F494672

General Info

Members Datasets Scaffolds Average Seq Length
1544 390 3088 341

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10009963|Ga0105245_100099637
Length 399
Sequence LALFDSRKMPGVQGGRYKNNKALRVGRLDLLARQDKATKAEYSRGGAGMSSGAGREPKMEQPSRRIVTGAALDEDARIDASVRPQRFADYIGQSRVKENIEIAIQAARSRGEALDHVLLYGPPGLGKTTLAQIIASELGVTIKTSSGPLLERKGDLTAILTSLEQREVFFLDEIHRLVPAIEEVLYPAMEDYRIDLVIGQGAGARIHPFILNRFTLIGATTRAGLVTAPLRSRFGIVHRLEFYTSEDLVTIIRRSASILGIAVDDDGAFELARRSRGTPRVANRLLRRARDFAQVRAQGHITLAVAKEALQMLGVDEHGLDEVDRTLMLTILQKYAGGPVGLSTLAASISEEEDAIEEIYEPYLMQLGLLDRTQRGRVATALAYKHFGLESPRRQPGLF

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
248 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
249 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
250 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
251 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
254 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
255 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
256 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
287 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
385 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
386 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
387 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
390 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.26
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 3.17
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10009963 3300009098 Bacteria 8277
2 JGI25406J46586_10013078 3300003203 Bacteria 3581
3 Ga0065712_10003117 3300005290 Bacteria 3928
4 Ga0065712_10067822 3300005290 Bacteria 28686
5 Ga0065712_10068256 3300005290 Bacteria 12406
6 Ga0065712_10069647 3300005290 Bacteria 6927
7 Ga0065712_10086315 3300005290 Bacteria 2636
8 Ga0065712_10092300 3300005290 Bacteria 2336
9 Ga0065712_10096909 3300005290 Bacteria 2168
10 Ga0065712_10117705 3300005290 Bacteria 1716
11 Ga0065715_10010472 3300005293 Bacteria 2805
12 Ga0065715_10090135 3300005293 Bacteria 7597
13 Ga0065715_10093135 3300005293 Bacteria 4798
14 Ga0065715_10093168 3300005293 Bacteria 4784
15 Ga0065715_10094425 3300005293 Bacteria 4344
16 Ga0065715_10113341 3300005293 Bacteria 2493
17 Ga0065715_10117987 3300005293 Bacteria 2330
18 Ga0065707_10001479 3300005295 Bacteria 9195
19 Ga0065707_10082300 3300005295 Bacteria 17197
20 Ga0065707_10114653 3300005295 Bacteria 2291
21 Ga0065707_10132595 3300005295 Bacteria 1895
22 Ga0065707_10162560 3300005295 Bacteria 1550
23 Ga0065707_10167462 3300005295 Bacteria 1511
24 Ga0070676_10007541 3300005328 Bacteria 5844
25 Ga0070676_10026430 3300005328 Bacteria 3286
26 Ga0070676_10042457 3300005328 Bacteria 2640
27 Ga0070683_100000767 3300005329 Bacteria 23601
28 Ga0070683_100200920 3300005329 Bacteria 1893
29 Ga0070690_100016845 3300005330 Bacteria 4387
30 Ga0070690_100047784 3300005330 Bacteria 2723
31 Ga0070690_100137999 3300005330 Bacteria 1653
32 Ga0070670_100004018 3300005331 Bacteria 12279
33 Ga0070670_100005693 3300005331 Bacteria 10524
34 Ga0070670_100006799 3300005331 Bacteria 9681
35 Ga0070670_100014101 3300005331 Bacteria 6857
36 Ga0070670_100053037 3300005331 Bacteria 3482
37 Ga0070670_100068457 3300005331 Bacteria 3047
38 Ga0070670_100082316 3300005331 Bacteria 2766
39 Ga0070670_100117557 3300005331 Bacteria 2293
40 Ga0070677_10001941 3300005333 Bacteria 6558
41 Ga0070677_10016182 3300005333 Bacteria 2653
42 Ga0070677_10051067 3300005333 Bacteria 1672
43 Ga0068869_100001962 3300005334 Bacteria 12329
44 Ga0068869_100019703 3300005334 Bacteria 4615
45 Ga0070666_10016269 3300005335 Bacteria 4756
46 Ga0070666_10063651 3300005335 Bacteria 2500
47 Ga0070666_10112771 3300005335 Bacteria 1881
48 Ga0070682_100000035 3300005337 Bacteria 150016
49 Ga0068868_100043851 3300005338 Bacteria 3494
50 Ga0068868_100141734 3300005338 Bacteria 1973
51 Ga0068868_100144848 3300005338 Bacteria 1953
52 Ga0068868_100194443 3300005338 Bacteria 1688
53 Ga0070660_100154479 3300005339 Bacteria 1847
54 Ga0070689_100016312 3300005340 Bacteria 5435
55 Ga0070689_100020541 3300005340 Bacteria 4902
56 Ga0070689_100023685 3300005340 Bacteria 4599
57 Ga0070689_100059391 3300005340 Bacteria 2972
58 Ga0070689_100100302 3300005340 Bacteria 2291
59 Ga0070689_100172345 3300005340 Bacteria 1754
60 Ga0070691_10005391 3300005341 Bacteria 5817
61 Ga0070687_100003542 3300005343 Bacteria 6079
62 Ga0070687_100006797 3300005343 Bacteria 4718
63 Ga0070687_100186401 3300005343 Bacteria 1247
64 Ga0070687_100246111 3300005343 Bacteria 1108
65 Ga0070661_100023235 3300005344 Bacteria 4443
66 Ga0070661_100032912 3300005344 Bacteria 3754
67 Ga0070661_100067305 3300005344 Bacteria 2632
68 Ga0070668_100025473 3300005347 Bacteria 4484
69 Ga0070669_100002591 3300005353 Bacteria 13067
70 Ga0070669_100027676 3300005353 Bacteria 4080
71 Ga0070669_100040428 3300005353 Bacteria 3389
72 Ga0070669_100058689 3300005353 Bacteria 2824
73 Ga0070669_100103009 3300005353 Bacteria 2156
74 Ga0070669_100136306 3300005353 Bacteria 1888
75 Ga0070669_100189810 3300005353 Bacteria 1611
76 Ga0070675_100000442 3300005354 Bacteria 28196
77 Ga0070675_100001024 3300005354 Bacteria 20115
78 Ga0070675_100012826 3300005354 Bacteria 6576
79 Ga0070675_100024303 3300005354 Bacteria 4852
80 Ga0070675_100031700 3300005354 Bacteria 4275
81 Ga0070675_100035531 3300005354 Bacteria 4050
82 Ga0070675_100037927 3300005354 Bacteria 3926
83 Ga0070675_100049232 3300005354 Bacteria 3458
84 Ga0070675_100064924 3300005354 Bacteria 3018
85 Ga0070675_100072539 3300005354 Bacteria 2858
86 Ga0070675_100106845 3300005354 Bacteria 2363
87 Ga0070675_100126641 3300005354 Bacteria 2173
88 Ga0070675_100159643 3300005354 Bacteria 1938
89 Ga0070675_100171016 3300005354 Bacteria 1874
90 Ga0070675_100254623 3300005354 Bacteria 1537
91 Ga0070671_100022132 3300005355 Bacteria 5193
92 Ga0070671_100359700 3300005355 Bacteria 1243
93 Ga0070674_100004110 3300005356 Bacteria 8268
94 Ga0070674_100016261 3300005356 Bacteria 4662
95 Ga0070674_100052135 3300005356 Bacteria 2821
96 Ga0070674_100052750 3300005356 Bacteria 2806
97 Ga0070674_100071144 3300005356 Bacteria 2459
98 Ga0070674_100080733 3300005356 Bacteria 2323
99 Ga0070674_100098405 3300005356 Bacteria 2126
100 Ga0070674_100100078 3300005356 Bacteria 2110
101 Ga0070673_100007497 3300005364 Bacteria 7204
102 Ga0070673_100008711 3300005364 Bacteria 6767
103 Ga0070673_100011429 3300005364 Bacteria 6056
104 Ga0070673_100039289 3300005364 Bacteria 3620
105 Ga0070673_100045756 3300005364 Bacteria 3396
106 Ga0070673_100052057 3300005364 Bacteria 3211
107 Ga0070673_100054726 3300005364 Bacteria 3140
108 Ga0070673_100058579 3300005364 Bacteria 3046
109 Ga0070673_100074909 3300005364 Bacteria 2728
110 Ga0070673_100082692 3300005364 Bacteria 2607
111 Ga0070673_100272439 3300005364 Bacteria 1482
112 Ga0070688_100009725 3300005365 Bacteria 5277
113 Ga0070688_100021012 3300005365 Bacteria 3806
114 Ga0070688_100085427 3300005365 Bacteria 2051
115 Ga0070688_100101264 3300005365 Bacteria 1900
116 Ga0070688_100118249 3300005365 Bacteria 1771
117 Ga0070688_100206141 3300005365 Bacteria 1378
118 Ga0070667_100014780 3300005367 Bacteria 6449
119 Ga0070667_100106411 3300005367 Bacteria 2428
120 Ga0070667_100156520 3300005367 Bacteria 2004
121 Ga0070667_100207474 3300005367 Bacteria 1741
122 Ga0070667_100262386 3300005367 Bacteria 1547
123 Ga0070703_10003911 3300005406 Bacteria 4220
124 Ga0070703_10019537 3300005406 Bacteria 1964
125 Ga0070709_10004268 3300005434 Bacteria 7711
126 Ga0070709_10037201 3300005434 Bacteria 2971
127 Ga0070709_10069154 3300005434 Bacteria 2273
128 Ga0070714_100165808 3300005435 Bacteria 2002
129 Ga0070713_100028719 3300005436 Bacteria 4395
130 Ga0070713_100031212 3300005436 Bacteria 4242
131 Ga0070713_100097566 3300005436 Bacteria 2540
132 Ga0070713_100199094 3300005436 Bacteria 1808
133 Ga0070701_10007445 3300005438 Bacteria 4678
134 Ga0070701_10025421 3300005438 Bacteria 2876
135 Ga0070701_10025882 3300005438 Bacteria 2854
136 Ga0070711_100009831 3300005439 Bacteria 5899
137 Ga0070711_100083557 3300005439 Bacteria 2282
138 Ga0070711_100212492 3300005439 Bacteria 1499
139 Ga0070705_100000288 3300005440 Bacteria 30044
140 Ga0070705_100000449 3300005440 Bacteria 23638
141 Ga0070705_100026756 3300005440 Bacteria 3143
142 Ga0070705_100057794 3300005440 Bacteria 2289
143 Ga0070705_100115577 3300005440 Bacteria 1723
144 Ga0070700_100003978 3300005441 Bacteria 7679
145 Ga0070700_100010664 3300005441 Bacteria 5075
146 Ga0070700_100011740 3300005441 Bacteria 4862
147 Ga0070700_100153909 3300005441 Bacteria 1575
148 Ga0070694_100000762 3300005444 Bacteria 17985
149 Ga0070694_100020020 3300005444 Bacteria 4262
150 Ga0070694_100028490 3300005444 Bacteria 3635
151 Ga0070694_100032377 3300005444 Bacteria 3434
152 Ga0070694_100180103 3300005444 Bacteria 1563
153 Ga0070694_100335306 3300005444 Bacteria 1168
154 Ga0070708_100019182 3300005445 Bacteria 5741
155 Ga0070708_100028160 3300005445 Bacteria 4832
156 Ga0070708_100048944 3300005445 Bacteria 3739
157 Ga0070708_100057244 3300005445 Bacteria 3470
158 Ga0070708_100205444 3300005445 Bacteria 1845
159 Ga0070708_100293505 3300005445 Bacteria 1531
160 Ga0070708_100325323 3300005445 Bacteria 1448
161 Ga0070663_100009691 3300005455 Bacteria 5975
162 Ga0070678_100237450 3300005456 Bacteria 1522
163 Ga0070662_100036324 3300005457 Bacteria 3484
164 Ga0070662_100050184 3300005457 Bacteria 3010
165 Ga0070662_100076829 3300005457 Bacteria 2476
166 Ga0070681_10000926 3300005458 Bacteria 24766
167 Ga0070681_10005093 3300005458 Bacteria 12679
168 Ga0068867_100004543 3300005459 Bacteria 9755
169 Ga0068867_100007110 3300005459 Bacteria 7911
170 Ga0068867_100012153 3300005459 Bacteria 6083
171 Ga0068867_100015273 3300005459 Bacteria 5443
172 Ga0068867_100040773 3300005459 Bacteria 3391
173 Ga0068867_100068142 3300005459 Bacteria 2655
174 Ga0068867_100110181 3300005459 Bacteria 2114
175 Ga0068867_100129921 3300005459 Bacteria 1956
176 Ga0068867_100235012 3300005459 Bacteria 1483
177 Ga0068867_100414885 3300005459 Bacteria 1139
178 Ga0070685_10002548 3300005466 Bacteria 9333
179 Ga0070685_10003010 3300005466 Bacteria 8594
180 Ga0070685_10191722 3300005466 Bacteria 1323
181 Ga0070706_100007364 3300005467 Bacteria 10323
182 Ga0070706_100017811 3300005467 Bacteria 6553
183 Ga0070706_100062834 3300005467 Bacteria 3431
184 Ga0070706_100070232 3300005467 Bacteria 3239
185 Ga0070706_100201483 3300005467 Bacteria 1859
186 Ga0070707_100000011 3300005468 Bacteria 158252
187 Ga0070707_100002468 3300005468 Bacteria 17624
188 Ga0070707_100045214 3300005468 Bacteria 4215
189 Ga0070707_100049961 3300005468 Bacteria 4009
190 Ga0070707_100052066 3300005468 Bacteria 3924
191 Ga0070707_100060347 3300005468 Bacteria 3637
192 Ga0070707_100103657 3300005468 Bacteria 2757
193 Ga0070707_100211057 3300005468 Bacteria 1892
194 Ga0070698_100001654 3300005471 Bacteria 24859
195 Ga0070698_100002474 3300005471 Bacteria 20388
196 Ga0070698_100014002 3300005471 Bacteria 8483
197 Ga0070698_100015006 3300005471 Bacteria 8189
198 Ga0070698_100072730 3300005471 Bacteria 3446
199 Ga0070698_100163544 3300005471 Bacteria 2169
200 Ga0070699_100000558 3300005518 Bacteria 35133
201 Ga0070699_100009920 3300005518 Bacteria 8250
202 Ga0070699_100026285 3300005518 Bacteria 5021
203 Ga0070699_100042605 3300005518 Bacteria 3929
204 Ga0070699_100060971 3300005518 Bacteria 3269
205 Ga0070699_100063016 3300005518 Bacteria 3214
206 Ga0070699_100091306 3300005518 Bacteria 2662
207 Ga0070699_100104888 3300005518 Bacteria 2479
208 Ga0070699_100152609 3300005518 Bacteria 2044
209 Ga0070699_100217634 3300005518 Bacteria 1702
210 Ga0070699_100421623 3300005518 Bacteria 1208
211 Ga0070679_100011918 3300005530 Bacteria 8298
212 Ga0070679_100124285 3300005530 Bacteria 2563
213 Ga0070684_100004962 3300005535 Bacteria 10158
214 Ga0070684_100010485 3300005535 Bacteria 7343
215 Ga0070684_100122918 3300005535 Bacteria 2336
216 Ga0070697_100004983 3300005536 Bacteria 10194
217 Ga0070697_100057979 3300005536 Bacteria 3151
218 Ga0070697_100097400 3300005536 Bacteria 2441
219 Ga0070697_100162709 3300005536 Bacteria 1886
220 Ga0070697_100162949 3300005536 Bacteria 1884
221 Ga0070697_100267488 3300005536 Bacteria 1465
222 Ga0068853_100174627 3300005539 Bacteria 1946
223 Ga0070672_100000360 3300005543 Bacteria 26221
224 Ga0070672_100037705 3300005543 Bacteria 3689
225 Ga0070672_100066328 3300005543 Bacteria 2858
226 Ga0070672_100104885 3300005543 Bacteria 2297
227 Ga0070672_100115218 3300005543 Bacteria 2194
228 Ga0070672_100144402 3300005543 Bacteria 1965
229 Ga0070672_100247639 3300005543 Bacteria 1500
230 Ga0070686_100006747 3300005544 Bacteria 6388
231 Ga0070686_100147924 3300005544 Bacteria 1642
232 Ga0070695_100000582 3300005545 Bacteria 19251
233 Ga0070695_100008733 3300005545 Bacteria 6021
234 Ga0070695_100165990 3300005545 Bacteria 1554
235 Ga0070695_100296084 3300005545 Bacteria 1194
236 Ga0070696_100001518 3300005546 Bacteria 15229
237 Ga0070696_100003257 3300005546 Bacteria 10825
238 Ga0070696_100018392 3300005546 Bacteria 4722
239 Ga0070696_100033671 3300005546 Bacteria 3522
240 Ga0070696_100070820 3300005546 Bacteria 2453
241 Ga0070693_100000004 3300005547 Bacteria 94899
242 Ga0070693_100005655 3300005547 Bacteria 6029
243 Ga0070665_100000122 3300005548 Bacteria 147483
244 Ga0070665_100002388 3300005548 Bacteria 20707
245 Ga0070665_100003370 3300005548 Bacteria 17092
246 Ga0070665_100166571 3300005548 Bacteria 2206
247 Ga0070704_100000802 3300005549 Bacteria 15581
248 Ga0070704_100012627 3300005549 Bacteria 5223
249 Ga0070704_100012700 3300005549 Bacteria 5210
250 Ga0070704_100020062 3300005549 Bacteria 4303
251 Ga0070704_100049606 3300005549 Bacteria 2946
252 Ga0070704_100133034 3300005549 Bacteria 1931
253 Ga0070704_100153527 3300005549 Bacteria 1813
254 Ga0070704_100197329 3300005549 Bacteria 1622
255 Ga0068855_100345507 3300005563 Bacteria 1640
256 Ga0070664_100009155 3300005564 Bacteria 8040
257 Ga0070664_100040446 3300005564 Bacteria 3930
258 Ga0070664_100050239 3300005564 Bacteria 3529
259 Ga0070664_100054162 3300005564 Bacteria 3403
260 Ga0070664_100128131 3300005564 Bacteria 2228
261 Ga0070664_100147749 3300005564 Bacteria 2074
262 Ga0068857_100031800 3300005577 Bacteria 4663
263 Ga0068857_100041841 3300005577 Bacteria 4063
264 Ga0068857_100043627 3300005577 Bacteria 3977
265 Ga0068857_100124417 3300005577 Bacteria 2323
266 Ga0068854_100011543 3300005578 Bacteria 5758
267 Ga0070702_100002550 3300005615 Bacteria 7914
268 Ga0070702_100041188 3300005615 Bacteria 2589
269 Ga0070702_100105012 3300005615 Bacteria 1740
270 Ga0070702_100153084 3300005615 Bacteria 1482
271 Ga0068852_100026364 3300005616 Bacteria 4723
272 Ga0068852_100176540 3300005616 Bacteria 2006
273 Ga0068859_100004358 3300005617 Bacteria 14441
274 Ga0068859_100007450 3300005617 Bacteria 11108
275 Ga0068859_100023926 3300005617 Bacteria 6129
276 Ga0068859_100034044 3300005617 Bacteria 5115
277 Ga0068859_100053436 3300005617 Bacteria 4063
278 Ga0068859_100098046 3300005617 Bacteria 2985
279 Ga0068864_100000007 3300005618 Bacteria 392187
280 Ga0068864_100008459 3300005618 Bacteria 8492
281 Ga0068864_100008524 3300005618 Bacteria 8459
282 Ga0068864_100022414 3300005618 Bacteria 5296
283 Ga0068864_100037340 3300005618 Bacteria 4146
284 Ga0068864_100066381 3300005618 Bacteria 3131
285 Ga0068864_100067698 3300005618 Bacteria 3101
286 Ga0068864_100166898 3300005618 Bacteria 2005
287 Ga0068864_100276282 3300005618 Bacteria 1567
288 Ga0068864_100486886 3300005618 Bacteria 1185
289 Ga0068866_10010430 3300005718 Bacteria 3982
290 Ga0068861_100001024 3300005719 Bacteria 17105
291 Ga0068861_100004253 3300005719 Bacteria 9595
292 Ga0068861_100011191 3300005719 Bacteria 6229
293 Ga0068861_100018977 3300005719 Bacteria 4905
294 Ga0068861_100092894 3300005719 Bacteria 2385
295 Ga0068861_100130396 3300005719 Bacteria 2040
296 Ga0068861_100346505 3300005719 Bacteria 1301
297 Ga0068861_100383676 3300005719 Bacteria 1242
298 Ga0068851_10012457 3300005834 Bacteria 4009
299 Ga0068870_10002841 3300005840 Bacteria 7291
300 Ga0068870_10006109 3300005840 Bacteria 5293
301 Ga0068870_10006855 3300005840 Bacteria 5052
302 Ga0068870_10014126 3300005840 Bacteria 3766
303 Ga0068870_10066587 3300005840 Bacteria 1951
304 Ga0068870_10183760 3300005840 Bacteria 1257
305 Ga0068863_100089191 3300005841 Bacteria 2923
