | Bacteria | 2370 |
| 1475 | nmdc:mga0n895_209668_c1 | 3300050512 | Bacteria | 1979 |
| 1476 | nmdc:mga0n895_287087_c1 | 3300050512 | Bacteria | 1668 |
| 1477 | nmdc:mga0n895_36785_c1 | 3300050512 | Bacteria | 4730 |
| 1478 | nmdc:mga0n895_69859_c1 | 3300050512 | Bacteria | 3480 |
| 1479 | nmdc:mga0n895_79259_c1 | 3300050512 | Bacteria | 3271 |
| 1480 | nmdc:mga0n895_84092_c1 | 3300050512 | Bacteria | 3175 |
| 1481 | nmdc:mga0rr50_134599_c1 | 3300050513 | Bacteria | 1982 |
| 1482 | nmdc:mga0rr50_2215_c1 | 3300050513 | Bacteria | 10908 |
| 1483 | nmdc:mga0rr50_282787_c1 | 3300050513 | Bacteria | 1384 |
| 1484 | nmdc:mga0rr50_56489_c1 | 3300050513 | Bacteria | 2933 |
| 1485 | nmdc:mga0rr50_58092_c1 | 3300050513 | Bacteria | 2897 |
| 1486 | nmdc:mga0rr50_716_c1 | 3300050513 | Bacteria | 17853 |
| 1487 | nmdc:mga0rr50_76530_c1 | 3300050513 | Bacteria | 2569 |
| 1488 | nmdc:mga0rr50_97048_c1 | 3300050513 | Bacteria | 2307 |
| 1489 | nmdc:mga08x19_10017_c1 | 3300050514 | Bacteria | 5682 |
| 1490 | nmdc:mga08x19_1347_c1 | 3300050514 | Bacteria | 15247 |
| 1491 | nmdc:mga08x19_524_c1 | 3300050514 | Bacteria | 25566 |
| 1492 | nmdc:mga08x19_54222_c1 | 3300050514 | Bacteria | 2580 |
| 1493 | nmdc:mga0a205_104560_c1 | 3300050515 | Bacteria | 2731 |
| 1494 | nmdc:mga0a205_118219_c1 | 3300050515 | Bacteria | 2549 |
| 1495 | nmdc:mga0a205_1412_c1 | 3300050515 | Bacteria | 20378 |
| 1496 | nmdc:mga0a205_174619_c1 | 3300050515 | Bacteria | 2044 |
| 1497 | nmdc:mga0a205_2103_c1 | 3300050515 | Bacteria | 17454 |
| 1498 | nmdc:mga0a205_219952_c1 | 3300050515 | Bacteria | 1785 |
| 1499 | nmdc:mga0a205_22925_c1 | 3300050515 | Bacteria | 5920 |
| 1500 | nmdc:mga0a205_249144_c1 | 3300050515 | Bacteria | 1656 |
| 1501 | nmdc:mga0a205_3073_c1 | 3300050515 | Bacteria | 14819 |
| 1502 | nmdc:mga0a205_428009_c1 | 3300050515 | Bacteria | 1185 |
| 1503 | nmdc:mga0a205_5662_c1 | 3300050515 | Bacteria | 11257 |
| 1504 | nmdc:mga0a205_60956_c1 | 3300050515 | Bacteria | 3644 |
| 1505 | Ga0495601_0009838 | 3300053077 | Bacteria | 5659 |
| 1506 | Ga0495601_0079319 | 3300053077 | Bacteria | 2105 |
| 1507 | Ga0495612_0000398 | 3300053078 | Bacteria | 17397 |
| 1508 | Ga0495655_0000574 | 3300053083 | Bacteria | 6053 |
| 1509 | Ga0495595_0048976 | 3300053084 | Bacteria | 1953 |
| 1510 | Ga0495619_0007406 | 3300053085 | Bacteria | 6956 |
| 1511 | Ga0495619_0113876 | 3300053085 | Bacteria | 1850 |
| 1512 | Ga0495619_0144885 | 3300053085 | Bacteria | 1637 |
| 1513 | Ga0495619_0158037 | 3300053085 | Bacteria | 1565 |
| 1514 | Ga0495619_0242434 | 3300053085 | Bacteria | 1249 |
| 1515 | Ga0500628_003394 | 3300053129 | Bacteria | 2630 |
| 1516 | Ga0500628_007908 | 3300053129 | Bacteria | 1834 |
| 1517 | Ga0501084_0030447 | 3300054114 | Bacteria | 4513 |
| 1518 | Ga0501084_0044927 | 3300054114 | Bacteria | 3699 |
| 1519 | Ga0501084_0054785 | 3300054114 | Bacteria | 3336 |
| 1520 | Ga0501084_0212131 | 3300054114 | Bacteria | 1634 |
| 1521 | Ga0501084_0268347 | 3300054114 | Bacteria | 1441 |
| 1522 | Ga0501084_0291544 | 3300054114 | Bacteria | 1378 |
| 1523 | Ga0501084_0322180 | 3300054114 | Bacteria | 1305 |
| 1524 | Ga0590071_000359 | 3300059421 | Bacteria | 13451 |
| 1525 | Ga0590071_008116 | 3300059421 | Bacteria | 2479 |
| 1526 | Ga0590071_023051 | 3300059421 | Bacteria | 1470 |
| 1527 | Ga0590074_006216 | 3300059423 | Bacteria | 1982 |
| 1528 | Ga0590075_000139 | 3300059424 | Bacteria | 19073 |
| 1529 | Ga0590075_001920 | 3300059424 | Bacteria | 5035 |
| 1530 | Ga0590075_011912 | 3300059424 | Bacteria | 2107 |
| 1531 | Ga0590077_000011 | 3300059426 | Bacteria | 41505 |
| 1532 | Ga0590077_005365 | 3300059426 | Bacteria | 2628 |
| 1533 | Ga0501082_0003063 | 3300060353 | Bacteria | 14588 |
| 1534 | Ga0501082_0019848 | 3300060353 | Bacteria | 5796 |
| 1535 | Ga0501082_0036375 | 3300060353 | Bacteria | 4241 |
| 1536 | Ga0501082_0072004 | 3300060353 | Bacteria | 2977 |
| 1537 | Ga0501082_0132483 | 3300060353 | Bacteria | 2163 |
| 1538 | Ga0501082_0198994 | 3300060353 | Bacteria | 1743 |
| 1539 | Ga0501082_0263380 | 3300060353 | Bacteria | 1500 |
| 1540 | Ga0530510_0005554 | 3300061734 | Bacteria | 8740 |
| 1541 | Ga0530510_0082052 | 3300061734 | Bacteria | 2348 |
| 1542 | Ga0530510_0145796 | 3300061734 | Bacteria | 1746 |
| 1543 | Ga0530510_0353601 | 3300061734 | Bacteria | 1104 |
| 1544 | 8054359959 | 8054357960 | Bacteria | 2867777 |
| 1545 | Ga0105245_10009963 | |||
| 1546 | JGI25406J46586_10013078 | |||
| 1547 | Ga0065712_10003117 | |||
| 1548 | Ga0065712_10067822 | |||
| 1549 | Ga0065712_10068256 | |||
| 1550 | Ga0065712_10069647 | |||
| 1551 | Ga0065712_10086315 | |||
| 1552 | Ga0065712_10092300 | |||
| 1553 | Ga0065712_10096909 | |||
| 1554 | Ga0065712_10117705 | |||
| 1555 | Ga0065715_10010472 | |||
| 1556 | Ga0065715_10090135 | |||
| 1557 | Ga0065715_10093135 | |||
| 1558 | Ga0065715_10093168 | |||
| 1559 | Ga0065715_10094425 | |||
| 1560 | Ga0065715_10113341 | |||
| 1561 | Ga0065715_10117987 | |||
| 1562 | Ga0065707_10001479 | |||
| 1563 | Ga0065707_10082300 | |||
| 1564 | Ga0065707_10114653 | |||
| 1565 | Ga0065707_10132595 | |||
| 1566 | Ga0065707_10162560 | |||
| 1567 | Ga0065707_10167462 | |||
| 1568 | Ga0070676_10007541 | |||
| 1569 | Ga0070676_10026430 | |||
| 1570 | Ga0070676_10042457 | |||
| 1571 | Ga0070683_100000767 | |||
| 1572 | Ga0070683_100200920 | |||
| 1573 | Ga0070690_100016845 | |||
| 1574 | Ga0070690_100047784 | |||
| 1575 | Ga0070690_100137999 | |||
| 1576 | Ga0070670_100004018 | |||
| 1577 | Ga0070670_100005693 | |||
| 1578 | Ga0070670_100006799 | |||
| 1579 | Ga0070670_100014101 | |||
| 1580 | Ga0070670_100053037 | |||
| 1581 | Ga0070670_100068457 | |||
| 1582 | Ga0070670_100082316 | |||
| 1583 | Ga0070670_100117557 | |||
| 1584 | Ga0070677_10001941 | |||
| 1585 | Ga0070677_10016182 | |||
| 1586 | Ga0070677_10051067 | |||
| 1587 | Ga0068869_100001962 | |||
| 1588 | Ga0068869_100019703 | |||
| 1589 | Ga0070666_10016269 | |||
| 1590 | Ga0070666_10063651 | |||
| 1591 | Ga0070666_10112771 | |||
| 1592 | Ga0070682_100000035 | |||
| 1593 | Ga0068868_100043851 | |||
| 1594 | Ga0068868_100141734 | |||
| 1595 | Ga0068868_100144848 | |||
| 1596 | Ga0068868_100194443 | |||
| 1597 | Ga0070660_100154479 | |||
| 1598 | Ga0070689_100016312 | |||
| 1599 | Ga0070689_100020541 | |||
| 1600 | Ga0070689_100023685 | |||
| 1601 | Ga0070689_100059391 | |||
| 1602 | Ga0070689_100100302 | |||
| 1603 | Ga0070689_100172345 | |||
| 1604 | Ga0070691_10005391 | |||
| 1605 | Ga0070687_100003542 | |||
| 1606 | Ga0070687_100006797 | |||
| 1607 | Ga0070687_100186401 | |||
| 1608 | Ga0070687_100246111 | |||
| 1609 | Ga0070661_100023235 | |||
| 1610 | Ga0070661_100032912 | |||
| 1611 | Ga0070661_100067305 | |||
| 1612 | Ga0070668_100025473 | |||
| 1613 | Ga0070669_100002591 | |||
| 1614 | Ga0070669_100027676 | |||
| 1615 | Ga0070669_100040428 | |||
| 1616 | Ga0070669_100058689 | |||
| 1617 | Ga0070669_100103009 | |||
| 1618 | Ga0070669_100136306 | |||
| 1619 | Ga0070669_100189810 | |||
| 1620 | Ga0070675_100000442 | |||
| 1621 | Ga0070675_100001024 | |||
| 1622 | Ga0070675_100012826 | |||
| 1623 | Ga0070675_100024303 | |||
| 1624 | Ga0070675_100031700 | |||
| 1625 | Ga0070675_100035531 | |||
| 1626 | Ga0070675_100037927 | |||
| 1627 | Ga0070675_100049232 | |||
| 1628 | Ga0070675_100064924 | |||
| 1629 | Ga0070675_100072539 | |||
| 1630 | Ga0070675_100106845 | |||
