F494674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1544 | 1058 | 967 | 368 |
Family's Representative Sequence
| Representative Sequence | 3300053177|Ga0500636_0000180|Ga0500636_0000180_19997_21163 |
| Length | 388 |
| Sequence | MQAFLRSKNMNKGIVLLAAGGTGGHVFPAEALAYELKARGYAVHLVTDSRAERYAGTFPADEIHVVPSATIGSKNPIAVAKALLKLWKGLRAARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSLIHEQNAVMGRANKALAKRVKAIAGGFLPETQGDYAEKTVATGNPVRPAVLAAAEVAYTPSNAGEPFQLVVFGGSQGAQFFSGAVPAAICLMPNEMRARISVTQQARPEDKESVIASYKKLGVNADVSPFFGDMAERIAGSDLVISRSGASTVSELSVIGRPSVLVPYPHALDHDQAANAAALSAAGGASVIKQSELSPQKLSSLLSDAMNDPDRLAQTAAAAKATGKPDAAQRLADLVEAIATGQSVQHFKLKNKEGMHP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 4 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 5 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 6 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 7 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 8 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 9 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 10 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 20 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 21 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 22 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 23 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 24 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 25 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 26 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 27 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 28 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 29 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 30 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 31 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 32 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 33 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 34 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 35 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 36 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 37 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 38 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 39 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 40 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 41 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 42 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 43 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 44 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 45 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 46 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 47 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 48 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 49 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 50 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 51 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 52 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 53 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 54 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 55 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 56 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 57 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 58 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 59 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 60 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 61 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 62 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 63 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 64 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 65 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 66 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 67 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 68 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 69 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 70 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 71 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 72 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 73 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 74 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 75 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 76 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 77 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 78 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 79 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 80 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 81 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 82 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 83 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 84 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 85 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 86 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 87 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 88 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 89 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 90 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 91 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 92 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 93 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 94 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 95 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 96 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 97 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 98 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 99 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 100 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 101 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 102 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 103 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 104 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 105 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 106 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 107 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 108 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 109 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 110 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 111 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 112 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 113 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 114 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 115 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 116 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 117 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 118 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 119 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 120 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 121 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 122 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 123 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 124 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 125 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 126 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 127 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 128 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 129 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 130 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 131 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 132 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 133 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 134 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 135 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 136 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 137 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 138 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 139 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 140 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 141 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 142 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 143 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 144 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 145 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 146 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 147 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 148 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 149 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 150 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 151 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 152 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 153 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 154 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 155 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 156 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 157 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 158 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 159 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 160 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 161 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 162 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 163 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 164 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 165 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 166 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 167 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 168 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 169 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 170 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 171 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 172 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 173 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 174 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 175 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 176 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 177 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 178 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 179 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 180 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 181 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 182 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 183 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 184 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 185 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 186 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 187 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 188 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 189 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 190 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 191 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 192 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 193 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 194 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 195 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 196 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 197 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 198 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 199 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 200 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 201 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 202 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 203 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 204 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 205 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 206 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 207 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 208 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 209 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 210 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 211 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 212 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 213 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 214 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 215 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 216 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 217 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 218 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 219 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 220 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 221 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 222 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 223 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 224 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 225 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 226 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 227 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 228 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 229 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 230 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 231 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 232 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 233 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 234 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 235 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 236 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 