306 Ga0068863_100131497 3300005841 Bacteria 2390
307 Ga0068863_100135370 3300005841 Bacteria 2354
308 Ga0068858_100000717 3300005842 Bacteria 34513
309 Ga0068858_100010084 3300005842 Bacteria 8969
310 Ga0068858_100059383 3300005842 Bacteria 3535
311 Ga0068858_100096421 3300005842 Bacteria 2756
312 Ga0068858_100098730 3300005842 Bacteria 2722
313 Ga0068858_100182368 3300005842 Bacteria 1982
314 Ga0068860_100000658 3300005843 Bacteria 40219
315 Ga0068860_100002851 3300005843 Bacteria 17951
316 Ga0068860_100015659 3300005843 Bacteria 7403
317 Ga0068860_100095866 3300005843 Bacteria 2828
318 Ga0068860_100185812 3300005843 Bacteria 2010
319 Ga0068860_100196091 3300005843 Bacteria 1956
320 Ga0068860_100276596 3300005843 Bacteria 1640
321 Ga0068862_100002475 3300005844 Bacteria 16354
322 Ga0068862_100006398 3300005844 Bacteria 9794
323 Ga0068862_100016709 3300005844 Bacteria 6110
324 Ga0068862_100018886 3300005844 Bacteria 5744
325 Ga0068862_100167988 3300005844 Bacteria 1962
326 Ga0068862_100169822 3300005844 Bacteria 1952
327 Ga0068862_100172065 3300005844 Bacteria 1939
328 Ga0068862_100312083 3300005844 Bacteria 1449
329 Ga0068862_100484977 3300005844 Bacteria 1171
330 Ga0081539_10000025 3300005985 Bacteria 340255
331 Ga0081539_10000134 3300005985 Bacteria 173625
332 Ga0081539_10004230 3300005985 Bacteria 16158
333 Ga0070717_10000160 3300006028 Bacteria 50638
334 Ga0070717_10288392 3300006028 Bacteria 1457
335 Ga0075368_10006201 3300006042 Bacteria 4165
336 Ga0075432_10055177 3300006058 Bacteria 1407
337 Ga0070715_10063972 3300006163 Bacteria 1623
338 Ga0070716_100004009 3300006173 Bacteria 6991
339 Ga0070716_100042123 3300006173 Bacteria 2547
340 Ga0070716_100201173 3300006173 Bacteria 1324
341 Ga0070716_100219253 3300006173 Bacteria 1277
342 Ga0070712_100021014 3300006175 Bacteria 4280
343 Ga0070712_100077573 3300006175 Bacteria 2395
344 Ga0070712_100112029 3300006175 Bacteria 2038
345 Ga0075367_10003716 3300006178 Bacteria 7337
346 Ga0075367_10060288 3300006178 Bacteria 2262
347 Ga0097621_100005430 3300006237 Bacteria 8984
348 Ga0097621_100058986 3300006237 Bacteria 3141
349 Ga0097621_100059085 3300006237 Bacteria 3138
350 Ga0097621_100089132 3300006237 Bacteria 2579
351 Ga0097621_100100594 3300006237 Bacteria 2432
352 Ga0075370_10076812 3300006353 Bacteria 1916
353 Ga0068871_100001401 3300006358 Bacteria 16134
354 Ga0068871_100016049 3300006358 Bacteria 5628
355 Ga0068871_100060151 3300006358 Bacteria 3098
356 Ga0068871_100075412 3300006358 Bacteria 2784
357 Ga0068871_100117926 3300006358 Bacteria 2239
358 Ga0075428_100000005 3300006844 Bacteria 326130
359 Ga0075428_100002473 3300006844 Bacteria 20060
360 Ga0075428_100003359 3300006844 Bacteria 17508
361 Ga0075428_100006386 3300006844 Bacteria 13120
362 Ga0075428_100009431 3300006844 Bacteria 10834
363 Ga0075428_100016154 3300006844 Bacteria 8253
364 Ga0075428_100027209 3300006844 Bacteria 6331
365 Ga0075428_100048327 3300006844 Bacteria 4670
366 Ga0075428_100057559 3300006844 Bacteria 4255
367 Ga0075428_100166741 3300006844 Bacteria 2389
368 Ga0075428_100395198 3300006844 Bacteria 1482
369 Ga0075428_100442094 3300006844 Bacteria 1393
370 Ga0075430_100002136 3300006846 Bacteria 16365
371 Ga0075430_100002239 3300006846 Bacteria 16031
372 Ga0075430_100005588 3300006846 Bacteria 10624
373 Ga0075430_100014486 3300006846 Bacteria 6716
374 Ga0075430_100020148 3300006846 Bacteria 5675
375 Ga0075430_100034120 3300006846 Bacteria 4318
376 Ga0075430_100095682 3300006846 Bacteria 2482
377 Ga0075430_100175267 3300006846 Bacteria 1784
378 Ga0075430_100314349 3300006846 Bacteria 1295
379 Ga0075431_100000575 3300006847 Bacteria 31085
380 Ga0075431_100001153 3300006847 Bacteria 23746
381 Ga0075431_100005566 3300006847 Bacteria 12437
382 Ga0075431_100007412 3300006847 Bacteria 10923
383 Ga0075431_100010853 3300006847 Bacteria 9164
384 Ga0075431_100032234 3300006847 Bacteria 5400
385 Ga0075431_100074509 3300006847 Bacteria 3502
386 Ga0075431_100177433 3300006847 Bacteria 2188
387 Ga0075431_100192911 3300006847 Bacteria 2087
388 Ga0075431_100198791 3300006847 Bacteria 2052
389 Ga0075431_100330244 3300006847 Bacteria 1536
390 Ga0075433_10003019 3300006852 Bacteria 12931
391 Ga0075433_10050195 3300006852 Bacteria 3631
392 Ga0075433_10065855 3300006852 Bacteria 3178
393 Ga0075433_10067923 3300006852 Bacteria 3128
394 Ga0075433_10083058 3300006852 Bacteria 2826
395 Ga0075433_10088168 3300006852 Bacteria 2741
396 Ga0075433_10097299 3300006852 Bacteria 2605
397 Ga0075434_100000919 3300006871 Bacteria 23605
398 Ga0075434_100025674 3300006871 Bacteria 5765
399 Ga0075434_100037402 3300006871 Bacteria 4805
400 Ga0075434_100051482 3300006871 Bacteria 4093
401 Ga0075434_100062148 3300006871 Bacteria 3717
402 Ga0075434_100084179 3300006871 Bacteria 3179
403 Ga0075434_100100251 3300006871 Bacteria 2902
404 Ga0075434_100110857 3300006871 Bacteria 2755
405 Ga0075434_100127023 3300006871 Bacteria 2567
406 Ga0075434_100166250 3300006871 Bacteria 2226
407 Ga0075434_100176521 3300006871 Bacteria 2156
408 Ga0075434_100193417 3300006871 Bacteria 2055
409 Ga0075434_100204784 3300006871 Bacteria 1993
410 Ga0075434_100271683 3300006871 Bacteria 1714
411 Ga0075434_100396614 3300006871 Bacteria 1401
412 Ga0075434_100487985 3300006871 Bacteria 1253
413 Ga0075429_100003923 3300006880 Bacteria 12713
414 Ga0075429_100013537 3300006880 Bacteria 7077
415 Ga0075429_100016751 3300006880 Bacteria 6347
416 Ga0075429_100035327 3300006880 Bacteria 4347
417 Ga0075429_100036989 3300006880 Bacteria 4249
418 Ga0075429_100068908 3300006880 Bacteria 3079
419 Ga0075429_100091401 3300006880 Bacteria 2655
420 Ga0075429_100112122 3300006880 Bacteria 2384
421 Ga0075429_100116987 3300006880 Bacteria 2330
422 Ga0068865_100105696 3300006881 Bacteria 2068
423 Ga0075436_100007865 3300006914 Bacteria 7295
424 Ga0075436_100008907 3300006914 Bacteria 6869
425 Ga0075436_100011225 3300006914 Bacteria 6141
426 Ga0075436_100037045 3300006914 Bacteria 3367
427 Ga0075436_100042530 3300006914 Bacteria 3134
428 Ga0075436_100090348 3300006914 Bacteria 2129
429 Ga0097620_100004358 3300006931 Bacteria 14441
430 Ga0097620_100007450 3300006931 Bacteria 11108
431 Ga0097620_100023926 3300006931 Bacteria 6129
432 Ga0097620_100034044 3300006931 Bacteria 5115
433 Ga0097620_100053435 3300006931 Bacteria 4063
434 Ga0097620_100098046 3300006931 Bacteria 2985
435 Ga0075435_100000185 3300007076 Bacteria 37052
436 Ga0075435_100004809 3300007076 Bacteria 9342
437 Ga0075435_100006977 3300007076 Bacteria 8019
438 Ga0075435_100035383 3300007076 Bacteria 3963
439 Ga0075435_100336062 3300007076 Bacteria 1294
440 Ga0099794_10010639 3300007265 Bacteria 3912
441 Ga0099794_10012772 3300007265 Bacteria 3637
442 Ga0099794_10019314 3300007265 Bacteria 3067
443 Ga0099794_10049428 3300007265 Bacteria 2021
444 Ga0099794_10050745 3300007265 Bacteria 1996
445 Ga0099795_10011684 3300007788 Bacteria 2635
446 Ga0105240_10018260 3300009093 Bacteria 9428
447 Ga0105240_10024901 3300009093 Bacteria 7878
448 Ga0105240_10045142 3300009093 Bacteria 5593
449 Ga0105240_10118771 3300009093 Bacteria 3186
450 Ga0111539_10000008 3300009094 Bacteria 382609
451 Ga0111539_10010233 3300009094 Bacteria 11819
452 Ga0111539_10015435 3300009094 Bacteria 9501
453 Ga0111539_10017849 3300009094 Bacteria 8786
454 Ga0111539_10053056 3300009094 Bacteria 4826
455 Ga0111539_10069612 3300009094 Bacteria 4155
456 Ga0111539_10120056 3300009094 Bacteria 3080
457 Ga0111539_10162093 3300009094 Bacteria 2615
458 Ga0111539_10172713 3300009094 Bacteria 2525
459 Ga0111539_10237395 3300009094 Bacteria 2122
460 Ga0111539_10259101 3300009094 Bacteria 2025
461 Ga0111539_10366046 3300009094 Bacteria 1678
462 Ga0111539_10385603 3300009094 Bacteria 1631
463 Ga0111539_10419146 3300009094 Bacteria 1559
464 Ga0111539_10428901 3300009094 Bacteria 1540
465 Ga0111539_10505083 3300009094 Bacteria 1408
466 Ga0111539_10531179 3300009094 Bacteria 1371
467 Ga0105245_10004535 3300009098 Bacteria 12264
468 Ga0105245_10005359 3300009098 Bacteria 11269
469 Ga0105245_10033714 3300009098 Bacteria 4538
470 Ga0105245_10050297 3300009098 Bacteria 3735
471 Ga0105245_10152435 3300009098 Bacteria 2186
472 Ga0114129_10000574 3300009147 Bacteria 45251
473 Ga0114129_10001790 3300009147 Bacteria 29271
474 Ga0114129_10002431 3300009147 Bacteria 25841
475 Ga0114129_10007344 3300009147 Bacteria 15689
476 Ga0114129_10008510 3300009147 Bacteria 14623
477 Ga0114129_10020281 3300009147 Bacteria 9460
478 Ga0114129_10024870 3300009147 Bacteria 8491
479 Ga0114129_10049166 3300009147 Bacteria 5927
480 Ga0114129_10057984 3300009147 Bacteria 5418
481 Ga0114129_10103084 3300009147 Bacteria 3945
482 Ga0114129_10126427 3300009147 Bacteria 3514
483 Ga0114129_10147067 3300009147 Bacteria 3227
484 Ga0114129_10191633 3300009147 Bacteria 2776
485 Ga0114129_10400489 3300009147 Bacteria 1809
486 Ga0114129_10413203 3300009147 Unclassified 1776
487 Ga0105243_10013883 3300009148 Bacteria 6098
488 Ga0105243_10077158 3300009148 Bacteria 2709
489 Ga0105243_10118442 3300009148 Bacteria 2228
490 Ga0105243_10229795 3300009148 Bacteria 1645
491 Ga0105241_10033243 3300009174 Bacteria 3871
492 Ga0105241_10360000 3300009174 Bacteria 1266
493 Ga0105242_10007676 3300009176 Bacteria 8301
494 Ga0105242_10074387 3300009176 Bacteria 2827
495 Ga0105242_10129741 3300009176 Bacteria 2174
496 Ga0105242_10142896 3300009176 Bacteria 2079
497 Ga0105248_10001544 3300009177 Bacteria 25631
498 Ga0105248_10029775 3300009177 Bacteria 6092
499 Ga0105248_10039996 3300009177 Bacteria 5255
500 Ga0105248_10084089 3300009177 Bacteria 3579
501 Ga0105248_10093304 3300009177 Bacteria 3390
502 Ga0105248_10100342 3300009177 Bacteria 3262
503 Ga0105248_10119465 3300009177 Bacteria 2973
504 Ga0105248_10128088 3300009177 Bacteria 2864
505 Ga0105248_10182129 3300009177 Bacteria 2367
506 Ga0105248_10207658 3300009177 Bacteria 2207
507 Ga0105248_10410839 3300009177 Bacteria 1524
508 Ga0105238_10000002 3300009551 Bacteria 772711
509 Ga0105238_10203277 3300009551 Bacteria 1957
510 Ga0105249_10021476 3300009553 Bacteria 5779
511 Ga0105249_10032539 3300009553 Bacteria 4719
512 Ga0105249_10052119 3300009553 Bacteria 3736
513 Ga0105249_10104120 3300009553 Bacteria 2674
514 Ga0105249_10549398 3300009553 Bacteria 1205
515 Ga0099796_10002341 3300010159 Bacteria 4139
516 Ga0105239_10051109 3300010375 Bacteria 4532
517 Ga0105246_10016281 3300011119 Bacteria 4707
518 Ga0157374_10000038 3300013296 Bacteria 169868
519 Ga0157374_10001975 3300013296 Bacteria 17206
520 Ga0157374_10179131 3300013296 Bacteria 2070
521 Ga0157374_10200211 3300013296 Bacteria 1955
522 Ga0157378_10000044 3300013297 Bacteria 106822
523 Ga0157378_10000678 3300013297 Bacteria 31999
524 Ga0157378_10001262 3300013297 Bacteria 22775
525 Ga0157378_10002388 3300013297 Bacteria 16681
526 Ga0157378_10003083 3300013297 Bacteria 14811
527 Ga0157378_10281354 3300013297 Bacteria 1603
528 Ga0157378_10299363 3300013297 Bacteria 1556
529 Ga0163162_10006374 3300013306 Bacteria 11424
530 Ga0163162_10030754 3300013306 Bacteria 5321
531 Ga0163162_10031743 3300013306 Bacteria 5241
532 Ga0163162_10072255 3300013306 Bacteria 3505
533 Ga0157375_10000003 3300013308 Bacteria 476325
534 Ga0157375_10000010 3300013308 Bacteria 361011
535 Ga0157375_10006844 3300013308 Bacteria 9934
536 Ga0157375_10046618 3300013308 Bacteria 4228
537 Ga0157375_10094436 3300013308 Bacteria 3060
538 Ga0163163_10000023 3300014325 Bacteria 185843
539 Ga0163163_10007293 3300014325 Bacteria 9753
540 Ga0163163_10015982 3300014325 Bacteria 6956
541 Ga0163163_10074644 3300014325 Bacteria 3383
542 Ga0163163_10347387 3300014325 Bacteria 1539
543 Ga0157380_10007520 3300014326 Bacteria 7739
544 Ga0157380_10008698 3300014326 Bacteria 7257
545 Ga0157380_10011997 3300014326 Bacteria 6270
546 Ga0157380_10013898 3300014326 Bacteria 5878
547 Ga0157380_10015991 3300014326 Bacteria 5524
548 Ga0157380_10044711 3300014326 Bacteria 3472
549 Ga0157380_10049170 3300014326 Bacteria 3324
550 Ga0157380_10068673 3300014326 Bacteria 2857
551 Ga0157380_10084766 3300014326 Bacteria 2599
552 Ga0157380_10196324 3300014326 Bacteria 1786
553 Ga0157380_10204107 3300014326 Bacteria 1756
554 Ga0157380_10303700 3300014326 Bacteria 1471
555 Ga0157380_10331615 3300014326 Bacteria 1415
556 Ga0157377_10000004 3300014745 Bacteria 430019
557 Ga0157377_10000074 3300014745 Bacteria 77443
558 Ga0157377_10002734 3300014745 Bacteria 7847
559 Ga0157377_10008196 3300014745 Bacteria 5085
560 Ga0157379_10005070 3300014968 Bacteria 11291
561 Ga0157379_10207188 3300014968 Bacteria 1774
562 Ga0157376_10000003 3300014969 Bacteria 568634
563 Ga0157376_10000008 3300014969 Bacteria 351192
564 Ga0157376_10000231 3300014969 Bacteria 38978
565 Ga0157376_10055323 3300014969 Bacteria 3310
566 Ga0157376_10138252 3300014969 Bacteria 2182
567 Ga0157376_10325007 3300014969 Bacteria 1464
568 Ga0157376_10610909 3300014969 Bacteria 1086
569 Ga0163161_10024629 3300017792 Bacteria 4253
570 Ga0163161_10072790 3300017792 Bacteria 2517
571 Ga0228598_1000166 3300024227 Bacteria 11590
572 Ga0207697_10007162 3300025315 Bacteria 4990
573 Ga0207697_10025607 3300025315 Bacteria 2411
574 Ga0207653_10000691 3300025885 Bacteria 11593
575 Ga0207682_10002808 3300025893 Bacteria 7700
576 Ga0207682_10008627 3300025893 Bacteria 4029
577 Ga0207682_10026000 3300025893 Bacteria 2323
578 Ga0207682_10035209 3300025893 Bacteria 2021
579 Ga0207642_10002113 3300025899 Bacteria 6145
580 Ga0207642_10072235 3300025899 Bacteria 1646
581 Ga0207688_10000078 3300025901 Bacteria 37290
582 Ga0207688_10023905 3300025901 Bacteria 3350
583 Ga0207688_10122377 3300025901 Bacteria 1519
584 Ga0207685_10048472 3300025905 Bacteria 1627
585 Ga0207699_10001243 3300025906 Bacteria 12111
586 Ga0207699_10021854 3300025906 Bacteria 3458
587 Ga0207699_10044858 3300025906 Bacteria 2576
588 Ga0207699_10056021 3300025906 Bacteria 2348
589 Ga0207699_10060540 3300025906 Bacteria 2274
590 Ga0207645_10000374 3300025907 Bacteria 37092
591 Ga0207645_10001092 3300025907 Bacteria 22384
592 Ga0207645_10010985 3300025907 Bacteria 6195
593 Ga0207645_10034102 3300025907 Bacteria 3270
594 Ga0207645_10047816 3300025907 Bacteria 2732
595 Ga0207643_10003058 3300025908 Bacteria 8996
596 Ga0207643_10006513 3300025908 Bacteria 6254
597 Ga0207643_10038368 3300025908 Bacteria 2690
598 Ga0207643_10064690 3300025908 Bacteria 2093
599 Ga0207643_10101174 3300025908 Bacteria 1690
600 Ga0207643_10168825 3300025908 Bacteria 1320
601 Ga0207643_10186244 3300025908 Bacteria 1258
602 Ga0207684_10002227 3300025910 Bacteria 19778
603 Ga0207684_10048144 3300025910 Bacteria 3615
604 Ga0207684_10051922 3300025910 Bacteria 3479
605 Ga0207707_10008909 3300025912 Bacteria 8713
606 Ga0207707_10022422 3300025912 Bacteria 5520
607 Ga0207695_10034283 3300025913 Bacteria 5523
608 Ga0207695_10119515 3300025913 Bacteria 2605
609 Ga0207671_10147123 3300025914 Bacteria 1818
610 Ga0207693_10003389 3300025915 Bacteria 13619
611 Ga0207693_10015404 3300025915 Bacteria 6135
612 Ga0207693_10015622 3300025915 Bacteria 6087
613 Ga0207693_10034863 3300025915 Bacteria 3969
614 Ga0207693_10194445 3300025915 Bacteria 1596
615 Ga0207663_10006081 3300025916 Bacteria 6139
616 Ga0207663_10059865 3300025916 Bacteria 2411
617 Ga0207663_10066980 3300025916 Bacteria 2301
618 Ga0207660_10108613 3300025917 Bacteria 2084
619 Ga0207662_10007437 3300025918 Bacteria 5966
620 Ga0207662_10034763 3300025918 Bacteria 2941
621 Ga0207662_10056672 3300025918 Bacteria 2341
622 Ga0207662_10068771 3300025918 Bacteria 2139
623 Ga0207657_10131981 3300025919 Bacteria 2046
624 Ga0207649_10005573 3300025920 Bacteria 6809
625 Ga0207649_10085622 3300025920 Bacteria 2051
626 Ga0207652_10015551 3300025921 Bacteria 6190
627 Ga0207646_10000055 3300025922 Bacteria 158886
628 Ga0207646_10000122 3300025922 Bacteria 105908
629 Ga0207646_10001764 3300025922 Bacteria 26210
630 Ga0207646_10044362 3300025922 Bacteria 3991
631 Ga0207646_10051322 3300025922 Bacteria 3691
632 Ga0207646_10089322 3300025922 Bacteria 2758
633 Ga0207646_10115678 3300025922 Bacteria 2409
634 Ga0207646_10407768 3300025922 Bacteria 1227
635 Ga0207681_10000705 3300025923 Bacteria 21963
636 Ga0207681_10030851 3300025923 Bacteria 3497
637 Ga0207681_10048185 3300025923 Bacteria 2875
638 Ga0207681_10048216 3300025923 Bacteria 2874
639 Ga0207681_10049316 3300025923 Bacteria 2845
640 Ga0207681_10057761 3300025923 Bacteria 2653
641 Ga0207681_10080337 3300025923 Bacteria 2300