| 1631 | Ga0070675_100126641 | |||
| 1632 | Ga0070675_100159643 | |||
| 1633 | Ga0070675_100171016 | |||
| 1634 | Ga0070675_100254623 | |||
| 1635 | Ga0070671_100022132 | |||
| 1636 | Ga0070671_100359700 | |||
| 1637 | Ga0070674_100004110 | |||
| 1638 | Ga0070674_100016261 | |||
| 1639 | Ga0070674_100052135 | |||
| 1640 | Ga0070674_100052750 | |||
| 1641 | Ga0070674_100071144 | |||
| 1642 | Ga0070674_100080733 | |||
| 1643 | Ga0070674_100098405 | |||
| 1644 | Ga0070674_100100078 | |||
| 1645 | Ga0070673_100007497 | |||
| 1646 | Ga0070673_100008711 | |||
| 1647 | Ga0070673_100011429 | |||
| 1648 | Ga0070673_100039289 | |||
| 1649 | Ga0070673_100045756 | |||
| 1650 | Ga0070673_100052057 | |||
| 1651 | Ga0070673_100054726 | |||
| 1652 | Ga0070673_100058579 | |||
| 1653 | Ga0070673_100074909 | |||
| 1654 | Ga0070673_100082692 | |||
| 1655 | Ga0070673_100272439 | |||
| 1656 | Ga0070688_100009725 | |||
| 1657 | Ga0070688_100021012 | |||
| 1658 | Ga0070688_100085427 | |||
| 1659 | Ga0070688_100101264 | |||
| 1660 | Ga0070688_100118249 | |||
| 1661 | Ga0070688_100206141 | |||
| 1662 | Ga0070667_100014780 | |||
| 1663 | Ga0070667_100106411 | |||
| 1664 | Ga0070667_100156520 | |||
| 1665 | Ga0070667_100207474 | |||
| 1666 | Ga0070667_100262386 | |||
| 1667 | Ga0070703_10003911 | |||
| 1668 | Ga0070703_10019537 | |||
| 1669 | Ga0070709_10004268 | |||
| 1670 | Ga0070709_10037201 | |||
| 1671 | Ga0070709_10069154 | |||
| 1672 | Ga0070714_100165808 | |||
| 1673 | Ga0070713_100028719 | |||
| 1674 | Ga0070713_100031212 | |||
| 1675 | Ga0070713_100097566 | |||
| 1676 | Ga0070713_100199094 | |||
| 1677 | Ga0070701_10007445 | |||
| 1678 | Ga0070701_10025421 | |||
| 1679 | Ga0070701_10025882 | |||
| 1680 | Ga0070711_100009831 | |||
| 1681 | Ga0070711_100083557 | |||
| 1682 | Ga0070711_100212492 | |||
| 1683 | Ga0070705_100000288 | |||
| 1684 | Ga0070705_100000449 | |||
| 1685 | Ga0070705_100026756 | |||
| 1686 | Ga0070705_100057794 | |||
| 1687 | Ga0070705_100115577 | |||
| 1688 | Ga0070700_100003978 | |||
| 1689 | Ga0070700_100010664 | |||
| 1690 | Ga0070700_100011740 | |||
| 1691 | Ga0070700_100153909 | |||
| 1692 | Ga0070694_100000762 | |||
| 1693 | Ga0070694_100020020 | |||
| 1694 | Ga0070694_100028490 | |||
| 1695 | Ga0070694_100032377 | |||
| 1696 | Ga0070694_100180103 | |||
| 1697 | Ga0070694_100335306 | |||
| 1698 | Ga0070708_100019182 | |||
| 1699 | Ga0070708_100028160 | |||
| 1700 | Ga0070708_100048944 | |||
| 1701 | Ga0070708_100057244 | |||
| 1702 | Ga0070708_100205444 | |||
| 1703 | Ga0070708_100293505 | |||
| 1704 | Ga0070708_100325323 | |||
| 1705 | Ga0070663_100009691 | |||
| 1706 | Ga0070678_100237450 | |||
| 1707 | Ga0070662_100036324 | |||
| 1708 | Ga0070662_100050184 | |||
| 1709 | Ga0070662_100076829 | |||
| 1710 | Ga0070681_10000926 | |||
| 1711 | Ga0070681_10005093 | |||
| 1712 | Ga0068867_100004543 | |||
| 1713 | Ga0068867_100007110 | |||
| 1714 | Ga0068867_100012153 | |||
| 1715 | Ga0068867_100015273 | |||
| 1716 | Ga0068867_100040773 | |||
| 1717 | Ga0068867_100068142 | |||
| 1718 | Ga0068867_100110181 | |||
| 1719 | Ga0068867_100129921 | |||
| 1720 | Ga0068867_100235012 | |||
| 1721 | Ga0068867_100414885 | |||
| 1722 | Ga0070685_10002548 | |||
| 1723 | Ga0070685_10003010 | |||
| 1724 | Ga0070685_10191722 | |||
| 1725 | Ga0070706_100007364 | |||
| 1726 | Ga0070706_100017811 | |||
| 1727 | Ga0070706_100062834 | |||
| 1728 | Ga0070706_100070232 | |||
| 1729 | Ga0070706_100201483 | |||
| 1730 | Ga0070707_100000011 | |||
| 1731 | Ga0070707_100002468 | |||
| 1732 | Ga0070707_100045214 | |||
| 1733 | Ga0070707_100049961 | |||
| 1734 | Ga0070707_100052066 | |||
| 1735 | Ga0070707_100060347 | |||
| 1736 | Ga0070707_100103657 | |||
| 1737 | Ga0070707_100211057 | |||
| 1738 | Ga0070698_100001654 | |||
| 1739 | Ga0070698_100002474 | |||
| 1740 | Ga0070698_100014002 | |||
| 1741 | Ga0070698_100015006 | |||
| 1742 | Ga0070698_100072730 | |||
| 1743 | Ga0070698_100163544 | |||
| 1744 | Ga0070699_100000558 | |||
| 1745 | Ga0070699_100009920 | |||
| 1746 | Ga0070699_100026285 | |||
| 1747 | Ga0070699_100042605 | |||
| 1748 | Ga0070699_100060971 | |||
| 1749 | Ga0070699_100063016 | |||
| 1750 | Ga0070699_100091306 | |||
| 1751 | Ga0070699_100104888 | |||
| 1752 | Ga0070699_100152609 | |||
| 1753 | Ga0070699_100217634 | |||
| 1754 | Ga0070699_100421623 | |||
| 1755 | Ga0070679_100011918 | |||
| 1756 | Ga0070679_100124285 | |||
| 1757 | Ga0070684_100004962 | |||
| 1758 | Ga0070684_100010485 | |||
| 1759 | Ga0070684_100122918 | |||
| 1760 | Ga0070697_100004983 | |||
| 1761 | Ga0070697_100057979 | |||
| 1762 | Ga0070697_100097400 | |||
| 1763 | Ga0070697_100162709 | |||
| 1764 | Ga0070697_100162949 | |||
| 1765 | Ga0070697_100267488 | |||
| 1766 | Ga0068853_100174627 | |||
| 1767 | Ga0070672_100000360 | |||
| 1768 | Ga0070672_100037705 | |||
| 1769 | Ga0070672_100066328 | |||
| 1770 | Ga0070672_100104885 | |||
| 1771 | Ga0070672_100115218 | |||
| 1772 | Ga0070672_100144402 | |||
| 1773 | Ga0070672_100247639 | |||
| 1774 | Ga0070686_100006747 | |||
| 1775 | Ga0070686_100147924 | |||
| 1776 | Ga0070695_100000582 | |||
| 1777 | Ga0070695_100008733 | |||
| 1778 | Ga0070695_100165990 | |||
| 1779 | Ga0070695_100296084 | |||
| 1780 | Ga0070696_100001518 | |||
| 1781 | Ga0070696_100003257 | |||
| 1782 | Ga0070696_100018392 | |||
| 1783 | Ga0070696_100033671 | |||
| 1784 | Ga0070696_100070820 | |||
| 1785 | Ga0070693_100000004 | |||
| 1786 | Ga0070693_100005655 | |||
| 1787 | Ga0070665_100000122 | |||
| 1788 | Ga0070665_100002388 | |||
| 1789 | Ga0070665_100003370 | |||
| 1790 | Ga0070665_100166571 | |||
| 1791 | Ga0070704_100000802 | |||
| 1792 | Ga0070704_100012627 | |||
| 1793 | Ga0070704_100012700 | |||
| 1794 | Ga0070704_100020062 | |||
| 1795 | Ga0070704_100049606 | |||
| 1796 | Ga0070704_100133034 | |||
| 1797 | Ga0070704_100153527 | |||
| 1798 | Ga0070704_100197329 | |||
| 1799 | Ga0068855_100345507 | |||
| 1800 | Ga0070664_100009155 | |||
| 1801 | Ga0070664_100040446 | |||
| 1802 | Ga0070664_100050239 | |||
| 1803 | Ga0070664_100054162 | |||
| 1804 | Ga0070664_100128131 | |||
| 1805 | Ga0070664_100147749 | |||
| 1806 | Ga0068857_100031800 | |||
| 1807 | Ga0068857_100041841 | |||
| 1808 | Ga0068857_100043627 | |||
| 1809 | Ga0068857_100124417 | |||
| 1810 | Ga0068854_100011543 | |||
| 1811 | Ga0070702_100002550 | |||
| 1812 | Ga0070702_100041188 | |||
| 1813 | Ga0070702_100105012 | |||
| 1814 | Ga0070702_100153084 | |||
| 1815 | Ga0068852_100026364 | |||
| 1816 | Ga0068852_100176540 | |||
| 1817 | Ga0068859_100004358 | |||
| 1818 | Ga0068859_100007450 | |||
| 1819 | Ga0068859_100023926 | |||
| 1820 | Ga0068859_100034044 | |||
| 1821 | Ga0068859_100053436 | |||
| 1822 | Ga0068859_100098046 | |||
| 1823 | Ga0068864_100000007 | |||
| 1824 | Ga0068864_100008459 | |||
| 1825 | Ga0068864_100008524 | |||
| 1826 | Ga0068864_100022414 | |||
| 1827 | Ga0068864_100037340 | |||
| 1828 | Ga0068864_100066381 | |||
| 1829 | Ga0068864_100067698 | |||
| 1830 | Ga0068864_100166898 | |||
| 1831 | Ga0068864_100276282 | |||
| 1832 | Ga0068864_100486886 | |||
| 1833 | Ga0068866_10010430 | |||
| 1834 | Ga0068861_100001024 | |||
| 1835 | Ga0068861_100004253 | |||
| 1836 | Ga0068861_100011191 | |||
| 1837 | Ga0068861_100018977 | |||
| 1838 | Ga0068861_100092894 | |||
| 1839 | Ga0068861_100130396 | |||
| 1840 | Ga0068861_100346505 | |||
| 1841 | Ga0068861_100383676 | |||