237 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 238 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 239 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 240 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 241 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 242 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 243 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 244 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 245 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 246 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 247 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 248 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 249 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 250 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 251 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 252 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 253 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 254 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 255 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 256 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 257 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 258 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 259 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 260 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 261 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 262 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 263 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 264 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 265 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 266 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 267 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 268 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 269 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 270 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 271 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 272 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 273 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 274 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 275 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 276 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 277 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 278 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 279 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 280 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 281 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 282 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 283 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 284 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 285 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 286 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 287 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 288 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 289 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 290 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 291 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 292 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 293 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 294 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 295 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 296 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 297 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 298 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 299 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 300 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 301 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 302 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 303 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 304 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 305 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 306 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 307 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 308 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 309 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 310 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 311 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 312 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 313 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 314 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 315 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 316 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 317 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 318 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 319 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 320 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 321 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 322 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 323 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 324 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 325 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 326 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 327 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 328 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 329 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 330 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 331 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 332 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 333 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 334 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 335 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 336 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 337 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 338 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 339 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 340 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 341 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 342 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 343 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 344 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 345 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 346 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 347 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 348 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 349 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 350 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 351 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 352 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 353 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 354 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 355 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 356 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 357 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 358 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 359 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 360 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 361 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 362 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 363 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 364 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 365 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 366 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 367 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 368 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 369 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 370 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 371 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 372 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 373 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 374 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 375 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 376 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 377 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 378 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 379 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 380 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 381 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 382 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 383 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 384 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 385 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 386 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 387 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 388 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 389 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 390 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 391 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 392 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 393 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 394 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 395 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 396 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 397 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 398 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 399 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 400 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 401 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 402 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 403 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 404 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 405 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 406 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 407 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 408 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 409 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 410 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 411 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 412 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 413 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 414 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 415 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 416 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 417 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 418 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 419 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 420 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 421 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 422 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 423 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 424 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 425 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 426 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 427 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 428 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 429 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 430 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 431 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 432 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 433 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 434 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 435 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 436 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 437 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 438 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 439 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 440 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 441 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 442 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 443 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 444 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 445 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 446 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 447 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 448 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 449 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 450 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 451 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 452 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 453 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 454 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 455 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 456 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 457 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 458 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 459 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 460 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 461 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 462 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 463 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 464 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 465 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 466 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 467 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 468 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 469 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 470 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 