642 Ga0207681_10095641 3300025923 Bacteria 2131
643 Ga0207681_10164773 3300025923 Bacteria 1674
644 Ga0207681_10167476 3300025923 Bacteria 1662
645 Ga0207681_10372897 3300025923 Bacteria 1147
646 Ga0207694_10000001 3300025924 Bacteria 4078485
647 Ga0207650_10010475 3300025925 Bacteria 6358
648 Ga0207650_10015200 3300025925 Bacteria 5357
649 Ga0207650_10017612 3300025925 Bacteria 5003
650 Ga0207650_10019816 3300025925 Bacteria 4733
651 Ga0207650_10030655 3300025925 Bacteria 3876
652 Ga0207650_10119526 3300025925 Bacteria 2050
653 Ga0207650_10223524 3300025925 Bacteria 1516
654 Ga0207659_10000501 3300025926 Bacteria 23548
655 Ga0207659_10003555 3300025926 Bacteria 9373
656 Ga0207659_10014754 3300025926 Bacteria 5049
657 Ga0207659_10020760 3300025926 Bacteria 4348
658 Ga0207659_10064234 3300025926 Bacteria 2656
659 Ga0207659_10073756 3300025926 Bacteria 2500
660 Ga0207659_10098749 3300025926 Bacteria 2196
661 Ga0207659_10139943 3300025926 Bacteria 1878
662 Ga0207687_10000771 3300025927 Bacteria 21608
663 Ga0207687_10008609 3300025927 Bacteria 6672
664 Ga0207687_10034362 3300025927 Bacteria 3442
665 Ga0207687_10067081 3300025927 Bacteria 2551
666 Ga0207687_10067321 3300025927 Bacteria 2547
667 Ga0207700_10044131 3300025928 Bacteria 3280
668 Ga0207700_10063685 3300025928 Bacteria 2806
669 Ga0207700_10078610 3300025928 Bacteria 2567
670 Ga0207700_10097605 3300025928 Bacteria 2335
671 Ga0207700_10141252 3300025928 Bacteria 1979
672 Ga0207700_10178810 3300025928 Bacteria 1775
673 Ga0207664_10109716 3300025929 Bacteria 2293
674 Ga0207644_10046516 3300025931 Bacteria 3092
675 Ga0207644_10050148 3300025931 Bacteria 2991
676 Ga0207644_10067758 3300025931 Bacteria 2602
677 Ga0207644_10078777 3300025931 Bacteria 2430
678 Ga0207644_10181615 3300025931 Bacteria 1649
679 Ga0207690_10010646 3300025932 Bacteria 5480
680 Ga0207690_10082194 3300025932 Bacteria 2253
681 Ga0207690_10106393 3300025932 Bacteria 2013
682 Ga0207690_10134218 3300025932 Bacteria 1816
683 Ga0207706_10005517 3300025933 Bacteria 11795
684 Ga0207706_10039316 3300025933 Bacteria 4193
685 Ga0207706_10042267 3300025933 Bacteria 4040
686 Ga0207706_10054366 3300025933 Bacteria 3534
687 Ga0207706_10075480 3300025933 Bacteria 2964
688 Ga0207706_10075776 3300025933 Bacteria 2959
689 Ga0207686_10017235 3300025934 Bacteria 4067
690 Ga0207686_10046039 3300025934 Bacteria 2688
691 Ga0207686_10085013 3300025934 Bacteria 2074
692 Ga0207686_10099192 3300025934 Bacteria 1941
693 Ga0207686_10106152 3300025934 Bacteria 1885
694 Ga0207686_10235655 3300025934 Bacteria 1329
695 Ga0207709_10007327 3300025935 Bacteria 6151
696 Ga0207709_10025497 3300025935 Bacteria 3385
697 Ga0207709_10040623 3300025935 Bacteria 2786
698 Ga0207709_10058837 3300025935 Bacteria 2390
699 Ga0207709_10125183 3300025935 Bacteria 1742
700 Ga0207670_10011233 3300025936 Bacteria 5191
701 Ga0207670_10022933 3300025936 Bacteria 3877
702 Ga0207670_10048147 3300025936 Bacteria 2843
703 Ga0207670_10051749 3300025936 Bacteria 2759
704 Ga0207670_10051766 3300025936 Bacteria 2759
705 Ga0207670_10068660 3300025936 Bacteria 2443
706 Ga0207670_10113522 3300025936 Bacteria 1957
707 Ga0207670_10240256 3300025936 Bacteria 1395
708 Ga0207670_10317870 3300025936 Bacteria 1224
709 Ga0207669_10010135 3300025937 Bacteria 4526
710 Ga0207669_10010275 3300025937 Bacteria 4501
711 Ga0207669_10022027 3300025937 Bacteria 3377
712 Ga0207669_10139147 3300025937 Bacteria 1682
713 Ga0207669_10177867 3300025937 Bacteria 1522
714 Ga0207704_10011415 3300025938 Bacteria 4374
715 Ga0207704_10225874 3300025938 Bacteria 1389
716 Ga0207704_10261912 3300025938 Bacteria 1304
717 Ga0207665_10000008 3300025939 Bacteria 173434
718 Ga0207665_10008235 3300025939 Bacteria 6883
719 Ga0207665_10050032 3300025939 Bacteria 2809
720 Ga0207665_10052689 3300025939 Bacteria 2742
721 Ga0207665_10080243 3300025939 Bacteria 2244
722 Ga0207665_10136108 3300025939 Bacteria 1748
723 Ga0207665_10197299 3300025939 Bacteria 1465
724 Ga0207665_10246000 3300025939 Bacteria 1320
725 Ga0207665_10260036 3300025939 Bacteria 1286
726 Ga0207691_10006666 3300025940 Bacteria 11139
727 Ga0207691_10008868 3300025940 Bacteria 9654
728 Ga0207691_10010705 3300025940 Bacteria 8805
729 Ga0207691_10036965 3300025940 Bacteria 4524
730 Ga0207691_10040373 3300025940 Bacteria 4312
731 Ga0207691_10043122 3300025940 Bacteria 4158
732 Ga0207691_10064984 3300025940 Bacteria 3304
733 Ga0207691_10067224 3300025940 Bacteria 3241
734 Ga0207691_10104004 3300025940 Bacteria 2531
735 Ga0207691_10200543 3300025940 Bacteria 1737
736 Ga0207711_10070974 3300025941 Bacteria 3021
737 Ga0207711_10076066 3300025941 Bacteria 2923
738 Ga0207711_10078675 3300025941 Bacteria 2877
739 Ga0207711_10121043 3300025941 Bacteria 2336
740 Ga0207689_10004769 3300025942 Bacteria 12231
741 Ga0207689_10006874 3300025942 Bacteria 10004
742 Ga0207689_10023079 3300025942 Bacteria 5225
743 Ga0207689_10066454 3300025942 Bacteria 2965
744 Ga0207689_10094010 3300025942 Bacteria 2462
745 Ga0207689_10136530 3300025942 Bacteria 2020
746 Ga0207689_10148118 3300025942 Bacteria 1934
747 Ga0207689_10300848 3300025942 Bacteria 1330
748 Ga0207689_10365401 3300025942 Bacteria 1200
749 Ga0207661_10000567 3300025944 Bacteria 23624
750 Ga0207661_10076026 3300025944 Bacteria 2757
751 Ga0207661_10225408 3300025944 Bacteria 1658
752 Ga0207679_10002887 3300025945 Bacteria 10658
753 Ga0207679_10008110 3300025945 Bacteria 6680
754 Ga0207679_10038680 3300025945 Bacteria 3401
755 Ga0207679_10061002 3300025945 Bacteria 2805
756 Ga0207679_10080569 3300025945 Bacteria 2486
757 Ga0207679_10195768 3300025945 Bacteria 1684
758 Ga0207679_10345999 3300025945 Bacteria 1294
759 Ga0207679_10466302 3300025945 Bacteria 1122
760 Ga0207651_10003088 3300025960 Bacteria 8094
761 Ga0207651_10013243 3300025960 Bacteria 4710
762 Ga0207651_10017893 3300025960 Bacteria 4200
763 Ga0207651_10017894 3300025960 Bacteria 4200
764 Ga0207651_10025651 3300025960 Bacteria 3667
765 Ga0207651_10068350 3300025960 Bacteria 2504
766 Ga0207651_10079593 3300025960 Bacteria 2355
767 Ga0207651_10093640 3300025960 Bacteria 2207
768 Ga0207651_10136320 3300025960 Bacteria 1888
769 Ga0207651_10164201 3300025960 Bacteria 1744
770 Ga0207651_10328403 3300025960 Bacteria 1281
771 Ga0207712_10020761 3300025961 Bacteria 4306
772 Ga0207712_10026599 3300025961 Bacteria 3856
773 Ga0207712_10033799 3300025961 Bacteria 3459
774 Ga0207712_10135594 3300025961 Bacteria 1882
775 Ga0207712_10179426 3300025961 Bacteria 1662
776 Ga0207668_10172199 3300025972 Bacteria 1699
777 Ga0207640_10005632 3300025981 Bacteria 6828
778 Ga0207640_10018088 3300025981 Bacteria 4134
779 Ga0207640_10053034 3300025981 Bacteria 2645
780 Ga0207658_10085333 3300025986 Bacteria 2432
781 Ga0207677_10030076 3300026023 Bacteria 3461
782 Ga0207677_10112640 3300026023 Bacteria 2029
783 Ga0207677_10259951 3300026023 Bacteria 1415
784 Ga0207703_10111147 3300026035 Bacteria 2338
785 Ga0207703_10183813 3300026035 Bacteria 1846
786 Ga0207703_10251546 3300026035 Bacteria 1593
787 Ga0207703_10365100 3300026035 Bacteria 1332
788 Ga0207639_10000028 3300026041 Bacteria 197736
789 Ga0207639_10078745 3300026041 Bacteria 2602
790 Ga0207678_10019603 3300026067 Bacteria 5946
791 Ga0207678_10064943 3300026067 Bacteria 3135
792 Ga0207708_10030417 3300026075 Bacteria 4093
793 Ga0207708_10052944 3300026075 Bacteria 3091
794 Ga0207708_10060418 3300026075 Bacteria 2893
795 Ga0207708_10077717 3300026075 Bacteria 2548
796 Ga0207708_10078793 3300026075 Bacteria 2530
797 Ga0207708_10087996 3300026075 Bacteria 2392
798 Ga0207708_10109996 3300026075 Bacteria 2138
799 Ga0207708_10352092 3300026075 Bacteria 1208
800 Ga0207641_10068952 3300026088 Bacteria 3034
801 Ga0207641_10176334 3300026088 Bacteria 1954
802 Ga0207648_10003537 3300026089 Bacteria 16338
803 Ga0207648_10006736 3300026089 Bacteria 11394
804 Ga0207648_10014255 3300026089 Bacteria 7349
805 Ga0207648_10026662 3300026089 Bacteria 5133
806 Ga0207648_10037009 3300026089 Bacteria 4298
807 Ga0207648_10040076 3300026089 Bacteria 4116
808 Ga0207648_10055320 3300026089 Bacteria 3464
809 Ga0207648_10061425 3300026089 Bacteria 3277
810 Ga0207676_10000015 3300026095 Bacteria 329100
811 Ga0207676_10036130 3300026095 Bacteria 3756
812 Ga0207676_10082326 3300026095 Bacteria 2617
813 Ga0207676_10082601 3300026095 Bacteria 2614
814 Ga0207676_10084144 3300026095 Bacteria 2592
815 Ga0207676_10116410 3300026095 Bacteria 2246
816 Ga0207676_10130061 3300026095 Bacteria 2139
817 Ga0207676_10272370 3300026095 Bacteria 1534
818 Ga0207674_10035104 3300026116 Bacteria 5235
819 Ga0207674_10067461 3300026116 Bacteria 3601
820 Ga0207674_10137541 3300026116 Bacteria 2404
821 Ga0207674_10197575 3300026116 Bacteria 1961
822 Ga0207674_10288408 3300026116 Bacteria 1590
823 Ga0207675_100001961 3300026118 Bacteria 20530
824 Ga0207675_100002780 3300026118 Bacteria 17190
825 Ga0207675_100023842 3300026118 Bacteria 5691
826 Ga0207675_100027174 3300026118 Bacteria 5330
827 Ga0207675_100034443 3300026118 Bacteria 4722
828 Ga0207675_100048944 3300026118 Bacteria 3945
829 Ga0207675_100179457 3300026118 Bacteria 2027
830 Ga0207675_100196272 3300026118 Bacteria 1937
831 Ga0207675_100281120 3300026118 Bacteria 1617
832 Ga0207675_100302616 3300026118 Bacteria 1558
833 Ga0207675_100321919 3300026118 Bacteria 1510
834 Ga0207683_10048058 3300026121 Bacteria 3737
835 Ga0207683_10072444 3300026121 Bacteria 3047
836 Ga0207683_10075713 3300026121 Bacteria 2979
837 Ga0207683_10116065 3300026121 Bacteria 2400
838 Ga0207683_10200125 3300026121 Bacteria 1815
839 Ga0207683_10220060 3300026121 Bacteria 1730
840 Ga0207683_10490057 3300026121 Bacteria 1135
841 Ga0209179_1015421 3300027512 Bacteria 1419
842 Ga0209588_1005892 3300027671 Bacteria 3533
843 Ga0209588_1013432 3300027671 Bacteria 2496
844 Ga0209971_1006519 3300027682 Bacteria 2761
845 Ga0207428_10000285 3300027907 Bacteria 68342
846 Ga0207428_10005347 3300027907 Bacteria 11972
847 Ga0207428_10009579 3300027907 Bacteria 8675
848 Ga0207428_10019994 3300027907 Bacteria 5702
849 Ga0207428_10049425 3300027907 Bacteria 3370
850 Ga0207428_10104509 3300027907 Bacteria 2185
851 Ga0207428_10246372 3300027907 Bacteria 1334
852 Ga0207428_10253670 3300027907 Bacteria 1311
853 Ga0265354_1001565 3300028016 Bacteria 3212
854 Ga0265354_1001601 3300028016 Bacteria 3167
855 Ga0268266_10000153 3300028379 Bacteria 131887
856 Ga0268266_10000217 3300028379 Bacteria 100718
857 Ga0268266_10357377 3300028379 Bacteria 1374
858 Ga0268265_10000714 3300028380 Bacteria 32686
859 Ga0268265_10010217 3300028380 Bacteria 6337
860 Ga0268265_10100882 3300028380 Bacteria 2331
861 Ga0268265_10201002 3300028380 Bacteria 1729
862 Ga0268265_10214148 3300028380 Bacteria 1681
863 Ga0268265_10292863 3300028380 Bacteria 1462
864 Ga0268265_10316410 3300028380 Bacteria 1411
865 Ga0268264_10001337 3300028381 Bacteria 23185
866 Ga0268264_10001966 3300028381 Bacteria 18469
867 Ga0268264_10032193 3300028381 Bacteria 4302
868 Ga0268264_10092137 3300028381 Bacteria 2615
869 Ga0268264_10225569 3300028381 Bacteria 1727
870 Ga0268264_10355430 3300028381 Bacteria 1396
871 Ga0265319_1002464 3300028563 Bacteria 10098
872 Ga0265318_10000320 3300028577 Bacteria 38387
873 Ga0265338_10032726 3300028800 Bacteria 5062
874 Ga0265338_10038545 3300028800 Bacteria 4525
875 Ga0307511_10003746 3300030521 Bacteria 15547
876 Ga0265770_1001477 3300030878 Bacteria 3232
877 Ga0265765_1001239 3300030879 Bacteria 2317
878 Ga0265760_10000020 3300031090 Bacteria 71420
879 Ga0265760_10018513 3300031090 Bacteria 2007
880 Ga0265328_10028844 3300031239 Bacteria 2075
881 Ga0265328_10062127 3300031239 Bacteria 1371
882 Ga0265320_10000139 3300031240 Bacteria 61536
883 Ga0265320_10028961 3300031240 Bacteria 2870
884 Ga0265320_10059973 3300031240 Bacteria 1818
885 Ga0265325_10019621 3300031241 Bacteria 3734
886 Ga0265329_10000050 3300031242 Bacteria 51098
887 Ga0265329_10013066 3300031242 Bacteria 2970
888 Ga0265340_10025923 3300031247 Bacteria 2966
889 Ga0265339_10004465 3300031249 Bacteria 9546
890 Ga0265339_10156312 3300031249 Bacteria 1150
891 Ga0265331_10000135 3300031250 Bacteria 96750
892 Ga0265331_10006194 3300031250 Bacteria 7099
893 Ga0265331_10017191 3300031250 Bacteria 3778
894 Ga0265331_10026792 3300031250 Bacteria 2894
895 Ga0265316_10000531 3300031344 Bacteria 42984
896 Ga0265316_10000752 3300031344 Bacteria 35775
897 Ga0265316_10031452 3300031344 Bacteria 4339
898 Ga0265316_10067052 3300031344 Bacteria 2776
899 Ga0265316_10088298 3300031344 Bacteria 2367
900 Ga0307408_100019683 3300031548 Bacteria 4547
901 Ga0307408_100061025 3300031548 Bacteria 2751
902 Ga0307408_100130347 3300031548 Bacteria 1961
903 Ga0307408_100228101 3300031548 Bacteria 1523
904 Ga0265313_10001857 3300031595 Bacteria 19236
905 Ga0265313_10017309 3300031595 Bacteria 4101
906 Ga0307508_10019767 3300031616 Bacteria 6119
907 Ga0265314_10023524 3300031711 Bacteria 4695
908 Ga0265314_10029100 3300031711 Bacteria 4110
909 Ga0265314_10060442 3300031711 Bacteria 2586
910 Ga0265342_10000694 3300031712 Bacteria 35309
911 Ga0316576_10076797 3300031727 Bacteria 2472
912 Ga0307405_10000638 3300031731 Bacteria 13469
913 Ga0307413_10002032 3300031824 Bacteria 8053
914 Ga0307413_10017654 3300031824 Bacteria 3722
915 Ga0307410_10005295 3300031852 Bacteria 6809
916 Ga0307410_10005377 3300031852 Bacteria 6771
917 Ga0307410_10013809 3300031852 Bacteria 4727
918 Ga0307410_10026539 3300031852 Bacteria 3648
919 Ga0307406_10023741 3300031901 Bacteria 3653
920 Ga0307406_10033035 3300031901 Bacteria 3164
921 Ga0307407_10010455 3300031903 Bacteria 4378
922 Ga0307407_10010616 3300031903 Bacteria 4352
923 Ga0307407_10047429 3300031903 Bacteria 2438
924 Ga0307407_10066880 3300031903 Bacteria 2121
925 Ga0307407_10188770 3300031903 Bacteria 1372
926 Ga0307412_10022746 3300031911 Bacteria 3848
927 Ga0307412_10155456 3300031911 Bacteria 1692
928 Ga0307412_10330698 3300031911 Bacteria 1216
929 Ga0307409_100003656 3300031995 Bacteria 8414
930 Ga0307409_100065126 3300031995 Bacteria 2866
931 Ga0307409_100179543 3300031995 Bacteria 1872
932 Ga0307416_100003391 3300032002 Bacteria 9341
933 Ga0307416_100024508 3300032002 Bacteria 4406
934 Ga0307416_100027297 3300032002 Bacteria 4225
935 Ga0307416_100033527 3300032002 Bacteria 3894
936 Ga0307416_100046069 3300032002 Bacteria 3439
937 Ga0307416_100046391 3300032002 Bacteria 3428
938 Ga0307416_100129459 3300032002 Bacteria 2268
939 Ga0307416_100252380 3300032002 Bacteria 1718
940 Ga0307416_100423376 3300032002 Bacteria 1376
941 Ga0307416_100452523 3300032002 Bacteria 1337
942 Ga0307416_100495620 3300032002 Bacteria 1285
943 Ga0307414_10022618 3300032004 Bacteria 3970
944 Ga0307414_10030123 3300032004 Bacteria 3542
945 Ga0307414_10047654 3300032004 Bacteria 2951
946 Ga0307411_10025874 3300032005 Bacteria 3523
947 Ga0307411_10026725 3300032005 Bacteria 3479
948 Ga0307411_10069895 3300032005 Bacteria 2373
949 Ga0307411_10127043 3300032005 Bacteria 1856
950 Ga0307411_10171712 3300032005 Bacteria 1636
951 Ga0307415_100008737 3300032126 Bacteria 5634
952 Ga0307415_100041972 3300032126 Bacteria 3041
953 Ga0307415_100079332 3300032126 Bacteria 2338
954 Ga0316212_1008675 3300033547 Bacteria 1460
955 Ga0373926_0000176 3300035083 Bacteria 14340
956 Ga0373926_0004885 3300035083 Bacteria 4406
957 Ga0373929_0000003 3300035085 Bacteria 575058
958 Ga0373934_0001676 3300035086 Bacteria 8135
959 Ga0373949_0005553 3300035090 Bacteria 2812
960 Ga0373923_0022394 3300035111 Bacteria 2478
961 Ga0373932_0000061 3300035112 Bacteria 26428
962 Ga0373939_0011753 3300035114 Bacteria 2217
963 Ga0373945_0081489 3300035116 Bacteria 1240
964 Ga0373953_0028136 3300035117 Bacteria 2165
965 Ga0373954_0000648 3300035118 Bacteria 13316
966 Ga0373956_0001011 3300035119 Bacteria 11600
967 Ga0373956_0052747 3300035119 Bacteria 1829
968 Ga0373943_0093778 3300035170 Bacteria 1559
969 Ga0373946_0003193 3300035171 Bacteria 5812
970 Ga0373946_0041329 3300035171 Bacteria 1891
971 Ga0373946_0043801 3300035171 Bacteria 1845
972 Ga0373946_0073681 3300035171 Bacteria 1481
973 Ga0373955_0001645 3300035172 Bacteria 9559
974 Ga0373955_0014880 3300035172 Bacteria 3796
975 Ga0373955_0033421 3300035172 Bacteria 2709
976 Ga0373955_0087608 3300035172 Bacteria 1770
977 Ga0373961_0029778 3300035241 Bacteria 1514
978 Ga0373924_0017810 3300035410 Bacteria 2731
979 Ga0373924_0106313 3300035410 Bacteria 1210