| 1842 | Ga0068851_10012457 | |||
| 1843 | Ga0068870_10002841 | |||
| 1844 | Ga0068870_10006109 | |||
| 1845 | Ga0068870_10006855 | |||
| 1846 | Ga0068870_10014126 | |||
| 1847 | Ga0068870_10066587 | |||
| 1848 | Ga0068870_10183760 | |||
| 1849 | Ga0068863_100089191 | |||
| 1850 | Ga0068863_100131497 | |||
| 1851 | Ga0068863_100135370 | |||
| 1852 | Ga0068858_100000717 | |||
| 1853 | Ga0068858_100010084 | |||
| 1854 | Ga0068858_100059383 | |||
| 1855 | Ga0068858_100096421 | |||
| 1856 | Ga0068858_100098730 | |||
| 1857 | Ga0068858_100182368 | |||
| 1858 | Ga0068860_100000658 | |||
| 1859 | Ga0068860_100002851 | |||
| 1860 | Ga0068860_100015659 | |||
| 1861 | Ga0068860_100095866 | |||
| 1862 | Ga0068860_100185812 | |||
| 1863 | Ga0068860_100196091 | |||
| 1864 | Ga0068860_100276596 | |||
| 1865 | Ga0068862_100002475 | |||
| 1866 | Ga0068862_100006398 | |||
| 1867 | Ga0068862_100016709 | |||
| 1868 | Ga0068862_100018886 | |||
| 1869 | Ga0068862_100167988 | |||
| 1870 | Ga0068862_100169822 | |||
| 1871 | Ga0068862_100172065 | |||
| 1872 | Ga0068862_100312083 | |||
| 1873 | Ga0068862_100484977 | |||
| 1874 | Ga0081539_10000025 | |||
| 1875 | Ga0081539_10000134 | |||
| 1876 | Ga0081539_10004230 | |||
| 1877 | Ga0070717_10000160 | |||
| 1878 | Ga0070717_10288392 | |||
| 1879 | Ga0075368_10006201 | |||
| 1880 | Ga0075432_10055177 | |||
| 1881 | Ga0070715_10063972 | |||
| 1882 | Ga0070716_100004009 | |||
| 1883 | Ga0070716_100042123 | |||
| 1884 | Ga0070716_100201173 | |||
| 1885 | Ga0070716_100219253 | |||
| 1886 | Ga0070712_100021014 | |||
| 1887 | Ga0070712_100077573 | |||
| 1888 | Ga0070712_100112029 | |||
| 1889 | Ga0075367_10003716 | |||
| 1890 | Ga0075367_10060288 | |||
| 1891 | Ga0097621_100005430 | |||
| 1892 | Ga0097621_100058986 | |||
| 1893 | Ga0097621_100059085 | |||
| 1894 | Ga0097621_100089132 | |||
| 1895 | Ga0097621_100100594 | |||
| 1896 | Ga0075370_10076812 | |||
| 1897 | Ga0068871_100001401 | |||
| 1898 | Ga0068871_100016049 | |||
| 1899 | Ga0068871_100060151 | |||
| 1900 | Ga0068871_100075412 | |||
| 1901 | Ga0068871_100117926 | |||
| 1902 | Ga0075428_100000005 | |||
| 1903 | Ga0075428_100002473 | |||
| 1904 | Ga0075428_100003359 | |||
| 1905 | Ga0075428_100006386 | |||
| 1906 | Ga0075428_100009431 | |||
| 1907 | Ga0075428_100016154 | |||
| 1908 | Ga0075428_100027209 | |||
| 1909 | Ga0075428_100048327 | |||
| 1910 | Ga0075428_100057559 | |||
| 1911 | Ga0075428_100166741 | |||
| 1912 | Ga0075428_100395198 | |||
| 1913 | Ga0075428_100442094 | |||
| 1914 | Ga0075430_100002136 | |||
| 1915 | Ga0075430_100002239 | |||
| 1916 | Ga0075430_100005588 | |||
| 1917 | Ga0075430_100014486 | |||
| 1918 | Ga0075430_100020148 | |||
| 1919 | Ga0075430_100034120 | |||
| 1920 | Ga0075430_100095682 | |||
| 1921 | Ga0075430_100175267 | |||
| 1922 | Ga0075430_100314349 | |||
| 1923 | Ga0075431_100000575 | |||
| 1924 | Ga0075431_100001153 | |||
| 1925 | Ga0075431_100005566 | |||
| 1926 | Ga0075431_100007412 | |||
| 1927 | Ga0075431_100010853 | |||
| 1928 | Ga0075431_100032234 | |||
| 1929 | Ga0075431_100074509 | |||
| 1930 | Ga0075431_100177433 | |||
| 1931 | Ga0075431_100192911 | |||
| 1932 | Ga0075431_100198791 | |||
| 1933 | Ga0075431_100330244 | |||
| 1934 | Ga0075433_10003019 | |||
| 1935 | Ga0075433_10050195 | |||
| 1936 | Ga0075433_10065855 | |||
| 1937 | Ga0075433_10067923 | |||
| 1938 | Ga0075433_10083058 | |||
| 1939 | Ga0075433_10088168 | |||
| 1940 | Ga0075433_10097299 | |||
| 1941 | Ga0075434_100000919 | |||
| 1942 | Ga0075434_100025674 | |||
| 1943 | Ga0075434_100037402 | |||
| 1944 | Ga0075434_100051482 | |||
| 1945 | Ga0075434_100062148 | |||
| 1946 | Ga0075434_100084179 | |||
| 1947 | Ga0075434_100100251 | |||
| 1948 | Ga0075434_100110857 | |||
| 1949 | Ga0075434_100127023 | |||
| 1950 | Ga0075434_100166250 | |||
| 1951 | Ga0075434_100176521 | |||
| 1952 | Ga0075434_100193417 | |||
| 1953 | Ga0075434_100204784 | |||
| 1954 | Ga0075434_100271683 | |||
| 1955 | Ga0075434_100396614 | |||
| 1956 | Ga0075434_100487985 | |||
| 1957 | Ga0075429_100003923 | |||
| 1958 | Ga0075429_100013537 | |||
| 1959 | Ga0075429_100016751 | |||
| 1960 | Ga0075429_100035327 | |||
| 1961 | Ga0075429_100036989 | |||
| 1962 | Ga0075429_100068908 | |||
| 1963 | Ga0075429_100091401 | |||
| 1964 | Ga0075429_100112122 | |||
| 1965 | Ga0075429_100116987 | |||
| 1966 | Ga0068865_100105696 | |||
| 1967 | Ga0075436_100007865 | |||
| 1968 | Ga0075436_100008907 | |||
| 1969 | Ga0075436_100011225 | |||
| 1970 | Ga0075436_100037045 | |||
| 1971 | Ga0075436_100042530 | |||
| 1972 | Ga0075436_100090348 | |||
| 1973 | Ga0097620_100004358 | |||
| 1974 | Ga0097620_100007450 | |||
| 1975 | Ga0097620_100023926 | |||
| 1976 | Ga0097620_100034044 | |||
| 1977 | Ga0097620_100053435 | |||
| 1978 | Ga0097620_100098046 | |||
| 1979 | Ga0075435_100000185 | |||
| 1980 | Ga0075435_100004809 | |||
| 1981 | Ga0075435_100006977 | |||
| 1982 | Ga0075435_100035383 | |||
| 1983 | Ga0075435_100336062 | |||
| 1984 | Ga0099794_10010639 | |||
| 1985 | Ga0099794_10012772 | |||
| 1986 | Ga0099794_10019314 | |||
| 1987 | Ga0099794_10049428 | |||
| 1988 | Ga0099794_10050745 | |||
| 1989 | Ga0099795_10011684 | |||
| 1990 | Ga0105240_10018260 | |||
| 1991 | Ga0105240_10024901 | |||
| 1992 | Ga0105240_10045142 | |||
| 1993 | Ga0105240_10118771 | |||
| 1994 | Ga0111539_10000008 | |||
| 1995 | Ga0111539_10010233 | |||
| 1996 | Ga0111539_10015435 | |||
| 1997 | Ga0111539_10017849 | |||
| 1998 | Ga0111539_10053056 | |||
| 1999 | Ga0111539_10069612 | |||
| 2000 | Ga0111539_10120056 | |||
| 2001 | Ga0111539_10162093 | |||
| 2002 | Ga0111539_10172713 | |||
| 2003 | Ga0111539_10237395 | |||
| 2004 | Ga0111539_10259101 | |||
| 2005 | Ga0111539_10366046 | |||
| 2006 | Ga0111539_10385603 | |||
| 2007 | Ga0111539_10419146 | |||
| 2008 | Ga0111539_10428901 | |||
| 2009 | Ga0111539_10505083 | |||
| 2010 | Ga0111539_10531179 | |||
| 2011 | Ga0105245_10004535 | |||
| 2012 | Ga0105245_10005359 | |||
| 2013 | Ga0105245_10033714 | |||
| 2014 | Ga0105245_10050297 | |||
| 2015 | Ga0105245_10152435 | |||
| 2016 | Ga0114129_10000574 | |||
| 2017 | Ga0114129_10001790 | |||
| 2018 | Ga0114129_10002431 | |||
| 2019 | Ga0114129_10007344 | |||
| 2020 | Ga0114129_10008510 | |||
| 2021 | Ga0114129_10020281 | |||
| 2022 | Ga0114129_10024870 | |||
| 2023 | Ga0114129_10049166 | |||
| 2024 | Ga0114129_10057984 | |||
| 2025 | Ga0114129_10103084 | |||
| 2026 | Ga0114129_10126427 | |||
| 2027 | Ga0114129_10147067 | |||
| 2028 | Ga0114129_10191633 | |||
| 2029 | Ga0114129_10400489 | |||
| 2030 | Ga0114129_10413203 | |||
| 2031 | Ga0105243_10013883 | |||
| 2032 | Ga0105243_10077158 | |||
| 2033 | Ga0105243_10118442 | |||
| 2034 | Ga0105243_10229795 | |||
| 2035 | Ga0105241_10033243 | |||
| 2036 | Ga0105241_10360000 | |||
| 2037 | Ga0105242_10007676 | |||
| 2038 | Ga0105242_10074387 | |||
| 2039 | Ga0105242_10129741 | |||
| 2040 | Ga0105242_10142896 | |||
| 2041 | Ga0105248_10001544 | |||
| 2042 | Ga0105248_10029775 | |||
| 2043 | Ga0105248_10039996 | |||
| 2044 | Ga0105248_10084089 | |||
| 2045 | Ga0105248_10093304 | |||
| 2046 | Ga0105248_10100342 | |||
| 2047 | Ga0105248_10119465 | |||
| 2048 | Ga0105248_10128088 | |||
| 2049 | Ga0105248_10182129 | |||
| 2050 | Ga0105248_10207658 | |||
| 2051 | Ga0105248_10410839 | |||
| 2052 | Ga0105238_10000002 | |||
| 2053 | Ga0105238_10203277 | |||
| 2054 | Ga0105249_10021476 | |||