471 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 472 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 473 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 474 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 475 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 476 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 477 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 478 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 479 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 480 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 481 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 482 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 483 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 484 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 485 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 486 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 487 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 488 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 489 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 490 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 491 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 492 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 493 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 494 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 495 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 496 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 497 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 498 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 499 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 500 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 501 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 502 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 503 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 504 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 505 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 506 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 507 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 508 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 509 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 510 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 511 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 512 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 513 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 514 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 515 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 516 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 517 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 518 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 519 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 520 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 521 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 522 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 523 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 524 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 525 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 526 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 527 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 528 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 529 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 530 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 531 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 532 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 533 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 534 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 535 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 536 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 537 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 538 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 539 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 540 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 541 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 542 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 543 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 544 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 545 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 546 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 547 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 548 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 549 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 550 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 551 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 552 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 553 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 554 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 555 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 556 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 557 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 558 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 559 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 560 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 561 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 562 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 563 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 564 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 565 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 566 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 567 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 568 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 569 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 570 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 571 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 572 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 573 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 574 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 575 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 576 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 577 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 578 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 579 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 580 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 581 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 582 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 583 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 584 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 585 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 586 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 587 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 588 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 589 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 590 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 591 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 592 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 593 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 594 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 595 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 596 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 597 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 598 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 599 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 600 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 601 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 602 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 603 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 604 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 605 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 606 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 607 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 608 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 609 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 610 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 611 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 612 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 613 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 614 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 615 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 616 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 617 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 618 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 619 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 620 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 621 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 622 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 623 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 624 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 625 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 626 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 627 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 628 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 629 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 630 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 631 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 632 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 633 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 634 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 635 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 636 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 637 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 638 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 639 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 640 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 641 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 642 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 643 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 644 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 645 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 647 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 648 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 649 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 650 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 651 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 652 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 654 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 655 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 656 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 657 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 658 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 659 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 660 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 661 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 662 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 663 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 664 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 665 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 666 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 667 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 668 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 669 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 670 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 671 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 672 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 673 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 674 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 675 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 676 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 677 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 678 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 679 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 680 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 681 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 682 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 683 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 684 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 685 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 686 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 687 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 688 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 689 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 690 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 691 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 692 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 693 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 694 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 695 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 696 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 697 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 698 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 699 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 700 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 701 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 702 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 703 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 704 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 705 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 706 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 707 