980 Ga0373935_0000906 3300035692 Bacteria 16014
981 Ga0373927_0002502 3300035695 Bacteria 13413
982 Ga0373927_0023331 3300035695 Bacteria 4051
983 Ga0373927_0073760 3300035695 Bacteria 2210
984 Ga0373933_0001863 3300035724 Bacteria 12192
985 Ga0373933_0003491 3300035724 Bacteria 8752
986 Ga0373933_0129955 3300035724 Bacteria 1583
987 Ga0373947_0006424 3300035725 Bacteria 6830
988 Ga0373947_0044879 3300035725 Bacteria 2644
989 Ga0373947_0193851 3300035725 Bacteria 1327
990 Ga0373937_0000001 3300036401 Bacteria 478903
991 Ga0373937_0002907 3300036401 Bacteria 14312
992 Ga0373937_0006161 3300036401 Bacteria 10328
993 Ga0373937_0075873 3300036401 Bacteria 3104
994 Ga0373937_0339566 3300036401 Bacteria 1422
995 Ga0373937_0517493 3300036401 Bacteria 1134
996 Ga0373925_0002897 3300037068 Bacteria 13553
997 Ga0373925_0016760 3300037068 Bacteria 5307
998 Ga0373925_0313476 3300037068 Bacteria 1268
999 Ga0395905_0201526 3300037471 Bacteria 1866
1000 Ga0400487_55885 3300039110 Bacteria 37403
1001 Ga0436365_1139438 3300039437 Bacteria 14911
1002 Ga0436365_1884859 3300039437 Bacteria 3301
1003 Ga0439453_0004367 3300041408 Bacteria 2099
1004 Ga0439453_0007620 3300041408 Bacteria 1722
1005 Ga0439431_0009100 3300041997 Bacteria 2239
1006 Ga0439433_0018593 3300041999 Bacteria 1548
1007 Ga0439441_005229 3300042001 Bacteria 2005
1008 Ga0450894_000401 3300042131 Bacteria 7413
1009 Ga0450898_003741 3300042134 Bacteria 2203
1010 Ga0439446_0007852 3300042156 Bacteria 2815
1011 Ga0439434_0027623 3300042435 Bacteria 1716
1012 Ga0439434_0053512 3300042435 Bacteria 1254
1013 Ga0439435_0010606 3300042436 Bacteria 2192
1014 Ga0439435_0018526 3300042436 Bacteria 1773
1015 Ga0439444_0004188 3300042437 Bacteria 2082
1016 Ga0439464_0014996 3300042439 Bacteria 2089
1017 Ga0439460_0021550 3300042461 Bacteria 1762
1018 Ga0451577_0003196 3300042876 Bacteria 18409
1019 Ga0451577_0005031 3300042876 Bacteria 13669
1020 Ga0451577_0029633 3300042876 Bacteria 4947
1021 Ga0451577_0049163 3300042876 Bacteria 3766
1022 Ga0451577_0128653 3300042876 Bacteria 2271
1023 Ga0451577_0210331 3300042876 Bacteria 1757
1024 Ga0451577_0253283 3300042876 Bacteria 1594
1025 Ga0453683_0004141 3300044673 Bacteria 10399
1026 Ga0453683_0011579 3300044673 Bacteria 5810
1027 Ga0453683_0012309 3300044673 Bacteria 5608
1028 Ga0453683_0025434 3300044673 Bacteria 3761
1029 Ga0453684_0018139 3300044712 Bacteria 10832
1030 Ga0453684_0023641 3300044712 Bacteria 9032
1031 Ga0453684_0048534 3300044712 Bacteria 5611
1032 Ga0453684_0138370 3300044712 Bacteria 2912
1033 Ga0451576_0007133 3300045051 Bacteria 13485
1034 Ga0451576_0011820 3300045051 Bacteria 9882
1035 Ga0451576_0013194 3300045051 Bacteria 9246
1036 Ga0451576_0013267 3300045051 Bacteria 9220
1037 Ga0451576_0013998 3300045051 Bacteria 8945
1038 Ga0451576_0017863 3300045051 Bacteria 7792
1039 Ga0451576_0063613 3300045051 Bacteria 3845
1040 Ga0451576_0133886 3300045051 Bacteria 2584
1041 Ga0451576_0166417 3300045051 Bacteria 2301
1042 Ga0495592_0033147 3300046454 Unclassified 3897
1043 Ga0495592_0037134 3300046454 Bacteria 3668
1044 Ga0495592_0044739 3300046454 Bacteria 3306
1045 Ga0495603_0021187 3300046455 Bacteria 3936
1046 Ga0495629_0009367 3300046459 Bacteria 7162
1047 Ga0495629_0131506 3300046459 Bacteria 1743
1048 Ga0495638_0001740 3300046460 Bacteria 19123
1049 Ga0495638_0047352 3300046460 Bacteria 2695
1050 Ga0495651_0000059 3300046462 Bacteria 81986
1051 Ga0495651_0001481 3300046462 Bacteria 18160
1052 Ga0495651_0010905 3300046462 Bacteria 6991
1053 Ga0495651_0045238 3300046462 Bacteria 3410
1054 Ga0495653_0005508 3300046463 Bacteria 10313
1055 Ga0495653_0018250 3300046463 Bacteria 5701
1056 Ga0495653_0053917 3300046463 Bacteria 3074
1057 Ga0495653_0060335 3300046463 Bacteria 2874
1058 Ga0495653_0091792 3300046463 Bacteria 2219
1059 Ga0495653_0159876 3300046463 Bacteria 1565
1060 Ga0495580_0007354 3300046472 Bacteria 8856
1061 Ga0495580_0017978 3300046472 Bacteria 5271
1062 Ga0495580_0029073 3300046472 Bacteria 4013
1063 Ga0495580_0075697 3300046472 Bacteria 2348
1064 Ga0495582_0008789 3300046473 Bacteria 5570
1065 Ga0495582_0009955 3300046473 Bacteria 5234
1066 Ga0495582_0039499 3300046473 Bacteria 2598
1067 Ga0495582_0044965 3300046473 Bacteria 2432
1068 Ga0495639_0006368 3300046475 Bacteria 5074
1069 Ga0495662_0070371 3300046476 Bacteria 1695
1070 Ga0495664_0022141 3300046477 Unclassified 3680
1071 Ga0495664_0048340 3300046477 Bacteria 2525
1072 Ga0495664_0146681 3300046477 Bacteria 1431
1073 Ga0495584_0074747 3300046491 Bacteria 1703
1074 Ga0495584_0189663 3300046491 Bacteria 1045
1075 Ga0495594_0013813 3300046499 Bacteria 4221
1076 Ga0495594_0018400 3300046499 Bacteria 3700
1077 Ga0495594_0020639 3300046499 Bacteria 3510
1078 Ga0495608_0006754 3300046511 Bacteria 8135
1079 Ga0495608_0011876 3300046511 Bacteria 6059
1080 Ga0495608_0023053 3300046511 Bacteria 4268
1081 Ga0495608_0126526 3300046511 Bacteria 1636
1082 Ga0495618_0032478 3300046514 Bacteria 3269
1083 Ga0495618_0050503 3300046514 Bacteria 2627
1084 Ga0495618_0145286 3300046514 Bacteria 1516
1085 Ga0495618_0172507 3300046514 Bacteria 1376
1086 Ga0495628_0000167 3300046516 Bacteria 57173
1087 Ga0495628_0006133 3300046516 Bacteria 10513
1088 Ga0495628_0023006 3300046516 Bacteria 5116
1089 Ga0495628_0026102 3300046516 Bacteria 4769
1090 Ga0495628_0034713 3300046516 Bacteria 4056
1091 Ga0495628_0174473 3300046516 Bacteria 1629
1092 Ga0495630_0012486 3300046517 Bacteria 6168
1093 Ga0495630_0039810 3300046517 Bacteria 3513
1094 Ga0495630_0060214 3300046517 Bacteria 2849
1095 Ga0495630_0097031 3300046517 Bacteria 2229
1096 Ga0495630_0239205 3300046517 Bacteria 1387
1097 Ga0495643_0039860 3300046522 Bacteria 2567
1098 Ga0495663_0012376 3300046525 Bacteria 2377
1099 Ga0495666_0015665 3300046526 Bacteria 3776
1100 Ga0495666_0034741 3300046526 Bacteria 2459
1101 Ga0495666_0121370 3300046526 Bacteria 1224
1102 Ga0495652_0004609 3300046529 Bacteria 13141
1103 Ga0495652_0022463 3300046529 Bacteria 5598
1104 Ga0495652_0028614 3300046529 Unclassified 4901
1105 Ga0495652_0229127 3300046529 Bacteria 1391
1106 Ga0495665_0002242 3300046531 Bacteria 10469
1107 Ga0495640_0013332 3300046533 Bacteria 6247
1108 Ga0495640_0137294 3300046533 Bacteria 1578
1109 Ga0495640_0155162 3300046533 Bacteria 1469
1110 Ga0495586_0015110 3300046535 Bacteria 4107
1111 Ga0495586_0091128 3300046535 Bacteria 1684
1112 Ga0495587_0000433 3300046536 Bacteria 29356
1113 Ga0495587_0002851 3300046536 Bacteria 11583
1114 Ga0495587_0003324 3300046536 Bacteria 10734
1115 Ga0495587_0009418 3300046536 Bacteria 6259
1116 Ga0495587_0017789 3300046536 Bacteria 4409
1117 Ga0495587_0126171 3300046536 Bacteria 1464
1118 Ga0495587_0200610 3300046536 Bacteria 1128
1119 Ga0495598_0026235 3300046537 Bacteria 1596
1120 Ga0495621_0039227 3300046539 Bacteria 1656
1121 Ga0495645_0001627 3300046543 Bacteria 15209
1122 Ga0495645_0008122 3300046543 Bacteria 7317
1123 Ga0495645_0012788 3300046543 Bacteria 5922
1124 Ga0495645_0067573 3300046543 Bacteria 2581
1125 Ga0495667_0015159 3300046559 Bacteria 5203
1126 Ga0495667_0026551 3300046559 Bacteria 3903
1127 Ga0495667_0070065 3300046559 Bacteria 2288
1128 Ga0495634_0008535 3300046642 Bacteria 7615
1129 Ga0495634_0088712 3300046642 Bacteria 2011
1130 Ga0495634_0149287 3300046642 Bacteria 1479
1131 Ga0495635_0019091 3300046663 Bacteria 4786
1132 Ga0495588_0007178 3300046674 Bacteria 5054
1133 Ga0495588_0139565 3300046674 Bacteria 1280
1134 Ga0495657_0024248 3300046675 Bacteria 4323
1135 Ga0495657_0031177 3300046675 Bacteria 3728
1136 Ga0495657_0058349 3300046675 Bacteria 2563
1137 Ga0495657_0137593 3300046675 Bacteria 1525
1138 Ga0495623_0001017 3300046679 Bacteria 18952
1139 Ga0495623_0064206 3300046679 Bacteria 2298
1140 Ga0495646_0008681 3300046680 Bacteria 6460
1141 Ga0495647_0017713 3300046681 Bacteria 2524
1142 Ga0495658_0016100 3300046683 Bacteria 3847
1143 Ga0495658_0020937 3300046683 Bacteria 3441
1144 Ga0495658_0155381 3300046683 Bacteria 1408
1145 Ga0495669_0001134 3300046684 Bacteria 11020
1146 Ga0495613_0006297 3300046689 Bacteria 8877
1147 Ga0495613_0020315 3300046689 Bacteria 4952
1148 Ga0495613_0143099 3300046689 Bacteria 1707
1149 Ga0495624_0032778 3300046690 Bacteria 3366
1150 Ga0495624_0065425 3300046690 Bacteria 2271
1151 Ga0495670_0057819 3300046691 Bacteria 1947
1152 Ga0495670_0121659 3300046691 Bacteria 1356
1153 Ga0495600_0001754 3300046809 Bacteria 12130
1154 Ga0495581_0167760 3300047315 Bacteria 1284
1155 Ga0495604_0000934 3300047317 Bacteria 24332
1156 Ga0495604_0006656 3300047317 Bacteria 9155
1157 Ga0495604_0010097 3300047317 Bacteria 7478
1158 Ga0495604_0045587 3300047317 Bacteria 3421
1159 Ga0495604_0197137 3300047317 Bacteria 1399
1160 Ga0495636_0010751 3300047318 Bacteria 3619
1161 Ga0495674_0010778 3300047319 Bacteria 8648
1162 Ga0495674_0015359 3300047319 Bacteria 7162
1163 Ga0495674_0034699 3300047319 Bacteria 4558
1164 Ga0495674_0141469 3300047319 Bacteria 2022
1165 Ga0495676_0005978 3300047321 Bacteria 11182
1166 Ga0495676_0061862 3300047321 Bacteria 2926
1167 Ga0495680_0003912 3300047322 Bacteria 14410
1168 Ga0495680_0007293 3300047322 Bacteria 10176
1169 Ga0495680_0039676 3300047322 Bacteria 3754
1170 Ga0495680_0058882 3300047322 Bacteria 2967
1171 Ga0495675_0000289 3300047444 Bacteria 36410
1172 Ga0495675_0003236 3300047444 Bacteria 9789
1173 Ga0495675_0035585 3300047444 Bacteria 3179
1174 Ga0495675_0067611 3300047444 Bacteria 2258
1175 Ga0495679_022289 3300047446 Bacteria 2170
1176 Ga0495684_0000504 3300047471 Bacteria 31616
1177 Ga0495684_0006592 3300047471 Bacteria 9007
1178 Ga0495684_0008127 3300047471 Bacteria 8114
1179 Ga0495684_0137297 3300047471 Bacteria 1835
1180 Ga0495684_0249058 3300047471 Bacteria 1293
1181 Ga0495593_0008338 3300047673 Bacteria 6030
1182 Ga0495593_0103662 3300047673 Bacteria 1457
1183 Ga0495593_0138100 3300047673 Bacteria 1235
1184 Ga0495602_0000056 3300048088 Bacteria 109741
1185 Ga0495602_0004170 3300048088 Bacteria 15040
1186 Ga0495602_0011475 3300048088 Bacteria 9158
1187 Ga0495602_0015880 3300048088 Bacteria 7585
1188 Ga0495602_0054834 3300048088 Bacteria 3516
1189 Ga0495602_0143378 3300048088 Bacteria 1888
1190 Ga0495614_0020037 3300048089 Bacteria 2893
1191 Ga0495614_0021255 3300048089 Bacteria 2803
1192 Ga0496100_0012885 3300048903 Bacteria 4807
1193 Ga0496100_0043019 3300048903 Bacteria 2887
1194 Ga0496100_0049289 3300048903 Bacteria 2723
1195 Ga0496100_0098137 3300048903 Bacteria 2013
1196 Ga0496101_0006912 3300048904 Bacteria 7325
1197 Ga0496101_0087788 3300048904 Bacteria 2309
1198 Ga0496102_0010134 3300048905 Bacteria 8105
1199 Ga0496102_0012507 3300048905 Bacteria 7349
1200 Ga0496102_0021614 3300048905 Bacteria 5692
1201 Ga0496103_0029718 3300048906 Bacteria 3322
1202 Ga0496104_0000157 3300048907 Bacteria 61755
1203 Ga0496104_0097552 3300048907 Bacteria 2813
1204 Ga0496104_0115609 3300048907 Bacteria 2574
1205 Ga0496104_0130858 3300048907 Bacteria 2410
1206 Ga0496105_0083326 3300048908 Bacteria 2641
1207 Ga0496105_0100535 3300048908 Bacteria 2388
1208 Ga0496105_0129031 3300048908 Bacteria 2085
1209 Ga0496106_0015998 3300048909 Bacteria 5548
1210 Ga0496106_0028722 3300048909 Bacteria 4143
1211 Ga0496106_0046663 3300048909 Bacteria 3258
1212 Ga0496106_0222372 3300048909 Bacteria 1506
1213 Ga0496107_0038246 3300048910 Bacteria 3444
1214 Ga0496107_0045403 3300048910 Bacteria 3160
1215 Ga0496108_0003499 3300048911 Bacteria 12586
1216 Ga0496108_0148824 3300048911 Bacteria 2020
1217 Ga0496108_0421290 3300048911 Bacteria 1166
1218 Ga0496109_0009476 3300048912 Bacteria 8302
1219 Ga0496109_0047093 3300048912 Bacteria 3919
1220 Ga0496110_0000063 3300048913 Bacteria 53033
1221 Ga0496110_0377941 3300048913 Bacteria 1291
1222 Ga0496111_0004348 3300048914 Bacteria 8942
1223 Ga0496111_0073612 3300048914 Bacteria 2488
1224 Ga0496112_0000245 3300048915 Bacteria 34580
1225 Ga0496112_0024556 3300048915 Bacteria 5774
1226 Ga0496112_0031622 3300048915 Bacteria 5135
1227 Ga0496112_0045209 3300048915 Bacteria 4316
1228 Ga0496112_0060475 3300048915 Bacteria 3734
1229 Ga0496112_0131460 3300048915 Bacteria 2474
1230 Ga0496113_0009126 3300048916 Bacteria 6498
1231 Ga0496113_0245604 3300048916 Bacteria 1428
1232 Ga0496113_0264357 3300048916 Bacteria 1375
1233 Ga0496114_0000005 3300048917 Bacteria 564262
1234 Ga0496114_0000371 3300048917 Bacteria 33092
1235 Ga0496114_0017463 3300048917 Bacteria 5790
1236 Ga0496114_0048633 3300048917 Bacteria 3528
1237 Ga0496114_0079649 3300048917 Bacteria 2766
1238 Ga0496115_0017958 3300048918 Bacteria 5420
1239 Ga0496115_0038548 3300048918 Bacteria 3792
1240 Ga0496115_0050776 3300048918 Bacteria 3324
1241 Ga0501031_0081626 3300049568 Bacteria 2108
1242 Ga0501032_0063932 3300049569 Bacteria 2463
1243 Ga0501033_0001797 3300049570 Bacteria 18718
1244 Ga0501033_0108440 3300049570 Bacteria 2022
1245 Ga0501034_0014607 3300049571 Bacteria 8085
1246 Ga0501034_0015307 3300049571 Bacteria 7884
1247 Ga0501034_0029877 3300049571 Bacteria 5540
1248 Ga0501034_0083279 3300049571 Bacteria 3200
1249 Ga0501034_0087907 3300049571 Bacteria 3106
1250 Ga0501036_0005695 3300049572 Bacteria 10106
1251 Ga0501036_0014261 3300049572 Bacteria 6613
1252 Ga0501036_0020670 3300049572 Bacteria 5530
1253 Ga0501036_0023391 3300049572 Bacteria 5206
1254 Ga0501036_0097060 3300049572 Bacteria 2491
1255 Ga0501036_0185089 3300049572 Bacteria 1753
1256 Ga0501036_0218816 3300049572 Bacteria 1599
1257 Ga0501036_0285531 3300049572 Bacteria 1381
1258 Ga0501037_0001960 3300049573 Bacteria 14869
1259 Ga0501037_0021899 3300049573 Bacteria 4731
1260 Ga0501037_0054273 3300049573 Bacteria 2930
1261 Ga0501038_0043872 3300049574 Bacteria 3887
1262 Ga0501038_0075827 3300049574 Bacteria 2842
1263 Ga0501038_0110687 3300049574 Bacteria 2275
1264 Ga0501038_0117291 3300049574 Bacteria 2199
1265 Ga0501039_0003641 3300049575 Bacteria 11550
1266 Ga0501039_0024578 3300049575 Bacteria 4628
1267 Ga0501040_0009429 3300049576 Bacteria 6364
1268 Ga0501040_0047419 3300049576 Bacteria 2934
1269 Ga0501040_0059430 3300049576 Bacteria 2626
1270 Ga0501040_0198859 3300049576 Bacteria 1423
1271 Ga0501041_0010123 3300049577 Bacteria 5557
1272 Ga0501041_0018828 3300049577 Bacteria 4112
1273 Ga0501041_0133848 3300049577 Bacteria 1544
1274 Ga0501042_0025593 3300049578 Bacteria 4146
1275 Ga0501042_0028146 3300049578 Bacteria 3956
1276 Ga0501042_0034060 3300049578 Bacteria 3612
1277 Ga0501042_0038051 3300049578 Bacteria 3416
1278 Ga0501042_0058854 3300049578 Bacteria 2743
1279 Ga0501042_0063708 3300049578 Bacteria 2635
1280 Ga0501042_0084812 3300049578 Bacteria 2272
1281 Ga0501042_0181805 3300049578 Bacteria 1517
1282 Ga0501042_0195047 3300049578 Bacteria 1460
1283 Ga0501042_0224376 3300049578 Bacteria 1355
1284 Ga0501043_0013132 3300049579 Bacteria 6476
1285 Ga0501043_0118058 3300049579 Bacteria 2081
1286 Ga0501043_0146656 3300049579 Bacteria 1848
1287 Ga0501046_0014479 3300049580 Bacteria 6654
1288 Ga0501046_0014990 3300049580 Bacteria 6520
1289 Ga0501046_0046634 3300049580 Bacteria 3438
1290 Ga0501046_0368956 3300049580 Bacteria 1040
1291 Ga0501047_0006564 3300049581 Bacteria 10952
1292 Ga0501047_0088501 3300049581 Bacteria 2973
1293 Ga0501047_0139369 3300049581 Bacteria 2304
1294 Ga0501047_0147499 3300049581 Bacteria 2229
1295 Ga0501047_0250265 3300049581 Bacteria 1620
1296 Ga0501048_0004103 3300049582 Bacteria 11093
1297 Ga0501048_0008075 3300049582 Bacteria 7966
1298 Ga0501048_0033095 3300049582 Bacteria 3736
1299 Ga0501048_0037754 3300049582 Bacteria 3469
1300 Ga0501048_0082182 3300049582 Bacteria 2272
1301 Ga0501048_0140527 3300049582 Bacteria 1707
1302 Ga0501067_0001385 3300049583 Bacteria 13146
1303 Ga0501068_0012541 3300049584 Bacteria 4810
1304 Ga0501068_0015357 3300049584 Bacteria 4395
1305 Ga0501069_0022414 3300049585 Bacteria 3435
1306 Ga0501069_0027751 3300049585 Bacteria 3103
1307 Ga0501069_0147209 3300049585 Bacteria 1352
1308 Ga0501070_0005646 3300049586 Bacteria 10669
1309 Ga0501070_0022268 3300049586 Bacteria 5309
1310 Ga0501071_0019087 3300049587 Bacteria 4757
1311 Ga0501071_0019377 3300049587 Bacteria 4721
1312 Ga0501071_0024253 3300049587 Bacteria 4241
1313 Ga0501071_0136639 3300049587 Bacteria 1824
1314 Ga0501071_0196801 3300049587 Bacteria 1513
1315 Ga0501071_0286187 3300049587 Bacteria 1248
1316 Ga0501072_0015475 3300049588 Bacteria 5848
1317 Ga0501072_0026441 3300049588 Bacteria 4525
1318 Ga0501072_0052203 3300049588 Bacteria 3219