| 2055 | Ga0105249_10032539 | |||
| 2056 | Ga0105249_10052119 | |||
| 2057 | Ga0105249_10104120 | |||
| 2058 | Ga0105249_10549398 | |||
| 2059 | Ga0099796_10002341 | |||
| 2060 | Ga0105239_10051109 | |||
| 2061 | Ga0105246_10016281 | |||
| 2062 | Ga0157374_10000038 | |||
| 2063 | Ga0157374_10001975 | |||
| 2064 | Ga0157374_10179131 | |||
| 2065 | Ga0157374_10200211 | |||
| 2066 | Ga0157378_10000044 | |||
| 2067 | Ga0157378_10000678 | |||
| 2068 | Ga0157378_10001262 | |||
| 2069 | Ga0157378_10002388 | |||
| 2070 | Ga0157378_10003083 | |||
| 2071 | Ga0157378_10281354 | |||
| 2072 | Ga0157378_10299363 | |||
| 2073 | Ga0163162_10006374 | |||
| 2074 | Ga0163162_10030754 | |||
| 2075 | Ga0163162_10031743 | |||
| 2076 | Ga0163162_10072255 | |||
| 2077 | Ga0157375_10000003 | |||
| 2078 | Ga0157375_10000010 | |||
| 2079 | Ga0157375_10006844 | |||
| 2080 | Ga0157375_10046618 | |||
| 2081 | Ga0157375_10094436 | |||
| 2082 | Ga0163163_10000023 | |||
| 2083 | Ga0163163_10007293 | |||
| 2084 | Ga0163163_10015982 | |||
| 2085 | Ga0163163_10074644 | |||
| 2086 | Ga0163163_10347387 | |||
| 2087 | Ga0157380_10007520 | |||
| 2088 | Ga0157380_10008698 | |||
| 2089 | Ga0157380_10011997 | |||
| 2090 | Ga0157380_10013898 | |||
| 2091 | Ga0157380_10015991 | |||
| 2092 | Ga0157380_10044711 | |||
| 2093 | Ga0157380_10049170 | |||
| 2094 | Ga0157380_10068673 | |||
| 2095 | Ga0157380_10084766 | |||
| 2096 | Ga0157380_10196324 | |||
| 2097 | Ga0157380_10204107 | |||
| 2098 | Ga0157380_10303700 | |||
| 2099 | Ga0157380_10331615 | |||
| 2100 | Ga0157377_10000004 | |||
| 2101 | Ga0157377_10000074 | |||
| 2102 | Ga0157377_10002734 | |||
| 2103 | Ga0157377_10008196 | |||
| 2104 | Ga0157379_10005070 | |||
| 2105 | Ga0157379_10207188 | |||
| 2106 | Ga0157376_10000003 | |||
| 2107 | Ga0157376_10000008 | |||
| 2108 | Ga0157376_10000231 | |||
| 2109 | Ga0157376_10055323 | |||
| 2110 | Ga0157376_10138252 | |||
| 2111 | Ga0157376_10325007 | |||
| 2112 | Ga0157376_10610909 | |||
| 2113 | Ga0163161_10024629 | |||
| 2114 | Ga0163161_10072790 | |||
| 2115 | Ga0228598_1000166 | |||
| 2116 | Ga0207697_10007162 | |||
| 2117 | Ga0207697_10025607 | |||
| 2118 | Ga0207653_10000691 | |||
| 2119 | Ga0207682_10002808 | |||
| 2120 | Ga0207682_10008627 | |||
| 2121 | Ga0207682_10026000 | |||
| 2122 | Ga0207682_10035209 | |||
| 2123 | Ga0207642_10002113 | |||
| 2124 | Ga0207642_10072235 | |||
| 2125 | Ga0207688_10000078 | |||
| 2126 | Ga0207688_10023905 | |||
| 2127 | Ga0207688_10122377 | |||
| 2128 | Ga0207685_10048472 | |||
| 2129 | Ga0207699_10001243 | |||
| 2130 | Ga0207699_10021854 | |||
| 2131 | Ga0207699_10044858 | |||
| 2132 | Ga0207699_10056021 | |||
| 2133 | Ga0207699_10060540 | |||
| 2134 | Ga0207645_10000374 | |||
| 2135 | Ga0207645_10001092 | |||
| 2136 | Ga0207645_10010985 | |||
| 2137 | Ga0207645_10034102 | |||
| 2138 | Ga0207645_10047816 | |||
| 2139 | Ga0207643_10003058 | |||
| 2140 | Ga0207643_10006513 | |||
| 2141 | Ga0207643_10038368 | |||
| 2142 | Ga0207643_10064690 | |||
| 2143 | Ga0207643_10101174 | |||
| 2144 | Ga0207643_10168825 | |||
| 2145 | Ga0207643_10186244 | |||
| 2146 | Ga0207684_10002227 | |||
| 2147 | Ga0207684_10048144 | |||
| 2148 | Ga0207684_10051922 | |||
| 2149 | Ga0207707_10008909 | |||
| 2150 | Ga0207707_10022422 | |||
| 2151 | Ga0207695_10034283 | |||
| 2152 | Ga0207695_10119515 | |||
| 2153 | Ga0207671_10147123 | |||
| 2154 | Ga0207693_10003389 | |||
| 2155 | Ga0207693_10015404 | |||
| 2156 | Ga0207693_10015622 | |||
| 2157 | Ga0207693_10034863 | |||
| 2158 | Ga0207693_10194445 | |||
| 2159 | Ga0207663_10006081 | |||
| 2160 | Ga0207663_10059865 | |||
| 2161 | Ga0207663_10066980 | |||
| 2162 | Ga0207660_10108613 | |||
| 2163 | Ga0207662_10007437 | |||
| 2164 | Ga0207662_10034763 | |||
| 2165 | Ga0207662_10056672 | |||
| 2166 | Ga0207662_10068771 | |||
| 2167 | Ga0207657_10131981 | |||
| 2168 | Ga0207649_10005573 | |||
| 2169 | Ga0207649_10085622 | |||
| 2170 | Ga0207652_10015551 | |||
| 2171 | Ga0207646_10000055 | |||
| 2172 | Ga0207646_10000122 | |||
| 2173 | Ga0207646_10001764 | |||
| 2174 | Ga0207646_10044362 | |||
| 2175 | Ga0207646_10051322 | |||
| 2176 | Ga0207646_10089322 | |||
| 2177 | Ga0207646_10115678 | |||
| 2178 | Ga0207646_10407768 | |||
| 2179 | Ga0207681_10000705 | |||
| 2180 | Ga0207681_10030851 | |||
| 2181 | Ga0207681_10048185 | |||
| 2182 | Ga0207681_10048216 | |||
| 2183 | Ga0207681_10049316 | |||
| 2184 | Ga0207681_10057761 | |||
| 2185 | Ga0207681_10080337 | |||
| 2186 | Ga0207681_10095641 | |||
| 2187 | Ga0207681_10164773 | |||
| 2188 | Ga0207681_10167476 | |||
| 2189 | Ga0207681_10372897 | |||
| 2190 | Ga0207694_10000001 | |||
| 2191 | Ga0207650_10010475 | |||
| 2192 | Ga0207650_10015200 | |||
| 2193 | Ga0207650_10017612 | |||
| 2194 | Ga0207650_10019816 | |||
| 2195 | Ga0207650_10030655 | |||
| 2196 | Ga0207650_10119526 | |||
| 2197 | Ga0207650_10223524 | |||
| 2198 | Ga0207659_10000501 | |||
| 2199 | Ga0207659_10003555 | |||
| 2200 | Ga0207659_10014754 | |||
| 2201 | Ga0207659_10020760 | |||
| 2202 | Ga0207659_10064234 | |||
| 2203 | Ga0207659_10073756 | |||
| 2204 | Ga0207659_10098749 | |||
| 2205 | Ga0207659_10139943 | |||
| 2206 | Ga0207687_10000771 | |||
| 2207 | Ga0207687_10008609 | |||
| 2208 | Ga0207687_10034362 | |||
| 2209 | Ga0207687_10067081 | |||
| 2210 | Ga0207687_10067321 | |||
| 2211 | Ga0207700_10044131 | |||
| 2212 | Ga0207700_10063685 | |||
| 2213 | Ga0207700_10078610 | |||
| 2214 | Ga0207700_10097605 | |||
| 2215 | Ga0207700_10141252 | |||
| 2216 | Ga0207700_10178810 | |||
| 2217 | Ga0207664_10109716 | |||
| 2218 | Ga0207644_10046516 | |||
| 2219 | Ga0207644_10050148 | |||
| 2220 | Ga0207644_10067758 | |||
| 2221 | Ga0207644_10078777 | |||
| 2222 | Ga0207644_10181615 | |||
| 2223 | Ga0207690_10010646 | |||
| 2224 | Ga0207690_10082194 | |||
| 2225 | Ga0207690_10106393 | |||
| 2226 | Ga0207690_10134218 | |||
| 2227 | Ga0207706_10005517 | |||
| 2228 | Ga0207706_10039316 | |||
| 2229 | Ga0207706_10042267 | |||
| 2230 | Ga0207706_10054366 | |||
| 2231 | Ga0207706_10075480 | |||
| 2232 | Ga0207706_10075776 | |||
| 2233 | Ga0207686_10017235 | |||
| 2234 | Ga0207686_10046039 | |||
| 2235 | Ga0207686_10085013 | |||
| 2236 | Ga0207686_10099192 | |||
| 2237 | Ga0207686_10106152 | |||
| 2238 | Ga0207686_10235655 | |||
| 2239 | Ga0207709_10007327 | |||
| 2240 | Ga0207709_10025497 | |||
| 2241 | Ga0207709_10040623 | |||
| 2242 | Ga0207709_10058837 | |||
| 2243 | Ga0207709_10125183 | |||
| 2244 | Ga0207670_10011233 | |||
| 2245 | Ga0207670_10022933 | |||
| 2246 | Ga0207670_10048147 | |||
| 2247 | Ga0207670_10051749 | |||
| 2248 | Ga0207670_10051766 | |||
| 2249 | Ga0207670_10068660 | |||
| 2250 | Ga0207670_10113522 | |||
| 2251 | Ga0207670_10240256 | |||
| 2252 | Ga0207670_10317870 | |||
| 2253 | Ga0207669_10010135 | |||
| 2254 | Ga0207669_10010275 | |||
| 2255 | Ga0207669_10022027 | |||
| 2256 | Ga0207669_10139147 | |||
| 2257 | Ga0207669_10177867 | |||
| 2258 | Ga0207704_10011415 | |||
| 2259 | Ga0207704_10225874 | |||
| 2260 | Ga0207704_10261912 | |||
| 2261 | Ga0207665_10000008 | |||
| 2262 | Ga0207665_10008235 | |||
| 2263 | Ga0207665_10050032 | |||
| 2264 | Ga0207665_10052689 | |||
| 2265 | Ga0207665_10080243 | |||
| 2266 | Ga0207665_10136108 | |||
| 2267 | Ga0207665_10197299 | |||
| 2268 | Ga0207665_10246000 | |||
| 2269 | Ga0207665_10260036 | |||
| 2270 | Ga0207691_10006666 | |||
| 2271 | Ga0207691_10008868 | |||