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 708 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 709 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 710 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 711 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 712 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 713 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 714 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 715 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 716 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 717 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 718 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 719 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 720 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 721 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 722 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 723 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 724 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 725 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 726 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 727 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 728 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 729 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 730 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 731 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 732 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 733 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 734 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 735 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 736 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 737 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 738 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 739 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 740 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 741 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 742 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 743 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 744 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 745 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 746 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 747 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 748 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 749 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 750 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 751 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 752 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 753 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 754 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 755 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 756 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 757 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 758 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 759 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 760 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 761 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 762 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 763 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 764 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 765 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 766 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 767 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 768 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 769 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 770 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 771 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 772 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 773 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 774 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 775 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 776 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 777 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 778 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 779 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 780 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 781 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 782 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 783 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 784 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 785 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 786 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 787 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 788 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 789 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 790 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 791 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 792 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 793 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 794 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 795 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 796 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 797 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 798 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 799 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 800 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 801 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 802 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 803 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 804 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 805 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 806 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 807 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 808 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 809 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 810 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 811 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 812 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 813 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 814 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 815 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 816 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 817 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 818 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 819 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 820 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 821 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 822 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 823 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 824 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 825 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 826 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 827 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 828 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 829 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 830 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 831 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 832 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 833 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 834 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 835 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 836 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 837 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 838 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 839 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 840 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 841 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 842 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 843 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 844 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 845 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 846 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 847 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 848 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 849 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 850 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 851 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 852 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 853 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 854 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 855 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 856 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 857 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 858 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 859 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 860 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 861 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 862 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 863 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 864 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 865 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 866 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 867 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 868 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 869 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 870 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 871 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 872 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 873 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 874 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 875 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 876 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 877 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 878 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 879 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 880 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 881 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 882 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 883 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 884 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 885 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 886 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 887 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 888 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 889 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 890 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 891 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 892 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 893 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 894 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 895 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 896 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 897 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 899 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 900 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 901 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 902 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 903 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 904 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 905 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 906 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 907 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 908 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 909 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 910 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 911 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 912 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 913 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 914 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 915 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 916 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 917 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 918 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 919 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 920 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 921 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 922 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 923 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 924 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 925 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 926 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 927 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 928 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 929 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 930 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 931 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 932 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 933 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 934 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 935 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 936 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 937 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 938 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 939 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 940 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 941 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 942 