1319 Ga0501072_0108375 3300049588 Bacteria 2210
1320 Ga0501072_0110579 3300049588 Bacteria 2187
1321 Ga0501072_0233175 3300049588 Bacteria 1466
1322 Ga0501072_0357101 3300049588 Bacteria 1160
1323 Ga0501073_0003168 3300049589 Bacteria 12344
1324 Ga0501073_0008693 3300049589 Bacteria 7520
1325 Ga0501073_0039425 3300049589 Bacteria 3347
1326 Ga0501073_0062776 3300049589 Bacteria 2591
1327 Ga0501074_0003931 3300049590 Bacteria 10589
1328 Ga0501074_0044209 3300049590 Bacteria 3225
1329 Ga0501074_0055892 3300049590 Bacteria 2844
1330 Ga0501074_0079253 3300049590 Bacteria 2357
1331 Ga0501074_0098437 3300049590 Bacteria 2093
1332 Ga0501074_0143634 3300049590 Bacteria 1707
1333 Ga0501075_0001850 3300049591 Bacteria 13973
1334 Ga0501075_0005672 3300049591 Bacteria 8543
1335 Ga0501075_0014357 3300049591 Bacteria 5675
1336 Ga0501075_0034386 3300049591 Bacteria 3774
1337 Ga0501075_0078796 3300049591 Bacteria 2494
1338 Ga0501075_0096760 3300049591 Bacteria 2240
1339 Ga0501075_0128859 3300049591 Bacteria 1927
1340 Ga0501075_0203219 3300049591 Bacteria 1511
1341 Ga0501076_0000633 3300049592 Bacteria 22451
1342 Ga0501076_0005874 3300049592 Bacteria 8852
1343 Ga0501076_0041328 3300049592 Bacteria 3627
1344 Ga0501076_0050221 3300049592 Bacteria 3299
1345 Ga0501076_0072157 3300049592 Bacteria 2763
1346 Ga0501076_0091921 3300049592 Bacteria 2441
1347 Ga0501076_0143057 3300049592 Bacteria 1944
1348 Ga0501076_0145643 3300049592 Bacteria 1926
1349 Ga0501076_0214337 3300049592 Bacteria 1574
1350 Ga0501076_0286645 3300049592 Bacteria 1349
1351 Ga0501076_0303554 3300049592 Bacteria 1309
1352 Ga0501077_0021021 3300049593 Bacteria 4129
1353 Ga0501249_011801 3300049679 Bacteria 1840
1354 Ga0501079_0009681 3300049741 Bacteria 7306
1355 Ga0501079_0015604 3300049741 Bacteria 5800
1356 Ga0501079_0017966 3300049741 Bacteria 5399
1357 Ga0501079_0021979 3300049741 Bacteria 4887
1358 Ga0501079_0136919 3300049741 Bacteria 1907
1359 Ga0501079_0202661 3300049741 Bacteria 1550
1360 Ga0501079_0211349 3300049741 Bacteria 1515
1361 Ga0501079_0297257 3300049741 Bacteria 1263
1362 Ga0501080_0001466 3300049742 Bacteria 19854
1363 Ga0501080_0046033 3300049742 Bacteria 4063
1364 Ga0501080_0128544 3300049742 Bacteria 2346
1365 Ga0501080_0141101 3300049742 Bacteria 2227
1366 Ga0501080_0209310 3300049742 Bacteria 1787
1367 Ga0501080_0249396 3300049742 Bacteria 1619
1368 Ga0501080_0304333 3300049742 Bacteria 1445
1369 Ga0501081_0007223 3300049743 Bacteria 7222
1370 Ga0501081_0018947 3300049743 Bacteria 4575
1371 Ga0501081_0040573 3300049743 Bacteria 3187
1372 Ga0501081_0073426 3300049743 Bacteria 2386
1373 Ga0501081_0083342 3300049743 Bacteria 2241
1374 Ga0501081_0085253 3300049743 Bacteria 2217
1375 Ga0501081_0085428 3300049743 Bacteria 2215
1376 Ga0501081_0155177 3300049743 Bacteria 1647
1377 Ga0501081_0184799 3300049743 Bacteria 1508
1378 Ga0501083_0011031 3300049744 Bacteria 6349
1379 Ga0501083_0026727 3300049744 Bacteria 3987
1380 Ga0501083_0028261 3300049744 Bacteria 3866
1381 Ga0501035_0027160 3300049822 Bacteria 5233
1382 Ga0501035_0098220 3300049822 Bacteria 2571
1383 Ga0501044_0009040 3300049823 Bacteria 10890
1384 Ga0501044_0063277 3300049823 Bacteria 3780
1385 Ga0501044_0092305 3300049823 Bacteria 3053
1386 Ga0501044_0105112 3300049823 Bacteria 2836
1387 Ga0501045_0006147 3300049824 Bacteria 8319
1388 Ga0501045_0008164 3300049824 Bacteria 7293
1389 Ga0501045_0015928 3300049824 Bacteria 5333
1390 Ga0501045_0018451 3300049824 Bacteria 4963
1391 Ga0501045_0021060 3300049824 Bacteria 4661
1392 Ga0501045_0069439 3300049824 Bacteria 2590
1393 Ga0501045_0095660 3300049824 Bacteria 2197
1394 nmdc:mga00v17_132837_c1 3300050491 Bacteria 1592
1395 nmdc:mga0k408_24845_c1 3300050493 Bacteria 3389
1396 nmdc:mga0k408_25943_c1 3300050493 Bacteria 3321
1397 nmdc:mga0k408_70841_c1 3300050493 Bacteria 2034
1398 nmdc:mga06z11_85054_c1 3300050494 Bacteria 1706
1399 nmdc:mga05p37_11748_c1 3300050507 Bacteria 10439
1400 nmdc:mga05p37_13533_c1 3300050507 Bacteria 9781
1401 nmdc:mga05p37_167522_c1 3300050507 Bacteria 2681
1402 nmdc:mga05p37_18779_c1 3300050507 Bacteria 8355
1403 nmdc:mga05p37_22849_c1 3300050507 Bacteria 7584
1404 nmdc:mga05p37_2888_c1 3300050507 Bacteria 19926
1405 nmdc:mga05p37_29_c1 3300050507 Bacteria 114400
1406 nmdc:mga05p37_351913_c1 3300050507 Bacteria 1734
1407 nmdc:mga05p37_357395_c1 3300050507 Bacteria 1718
1408 nmdc:mga05p37_368307_c1 3300050507 Unclassified 1687
1409 nmdc:mga05p37_39052_c1 3300050507 Bacteria 5824
1410 nmdc:mga05p37_39487_c2 3300050507 Bacteria 4017
1411 nmdc:mga05p37_39668_c1 3300050507 Bacteria 5782
1412 nmdc:mga05p37_416935_c1 3300050507 Bacteria 1564
1413 nmdc:mga05p37_420241_c1 3300050507 Bacteria 1556
1414 nmdc:mga05p37_56321_c1 3300050507 Bacteria 4840
1415 nmdc:mga05p37_569_c2 3300050507 Bacteria 24307
1416 nmdc:mga05p37_610996_c1 3300050507 Bacteria 1229
1417 nmdc:mga05p37_73587_c1 3300050507 Bacteria 4205
1418 nmdc:mga05p37_90897_c1 3300050507 Bacteria 3762
1419 nmdc:mga09592_10035_c1 3300050508 Bacteria 7699
1420 nmdc:mga09592_12714_c1 3300050508 Bacteria 6861
1421 nmdc:mga09592_14921_c1 3300050508 Bacteria 6346
1422 nmdc:mga09592_15438_c1 3300050508 Bacteria 6240
1423 nmdc:mga09592_1848_c1 3300050508 Bacteria 17028
1424 nmdc:mga09592_20949_c1 3300050508 Bacteria 5383
1425 nmdc:mga09592_25857_c1 3300050508 Bacteria 4861
1426 nmdc:mga09592_33010_c1 3300050508 Bacteria 4318
1427 nmdc:mga0qj67_118605_c2 3300050509 Bacteria 1822
1428 nmdc:mga0qj67_122428_c1 3300050509 Bacteria 2104
1429 nmdc:mga0qj67_171285_c1 3300050509 Bacteria 1763
1430 nmdc:mga0qj67_21098_c1 3300050509 Bacteria 4995
1431 nmdc:mga0qj67_234549_c1 3300050509 Bacteria 1489
1432 nmdc:mga0qj67_32771_c1 3300050509 Bacteria 4053
1433 nmdc:mga0qj67_397745_c1 3300050509 Bacteria 1112
1434 nmdc:mga0qj67_41245_c1 3300050509 Bacteria 3630
1435 nmdc:mga0qj67_7069_c1 3300050509 Bacteria 8281
1436 nmdc:mga0qj67_88608_c1 3300050509 Bacteria 2484
1437 nmdc:mga06r32_101775_c1 3300050510 Bacteria 2820
1438 nmdc:mga06r32_107864_c1 3300050510 Bacteria 2737
1439 nmdc:mga06r32_23263_c1 3300050510 Bacteria 5731
1440 nmdc:mga06r32_310264_c1 3300050510 Bacteria 1563
1441 nmdc:mga06r32_33345_c1 3300050510 Bacteria 4850
1442 nmdc:mga06r32_34703_c1 3300050510 Bacteria 4758
1443 nmdc:mga06r32_46528_c1 3300050510 Bacteria 4140
1444 nmdc:mga06r32_58764_c1 3300050510 Bacteria 3696
1445 nmdc:mga06r32_82552_c1 3300050510 Bacteria 3131
1446 nmdc:mga08y16_120436_c1 3300050511 Bacteria 2731
1447 nmdc:mga08y16_148914_c1 3300050511 Bacteria 2433
1448 nmdc:mga08y16_154608_c1 3300050511 Bacteria 2384
1449 nmdc:mga08y16_158977_c1 3300050511 Bacteria 2348
1450 nmdc:mga08y16_164841_c1 3300050511 Bacteria 2302
1451 nmdc:mga08y16_173829_c1 3300050511 Bacteria 2237
1452 nmdc:mga08y16_178964_c1 3300050511 Bacteria 2202
1453 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
1454 nmdc:mga08y16_182208_c1 3300050511 Bacteria 2181
1455 nmdc:mga08y16_212203_c1 3300050511 Bacteria 2005
1456 nmdc:mga08y16_242780_c1 3300050511 Bacteria 1862
1457 nmdc:mga08y16_252016_c1 3300050511 Bacteria 1824
1458 nmdc:mga08y16_338041_c1 3300050511 Bacteria 1548
1459 nmdc:mga08y16_4308_c1 3300050511 Bacteria 14860
1460 nmdc:mga08y16_46776_c1 3300050511 Bacteria 4529
1461 nmdc:mga08y16_513071_c1 3300050511 Bacteria 1217
1462 nmdc:mga08y16_54011_c1 3300050511 Bacteria 4199
1463 nmdc:mga08y16_57474_c1 3300050511 Bacteria 4065
1464 nmdc:mga08y16_65734_c1 3300050511 Bacteria 3785
1465 nmdc:mga08y16_6614_c1 3300050511 Bacteria 12156
1466 nmdc:mga08y16_82537_c1 3300050511 Bacteria 3351
1467 nmdc:mga0n895_1110_c1 3300050512 Bacteria 19640
1468 nmdc:mga0n895_116876_c1 3300050512 Bacteria 2686
1469 nmdc:mga0n895_123625_c1 3300050512 Bacteria 2610
1470 nmdc:mga0n895_123811_c1 3300050512 Bacteria 2608
1471 nmdc:mga0n895_135327_c1 3300050512 Bacteria 2491
1472 nmdc:mga0n895_13860_c1 3300050512 Bacteria 7297
1473 nmdc:mga0n895_145362_c1 3300050512 Bacteria 2401
1474 nmdc:mga0n895_148879_c1 3300050512 Bacteria 2370
1475 nmdc:mga0n895_209668_c1 3300050512 Bacteria 1979
1476 nmdc:mga0n895_287087_c1 3300050512 Bacteria 1668
1477 nmdc:mga0n895_36785_c1 3300050512 Bacteria 4730
1478 nmdc:mga0n895_69859_c1 3300050512 Bacteria 3480
1479 nmdc:mga0n895_79259_c1 3300050512 Bacteria 3271
1480 nmdc:mga0n895_84092_c1 3300050512 Bacteria 3175
1481 nmdc:mga0rr50_134599_c1 3300050513 Bacteria 1982
1482 nmdc:mga0rr50_2215_c1 3300050513 Bacteria 10908
1483 nmdc:mga0rr50_282787_c1 3300050513 Bacteria 1384
1484 nmdc:mga0rr50_56489_c1 3300050513 Bacteria 2933
1485 nmdc:mga0rr50_58092_c1 3300050513 Bacteria 2897
1486 nmdc:mga0rr50_716_c1 3300050513 Bacteria 17853
1487 nmdc:mga0rr50_76530_c1 3300050513 Bacteria 2569
1488 nmdc:mga0rr50_97048_c1 3300050513 Bacteria 2307
1489 nmdc:mga08x19_10017_c1 3300050514 Bacteria 5682
1490 nmdc:mga08x19_1347_c1 3300050514 Bacteria 15247
1491 nmdc:mga08x19_524_c1 3300050514 Bacteria 25566
1492 nmdc:mga08x19_54222_c1 3300050514 Bacteria 2580
1493 nmdc:mga0a205_104560_c1 3300050515 Bacteria 2731
1494 nmdc:mga0a205_118219_c1 3300050515 Bacteria 2549
1495 nmdc:mga0a205_1412_c1 3300050515 Bacteria 20378
1496 nmdc:mga0a205_174619_c1 3300050515 Bacteria 2044
1497 nmdc:mga0a205_2103_c1 3300050515 Bacteria 17454
1498 nmdc:mga0a205_219952_c1 3300050515 Bacteria 1785
1499 nmdc:mga0a205_22925_c1 3300050515 Bacteria 5920
1500 nmdc:mga0a205_249144_c1 3300050515 Bacteria 1656
1501 nmdc:mga0a205_3073_c1 3300050515 Bacteria 14819
1502 nmdc:mga0a205_428009_c1 3300050515 Bacteria 1185
1503 nmdc:mga0a205_5662_c1 3300050515 Bacteria 11257
1504 nmdc:mga0a205_60956_c1 3300050515 Bacteria 3644
1505 Ga0495601_0009838 3300053077 Bacteria 5659
1506 Ga0495601_0079319 3300053077 Bacteria 2105
1507 Ga0495612_0000398 3300053078 Bacteria 17397
1508 Ga0495655_0000574 3300053083 Bacteria 6053
1509 Ga0495595_0048976 3300053084 Bacteria 1953
1510 Ga0495619_0007406 3300053085 Bacteria 6956
1511 Ga0495619_0113876 3300053085 Bacteria 1850
1512 Ga0495619_0144885 3300053085 Bacteria 1637
1513 Ga0495619_0158037 3300053085 Bacteria 1565
1514 Ga0495619_0242434 3300053085 Bacteria 1249
1515 Ga0500628_003394 3300053129 Bacteria 2630
1516 Ga0500628_007908 3300053129 Bacteria 1834
1517 Ga0501084_0030447 3300054114 Bacteria 4513
1518 Ga0501084_0044927 3300054114 Bacteria 3699
1519 Ga0501084_0054785 3300054114 Bacteria 3336
1520 Ga0501084_0212131 3300054114 Bacteria 1634
1521 Ga0501084_0268347 3300054114 Bacteria 1441
1522 Ga0501084_0291544 3300054114 Bacteria 1378
1523 Ga0501084_0322180 3300054114 Bacteria 1305
1524 Ga0590071_000359 3300059421 Bacteria 13451
1525 Ga0590071_008116 3300059421 Bacteria 2479
1526 Ga0590071_023051 3300059421 Bacteria 1470
1527 Ga0590074_006216 3300059423 Bacteria 1982
1528 Ga0590075_000139 3300059424 Bacteria 19073
1529 Ga0590075_001920 3300059424 Bacteria 5035
1530 Ga0590075_011912 3300059424 Bacteria 2107
1531 Ga0590077_000011 3300059426 Bacteria 41505
1532 Ga0590077_005365 3300059426 Bacteria 2628
1533 Ga0501082_0003063 3300060353 Bacteria 14588
1534 Ga0501082_0019848 3300060353 Bacteria 5796
1535 Ga0501082_0036375 3300060353 Bacteria 4241
1536 Ga0501082_0072004 3300060353 Bacteria 2977
1537 Ga0501082_0132483 3300060353 Bacteria 2163
1538 Ga0501082_0198994 3300060353 Bacteria 1743
1539 Ga0501082_0263380 3300060353 Bacteria 1500
1540 Ga0530510_0005554 3300061734 Bacteria 8740
1541 Ga0530510_0082052 3300061734 Bacteria 2348
1542 Ga0530510_0145796 3300061734 Bacteria 1746
1543 Ga0530510_0353601 3300061734 Bacteria 1104
1544 8054359959 8054357960 Bacteria 2867777
1545 Ga0105245_10009963
1546 JGI25406J46586_10013078
1547 Ga0065712_10003117
1548 Ga0065712_10067822
1549 Ga0065712_10068256
1550 Ga0065712_10069647
1551 Ga0065712_10086315
1552 Ga0065712_10092300
1553 Ga0065712_10096909
1554 Ga0065712_10117705
1555 Ga0065715_10010472
1556 Ga0065715_10090135
1557 Ga0065715_10093135
1558 Ga0065715_10093168
1559 Ga0065715_10094425
1560 Ga0065715_10113341
1561 Ga0065715_10117987
1562 Ga0065707_10001479
1563 Ga0065707_10082300
1564 Ga0065707_10114653
1565 Ga0065707_10132595
1566 Ga0065707_10162560
1567 Ga0065707_10167462
1568 Ga0070676_10007541
1569 Ga0070676_10026430
1570 Ga0070676_10042457
1571 Ga0070683_100000767
1572 Ga0070683_100200920
1573 Ga0070690_100016845
1574 Ga0070690_100047784
1575 Ga0070690_100137999
1576 Ga0070670_100004018
1577 Ga0070670_100005693
1578 Ga0070670_100006799
1579 Ga0070670_100014101
1580 Ga0070670_100053037
1581 Ga0070670_100068457
1582 Ga0070670_100082316
1583 Ga0070670_100117557
1584 Ga0070677_10001941
1585 Ga0070677_10016182
1586 Ga0070677_10051067
1587 Ga0068869_100001962
1588 Ga0068869_100019703
1589 Ga0070666_10016269
1590 Ga0070666_10063651
1591 Ga0070666_10112771
1592 Ga0070682_100000035
1593 Ga0068868_100043851
1594 Ga0068868_100141734
1595 Ga0068868_100144848
1596 Ga0068868_100194443
1597 Ga0070660_100154479
1598 Ga0070689_100016312
1599 Ga0070689_100020541
1600 Ga0070689_100023685
1601 Ga0070689_100059391
1602 Ga0070689_100100302
1603 Ga0070689_100172345
1604 Ga0070691_10005391
1605 Ga0070687_100003542
1606 Ga0070687_100006797
1607 Ga0070687_100186401
1608 Ga0070687_100246111
1609 Ga0070661_100023235
1610 Ga0070661_100032912
1611 Ga0070661_100067305
1612 Ga0070668_100025473
1613 Ga0070669_100002591
1614 Ga0070669_100027676
1615 Ga0070669_100040428
1616 Ga0070669_100058689
1617 Ga0070669_100103009
1618 Ga0070669_100136306
1619 Ga0070669_100189810
1620 Ga0070675_100000442
1621 Ga0070675_100001024
1622 Ga0070675_100012826
1623 Ga0070675_100024303
1624 Ga0070675_100031700
1625 Ga0070675_100035531
1626 Ga0070675_100037927
1627 Ga0070675_100049232
1628 Ga0070675_100064924
1629 Ga0070675_100072539
1630 Ga0070675_100106845
1631 Ga0070675_100126641
1632 Ga0070675_100159643
1633 Ga0070675_100171016
1634 Ga0070675_100254623
1635 Ga0070671_100022132
1636 Ga0070671_100359700
1637 Ga0070674_100004110
1638 Ga0070674_100016261
1639 Ga0070674_100052135
1640 Ga0070674_100052750
1641 Ga0070674_100071144
1642 Ga0070674_100080733
1643 Ga0070674_100098405
1644 Ga0070674_100100078
1645 Ga0070673_100007497
1646 Ga0070673_100008711
1647 Ga0070673_100011429
1648 Ga0070673_100039289
1649 Ga0070673_100045756
1650 Ga0070673_100052057
1651 Ga0070673_100054726
1652 Ga0070673_100058579
1653 Ga0070673_100074909
1654 Ga0070673_100082692
1655 Ga0070673_100272439
1656 Ga0070688_100009725
1657 Ga0070688_100021012
1658 Ga0070688_100085427
1659 Ga0070688_100101264
1660 Ga0070688_100118249
1661 Ga0070688_100206141
1662 Ga0070667_100014780
1663 Ga0070667_100106411
1664 Ga0070667_100156520
1665 Ga0070667_100207474
1666 Ga0070667_100262386
1667 Ga0070703_10003911
1668 Ga0070703_10019537
1669 Ga0070709_10004268
1670 Ga0070709_10037201
1671 Ga0070709_10069154
1672 Ga0070714_100165808
1673 Ga0070713_100028719
1674 Ga0070713_100031212
1675 Ga0070713_100097566
1676 Ga0070713_100199094
1677 Ga0070701_10007445
1678 Ga0070701_10025421
1679 Ga0070701_10025882
1680 Ga0070711_100009831
1681 Ga0070711_100083557
1682 Ga0070711_100212492
1683 Ga0070705_100000288
1684 Ga0070705_100000449
1685 Ga0070705_100026756
1686 Ga0070705_100057794
1687 Ga0070705_100115577
1688 Ga0070700_100003978
1689 Ga0070700_100010664
1690 Ga0070700_100011740
1691 Ga0070700_100153909
1692 Ga0070694_100000762
1693 Ga0070694_100020020
1694 Ga0070694_100028490
1695 Ga0070694_100032377
1696 Ga0070694_100180103
1697 Ga0070694_100335306
1698 Ga0070708_100019182
1699 Ga0070708_100028160
1700 Ga0070708_100048944
1701 Ga0070708_100057244
1702 Ga0070708_100205444
1703 Ga0070708_100293505
1704 Ga0070708_100325323
1705 Ga0070663_100009691
1706 Ga0070678_100237450
1707 Ga0070662_100036324
1708 Ga0070662_100050184
1709 Ga0070662_100076829
1710 Ga0070681_10000926
1711 Ga0070681_10005093
1712 Ga0068867_100004543
1713 Ga0068867_100007110
1714 Ga0068867_100012153
1715 Ga0068867_100015273
1716 Ga0068867_100040773
1717 Ga0068867_100068142
1718 Ga0068867_100110181
1719 Ga0068867_100129921
1720 Ga0068867_100235012
1721 Ga0068867_100414885
1722 Ga0070685_10002548
1723 Ga0070685_10003010
1724 Ga0070685_10191722
1725 Ga0070706_100007364
1726 Ga0070706_100017811
1727 Ga0070706_100062834
1728 Ga0070706_100070232
1729 Ga0070706_100201483
1730 Ga0070707_100000011
1731 Ga0070707_100002468
1732 Ga0070707_100045214
1733 Ga0070707_100049961
1734 Ga0070707_100052066
1735 Ga0070707_100060347
1736 Ga0070707_100103657
1737 Ga0070707_100211057
1738 Ga0070698_100001654
1739 Ga0070698_100002474