| 2272 | Ga0207691_10010705 | |||
| 2273 | Ga0207691_10036965 | |||
| 2274 | Ga0207691_10040373 | |||
| 2275 | Ga0207691_10043122 | |||
| 2276 | Ga0207691_10064984 | |||
| 2277 | Ga0207691_10067224 | |||
| 2278 | Ga0207691_10104004 | |||
| 2279 | Ga0207691_10200543 | |||
| 2280 | Ga0207711_10070974 | |||
| 2281 | Ga0207711_10076066 | |||
| 2282 | Ga0207711_10078675 | |||
| 2283 | Ga0207711_10121043 | |||
| 2284 | Ga0207689_10004769 | |||
| 2285 | Ga0207689_10006874 | |||
| 2286 | Ga0207689_10023079 | |||
| 2287 | Ga0207689_10066454 | |||
| 2288 | Ga0207689_10094010 | |||
| 2289 | Ga0207689_10136530 | |||
| 2290 | Ga0207689_10148118 | |||
| 2291 | Ga0207689_10300848 | |||
| 2292 | Ga0207689_10365401 | |||
| 2293 | Ga0207661_10000567 | |||
| 2294 | Ga0207661_10076026 | |||
| 2295 | Ga0207661_10225408 | |||
| 2296 | Ga0207679_10002887 | |||
| 2297 | Ga0207679_10008110 | |||
| 2298 | Ga0207679_10038680 | |||
| 2299 | Ga0207679_10061002 | |||
| 2300 | Ga0207679_10080569 | |||
| 2301 | Ga0207679_10195768 | |||
| 2302 | Ga0207679_10345999 | |||
| 2303 | Ga0207679_10466302 | |||
| 2304 | Ga0207651_10003088 | |||
| 2305 | Ga0207651_10013243 | |||
| 2306 | Ga0207651_10017893 | |||
| 2307 | Ga0207651_10017894 | |||
| 2308 | Ga0207651_10025651 | |||
| 2309 | Ga0207651_10068350 | |||
| 2310 | Ga0207651_10079593 | |||
| 2311 | Ga0207651_10093640 | |||
| 2312 | Ga0207651_10136320 | |||
| 2313 | Ga0207651_10164201 | |||
| 2314 | Ga0207651_10328403 | |||
| 2315 | Ga0207712_10020761 | |||
| 2316 | Ga0207712_10026599 | |||
| 2317 | Ga0207712_10033799 | |||
| 2318 | Ga0207712_10135594 | |||
| 2319 | Ga0207712_10179426 | |||
| 2320 | Ga0207668_10172199 | |||
| 2321 | Ga0207640_10005632 | |||
| 2322 | Ga0207640_10018088 | |||
| 2323 | Ga0207640_10053034 | |||
| 2324 | Ga0207658_10085333 | |||
| 2325 | Ga0207677_10030076 | |||
| 2326 | Ga0207677_10112640 | |||
| 2327 | Ga0207677_10259951 | |||
| 2328 | Ga0207703_10111147 | |||
| 2329 | Ga0207703_10183813 | |||
| 2330 | Ga0207703_10251546 | |||
| 2331 | Ga0207703_10365100 | |||
| 2332 | Ga0207639_10000028 | |||
| 2333 | Ga0207639_10078745 | |||
| 2334 | Ga0207678_10019603 | |||
| 2335 | Ga0207678_10064943 | |||
| 2336 | Ga0207708_10030417 | |||
| 2337 | Ga0207708_10052944 | |||
| 2338 | Ga0207708_10060418 | |||
| 2339 | Ga0207708_10077717 | |||
| 2340 | Ga0207708_10078793 | |||
| 2341 | Ga0207708_10087996 | |||
| 2342 | Ga0207708_10109996 | |||
| 2343 | Ga0207708_10352092 | |||
| 2344 | Ga0207641_10068952 | |||
| 2345 | Ga0207641_10176334 | |||
| 2346 | Ga0207648_10003537 | |||
| 2347 | Ga0207648_10006736 | |||
| 2348 | Ga0207648_10014255 | |||
| 2349 | Ga0207648_10026662 | |||
| 2350 | Ga0207648_10037009 | |||
| 2351 | Ga0207648_10040076 | |||
| 2352 | Ga0207648_10055320 | |||
| 2353 | Ga0207648_10061425 | |||
| 2354 | Ga0207676_10000015 | |||
| 2355 | Ga0207676_10036130 | |||
| 2356 | Ga0207676_10082326 | |||
| 2357 | Ga0207676_10082601 | |||
| 2358 | Ga0207676_10084144 | |||
| 2359 | Ga0207676_10116410 | |||
| 2360 | Ga0207676_10130061 | |||
| 2361 | Ga0207676_10272370 | |||
| 2362 | Ga0207674_10035104 | |||
| 2363 | Ga0207674_10067461 | |||
| 2364 | Ga0207674_10137541 | |||
| 2365 | Ga0207674_10197575 | |||
| 2366 | Ga0207674_10288408 | |||
| 2367 | Ga0207675_100001961 | |||
| 2368 | Ga0207675_100002780 | |||
| 2369 | Ga0207675_100023842 | |||
| 2370 | Ga0207675_100027174 | |||
| 2371 | Ga0207675_100034443 | |||
| 2372 | Ga0207675_100048944 | |||
| 2373 | Ga0207675_100179457 | |||
| 2374 | Ga0207675_100196272 | |||
| 2375 | Ga0207675_100281120 | |||
| 2376 | Ga0207675_100302616 | |||
| 2377 | Ga0207675_100321919 | |||
| 2378 | Ga0207683_10048058 | |||
| 2379 | Ga0207683_10072444 | |||
| 2380 | Ga0207683_10075713 | |||
| 2381 | Ga0207683_10116065 | |||
| 2382 | Ga0207683_10200125 | |||
| 2383 | Ga0207683_10220060 | |||
| 2384 | Ga0207683_10490057 | |||
| 2385 | Ga0209179_1015421 | |||
| 2386 | Ga0209588_1005892 | |||
| 2387 | Ga0209588_1013432 | |||
| 2388 | Ga0209971_1006519 | |||
| 2389 | Ga0207428_10000285 | |||
| 2390 | Ga0207428_10005347 | |||
| 2391 | Ga0207428_10009579 | |||
| 2392 | Ga0207428_10019994 | |||
| 2393 | Ga0207428_10049425 | |||
| 2394 | Ga0207428_10104509 | |||
| 2395 | Ga0207428_10246372 | |||
| 2396 | Ga0207428_10253670 | |||
| 2397 | Ga0265354_1001565 | |||
| 2398 | Ga0265354_1001601 | |||
| 2399 | Ga0268266_10000153 | |||
| 2400 | Ga0268266_10000217 | |||
| 2401 | Ga0268266_10357377 | |||
| 2402 | Ga0268265_10000714 | |||
| 2403 | Ga0268265_10010217 | |||
| 2404 | Ga0268265_10100882 | |||
| 2405 | Ga0268265_10201002 | |||
| 2406 | Ga0268265_10214148 | |||
| 2407 | Ga0268265_10292863 | |||
| 2408 | Ga0268265_10316410 | |||
| 2409 | Ga0268264_10001337 | |||
| 2410 | Ga0268264_10001966 | |||
| 2411 | Ga0268264_10032193 | |||
| 2412 | Ga0268264_10092137 | |||
| 2413 | Ga0268264_10225569 | |||
| 2414 | Ga0268264_10355430 | |||
| 2415 | Ga0265319_1002464 | |||
| 2416 | Ga0265318_10000320 | |||
| 2417 | Ga0265338_10032726 | |||
| 2418 | Ga0265338_10038545 | |||
| 2419 | Ga0307511_10003746 | |||
| 2420 | Ga0265770_1001477 | |||
| 2421 | Ga0265765_1001239 | |||
| 2422 | Ga0265760_10000020 | |||
| 2423 | Ga0265760_10018513 | |||
| 2424 | Ga0265328_10028844 | |||
| 2425 | Ga0265328_10062127 | |||
| 2426 | Ga0265320_10000139 | |||
| 2427 | Ga0265320_10028961 | |||
| 2428 | Ga0265320_10059973 | |||
| 2429 | Ga0265325_10019621 | |||
| 2430 | Ga0265329_10000050 | |||
| 2431 | Ga0265329_10013066 | |||
| 2432 | Ga0265340_10025923 | |||
| 2433 | Ga0265339_10004465 | |||
| 2434 | Ga0265339_10156312 | |||
| 2435 | Ga0265331_10000135 | |||
| 2436 | Ga0265331_10006194 | |||
| 2437 | Ga0265331_10017191 | |||
| 2438 | Ga0265331_10026792 | |||
| 2439 | Ga0265316_10000531 | |||
| 2440 | Ga0265316_10000752 | |||
| 2441 | Ga0265316_10031452 | |||
| 2442 | Ga0265316_10067052 | |||
| 2443 | Ga0265316_10088298 | |||
| 2444 | Ga0307408_100019683 | |||
| 2445 | Ga0307408_100061025 | |||
| 2446 | Ga0307408_100130347 | |||
| 2447 | Ga0307408_100228101 | |||
| 2448 | Ga0265313_10001857 | |||
| 2449 | Ga0265313_10017309 | |||
| 2450 | Ga0307508_10019767 | |||
| 2451 | Ga0265314_10023524 | |||
| 2452 | Ga0265314_10029100 | |||
| 2453 | Ga0265314_10060442 | |||
| 2454 | Ga0265342_10000694 | |||
| 2455 | Ga0316576_10076797 | |||
| 2456 | Ga0307405_10000638 | |||
| 2457 | Ga0307413_10002032 | |||
| 2458 | Ga0307413_10017654 | |||
| 2459 | Ga0307410_10005295 | |||
| 2460 | Ga0307410_10005377 | |||
| 2461 | Ga0307410_10013809 | |||
| 2462 | Ga0307410_10026539 | |||
| 2463 | Ga0307406_10023741 | |||
| 2464 | Ga0307406_10033035 | |||
| 2465 | Ga0307407_10010455 | |||
| 2466 | Ga0307407_10010616 | |||
| 2467 | Ga0307407_10047429 | |||
| 2468 | Ga0307407_10066880 | |||
| 2469 | Ga0307407_10188770 | |||
| 2470 | Ga0307412_10022746 | |||
| 2471 | Ga0307412_10155456 | |||
| 2472 | Ga0307412_10330698 | |||
| 2473 | Ga0307409_100003656 | |||
| 2474 | Ga0307409_100065126 | |||
| 2475 | Ga0307409_100179543 | |||
| 2476 | Ga0307416_100003391 | |||
| 2477 | Ga0307416_100024508 | |||
| 2478 | Ga0307416_100027297 | |||
| 2479 | Ga0307416_100033527 | |||
| 2480 | Ga0307416_100046069 | |||
| 2481 | Ga0307416_100046391 | |||
| 2482 | Ga0307416_100129459 | |||
| 2483 | Ga0307416_100252380 | |||
| 2484 | Ga0307416_100423376 | |||
| 2485 | Ga0307416_100452523 | |||
| 2486 | Ga0307416_100495620 | |||
| 2487 | Ga0307414_10022618 | |||