1740 Ga0070698_100014002
1741 Ga0070698_100015006
1742 Ga0070698_100072730
1743 Ga0070698_100163544
1744 Ga0070699_100000558
1745 Ga0070699_100009920
1746 Ga0070699_100026285
1747 Ga0070699_100042605
1748 Ga0070699_100060971
1749 Ga0070699_100063016
1750 Ga0070699_100091306
1751 Ga0070699_100104888
1752 Ga0070699_100152609
1753 Ga0070699_100217634
1754 Ga0070699_100421623
1755 Ga0070679_100011918
1756 Ga0070679_100124285
1757 Ga0070684_100004962
1758 Ga0070684_100010485
1759 Ga0070684_100122918
1760 Ga0070697_100004983
1761 Ga0070697_100057979
1762 Ga0070697_100097400
1763 Ga0070697_100162709
1764 Ga0070697_100162949
1765 Ga0070697_100267488
1766 Ga0068853_100174627
1767 Ga0070672_100000360
1768 Ga0070672_100037705
1769 Ga0070672_100066328
1770 Ga0070672_100104885
1771 Ga0070672_100115218
1772 Ga0070672_100144402
1773 Ga0070672_100247639
1774 Ga0070686_100006747
1775 Ga0070686_100147924
1776 Ga0070695_100000582
1777 Ga0070695_100008733
1778 Ga0070695_100165990
1779 Ga0070695_100296084
1780 Ga0070696_100001518
1781 Ga0070696_100003257
1782 Ga0070696_100018392
1783 Ga0070696_100033671
1784 Ga0070696_100070820
1785 Ga0070693_100000004
1786 Ga0070693_100005655
1787 Ga0070665_100000122
1788 Ga0070665_100002388
1789 Ga0070665_100003370
1790 Ga0070665_100166571
1791 Ga0070704_100000802
1792 Ga0070704_100012627
1793 Ga0070704_100012700
1794 Ga0070704_100020062
1795 Ga0070704_100049606
1796 Ga0070704_100133034
1797 Ga0070704_100153527
1798 Ga0070704_100197329
1799 Ga0068855_100345507
1800 Ga0070664_100009155
1801 Ga0070664_100040446
1802 Ga0070664_100050239
1803 Ga0070664_100054162
1804 Ga0070664_100128131
1805 Ga0070664_100147749
1806 Ga0068857_100031800
1807 Ga0068857_100041841
1808 Ga0068857_100043627
1809 Ga0068857_100124417
1810 Ga0068854_100011543
1811 Ga0070702_100002550
1812 Ga0070702_100041188
1813 Ga0070702_100105012
1814 Ga0070702_100153084
1815 Ga0068852_100026364
1816 Ga0068852_100176540
1817 Ga0068859_100004358
1818 Ga0068859_100007450
1819 Ga0068859_100023926
1820 Ga0068859_100034044
1821 Ga0068859_100053436
1822 Ga0068859_100098046
1823 Ga0068864_100000007
1824 Ga0068864_100008459
1825 Ga0068864_100008524
1826 Ga0068864_100022414
1827 Ga0068864_100037340
1828 Ga0068864_100066381
1829 Ga0068864_100067698
1830 Ga0068864_100166898
1831 Ga0068864_100276282
1832 Ga0068864_100486886
1833 Ga0068866_10010430
1834 Ga0068861_100001024
1835 Ga0068861_100004253
1836 Ga0068861_100011191
1837 Ga0068861_100018977
1838 Ga0068861_100092894
1839 Ga0068861_100130396
1840 Ga0068861_100346505
1841 Ga0068861_100383676
1842 Ga0068851_10012457
1843 Ga0068870_10002841
1844 Ga0068870_10006109
1845 Ga0068870_10006855
1846 Ga0068870_10014126
1847 Ga0068870_10066587
1848 Ga0068870_10183760
1849 Ga0068863_100089191
1850 Ga0068863_100131497
1851 Ga0068863_100135370
1852 Ga0068858_100000717
1853 Ga0068858_100010084
1854 Ga0068858_100059383
1855 Ga0068858_100096421
1856 Ga0068858_100098730
1857 Ga0068858_100182368
1858 Ga0068860_100000658
1859 Ga0068860_100002851
1860 Ga0068860_100015659
1861 Ga0068860_100095866
1862 Ga0068860_100185812
1863 Ga0068860_100196091
1864 Ga0068860_100276596
1865 Ga0068862_100002475
1866 Ga0068862_100006398
1867 Ga0068862_100016709
1868 Ga0068862_100018886
1869 Ga0068862_100167988
1870 Ga0068862_100169822
1871 Ga0068862_100172065
1872 Ga0068862_100312083
1873 Ga0068862_100484977
1874 Ga0081539_10000025
1875 Ga0081539_10000134
1876 Ga0081539_10004230
1877 Ga0070717_10000160
1878 Ga0070717_10288392
1879 Ga0075368_10006201
1880 Ga0075432_10055177
1881 Ga0070715_10063972
1882 Ga0070716_100004009
1883 Ga0070716_100042123
1884 Ga0070716_100201173
1885 Ga0070716_100219253
1886 Ga0070712_100021014
1887 Ga0070712_100077573
1888 Ga0070712_100112029
1889 Ga0075367_10003716
1890 Ga0075367_10060288
1891 Ga0097621_100005430
1892 Ga0097621_100058986
1893 Ga0097621_100059085
1894 Ga0097621_100089132
1895 Ga0097621_100100594
1896 Ga0075370_10076812
1897 Ga0068871_100001401
1898 Ga0068871_100016049
1899 Ga0068871_100060151
1900 Ga0068871_100075412
1901 Ga0068871_100117926
1902 Ga0075428_100000005
1903 Ga0075428_100002473
1904 Ga0075428_100003359
1905 Ga0075428_100006386
1906 Ga0075428_100009431
1907 Ga0075428_100016154
1908 Ga0075428_100027209
1909 Ga0075428_100048327
1910 Ga0075428_100057559
1911 Ga0075428_100166741
1912 Ga0075428_100395198
1913 Ga0075428_100442094
1914 Ga0075430_100002136
1915 Ga0075430_100002239
1916 Ga0075430_100005588
1917 Ga0075430_100014486
1918 Ga0075430_100020148
1919 Ga0075430_100034120
1920 Ga0075430_100095682
1921 Ga0075430_100175267
1922 Ga0075430_100314349
1923 Ga0075431_100000575
1924 Ga0075431_100001153
1925 Ga0075431_100005566
1926 Ga0075431_100007412
1927 Ga0075431_100010853
1928 Ga0075431_100032234
1929 Ga0075431_100074509
1930 Ga0075431_100177433
1931 Ga0075431_100192911
1932 Ga0075431_100198791
1933 Ga0075431_100330244
1934 Ga0075433_10003019
1935 Ga0075433_10050195
1936 Ga0075433_10065855
1937 Ga0075433_10067923
1938 Ga0075433_10083058
1939 Ga0075433_10088168
1940 Ga0075433_10097299
1941 Ga0075434_100000919
1942 Ga0075434_100025674
1943 Ga0075434_100037402
1944 Ga0075434_100051482
1945 Ga0075434_100062148
1946 Ga0075434_100084179
1947 Ga0075434_100100251
1948 Ga0075434_100110857
1949 Ga0075434_100127023
1950 Ga0075434_100166250
1951 Ga0075434_100176521
1952 Ga0075434_100193417
1953 Ga0075434_100204784
1954 Ga0075434_100271683
1955 Ga0075434_100396614
1956 Ga0075434_100487985
1957 Ga0075429_100003923
1958 Ga0075429_100013537
1959 Ga0075429_100016751
1960 Ga0075429_100035327
1961 Ga0075429_100036989
1962 Ga0075429_100068908
1963 Ga0075429_100091401
1964 Ga0075429_100112122
1965 Ga0075429_100116987
1966 Ga0068865_100105696
1967 Ga0075436_100007865
1968 Ga0075436_100008907
1969 Ga0075436_100011225
1970 Ga0075436_100037045
1971 Ga0075436_100042530
1972 Ga0075436_100090348
1973 Ga0097620_100004358
1974 Ga0097620_100007450
1975 Ga0097620_100023926
1976 Ga0097620_100034044
1977 Ga0097620_100053435
1978 Ga0097620_100098046
1979 Ga0075435_100000185
1980 Ga0075435_100004809
1981 Ga0075435_100006977
1982 Ga0075435_100035383
1983 Ga0075435_100336062
1984 Ga0099794_10010639
1985 Ga0099794_10012772
1986 Ga0099794_10019314
1987 Ga0099794_10049428
1988 Ga0099794_10050745
1989 Ga0099795_10011684
1990 Ga0105240_10018260
1991 Ga0105240_10024901
1992 Ga0105240_10045142
1993 Ga0105240_10118771
1994 Ga0111539_10000008
1995 Ga0111539_10010233
1996 Ga0111539_10015435
1997 Ga0111539_10017849
1998 Ga0111539_10053056
1999 Ga0111539_10069612
2000 Ga0111539_10120056
2001 Ga0111539_10162093
2002 Ga0111539_10172713
2003 Ga0111539_10237395
2004 Ga0111539_10259101
2005 Ga0111539_10366046
2006 Ga0111539_10385603
2007 Ga0111539_10419146
2008 Ga0111539_10428901
2009 Ga0111539_10505083
2010 Ga0111539_10531179
2011 Ga0105245_10004535
2012 Ga0105245_10005359
2013 Ga0105245_10033714
2014 Ga0105245_10050297
2015 Ga0105245_10152435
2016 Ga0114129_10000574
2017 Ga0114129_10001790
2018 Ga0114129_10002431
2019 Ga0114129_10007344
2020 Ga0114129_10008510
2021 Ga0114129_10020281
2022 Ga0114129_10024870
2023 Ga0114129_10049166
2024 Ga0114129_10057984
2025 Ga0114129_10103084
2026 Ga0114129_10126427
2027 Ga0114129_10147067
2028 Ga0114129_10191633
2029 Ga0114129_10400489
2030 Ga0114129_10413203
2031 Ga0105243_10013883
2032 Ga0105243_10077158
2033 Ga0105243_10118442
2034 Ga0105243_10229795
2035 Ga0105241_10033243
2036 Ga0105241_10360000
2037 Ga0105242_10007676
2038 Ga0105242_10074387
2039 Ga0105242_10129741
2040 Ga0105242_10142896
2041 Ga0105248_10001544
2042 Ga0105248_10029775
2043 Ga0105248_10039996
2044 Ga0105248_10084089
2045 Ga0105248_10093304
2046 Ga0105248_10100342
2047 Ga0105248_10119465
2048 Ga0105248_10128088
2049 Ga0105248_10182129
2050 Ga0105248_10207658
2051 Ga0105248_10410839
2052 Ga0105238_10000002
2053 Ga0105238_10203277
2054 Ga0105249_10021476
2055 Ga0105249_10032539
2056 Ga0105249_10052119
2057 Ga0105249_10104120
2058 Ga0105249_10549398
2059 Ga0099796_10002341
2060 Ga0105239_10051109
2061 Ga0105246_10016281
2062 Ga0157374_10000038
2063 Ga0157374_10001975
2064 Ga0157374_10179131
2065 Ga0157374_10200211
2066 Ga0157378_10000044
2067 Ga0157378_10000678
2068 Ga0157378_10001262
2069 Ga0157378_10002388
2070 Ga0157378_10003083
2071 Ga0157378_10281354
2072 Ga0157378_10299363
2073 Ga0163162_10006374
2074 Ga0163162_10030754
2075 Ga0163162_10031743
2076 Ga0163162_10072255
2077 Ga0157375_10000003
2078 Ga0157375_10000010
2079 Ga0157375_10006844
2080 Ga0157375_10046618
2081 Ga0157375_10094436
2082 Ga0163163_10000023
2083 Ga0163163_10007293
2084 Ga0163163_10015982
2085 Ga0163163_10074644
2086 Ga0163163_10347387
2087 Ga0157380_10007520
2088 Ga0157380_10008698
2089 Ga0157380_10011997
2090 Ga0157380_10013898
2091 Ga0157380_10015991
2092 Ga0157380_10044711
2093 Ga0157380_10049170
2094 Ga0157380_10068673
2095 Ga0157380_10084766
2096 Ga0157380_10196324
2097 Ga0157380_10204107
2098 Ga0157380_10303700
2099 Ga0157380_10331615
2100 Ga0157377_10000004
2101 Ga0157377_10000074
2102 Ga0157377_10002734
2103 Ga0157377_10008196
2104 Ga0157379_10005070
2105 Ga0157379_10207188
2106 Ga0157376_10000003
2107 Ga0157376_10000008
2108 Ga0157376_10000231
2109 Ga0157376_10055323
2110 Ga0157376_10138252
2111 Ga0157376_10325007
2112 Ga0157376_10610909
2113 Ga0163161_10024629
2114 Ga0163161_10072790
2115 Ga0228598_1000166
2116 Ga0207697_10007162
2117 Ga0207697_10025607
2118 Ga0207653_10000691
2119 Ga0207682_10002808
2120 Ga0207682_10008627
2121 Ga0207682_10026000
2122 Ga0207682_10035209
2123 Ga0207642_10002113
2124 Ga0207642_10072235
2125 Ga0207688_10000078
2126 Ga0207688_10023905
2127 Ga0207688_10122377
2128 Ga0207685_10048472
2129 Ga0207699_10001243
2130 Ga0207699_10021854
2131 Ga0207699_10044858
2132 Ga0207699_10056021
2133 Ga0207699_10060540
2134 Ga0207645_10000374
2135 Ga0207645_10001092
2136 Ga0207645_10010985
2137 Ga0207645_10034102
2138 Ga0207645_10047816
2139 Ga0207643_10003058
2140 Ga0207643_10006513
2141 Ga0207643_10038368
2142 Ga0207643_10064690
2143 Ga0207643_10101174
2144 Ga0207643_10168825
2145 Ga0207643_10186244
2146 Ga0207684_10002227
2147 Ga0207684_10048144
2148 Ga0207684_10051922
2149 Ga0207707_10008909
2150 Ga0207707_10022422
2151 Ga0207695_10034283
2152 Ga0207695_10119515
2153 Ga0207671_10147123
2154 Ga0207693_10003389
2155 Ga0207693_10015404
2156 Ga0207693_10015622
2157 Ga0207693_10034863
2158 Ga0207693_10194445
2159 Ga0207663_10006081
2160 Ga0207663_10059865
2161 Ga0207663_10066980
2162 Ga0207660_10108613
2163 Ga0207662_10007437
2164 Ga0207662_10034763
2165 Ga0207662_10056672
2166 Ga0207662_10068771
2167 Ga0207657_10131981
2168 Ga0207649_10005573
2169 Ga0207649_10085622
2170 Ga0207652_10015551
2171 Ga0207646_10000055
2172 Ga0207646_10000122
2173 Ga0207646_10001764
2174 Ga0207646_10044362
2175 Ga0207646_10051322
2176 Ga0207646_10089322
2177 Ga0207646_10115678
2178 Ga0207646_10407768
2179 Ga0207681_10000705
2180 Ga0207681_10030851
2181 Ga0207681_10048185
2182 Ga0207681_10048216
2183 Ga0207681_10049316
2184 Ga0207681_10057761
2185 Ga0207681_10080337
2186 Ga0207681_10095641
2187 Ga0207681_10164773
2188 Ga0207681_10167476
2189 Ga0207681_10372897
2190 Ga0207694_10000001
2191 Ga0207650_10010475
2192 Ga0207650_10015200
2193 Ga0207650_10017612
2194 Ga0207650_10019816
2195 Ga0207650_10030655
2196 Ga0207650_10119526
2197 Ga0207650_10223524
2198 Ga0207659_10000501
2199 Ga0207659_10003555
2200 Ga0207659_10014754
2201 Ga0207659_10020760
2202 Ga0207659_10064234
2203 Ga0207659_10073756
2204 Ga0207659_10098749
2205 Ga0207659_10139943
2206 Ga0207687_10000771
2207 Ga0207687_10008609
2208 Ga0207687_10034362
2209 Ga0207687_10067081
2210 Ga0207687_10067321
2211 Ga0207700_10044131
2212 Ga0207700_10063685
2213 Ga0207700_10078610
2214 Ga0207700_10097605
2215 Ga0207700_10141252
2216 Ga0207700_10178810
2217 Ga0207664_10109716
2218 Ga0207644_10046516
2219 Ga0207644_10050148
2220 Ga0207644_10067758
2221 Ga0207644_10078777
2222 Ga0207644_10181615
2223 Ga0207690_10010646
2224 Ga0207690_10082194
2225 Ga0207690_10106393
2226 Ga0207690_10134218
2227 Ga0207706_10005517
2228 Ga0207706_10039316
2229 Ga0207706_10042267
2230 Ga0207706_10054366
2231 Ga0207706_10075480
2232 Ga0207706_10075776
2233 Ga0207686_10017235
2234 Ga0207686_10046039
2235 Ga0207686_10085013
2236 Ga0207686_10099192
2237 Ga0207686_10106152
2238 Ga0207686_10235655
2239 Ga0207709_10007327
2240 Ga0207709_10025497
2241 Ga0207709_10040623
2242 Ga0207709_10058837
2243 Ga0207709_10125183
2244 Ga0207670_10011233
2245 Ga0207670_10022933
2246 Ga0207670_10048147
2247 Ga0207670_10051749
2248 Ga0207670_10051766
2249 Ga0207670_10068660
2250 Ga0207670_10113522
2251 Ga0207670_10240256
2252 Ga0207670_10317870
2253 Ga0207669_10010135
2254 Ga0207669_10010275
2255 Ga0207669_10022027
2256 Ga0207669_10139147
2257 Ga0207669_10177867
2258 Ga0207704_10011415
2259 Ga0207704_10225874
2260 Ga0207704_10261912
2261 Ga0207665_10000008
2262 Ga0207665_10008235
2263 Ga0207665_10050032
2264 Ga0207665_10052689
2265 Ga0207665_10080243
2266 Ga0207665_10136108
2267 Ga0207665_10197299
2268 Ga0207665_10246000
2269 Ga0207665_10260036
2270 Ga0207691_10006666
2271 Ga0207691_10008868
2272 Ga0207691_10010705
2273 Ga0207691_10036965
2274 Ga0207691_10040373
2275 Ga0207691_10043122
2276 Ga0207691_10064984
2277 Ga0207691_10067224
2278 Ga0207691_10104004
2279 Ga0207691_10200543
2280 Ga0207711_10070974
2281 Ga0207711_10076066
2282 Ga0207711_10078675
2283 Ga0207711_10121043
2284 Ga0207689_10004769
2285 Ga0207689_10006874
2286 Ga0207689_10023079
2287 Ga0207689_10066454
2288 Ga0207689_10094010
2289 Ga0207689_10136530
2290 Ga0207689_10148118
2291 Ga0207689_10300848
2292 Ga0207689_10365401
2293 Ga0207661_10000567
2294 Ga0207661_10076026
2295 Ga0207661_10225408
2296 Ga0207679_10002887
2297 Ga0207679_10008110
2298 Ga0207679_10038680
2299 Ga0207679_10061002
2300 Ga0207679_10080569
2301 Ga0207679_10195768
2302 Ga0207679_10345999
2303 Ga0207679_10466302
2304 Ga0207651_10003088
2305 Ga0207651_10013243
2306 Ga0207651_10017893
2307 Ga0207651_10017894
2308 Ga0207651_10025651
2309 Ga0207651_10068350
2310 Ga0207651_10079593
2311 Ga0207651_10093640
2312 Ga0207651_10136320
2313 Ga0207651_10164201
2314 Ga0207651_10328403
2315 Ga0207712_10020761
2316 Ga0207712_10026599
2317 Ga0207712_10033799
2318 Ga0207712_10135594
2319 Ga0207712_10179426
2320 Ga0207668_10172199
2321 Ga0207640_10005632
2322 Ga0207640_10018088
2323 Ga0207640_10053034
2324 Ga0207658_10085333
2325 Ga0207677_10030076
2326 Ga0207677_10112640
2327 Ga0207677_10259951
2328 Ga0207703_10111147
2329 Ga0207703_10183813
2330 Ga0207703_10251546
2331 Ga0207703_10365100
2332 Ga0207639_10000028
2333 Ga0207639_10078745
2334 Ga0207678_10019603
2335 Ga0207678_10064943
2336 Ga0207708_10030417
2337 Ga0207708_10052944
2338 Ga0207708_10060418
2339 Ga0207708_10077717
2340 Ga0207708_10078793
2341 Ga0207708_10087996
2342 Ga0207708_10109996
2343 Ga0207708_10352092
2344 Ga0207641_10068952
2345 Ga0207641_10176334
2346 Ga0207648_10003537
2347 Ga0207648_10006736
2348 Ga0207648_10014255
2349 Ga0207648_10026662
2350 Ga0207648_10037009
2351 Ga0207648_10040076
2352 Ga0207648_10055320
2353 Ga0207648_10061425
2354 Ga0207676_10000015
2355 Ga0207676_10036130
2356 Ga0207676_10082326
2357 Ga0207676_10082601
2358 Ga0207676_10084144
2359 Ga0207676_10116410
2360 Ga0207676_10130061
2361 Ga0207676_10272370
2362 Ga0207674_10035104
2363 Ga0207674_10067461
2364 Ga0207674_10137541
2365 Ga0207674_10197575
2366 Ga0207674_10288408
2367 Ga0207675_100001961
2368 Ga0207675_100002780
2369 Ga0207675_100023842
2370 Ga0207675_100027174
2371 Ga0207675_100034443
2372 Ga0207675_100048944
2373 Ga0207675_100179457
2374 Ga0207675_100196272
2375 Ga0207675_100281120
2376 Ga0207675_100302616
2377 Ga0207675_100321919
2378 Ga0207683_10048058
2379 Ga0207683_10072444
2380 Ga0207683_10075713
2381 Ga0207683_10116065
2382 Ga0207683_10200125
2383 Ga0207683_10220060
2384 Ga0207683_10490057
2385 Ga0209179_1015421
2386 Ga0209588_1005892
2387 Ga0209588_1013432
2388 Ga0209971_1006519
2389 Ga0207428_10000285
2390 Ga0207428_10005347
2391 Ga0207428_10009579
2392 Ga0207428_10019994
2393 Ga0207428_10049425
2394 Ga0207428_10104509
2395 Ga0207428_10246372
2396 Ga0207428_10253670
2397 Ga0265354_1001565
2398 Ga0265354_1001601
2399 Ga0268266_10000153
2400 Ga0268266_10000217
2401 Ga0268266_10357377
2402 Ga0268265_10000714
2403 Ga0268265_10010217
2404 Ga0268265_10100882
2405 Ga0268265_10201002
2406 Ga0268265_10214148
2407 Ga0268265_10292863
2408 Ga0268265_10316410
2409 Ga0268264_10001337
2410 Ga0268264_10001966
2411 Ga0268264_10032193
2412 Ga0268264_10092137
2413 Ga0268264_10225569
2414 Ga0268264_10355430
2415 Ga0265319_1002464
2416 Ga0265318_10000320
2417 Ga0265338_10032726
2418 Ga0265338_10038545
2419 Ga0307511_10003746
2420 Ga0265770_1001477
2421 Ga0265765_1001239
2422 Ga0265760_10000020
2423 Ga0265760_10018513
2424 Ga0265328_10028844
2425 Ga0265328_10062127
2426 Ga0265320_10000139
2427 Ga0265320_10028961
2428 Ga0265320_10059973
2429 Ga0265325_10019621
2430 Ga0265329_10000050
2431 Ga0265329_10013066
2432 Ga0265340_10025923
2433 Ga0265339_10004465
2434 Ga0265339_10156312
2435 Ga0265331_10000135
2436 Ga0265331_10006194
2437 Ga0265331_10017191
2438 Ga0265331_10026792
2439 Ga0265316_10000531
2440 Ga0265316_10000752
2441 Ga0265316_10031452
2442 Ga0265316_10067052
2443 Ga0265316_10088298
2444 Ga0307408_100019683
2445 Ga0307408_100061025
2446 Ga0307408_100130347
2447 Ga0307408_100228101
2448 Ga0265313_10001857
2449 Ga0265313_10017309
2450 Ga0307508_10019767
2451 Ga0265314_10023524
2452 Ga0265314_10029100
2453 Ga0265314_10060442
2454 Ga0265342_10000694
2455 Ga0316576_10076797
2456 Ga0307405_10000638
2457 Ga0307413_10002032
2458 Ga0307413_10017654
2459 Ga0307410_10005295
2460 Ga0307410_10005377
2461 Ga0307410_10013809
2462 Ga0307410_10026539
2463 Ga0307406_10023741
2464 Ga0307406_10033035
2465 Ga0307407_10010455
2466 Ga0307407_10010616
2467 Ga0307407_10047429
2468 Ga0307407_10066880
2469 Ga0307407_10188770
2470 Ga0307412_10022746
2471 Ga0307412_10155456
2472 Ga0307412_10330698
2473 Ga0307409_100003656
2474 Ga0307409_100065126
2475 Ga0307409_100179543
2476 Ga0307416_100003391
2477 Ga0307416_100024508
2478 Ga0307416_100027297
2479 Ga0307416_100033527
2480 Ga0307416_100046069
2481 Ga0307416_100046391
2482 Ga0307416_100129459
2483 Ga0307416_100252380
2484 Ga0307416_100423376
2485 Ga0307416_100452523
2486 Ga0307416_100495620
2487 Ga0307414_10022618
2488 Ga0307414_10030123
2489 Ga0307414_10047654
2490 Ga0307411_10025874
2491 Ga0307411_10026725
2492 Ga0307411_10069895
2493 Ga0307411_10127043
2494 Ga0307411_10171712
2495 Ga0307415_100008737
2496 Ga0307415_100041972
2497 Ga0307415_100079332
2498 Ga0316212_1008675
2499 Ga0373926_0000176
2500 Ga0373926_0004885
2501 Ga0373929_0000003
2502 Ga0373934_0001676
2503 Ga0373949_0005553
2504 Ga0373923_0022394
2505 Ga0373932_0000061
2506 Ga0373939_0011753
2507 Ga0373945_0081489
2508 Ga0373953_0028136
2509 Ga0373954_0000648
2510 Ga0373956_0001011
2511 Ga0373956_0052747
2512 Ga0373943_0093778
2513 Ga0373946_0003193
2514 Ga0373946_0041329
2515 Ga0373946_0043801
2516 Ga0373946_0073681
2517 Ga0373955_0001645
2518 Ga0373955_0014880
2519 Ga0373955_0033421
2520 Ga0373955_0087608
2521 Ga0373961_0029778
2522 Ga0373924_0017810
2523 Ga0373924_0106313
2524 Ga0373935_0000906
2525 Ga0373927_0002502
2526 Ga0373927_0023331
2527 Ga0373927_0073760
2528 Ga0373933_0001863
2529 Ga0373933_0003491
2530 Ga0373933_0129955
2531 Ga0373947_0006424
2532 Ga0373947_0044879
2533 Ga0373947_0193851
2534 Ga0373937_0000001
2535 Ga0373937_0002907
2536 Ga0373937_0006161
2537 Ga0373937_0075873
2538 Ga0373937_0339566
2539 Ga0373937_0517493
2540 Ga0373925_0002897
2541 Ga0373925_0016760
2542 Ga0373925_0313476
2543 Ga0395905_0201526
2544 Ga0400487_55885
2545 Ga0436365_1139438
2546 Ga0436365_1884859
2547 Ga0439453_0004367
2548 Ga0439453_0007620
2549 Ga0439431_0009100
2550 Ga0439433_0018593
2551 Ga0439441_005229
2552 Ga0450894_000401
2553 Ga0450898_003741
2554 Ga0439446_0007852
2555 Ga0439434_0027623
2556 Ga0439434_0053512
2557 Ga0439435_0010606
2558 Ga0439435_0018526
2559 Ga0439444_0004188
2560 Ga0439464_0014996
2561 Ga0439460_0021550
2562 Ga0451577_0003196
2563 Ga0451577_0005031
2564 Ga0451577_0029633
2565 Ga0451577_0049163
2566 Ga0451577_0128653
2567 Ga0451577_0210331
2568 Ga0451577_0253283
2569 Ga0453683_0004141
2570 Ga0453683_0011579
2571 Ga0453683_0012309
2572 Ga0453683_0025434
2573 Ga0453684_0018139
2574 Ga0453684_0023641
2575 Ga0453684_0048534
2576 Ga0453684_0138370
2577 Ga0451576_0007133
2578 Ga0451576_0011820
2579 Ga0451576_0013194
2580 Ga0451576_0013267
2581 Ga0451576_0013998
2582 Ga0451576_0017863
2583 Ga0451576_0063613
2584 Ga0451576_0133886
2585 Ga0451576_0166417
2586 Ga0495592_0033147
2587 Ga0495592_0037134
2588 Ga0495592_0044739
2589 Ga0495603_0021187
2590 Ga0495629_0009367
2591 Ga0495629_0131506
2592 Ga0495638_0001740
2593 Ga0495638_0047352
2594 Ga0495651_0000059
2595 Ga0495651_0001481
2596 Ga0495651_0010905
2597 Ga0495651_0045238
2598 Ga0495653_0005508
2599 Ga0495653_0018250
2600 Ga0495653_0053917
2601 Ga0495653_0060335
2602 Ga0495653_0091792
2603 Ga0495653_0159876
2604 Ga0495580_0007354
2605 Ga0495580_0017978
2606 Ga0495580_0029073
2607 Ga0495580_0075697
2608 Ga0495582_0008789
2609 Ga0495582_0009955
2610 Ga0495582_0039499
2611 Ga0495582_0044965
2612 Ga0495639_0006368
2613 Ga0495662_0070371
2614 Ga0495664_0022141
2615 Ga0495664_0048340
2616 Ga0495664_0146681
2617 Ga0495584_0074747
2618 Ga0495584_0189663
2619 Ga0495594_0013813
2620 Ga0495594_0018400
2621 Ga0495594_0020639
2622 Ga0495608_0006754
2623 Ga0495608_0011876
2624 Ga0495608_0023053
2625 Ga0495608_0126526
2626 Ga0495618_0032478
2627 Ga0495618_0050503
2628 Ga0495618_0145286
2629 Ga0495618_0172507
2630 Ga0495628_0000167
2631 Ga0495628_0006133
2632 Ga0495628_0023006
2633 Ga0495628_0026102
2634 Ga0495628_0034713
2635 Ga0495628_0174473
2636 Ga0495630_0012486
2637 Ga0495630_0039810
2638 Ga0495630_0060214
2639 Ga0495630_0097031
2640 Ga0495630_0239205
2641 Ga0495643_0039860
2642 Ga0495663_0012376
2643 Ga0495666_0015665
2644 Ga0495666_0034741
2645 Ga0495666_0121370
2646 Ga0495652_0004609
2647 Ga0495652_0022463
2648 Ga0495652_0028614
2649 Ga0495652_0229127
2650 Ga0495665_0002242
2651 Ga0495640_0013332
2652 Ga0495640_0137294
2653 Ga0495640_0155162
2654 Ga0495586_0015110
2655 Ga0495586_0091128
2656 Ga0495587_0000433
2657 Ga0495587_0002851
2658 Ga0495587_0003324
2659 Ga0495587_0009418
2660 Ga0495587_0017789
2661 Ga0495587_0126171
2662 Ga0495587_0200610
2663 Ga0495598_0026235
2664 Ga0495621_0039227
2665 Ga0495645_0001627
2666 Ga0495645_0008122
2667 Ga0495645_0012788
2668 Ga0495645_0067573
2669 Ga0495667_0015159
2670 Ga0495667_0026551
2671 Ga0495667_0070065
2672 Ga0495634_0008535
2673 Ga0495634_0088712
2674 Ga0495634_0149287
2675 Ga0495635_0019091
2676 Ga0495588_0007178
2677 Ga0495588_0139565
2678 Ga0495657_0024248
2679 Ga0495657_0031177
2680 Ga0495657_0058349
2681 Ga0495657_0137593
2682 Ga0495623_0001017
2683 Ga0495623_0064206
2684 Ga0495646_0008681
2685 Ga0495647_0017713
2686 Ga0495658_0016100
2687 Ga0495658_0020937
2688 Ga0495658_0155381
2689 Ga0495669_0001134
2690 Ga0495613_0006297
2691 Ga0495613_0020315
2692 Ga0495613_0143099
2693 Ga0495624_0032778
2694 Ga0495624_0065425
2695 Ga0495670_0057819
2696 Ga0495670_0121659
2697 Ga0495600_0001754
2698 Ga0495581_0167760
2699 Ga0495604_0000934
2700 Ga0495604_0006656
2701 Ga0495604_0010097
2702 Ga0495604_0045587
2703 Ga0495604_0197137
2704 Ga0495636_0010751
2705 Ga0495674_0010778
2706 Ga0495674_0015359
2707 Ga0495674_0034699
2708 Ga0495674_0141469
2709 Ga0495676_0005978
2710 Ga0495676_0061862
2711 Ga0495680_0003912
2712 Ga0495680_0007293
2713 Ga0495680_0039676
2714 Ga0495680_0058882
2715 Ga0495675_0000289
2716 Ga0495675_0003236
2717 Ga0495675_0035585
2718 Ga0495675_0067611
2719 Ga0495679_022289
2720 Ga0495684_0000504
2721 Ga0495684_0006592
2722 Ga0495684_0008127
2723 Ga0495684_0137297
2724 Ga0495684_0249058
2725 Ga0495593_0008338
2726 Ga0495593_0103662
2727 Ga0495593_0138100
2728 Ga0495602_0000056
2729 Ga0495602_0004170
2730 Ga0495602_0011475
2731 Ga0495602_0015880
2732 Ga0495602_0054834
2733 Ga0495602_0143378
2734 Ga0495614_0020037
2735 Ga0495614_0021255
2736 Ga0496100_0012885
2737 Ga0496100_0043019
2738 Ga0496100_0049289
2739 Ga0496100_0098137
2740 Ga0496101_0006912
2741 Ga0496101_0087788
2742 Ga0496102_0010134
2743 Ga0496102_0012507
2744 Ga0496102_0021614
2745 Ga0496103_0029718
2746 Ga0496104_0000157
2747 Ga0496104_0097552
2748 Ga0496104_0115609
2749 Ga0496104_0130858
2750 Ga0496105_0083326
2751 Ga0496105_0100535
2752 Ga0496105_0129031
2753 Ga0496106_0015998
2754 Ga0496106_0028722
2755 Ga0496106_0046663
2756 Ga0496106_0222372
2757 Ga0496107_0038246
2758 Ga0496107_0045403
2759 Ga0496108_0003499
2760 Ga0496108_0148824
2761 Ga0496108_0421290
2762 Ga0496109_0009476
2763 Ga0496109_0047093
2764 Ga0496110_0000063
2765 Ga0496110_0377941
2766 Ga0496111_0004348
2767 Ga0496111_0073612
2768 Ga0496112_0000245
2769 Ga0496112_0024556
2770 Ga0496112_0031622
2771 Ga0496112_0045209
2772 Ga0496112_0060475
2773 Ga0496112_0131460
2774 Ga0496113_0009126
2775 Ga0496113_0245604
2776 Ga0496113_0264357
2777 Ga0496114_0000005
2778 Ga0496114_0000371
2779 Ga0496114_0017463
2780 Ga0496114_0048633
2781 Ga0496114_0079649
2782 Ga0496115_0017958
2783 Ga0496115_0038548
2784 Ga0496115_0050776
2785 Ga0501031_0081626
2786 Ga0501032_0063932
2787 Ga0501033_0001797
2788 Ga0501033_0108440
2789 Ga0501034_0014607
2790 Ga0501034_0015307
2791 Ga0501034_0029877
2792 Ga0501034_0083279
2793 Ga0501034_0087907
2794 Ga0501036_0005695
2795 Ga0501036_0014261
2796 Ga0501036_0020670
2797 Ga0501036_0023391
2798 Ga0501036_0097060
2799 Ga0501036_0185089
2800 Ga0501036_0218816
2801 Ga0501036_0285531
2802 Ga0501037_0001960
2803 Ga0501037_0021899
2804 Ga0501037_0054273
2805 Ga0501038_0043872
2806 Ga0501038_0075827
2807 Ga0501038_0110687
2808 Ga0501038_0117291
2809 Ga0501039_0003641
2810 Ga0501039_0024578
2811 Ga0501040_0009429
2812 Ga0501040_0047419
2813 Ga0501040_0059430
2814 Ga0501040_0198859
2815 Ga0501041_0010123
2816 Ga0501041_0018828
2817 Ga0501041_0133848
2818 Ga0501042_0025593
2819 Ga0501042_0028146
2820 Ga0501042_0034060
2821 Ga0501042_0038051
2822 Ga0501042_0058854
2823 Ga0501042_0063708
2824 Ga0501042_0084812
2825 Ga0501042_0181805
2826 Ga0501042_0195047
2827 Ga0501042_0224376
2828 Ga0501043_0013132
2829 Ga0501043_0118058
2830 Ga0501043_0146656
2831 Ga0501046_0014479
2832 Ga0501046_0014990
2833 Ga0501046_0046634
2834 Ga0501046_0368956
2835 Ga0501047_0006564
2836 Ga0501047_0088501
2837 Ga0501047_0139369
2838 Ga0501047_0147499
2839 Ga0501047_0250265
2840 Ga0501048_0004103
2841 Ga0501048_0008075
2842 Ga0501048_0033095
2843 Ga0501048_0037754
2844 Ga0501048_0082182
2845 Ga0501048_0140527
2846 Ga0501067_0001385
2847 Ga0501068_0012541
2848 Ga0501068_0015357
2849 Ga0501069_0022414
2850 Ga0501069_0027751
2851 Ga0501069_0147209
2852 Ga0501070_0005646
2853 Ga0501070_0022268
2854 Ga0501071_0019087
2855 Ga0501071_0019377
2856 Ga0501071_0024253
2857 Ga0501071_0136639
2858 Ga0501071_0196801
2859 Ga0501071_0286187
2860 Ga0501072_0015475
2861 Ga0501072_0026441
2862 Ga0501072_0052203
2863 Ga0501072_0108375
2864 Ga0501072_0110579
2865 Ga0501072_0233175
2866 Ga0501072_0357101
2867 Ga0501073_0003168
2868 Ga0501073_0008693
2869 Ga0501073_0039425
2870 Ga0501073_0062776
2871 Ga0501074_0003931
2872 Ga0501074_0044209
2873 Ga0501074_0055892
2874 Ga0501074_0079253
2875 Ga0501074_0098437
2876 Ga0501074_0143634
2877 Ga0501075_0001850
2878 Ga0501075_0005672
2879 Ga0501075_0014357
2880 Ga0501075_0034386
2881 Ga0501075_0078796
2882 Ga0501075_0096760
2883 Ga0501075_0128859
2884 Ga0501075_0203219
2885 Ga0501076_0000633
2886 Ga0501076_0005874
2887 Ga0501076_0041328
2888 Ga0501076_0050221
2889 Ga0501076_0072157
2890 Ga0501076_0091921
2891 Ga0501076_0143057
2892 Ga0501076_0145643
2893 Ga0501076_0214337
2894 Ga0501076_0286645
2895 Ga0501076_0303554
2896 Ga0501077_0021021
2897 Ga0501249_011801
2898 Ga0501079_0009681
2899 Ga0501079_0015604
2900 Ga0501079_0017966
2901 Ga0501079_0021979
2902 Ga0501079_0136919
2903 Ga0501079_0202661
2904 Ga0501079_0211349
2905 Ga0501079_0297257
2906 Ga0501080_0001466
2907 Ga0501080_0046033
2908 Ga0501080_0128544
2909 Ga0501080_0141101
2910 Ga0501080_0209310
2911 Ga0501080_0249396
2912 Ga0501080_0304333
2913 Ga0501081_0007223
2914 Ga0501081_0018947
2915 Ga0501081_0040573
2916 Ga0501081_0073426
2917 Ga0501081_0083342
2918 Ga0501081_0085253
2919 Ga0501081_0085428
2920 Ga0501081_0155177
2921 Ga0501081_0184799
2922 Ga0501083_0011031
2923 Ga0501083_0026727
2924 Ga0501083_0028261
2925 Ga0501035_0027160
2926 Ga0501035_0098220
2927 Ga0501044_0009040
2928 Ga0501044_0063277
2929 Ga0501044_0092305
2930 Ga0501044_0105112
2931 Ga0501045_0006147
2932 Ga0501045_0008164
2933 Ga0501045_0015928
2934 Ga0501045_0018451
2935 Ga0501045_0021060
2936 Ga0501045_0069439
2937 Ga0501045_0095660
2938 nmdc:mga00v17_132837_c1
2939 nmdc:mga0k408_24845_c1
2940 nmdc:mga0k408_25943_c1
2941 nmdc:mga0k408_70841_c1
2942 nmdc:mga06z11_85054_c1
2943 nmdc:mga05p37_11748_c1
2944 nmdc:mga05p37_13533_c1
2945 nmdc:mga05p37_167522_c1
2946 nmdc:mga05p37_18779_c1
2947 nmdc:mga05p37_22849_c1
2948 nmdc:mga05p37_2888_c1
2949 nmdc:mga05p37_29_c1
2950 nmdc:mga05p37_351913_c1
2951 nmdc:mga05p37_357395_c1
2952 nmdc:mga05p37_368307_c1
2953 nmdc:mga05p37_39052_c1
2954 nmdc:mga05p37_39487_c2
2955 nmdc:mga05p37_39668_c1
2956 nmdc:mga05p37_416935_c1
2957 nmdc:mga05p37_420241_c1
2958 nmdc:mga05p37_56321_c1
2959 nmdc:mga05p37_569_c2
2960 nmdc:mga05p37_610996_c1
2961 nmdc:mga05p37_73587_c1
2962 nmdc:mga05p37_90897_c1
2963 nmdc:mga09592_10035_c1
2964 nmdc:mga09592_12714_c1
2965 nmdc:mga09592_14921_c1
2966 nmdc:mga09592_15438_c1
2967 nmdc:mga09592_1848_c1
2968 nmdc:mga09592_20949_c1
2969 nmdc:mga09592_25857_c1
2970 nmdc:mga09592_33010_c1
2971 nmdc:mga0qj67_118605_c2
2972 nmdc:mga0qj67_122428_c1
2973 nmdc:mga0qj67_171285_c1
2974 nmdc:mga0qj67_21098_c1
2975 nmdc:mga0qj67_234549_c1
2976 nmdc:mga0qj67_32771_c1
2977 nmdc:mga0qj67_397745_c1
2978 nmdc:mga0qj67_41245_c1
2979 nmdc:mga0qj67_7069_c1
2980 nmdc:mga0qj67_88608_c1
2981 nmdc:mga06r32_101775_c1
2982 nmdc:mga06r32_107864_c1
2983 nmdc:mga06r32_23263_c1
2984 nmdc:mga06r32_310264_c1
2985 nmdc:mga06r32_33345_c1
2986 nmdc:mga06r32_34703_c1
2987 nmdc:mga06r32_46528_c1
2988 nmdc:mga06r32_58764_c1
2989 nmdc:mga06r32_82552_c1
2990 nmdc:mga08y16_120436_c1
2991 nmdc:mga08y16_148914_c1
2992 nmdc:mga08y16_154608_c1
2993 nmdc:mga08y16_158977_c1
2994 nmdc:mga08y16_164841_c1
2995 nmdc:mga08y16_173829_c1
2996 nmdc:mga08y16_178964_c1
2997 nmdc:mga08y16_17_c1
2998 nmdc:mga08y16_182208_c1
2999 nmdc:mga08y16_212203_c1
3000 nmdc:mga08y16_242780_c1
3001 nmdc:mga08y16_252016_c1
3002 nmdc:mga08y16_338041_c1
3003 nmdc:mga08y16_4308_c1
3004 nmdc:mga08y16_46776_c1
3005 nmdc:mga08y16_513071_c1
3006 nmdc:mga08y16_54011_c1
3007 nmdc:mga08y16_57474_c1
3008 nmdc:mga08y16_65734_c1
3009 nmdc:mga08y16_6614_c1
3010 nmdc:mga08y16_82537_c1
3011 nmdc:mga0n895_1110_c1
3012 nmdc:mga0n895_116876_c1
3013 nmdc:mga0n895_123625_c1
3014 nmdc:mga0n895_123811_c1
3015 nmdc:mga0n895_135327_c1
3016 nmdc:mga0n895_13860_c1
3017 nmdc:mga0n895_145362_c1
3018 nmdc:mga0n895_148879_c1
3019 nmdc:mga0n895_209668_c1
3020 nmdc:mga0n895_287087_c1
3021 nmdc:mga0n895_36785_c1
3022 nmdc:mga0n895_69859_c1
3023 nmdc:mga0n895_79259_c1
3024 nmdc:mga0n895_84092_c1
3025 nmdc:mga0rr50_134599_c1
3026 nmdc:mga0rr50_2215_c1
3027 nmdc:mga0rr50_282787_c1
3028 nmdc:mga0rr50_56489_c1
3029 nmdc:mga0rr50_58092_c1
3030 nmdc:mga0rr50_716_c1
3031 nmdc:mga0rr50_76530_c1
3032 nmdc:mga0rr50_97048_c1
3033 nmdc:mga08x19_10017_c1
3034 nmdc:mga08x19_1347_c1
3035 nmdc:mga08x19_524_c1
3036 nmdc:mga08x19_54222_c1
3037 nmdc:mga0a205_104560_c1
3038 nmdc:mga0a205_118219_c1
3039 nmdc:mga0a205_1412_c1
3040 nmdc:mga0a205_174619_c1
3041 nmdc:mga0a205_2103_c1
3042 nmdc:mga0a205_219952_c1
3043 nmdc:mga0a205_22925_c1
3044 nmdc:mga0a205_249144_c1
3045 nmdc:mga0a205_3073_c1
3046 nmdc:mga0a205_428009_c1
3047 nmdc:mga0a205_5662_c1
3048 nmdc:mga0a205_60956_c1
3049 Ga0495601_0009838
3050 Ga0495601_0079319
3051 Ga0495612_0000398
3052 Ga0495655_0000574
3053 Ga0495595_0048976
3054 Ga0495619_0007406
3055 Ga0495619_0113876
3056 Ga0495619_0144885
3057 Ga0495619_0158037
3058 Ga0495619_0242434
3059 Ga0500628_003394
3060 Ga0500628_007908
3061 Ga0501084_0030447
3062 Ga0501084_0044927
3063 Ga0501084_0054785
3064 Ga0501084_0212131
3065 Ga0501084_0268347
3066 Ga0501084_0291544
3067 Ga0501084_0322180
3068 Ga0590071_000359
3069 Ga0590071_008116
3070 Ga0590071_023051
3071 Ga0590074_006216
3072 Ga0590075_000139
3073 Ga0590075_001920
3074 Ga0590075_011912
3075 Ga0590077_000011
3076 Ga0590077_005365
3077 Ga0501082_0003063
3078 Ga0501082_0019848
3079 Ga0501082_0036375
3080 Ga0501082_0072004
3081 Ga0501082_0132483
3082 Ga0501082_0198994
3083 Ga0501082_0263380
3084 Ga0530510_0005554
3085 Ga0530510_0082052
3086 Ga0530510_0145796
3087 Ga0530510_0353601
3088 8054359959