| 2488 | Ga0307414_10030123 | |||
| 2489 | Ga0307414_10047654 | |||
| 2490 | Ga0307411_10025874 | |||
| 2491 | Ga0307411_10026725 | |||
| 2492 | Ga0307411_10069895 | |||
| 2493 | Ga0307411_10127043 | |||
| 2494 | Ga0307411_10171712 | |||
| 2495 | Ga0307415_100008737 | |||
| 2496 | Ga0307415_100041972 | |||
| 2497 | Ga0307415_100079332 | |||
| 2498 | Ga0316212_1008675 | |||
| 2499 | Ga0373926_0000176 | |||
| 2500 | Ga0373926_0004885 | |||
| 2501 | Ga0373929_0000003 | |||
| 2502 | Ga0373934_0001676 | |||
| 2503 | Ga0373949_0005553 | |||
| 2504 | Ga0373923_0022394 | |||
| 2505 | Ga0373932_0000061 | |||
| 2506 | Ga0373939_0011753 | |||
| 2507 | Ga0373945_0081489 | |||
| 2508 | Ga0373953_0028136 | |||
| 2509 | Ga0373954_0000648 | |||
| 2510 | Ga0373956_0001011 | |||
| 2511 | Ga0373956_0052747 | |||
| 2512 | Ga0373943_0093778 | |||
| 2513 | Ga0373946_0003193 | |||
| 2514 | Ga0373946_0041329 | |||
| 2515 | Ga0373946_0043801 | |||
| 2516 | Ga0373946_0073681 | |||
| 2517 | Ga0373955_0001645 | |||
| 2518 | Ga0373955_0014880 | |||
| 2519 | Ga0373955_0033421 | |||
| 2520 | Ga0373955_0087608 | |||
| 2521 | Ga0373961_0029778 | |||
| 2522 | Ga0373924_0017810 | |||
| 2523 | Ga0373924_0106313 | |||
| 2524 | Ga0373935_0000906 | |||
| 2525 | Ga0373927_0002502 | |||
| 2526 | Ga0373927_0023331 | |||
| 2527 | Ga0373927_0073760 | |||
| 2528 | Ga0373933_0001863 | |||
| 2529 | Ga0373933_0003491 | |||
| 2530 | Ga0373933_0129955 | |||
| 2531 | Ga0373947_0006424 | |||
| 2532 | Ga0373947_0044879 | |||
| 2533 | Ga0373947_0193851 | |||
| 2534 | Ga0373937_0000001 | |||
| 2535 | Ga0373937_0002907 | |||
| 2536 | Ga0373937_0006161 | |||
| 2537 | Ga0373937_0075873 | |||
| 2538 | Ga0373937_0339566 | |||
| 2539 | Ga0373937_0517493 | |||
| 2540 | Ga0373925_0002897 | |||
| 2541 | Ga0373925_0016760 | |||
| 2542 | Ga0373925_0313476 | |||
| 2543 | Ga0395905_0201526 | |||
| 2544 | Ga0400487_55885 | |||
| 2545 | Ga0436365_1139438 | |||
| 2546 | Ga0436365_1884859 | |||
| 2547 | Ga0439453_0004367 | |||
| 2548 | Ga0439453_0007620 | |||
| 2549 | Ga0439431_0009100 | |||
| 2550 | Ga0439433_0018593 | |||
| 2551 | Ga0439441_005229 | |||
| 2552 | Ga0450894_000401 | |||
| 2553 | Ga0450898_003741 | |||
| 2554 | Ga0439446_0007852 | |||
| 2555 | Ga0439434_0027623 | |||
| 2556 | Ga0439434_0053512 | |||
| 2557 | Ga0439435_0010606 | |||
| 2558 | Ga0439435_0018526 | |||
| 2559 | Ga0439444_0004188 | |||
| 2560 | Ga0439464_0014996 | |||
| 2561 | Ga0439460_0021550 | |||
| 2562 | Ga0451577_0003196 | |||
| 2563 | Ga0451577_0005031 | |||
| 2564 | Ga0451577_0029633 | |||
| 2565 | Ga0451577_0049163 | |||
| 2566 | Ga0451577_0128653 | |||
| 2567 | Ga0451577_0210331 | |||
| 2568 | Ga0451577_0253283 | |||
| 2569 | Ga0453683_0004141 | |||
| 2570 | Ga0453683_0011579 | |||
| 2571 | Ga0453683_0012309 | |||
| 2572 | Ga0453683_0025434 | |||
| 2573 | Ga0453684_0018139 | |||
| 2574 | Ga0453684_0023641 | |||
| 2575 | Ga0453684_0048534 | |||
| 2576 | Ga0453684_0138370 | |||
| 2577 | Ga0451576_0007133 | |||
| 2578 | Ga0451576_0011820 | |||
| 2579 | Ga0451576_0013194 | |||
| 2580 | Ga0451576_0013267 | |||
| 2581 | Ga0451576_0013998 | |||
| 2582 | Ga0451576_0017863 | |||
| 2583 | Ga0451576_0063613 | |||
| 2584 | Ga0451576_0133886 | |||
| 2585 | Ga0451576_0166417 | |||
| 2586 | Ga0495592_0033147 | |||
| 2587 | Ga0495592_0037134 | |||
| 2588 | Ga0495592_0044739 | |||
| 2589 | Ga0495603_0021187 | |||
| 2590 | Ga0495629_0009367 | |||
| 2591 | Ga0495629_0131506 | |||
| 2592 | Ga0495638_0001740 | |||
| 2593 | Ga0495638_0047352 | |||
| 2594 | Ga0495651_0000059 | |||
| 2595 | Ga0495651_0001481 | |||
| 2596 | Ga0495651_0010905 | |||
| 2597 | Ga0495651_0045238 | |||
| 2598 | Ga0495653_0005508 | |||
| 2599 | Ga0495653_0018250 | |||
| 2600 | Ga0495653_0053917 | |||
| 2601 | Ga0495653_0060335 | |||
| 2602 | Ga0495653_0091792 | |||
| 2603 | Ga0495653_0159876 | |||
| 2604 | Ga0495580_0007354 | |||
| 2605 | Ga0495580_0017978 | |||
| 2606 | Ga0495580_0029073 | |||
| 2607 | Ga0495580_0075697 | |||
| 2608 | Ga0495582_0008789 | |||
| 2609 | Ga0495582_0009955 | |||
| 2610 | Ga0495582_0039499 | |||
| 2611 | Ga0495582_0044965 | |||
| 2612 | Ga0495639_0006368 | |||
| 2613 | Ga0495662_0070371 | |||
| 2614 | Ga0495664_0022141 | |||
| 2615 | Ga0495664_0048340 | |||
| 2616 | Ga0495664_0146681 | |||
| 2617 | Ga0495584_0074747 | |||
| 2618 | Ga0495584_0189663 | |||
| 2619 | Ga0495594_0013813 | |||
| 2620 | Ga0495594_0018400 | |||
| 2621 | Ga0495594_0020639 | |||
| 2622 | Ga0495608_0006754 | |||
| 2623 | Ga0495608_0011876 | |||
| 2624 | Ga0495608_0023053 | |||
| 2625 | Ga0495608_0126526 | |||
| 2626 | Ga0495618_0032478 | |||
| 2627 | Ga0495618_0050503 | |||
| 2628 | Ga0495618_0145286 | |||
| 2629 | Ga0495618_0172507 | |||
| 2630 | Ga0495628_0000167 | |||
| 2631 | Ga0495628_0006133 | |||
| 2632 | Ga0495628_0023006 | |||
| 2633 | Ga0495628_0026102 | |||
| 2634 | Ga0495628_0034713 | |||
| 2635 | Ga0495628_0174473 | |||
| 2636 | Ga0495630_0012486 | |||
| 2637 | Ga0495630_0039810 | |||
| 2638 | Ga0495630_0060214 | |||
| 2639 | Ga0495630_0097031 | |||
| 2640 | Ga0495630_0239205 | |||
| 2641 | Ga0495643_0039860 | |||
| 2642 | Ga0495663_0012376 | |||
| 2643 | Ga0495666_0015665 | |||
| 2644 | Ga0495666_0034741 | |||
| 2645 | Ga0495666_0121370 | |||
| 2646 | Ga0495652_0004609 | |||
| 2647 | Ga0495652_0022463 | |||
| 2648 | Ga0495652_0028614 | |||
| 2649 | Ga0495652_0229127 | |||
| 2650 | Ga0495665_0002242 | |||
| 2651 | Ga0495640_0013332 | |||
| 2652 | Ga0495640_0137294 | |||
| 2653 | Ga0495640_0155162 | |||
| 2654 | Ga0495586_0015110 | |||
| 2655 | Ga0495586_0091128 | |||
| 2656 | Ga0495587_0000433 | |||
| 2657 | Ga0495587_0002851 | |||
| 2658 | Ga0495587_0003324 | |||
| 2659 | Ga0495587_0009418 | |||
| 2660 | Ga0495587_0017789 | |||
| 2661 | Ga0495587_0126171 | |||
| 2662 | Ga0495587_0200610 | |||
| 2663 | Ga0495598_0026235 | |||
| 2664 | Ga0495621_0039227 | |||
| 2665 | Ga0495645_0001627 | |||
| 2666 | Ga0495645_0008122 | |||
| 2667 | Ga0495645_0012788 | |||
| 2668 | Ga0495645_0067573 | |||
| 2669 | Ga0495667_0015159 | |||
| 2670 | Ga0495667_0026551 | |||
| 2671 | Ga0495667_0070065 | |||
| 2672 | Ga0495634_0008535 | |||
| 2673 | Ga0495634_0088712 | |||
| 2674 | Ga0495634_0149287 | |||
| 2675 | Ga0495635_0019091 | |||
| 2676 | Ga0495588_0007178 | |||
| 2677 | Ga0495588_0139565 | |||
| 2678 | Ga0495657_0024248 | |||
| 2679 | Ga0495657_0031177 | |||
| 2680 | Ga0495657_0058349 | |||
| 2681 | Ga0495657_0137593 | |||
| 2682 | Ga0495623_0001017 | |||
| 2683 | Ga0495623_0064206 | |||
| 2684 | Ga0495646_0008681 | |||
| 2685 | Ga0495647_0017713 | |||
| 2686 | Ga0495658_0016100 | |||
| 2687 | Ga0495658_0020937 | |||
| 2688 | Ga0495658_0155381 | |||
| 2689 | Ga0495669_0001134 | |||
| 2690 | Ga0495613_0006297 | |||
| 2691 | Ga0495613_0020315 | |||
| 2692 | Ga0495613_0143099 | |||
| 2693 | Ga0495624_0032778 | |||
| 2694 | Ga0495624_0065425 | |||
| 2695 | Ga0495670_0057819 | |||
| 2696 | Ga0495670_0121659 | |||
| 2697 | Ga0495600_0001754 | |||
| 2698 | Ga0495581_0167760 | |||
| 2699 | Ga0495604_0000934 | |||
| 2700 | Ga0495604_0006656 | |||
| 2701 | Ga0495604_0010097 | |||
| 2702 | Ga0495604_0045587 | |||
| 2703 | Ga0495604_0197137 | |||
| 2704 | Ga0495636_0010751 | |||
| 2705 | Ga0495674_0010778 | |||
| 2706 | Ga0495674_0015359 | |||
| 2707 | Ga0495674_0034699 | |||
| 2708 | Ga0495674_0141469 | |||
| 2709 | Ga0495676_0005978 | |||