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05496

RuvB_N

Holliday junction DNA helicase RuvB P-loop domain

82

240

0.99

PF17864

AAA_lid_4

RuvB AAA lid domain

243

316

0.99

PF05491

RuvB_C

RuvB C-terminal winged helix domain

317

388

0.98

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

117

242

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7k-assembly1.cif.gz_A thermotoga maritima ruvb p216g mutant 0.9718 31 340
1in5-assembly1.cif.gz_A thermogota maritima ruvb a156s mutant 0.9713 29 340
1in8-assembly1.cif.gz_A thermotoga maritima ruvb t158v 0.9712 30 340
1in4-assembly1.cif.gz_A thermotoga maritima ruvb holliday junction branch migration motor 0.9712 30 340
1in7-assembly1.cif.gz_A thermotoga maritima ruvb r170a 0.9712 30 340
ID Description Score Start End Superfamily
6blbA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9889 191 265 1.10.8.60
6blbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9887 31 190 3.40.50.300
1in5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9803 267 337 1.10.10.10
6blbA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9709 267 342 1.10.10.10
6blbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9701 31 190 3.40.50.300
ID Description Score Start End GO Terms
AF-X1G2L0-F1-model_v4 AAA+ ATPase domain-containing protein 0.9976 49 208 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
GO:0016887
AF-A0A6M1X791-F1-model_v4 deleted 0.9963 31 126
AF-A0A349UQX2-F1-model_v4 Holliday junction branch migration DNA helicase RuvB 0.992 64 227 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
GO:0016887
AF-A0A7Y2ISW1-F1-model_v4 AAA family ATPase 0.9918 36 145 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A6G2DWS7-F1-model_v4 AAA family ATPase 0.9911 38 144 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378

Map