| 2710 | Ga0495676_0061862 | |||
| 2711 | Ga0495680_0003912 | |||
| 2712 | Ga0495680_0007293 | |||
| 2713 | Ga0495680_0039676 | |||
| 2714 | Ga0495680_0058882 | |||
| 2715 | Ga0495675_0000289 | |||
| 2716 | Ga0495675_0003236 | |||
| 2717 | Ga0495675_0035585 | |||
| 2718 | Ga0495675_0067611 | |||
| 2719 | Ga0495679_022289 | |||
| 2720 | Ga0495684_0000504 | |||
| 2721 | Ga0495684_0006592 | |||
| 2722 | Ga0495684_0008127 | |||
| 2723 | Ga0495684_0137297 | |||
| 2724 | Ga0495684_0249058 | |||
| 2725 | Ga0495593_0008338 | |||
| 2726 | Ga0495593_0103662 | |||
| 2727 | Ga0495593_0138100 | |||
| 2728 | Ga0495602_0000056 | |||
| 2729 | Ga0495602_0004170 | |||
| 2730 | Ga0495602_0011475 | |||
| 2731 | Ga0495602_0015880 | |||
| 2732 | Ga0495602_0054834 | |||
| 2733 | Ga0495602_0143378 | |||
| 2734 | Ga0495614_0020037 | |||
| 2735 | Ga0495614_0021255 | |||
| 2736 | Ga0496100_0012885 | |||
| 2737 | Ga0496100_0043019 | |||
| 2738 | Ga0496100_0049289 | |||
| 2739 | Ga0496100_0098137 | |||
| 2740 | Ga0496101_0006912 | |||
| 2741 | Ga0496101_0087788 | |||
| 2742 | Ga0496102_0010134 | |||
| 2743 | Ga0496102_0012507 | |||
| 2744 | Ga0496102_0021614 | |||
| 2745 | Ga0496103_0029718 | |||
| 2746 | Ga0496104_0000157 | |||
| 2747 | Ga0496104_0097552 | |||
| 2748 | Ga0496104_0115609 | |||
| 2749 | Ga0496104_0130858 | |||
| 2750 | Ga0496105_0083326 | |||
| 2751 | Ga0496105_0100535 | |||
| 2752 | Ga0496105_0129031 | |||
| 2753 | Ga0496106_0015998 | |||
| 2754 | Ga0496106_0028722 | |||
| 2755 | Ga0496106_0046663 | |||
| 2756 | Ga0496106_0222372 | |||
| 2757 | Ga0496107_0038246 | |||
| 2758 | Ga0496107_0045403 | |||
| 2759 | Ga0496108_0003499 | |||
| 2760 | Ga0496108_0148824 | |||
| 2761 | Ga0496108_0421290 | |||
| 2762 | Ga0496109_0009476 | |||
| 2763 | Ga0496109_0047093 | |||
| 2764 | Ga0496110_0000063 | |||
| 2765 | Ga0496110_0377941 | |||
| 2766 | Ga0496111_0004348 | |||
| 2767 | Ga0496111_0073612 | |||
| 2768 | Ga0496112_0000245 | |||
| 2769 | Ga0496112_0024556 | |||
| 2770 | Ga0496112_0031622 | |||
| 2771 | Ga0496112_0045209 | |||
| 2772 | Ga0496112_0060475 | |||
| 2773 | Ga0496112_0131460 | |||
| 2774 | Ga0496113_0009126 | |||
| 2775 | Ga0496113_0245604 | |||
| 2776 | Ga0496113_0264357 | |||
| 2777 | Ga0496114_0000005 | |||
| 2778 | Ga0496114_0000371 | |||
| 2779 | Ga0496114_0017463 | |||
| 2780 | Ga0496114_0048633 | |||
| 2781 | Ga0496114_0079649 | |||
| 2782 | Ga0496115_0017958 | |||
| 2783 | Ga0496115_0038548 | |||
| 2784 | Ga0496115_0050776 | |||
| 2785 | Ga0501031_0081626 | |||
| 2786 | Ga0501032_0063932 | |||
| 2787 | Ga0501033_0001797 | |||
| 2788 | Ga0501033_0108440 | |||
| 2789 | Ga0501034_0014607 | |||
| 2790 | Ga0501034_0015307 | |||
| 2791 | Ga0501034_0029877 | |||
| 2792 | Ga0501034_0083279 | |||
| 2793 | Ga0501034_0087907 | |||
| 2794 | Ga0501036_0005695 | |||
| 2795 | Ga0501036_0014261 | |||
| 2796 | Ga0501036_0020670 | |||
| 2797 | Ga0501036_0023391 | |||
| 2798 | Ga0501036_0097060 | |||
| 2799 | Ga0501036_0185089 | |||
| 2800 | Ga0501036_0218816 | |||
| 2801 | Ga0501036_0285531 | |||
| 2802 | Ga0501037_0001960 | |||
| 2803 | Ga0501037_0021899 | |||
| 2804 | Ga0501037_0054273 | |||
| 2805 | Ga0501038_0043872 | |||
| 2806 | Ga0501038_0075827 | |||
| 2807 | Ga0501038_0110687 | |||
| 2808 | Ga0501038_0117291 | |||
| 2809 | Ga0501039_0003641 | |||
| 2810 | Ga0501039_0024578 | |||
| 2811 | Ga0501040_0009429 | |||
| 2812 | Ga0501040_0047419 | |||
| 2813 | Ga0501040_0059430 | |||
| 2814 | Ga0501040_0198859 | |||
| 2815 | Ga0501041_0010123 | |||
| 2816 | Ga0501041_0018828 | |||
| 2817 | Ga0501041_0133848 | |||
| 2818 | Ga0501042_0025593 | |||
| 2819 | Ga0501042_0028146 | |||
| 2820 | Ga0501042_0034060 | |||
| 2821 | Ga0501042_0038051 | |||
| 2822 | Ga0501042_0058854 | |||
| 2823 | Ga0501042_0063708 | |||
| 2824 | Ga0501042_0084812 | |||
| 2825 | Ga0501042_0181805 | |||
| 2826 | Ga0501042_0195047 | |||
| 2827 | Ga0501042_0224376 | |||
| 2828 | Ga0501043_0013132 | |||
| 2829 | Ga0501043_0118058 | |||
| 2830 | Ga0501043_0146656 | |||
| 2831 | Ga0501046_0014479 | |||
| 2832 | Ga0501046_0014990 | |||
| 2833 | Ga0501046_0046634 | |||
| 2834 | Ga0501046_0368956 | |||
| 2835 | Ga0501047_0006564 | |||
| 2836 | Ga0501047_0088501 | |||
| 2837 | Ga0501047_0139369 | |||
| 2838 | Ga0501047_0147499 | |||
| 2839 | Ga0501047_0250265 | |||
| 2840 | Ga0501048_0004103 | |||
| 2841 | Ga0501048_0008075 | |||
| 2842 | Ga0501048_0033095 | |||
| 2843 | Ga0501048_0037754 | |||
| 2844 | Ga0501048_0082182 | |||
| 2845 | Ga0501048_0140527 | |||
| 2846 | Ga0501067_0001385 | |||
| 2847 | Ga0501068_0012541 | |||
| 2848 | Ga0501068_0015357 | |||
| 2849 | Ga0501069_0022414 | |||
| 2850 | Ga0501069_0027751 | |||
| 2851 | Ga0501069_0147209 | |||
| 2852 | Ga0501070_0005646 | |||
| 2853 | Ga0501070_0022268 | |||
| 2854 | Ga0501071_0019087 | |||
| 2855 | Ga0501071_0019377 | |||
| 2856 | Ga0501071_0024253 | |||
| 2857 | Ga0501071_0136639 | |||
| 2858 | Ga0501071_0196801 | |||
| 2859 | Ga0501071_0286187 | |||
| 2860 | Ga0501072_0015475 | |||
| 2861 | Ga0501072_0026441 | |||
| 2862 | Ga0501072_0052203 | |||
| 2863 | Ga0501072_0108375 | |||
| 2864 | Ga0501072_0110579 | |||
| 2865 | Ga0501072_0233175 | |||
| 2866 | Ga0501072_0357101 | |||
| 2867 | Ga0501073_0003168 | |||
| 2868 | Ga0501073_0008693 | |||
| 2869 | Ga0501073_0039425 | |||
| 2870 | Ga0501073_0062776 | |||
| 2871 | Ga0501074_0003931 | |||
| 2872 | Ga0501074_0044209 | |||
| 2873 | Ga0501074_0055892 | |||
| 2874 | Ga0501074_0079253 | |||
| 2875 | Ga0501074_0098437 | |||
| 2876 | Ga0501074_0143634 | |||
| 2877 | Ga0501075_0001850 | |||
| 2878 | Ga0501075_0005672 | |||
| 2879 | Ga0501075_0014357 | |||
| 2880 | Ga0501075_0034386 | |||
| 2881 | Ga0501075_0078796 | |||
| 2882 | Ga0501075_0096760 | |||
| 2883 | Ga0501075_0128859 | |||
| 2884 | Ga0501075_0203219 | |||
| 2885 | Ga0501076_0000633 | |||
| 2886 | Ga0501076_0005874 | |||
| 2887 | Ga0501076_0041328 | |||
| 2888 | Ga0501076_0050221 | |||
| 2889 | Ga0501076_0072157 | |||
| 2890 | Ga0501076_0091921 | |||
| 2891 | Ga0501076_0143057 | |||
| 2892 | Ga0501076_0145643 | |||
| 2893 | Ga0501076_0214337 | |||
| 2894 | Ga0501076_0286645 | |||
| 2895 | Ga0501076_0303554 | |||
| 2896 | Ga0501077_0021021 | |||
| 2897 | Ga0501249_011801 | |||
| 2898 | Ga0501079_0009681 | |||
| 2899 | Ga0501079_0015604 | |||
| 2900 | Ga0501079_0017966 | |||
| 2901 | Ga0501079_0021979 | |||
| 2902 | Ga0501079_0136919 | |||
| 2903 | Ga0501079_0202661 | |||
| 2904 | Ga0501079_0211349 | |||
| 2905 | Ga0501079_0297257 | |||
| 2906 | Ga0501080_0001466 | |||
| 2907 | Ga0501080_0046033 | |||
| 2908 | Ga0501080_0128544 | |||
| 2909 | Ga0501080_0141101 | |||
| 2910 | Ga0501080_0209310 | |||
| 2911 | Ga0501080_0249396 | |||
| 2912 | Ga0501080_0304333 | |||
| 2913 | Ga0501081_0007223 | |||
| 2914 | Ga0501081_0018947 | |||
| 2915 | Ga0501081_0040573 | |||
| 2916 | Ga0501081_0073426 | |||
| 2917 | Ga0501081_0083342 | |||
| 2918 | Ga0501081_0085253 | |||
| 2919 | Ga0501081_0085428 | |||
| 2920 | Ga0501081_0155177 | |||
| 2921 | Ga0501081_0184799 | |||
| 2922 | Ga0501083_0011031 | |||
| 2923 | Ga0501083_0026727 | |||
| 2924 | Ga0501083_0028261 | |||
| 2925 | Ga0501035_0027160 | |||
| 2926 | Ga0501035_0098220 | |||
| 2927 | Ga0501044_0009040 | |||
| 2928 | Ga0501044_0063277 | |||
| 2929 | Ga0501044_0092305 | |||
| 2930 | Ga0501044_0105112 | |||
| 2931 | Ga0501045_0006147 | |||
| 2932 | Ga0501045_0008164 | |||
| 2933 | Ga0501045_0015928 | |||
| 2934 | Ga0501045_0018451 | |||
| 2935 | Ga0501045_0021060 | |||
| 2936 | Ga0501045_0069439 | |||
| 2937 | Ga0501045_0095660 | |||
| 2938 | nmdc:mga00v17_132837_c1 | |||
| 2939 | nmdc:mga0k408_24845_c1 | |||
| 2940 | nmdc:mga0k408_25943_c1 | |||
| 2941 | nmdc:mga0k408_70841_c1 | |||
| 2942 | nmdc:mga06z11_85054_c1 | |||
| 2943 | nmdc:mga05p37_11748_c1 | |||
| 2944 | nmdc:mga05p37_13533_c1 | |||
| 2945 | nmdc:mga05p37_167522_c1 | |||
| 2946 | nmdc:mga05p37_18779_c1 | |||
| 2947 | nmdc:mga05p37_22849_c1 | |||
| 2948 | nmdc:mga05p37_2888_c1 | |||
| 2949 | nmdc:mga05p37_29_c1 | |||
| 2950 | nmdc:mga05p37_351913_c1 | |||
| 2951 | nmdc:mga05p37_357395_c1 | |||
| 2952 | nmdc:mga05p37_368307_c1 | |||
| 2953 | nmdc:mga05p37_39052_c1 | |||
| 2954 | nmdc:mga05p37_39487_c2 | |||
| 2955 | nmdc:mga05p37_39668_c1 | |||
| 2956 | nmdc:mga05p37_416935_c1 | |||
| 2957 | nmdc:mga05p37_420241_c1 | |||
| 2958 | nmdc:mga05p37_56321_c1 | |||
| 2959 | nmdc:mga05p37_569_c2 | |||
| 2960 | nmdc:mga05p37_610996_c1 | |||
| 2961 | nmdc:mga05p37_73587_c1 | |||
| 2962 | nmdc:mga05p37_90897_c1 | |||
| 2963 | nmdc:mga09592_10035_c1 | |||
| 2964 | nmdc:mga09592_12714_c1 | |||
| 2965 | nmdc:mga09592_14921_c1 | |||
| 2966 | nmdc:mga09592_15438_c1 | |||
| 2967 | nmdc:mga09592_1848_c1 | |||
| 2968 | nmdc:mga09592_20949_c1 | |||
| 2969 | nmdc:mga09592_25857_c1 | |||
| 2970 | nmdc:mga09592_33010_c1 | |||
| 2971 | nmdc:mga0qj67_118605_c2 | |||
| 2972 | nmdc:mga0qj67_122428_c1 | |||
| 2973 | nmdc:mga0qj67_171285_c1 | |||
| 2974 | nmdc:mga0qj67_21098_c1 | |||
| 2975 | nmdc:mga0qj67_234549_c1 | |||
| 2976 | nmdc:mga0qj67_32771_c1 | |||
| 2977 | nmdc:mga0qj67_397745_c1 | |||
| 2978 | nmdc:mga0qj67_41245_c1 | |||
| 2979 | nmdc:mga0qj67_7069_c1 | |||
| 2980 | nmdc:mga0qj67_88608_c1 | |||
| 2981 | nmdc:mga06r32_101775_c1 | |||
| 2982 | nmdc:mga06r32_107864_c1 | |||
| 2983 | nmdc:mga06r32_23263_c1 | |||
| 2984 | nmdc:mga06r32_310264_c1 | |||
| 2985 | nmdc:mga06r32_33345_c1 | |||
| 2986 | nmdc:mga06r32_34703_c1 | |||
| 2987 | nmdc:mga06r32_46528_c1 | |||
| 2988 | nmdc:mga06r32_58764_c1 | |||
| 2989 | nmdc:mga06r32_82552_c1 | |||
| 2990 | nmdc:mga08y16_120436_c1 | |||
| 2991 | nmdc:mga08y16_148914_c1 | |||
| 2992 | nmdc:mga08y16_154608_c1 | |||
| 2993 | nmdc:mga08y16_158977_c1 | |||
| 2994 | nmdc:mga08y16_164841_c1 | |||
| 2995 | nmdc:mga08y16_173829_c1 | |||
| 2996 | nmdc:mga08y16_178964_c1 | |||
| 2997 | nmdc:mga08y16_17_c1 | |||
| 2998 | nmdc:mga08y16_182208_c1 | |||
| 2999 | nmdc:mga08y16_212203_c1 | |||
| 3000 | nmdc:mga08y16_242780_c1 | |||
| 3001 | nmdc:mga08y16_252016_c1 | |||
| 3002 | nmdc:mga08y16_338041_c1 | |||
| 3003 | nmdc:mga08y16_4308_c1 | |||
| 3004 | nmdc:mga08y16_46776_c1 | |||
| 3005 | nmdc:mga08y16_513071_c1 | |||
| 3006 | nmdc:mga08y16_54011_c1 | |||
| 3007 | nmdc:mga08y16_57474_c1 | |||
| 3008 | nmdc:mga08y16_65734_c1 | |||
| 3009 | nmdc:mga08y16_6614_c1 | |||
| 3010 | nmdc:mga08y16_82537_c1 | |||
| 3011 | nmdc:mga0n895_1110_c1 | |||
| 3012 | nmdc:mga0n895_116876_c1 | |||
| 3013 | nmdc:mga0n895_123625_c1 | |||
| 3014 | nmdc:mga0n895_123811_c1 | |||
| 3015 | nmdc:mga0n895_135327_c1 | |||
| 3016 | nmdc:mga0n895_13860_c1 | |||
| 3017 | nmdc:mga0n895_145362_c1 | |||
| 3018 | nmdc:mga0n895_148879_c1 | |||
| 3019 | nmdc:mga0n895_209668_c1 | |||
| 3020 | nmdc:mga0n895_287087_c1 | |||
| 3021 | nmdc:mga0n895_36785_c1 | |||
| 3022 | nmdc:mga0n895_69859_c1 | |||
| 3023 | nmdc:mga0n895_79259_c1 | |||
| 3024 | nmdc:mga0n895_84092_c1 | |||
| 3025 | nmdc:mga0rr50_134599_c1 | |||
| 3026 | nmdc:mga0rr50_2215_c1 | |||
| 3027 | nmdc:mga0rr50_282787_c1 | |||
| 3028 | nmdc:mga0rr50_56489_c1 | |||
| 3029 | nmdc:mga0rr50_58092_c1 | |||
| 3030 | nmdc:mga0rr50_716_c1 | |||
| 3031 | nmdc:mga0rr50_76530_c1 | |||
| 3032 | nmdc:mga0rr50_97048_c1 | |||
| 3033 | nmdc:mga08x19_10017_c1 | |||
| 3034 | nmdc:mga08x19_1347_c1 | |||
| 3035 | nmdc:mga08x19_524_c1 | |||
| 3036 | nmdc:mga08x19_54222_c1 | |||
| 3037 | nmdc:mga0a205_104560_c1 | |||
| 3038 | nmdc:mga0a205_118219_c1 | |||
| 3039 | nmdc:mga0a205_1412_c1 | |||
| 3040 | nmdc:mga0a205_174619_c1 | |||
| 3041 | nmdc:mga0a205_2103_c1 | |||
| 3042 | nmdc:mga0a205_219952_c1 | |||
| 3043 | nmdc:mga0a205_22925_c1 | |||
| 3044 | nmdc:mga0a205_249144_c1 | |||
| 3045 | nmdc:mga0a205_3073_c1 | |||
| 3046 | nmdc:mga0a205_428009_c1 | |||
| 3047 | nmdc:mga0a205_5662_c1 | |||
| 3048 | nmdc:mga0a205_60956_c1 | |||
| 3049 | Ga0495601_0009838 | |||
| 3050 | Ga0495601_0079319 | |||
| 3051 | Ga0495612_0000398 | |||
| 3052 | Ga0495655_0000574 | |||
| 3053 | Ga0495595_0048976 | |||
| 3054 | Ga0495619_0007406 | |||
| 3055 | Ga0495619_0113876 | |||
| 3056 | Ga0495619_0144885 | |||
| 3057 | Ga0495619_0158037 | |||
| 3058 | Ga0495619_0242434 | |||
| 3059 | Ga0500628_003394 | |||
| 3060 | Ga0500628_007908 | |||
| 3061 | Ga0501084_0030447 | |||
| 3062 | Ga0501084_0044927 | |||
| 3063 | Ga0501084_0054785 | |||
| 3064 | Ga0501084_0212131 | |||
| 3065 | Ga0501084_0268347 | |||
| 3066 | Ga0501084_0291544 | |||
| 3067 | Ga0501084_0322180 | |||
| 3068 | Ga0590071_000359 | |||
| 3069 | Ga0590071_008116 | |||
| 3070 | Ga0590071_023051 | |||
| 3071 | Ga0590074_006216 | |||
| 3072 | Ga0590075_000139 | |||
| 3073 | Ga0590075_001920 | |||
| 3074 | Ga0590075_011912 | |||
| 3075 | Ga0590077_000011 | |||
| 3076 | Ga0590077_005365 | |||
| 3077 | Ga0501082_0003063 | |||
| 3078 | Ga0501082_0019848 | |||
| 3079 | Ga0501082_0036375 | |||
| 3080 | Ga0501082_0072004 | |||
| 3081 | Ga0501082_0132483 | |||
| 3082 | Ga0501082_0198994 | |||
| 3083 | Ga0501082_0263380 | |||
| 3084 | Ga0530510_0005554 | |||
| 3085 | Ga0530510_0082052 | |||
| 3086 | Ga0530510_0145796 | |||
| 3087 | Ga0530510_0353601 | |||
| 3088 | 8054359959 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j7k-assembly1.cif.gz_A | thermotoga maritima ruvb p216g mutant | 0.9718 | 31 | 340 |
| 1in5-assembly1.cif.gz_A | thermogota maritima ruvb a156s mutant | 0.9713 | 29 | 340 |
| 1in8-assembly1.cif.gz_A | thermotoga maritima ruvb t158v | 0.9712 | 30 | 340 |
| 1in4-assembly1.cif.gz_A | thermotoga maritima ruvb holliday junction branch migration motor | 0.9712 | 30 | 340 |
| 1in7-assembly1.cif.gz_A | thermotoga maritima ruvb r170a | 0.9712 | 30 | 340 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6blbA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9889 | 191 | 265 | 1.10.8.60 |
| 6blbA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9887 | 31 | 190 | 3.40.50.300 |
| 1in5A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9803 | 267 | 337 | 1.10.10.10 |
| 6blbA03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9709 | 267 | 342 | 1.10.10.10 |
| 6blbA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9701 | 31 | 190 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1G2L0-F1-model_v4 | AAA+ ATPase domain-containing protein | 0.9976 | 49 | 208 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 GO:0016887 |
| AF-A0A6M1X791-F1-model_v4 | deleted | 0.9963 | 31 | 126 |
|
| AF-A0A349UQX2-F1-model_v4 | Holliday junction branch migration DNA helicase RuvB | 0.992 | 64 | 227 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 GO:0016887 |
| AF-A0A7Y2ISW1-F1-model_v4 | AAA family ATPase | 0.9918 | 36 | 145 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |
| AF-A0A6G2DWS7-F1-model_v4 | AAA family ATPase | 0.9911 | 38 | 144 |
GO:0003677
GO:0005524 GO:0006281 GO:0006310 GO:0009378 |