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 943 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 944 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 945 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 946 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 947 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 948 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 949 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 950 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 951 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 952 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 953 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 954 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 955 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 956 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 957 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 958 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 959 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 960 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 961 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 962 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 963 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 964 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 965 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 966 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 967 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 968 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 969 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 970 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 971 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 972 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 973 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 974 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 975 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 976 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 977 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 978 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 979 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 980 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 981 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 982 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 983 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 984 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 985 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 986 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 987 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 988 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 989 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 990 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 991 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 992 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 993 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 994 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 995 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 996 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 997 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 998 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 999 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1000 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1001 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1002 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1003 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1004 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1005 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1006 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1007 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1008 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1009 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 1010 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1011 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1012 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1013 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1014 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1015 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1016 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1017 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1018 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1019 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1020 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1021 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1022 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1023 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1024 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1025 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1026 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1027 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1028 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1029 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1030 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1031 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1032 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1033 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1034 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1035 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1036 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1037 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1038 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1039 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1040 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1041 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1042 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1043 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1044 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1045 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1046 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1047 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1048 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1049 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1050 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1051 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1052 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1053 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1054 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1055 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1056 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1057 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1058 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 62.56 |
| Metatranscriptomes | 0.06 |
| Isolates | 37.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.32 |
| Bulb | 0 |
| Endosphere | 11.53 |
| Nodule | 28.17 |
| Rhizoplane | 3.43 |
| Rhizosphere | 43.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214795217 | 2209111006 | Bacteria | 2132 |
| 2 | ARSoilYngRDRAFT_c00890 | 3300000042 | Bacteria | 2307 |
| 3 | ARSoilOldRDRAFT_c001247 | 3300000044 | Bacteria | 2419 |
| 4 | JGI24736J21556_1017616 | 3300001904 | Bacteria | 1133 |
| 5 | JGI24747J21853_1005660 | 3300001978 | Bacteria | 1160 |
| 6 | JGI24740J21852_10000015 | 3300001979 | Bacteria | 58951 |
| 7 | JGI24739J22299_10000203 | 3300001989 | Bacteria | 19736 |
| 8 | JGI24737J22298_10002225 | 3300001990 | Bacteria | 6917 |
| 9 | JGI24737J22298_10015628 | 3300001990 | Bacteria | 2455 |
| 10 | JGI24750J21931_1000206 | 3300002070 | Bacteria | 9983 |
| 11 | JGI24745J21846_1000036 | 3300002073 | Bacteria | 9023 |
| 12 | JGI24748J21848_1000461 | 3300002074 | Bacteria | 4506 |
| 13 | JGI24749J21850_1001705 | 3300002076 | Bacteria | 3116 |
| 14 | JGI24744J21845_10004108 | 3300002077 | Bacteria | 3003 |
| 15 | JGI24034J26672_10001100 | 3300002239 | Bacteria | 3524 |
| 16 | JGI24742J22300_10000210 | 3300002244 | Bacteria | 8662 |
| 17 | JGI25155J39150_1000001 | 3300002704 | Bacteria | 354543 |
| 18 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 19 | JGI25162J39368_1000366 | 3300002737 | Bacteria | 38535 |
| 20 | JGI25162J39368_1000368 | 3300002737 | Bacteria | 38495 |
| 21 | JGI25154J39366_1000122 | 3300002738 | Bacteria | 61892 |
| 22 | JGI25158J39367_1000038 | 3300002739 | Bacteria | 30017 |
| 23 | JGI25157J39369_1000044 | 3300002741 | Bacteria | 122466 |
| 24 | JGI25152J39213_1000636 | 3300002773 | Bacteria | 18557 |
| 25 | JGI25152J39213_1001315 | 3300002773 | Bacteria | 11089 |
| 26 | JGI25152J39213_1003453 | 3300002773 | Bacteria | 5394 |
| 27 | JGI25150J39212_1000107 | 3300002774 | Bacteria | 48306 |
| 28 | JGI25159J45721_1000014 | 3300002987 | Bacteria | 147809 |
| 29 | JGI25159J45721_1000154 | 3300002987 | Bacteria | 32025 |
| 30 | JGI25159J45721_1001072 | 3300002987 | Bacteria | 11688 |
| 31 | JGI25151J46595_10000374 | 3300003187 | Bacteria | 46807 |
| 32 | JGI25151J46595_10000839 | 3300003187 | Bacteria | 24488 |
| 33 | JGI25151J46595_10005074 | 3300003187 | Bacteria | 6846 |
| 34 | JGI25151J46595_10016744 | 3300003187 | Bacteria | 3198 |
| 35 | JGI25151J46595_10021278 | 3300003187 | Bacteria | 2717 |
| 36 | JGI25151J46595_10021451 | 3300003187 | Bacteria | 2702 |
| 37 | JGI25151J46595_10031522 | 3300003187 | Bacteria | 2069 |
| 38 | JGI25165J46597_1000516 | 3300003214 | Bacteria | 36635 |
| 39 | JGI25165J46597_1001042 | 3300003214 | Bacteria | 18102 |
| 40 | JGI25165J46597_1002493 | 3300003214 | Bacteria | 5839 |
| 41 | JGI25153J46596_10000696 | 3300003215 | Bacteria | 20557 |
| 42 | JGI25153J46596_10003837 | 3300003215 | Bacteria | 8280 |
| 43 | JGI25153J46596_10010733 | 3300003215 | Bacteria | 4115 |
| 44 | JGI25153J46596_10011201 | 3300003215 | Bacteria | 3983 |
| 45 | rootH1_10118411 | 3300003316 | Bacteria | 1635 |
| 46 | rootH2_10034283 | 3300003320 | Bacteria | 2689 |
| 47 | rootL2_10006964 | 3300003322 | Bacteria | 8628 |
| 48 | rootH1_10280226 | 3300003323 | Bacteria | 1360 |
| 49 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 50 | JGI25160J50197_1000020 | 3300003354 | Bacteria | 232739 |
| 51 | JGI25160J50197_1012216 | 3300003354 | Bacteria | 2996 |
| 52 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 53 | JGI25161J50226_1000174 | 3300003374 | Bacteria | 43080 |
| 54 | JGI25161J50226_1001510 | 3300003374 | Bacteria | 6891 |
| 55 | Ga0006562J51391_1050564 | 3300003578 | Bacteria | 1866 |
| 56 | Ga0055526_1000597 | 3300003771 | Bacteria | 28415 |
| 57 | Ga0055526_1001490 | 3300003771 | Bacteria | 16607 |
| 58 | Ga0055526_1003626 | 3300003771 | Bacteria | 9665 |
| 59 | Ga0055526_1006767 | 3300003771 | Bacteria | 6128 |
| 60 | Ga0055524_1001814 | 3300003775 | Bacteria | 11704 |
| 61 | Ga0055524_1004279 | 3300003775 | Bacteria | 6626 |
| 62 | Ga0055524_1004359 | 3300003775 | Bacteria | 6539 |
| 63 | Ga0055536_1000497 | 3300003781 | Bacteria | 27238 |
| 64 | Ga0055536_1005415 | 3300003781 | Bacteria | 6250 |
| 65 | Ga0055528_1002181 | 3300003790 | Bacteria | 10723 |
| 66 | Ga0055528_1005558 | 3300003790 | Bacteria | 5838 |
| 67 | Ga0055528_1011408 | 3300003790 | Bacteria | 3531 |
| 68 | Ga0055528_1014643 | 3300003790 | Bacteria | 2886 |
| 69 | Ga0055528_1015571 | 3300003790 | Bacteria | 2739 |
| 70 | Ga0055530_10008497 | 3300003791 | Bacteria | 4101 |
| 71 | Ga0055540_1000929 | 3300003792 | Bacteria | 19079 |
| 72 | Ga0055540_1003312 | 3300003792 | Bacteria | 7857 |
| 73 | Ga0055540_1019170 | 3300003792 | Bacteria | 1851 |
| 74 | Ga0055531_10002881 | 3300003794 | Bacteria | 11207 |
| 75 | Ga0055531_10008844 | 3300003794 | Bacteria | 5236 |
| 76 | Ga0058692_1004850 | 3300003856 | Bacteria | 3912 |
| 77 | JGI25405J52794_10004407 | 3300003911 | Bacteria | 2514 |
| 78 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 79 | Ga0055543_1000047 | 3300004625 | Bacteria | 111073 |
| 80 | Ga0055543_1000350 | 3300004625 | Bacteria | 31311 |
| 81 | Ga0055543_1000500 | 3300004625 | Bacteria | 22620 |
| 82 | Ga0065165_1000013 | 3300005262 | Bacteria | 301887 |
| 83 | Ga0065165_1000068 | 3300005262 | Bacteria | 170609 |
| 84 | Ga0065165_1008935 | 3300005262 | Bacteria | 4591 |
| 85 | Ga0065165_1011468 | 3300005262 | Bacteria | 3693 |
| 86 | Ga0065165_1012221 | 3300005262 | Bacteria | 3512 |
| 87 | Ga0065712_10001033 | 3300005290 | Bacteria | 10330 |
| 88 | Ga0065715_10095332 | 3300005293 | Bacteria | 4107 |
| 89 | Ga0065707_10174941 | 3300005295 | Bacteria | 1450 |
| 90 | Ga0070676_10000499 | 3300005328 | Bacteria | 18707 |
| 91 | Ga0070676_10032562 | 3300005328 | Bacteria | 2987 |
| 92 | Ga0070683_100000265 | 3300005329 | Bacteria | 36059 |
| 93 | Ga0070690_100000718 | 3300005330 | Bacteria | 16997 |
| 94 | Ga0070690_100031150 | 3300005330 | Bacteria | 3320 |
| 95 | Ga0070690_100044337 | 3300005330 | Bacteria | 2822 |
| 96 | Ga0070670_100014626 | 3300005331 | Bacteria | 6737 |
| 97 | Ga0070677_10001854 | 3300005333 | Bacteria | 6684 |
| 98 | Ga0068869_100000414 | 3300005334 | Bacteria | 23258 |
| 99 | Ga0068869_100056304 | 3300005334 | Bacteria | 2867 |
| 100 | Ga0070666_10018983 | 3300005335 | Bacteria | 4431 |
| 101 | Ga0070666_10020803 | 3300005335 | Bacteria | 4245 |
| 102 | Ga0070680_100001359 | 3300005336 | Bacteria | 17686 |
| 103 | Ga0070680_100046737 | 3300005336 | Bacteria | 3522 |
| 104 | Ga0070682_100000745 | 3300005337 | Bacteria | 19431 |
| 105 | Ga0070682_100074471 | 3300005337 | Bacteria | 2180 |
| 106 | Ga0070660_100000136 | 3300005339 | Bacteria | 46892 |
| 107 | Ga0070660_100043329 | 3300005339 | Bacteria | 3439 |
| 108 | Ga0070660_100079857 | 3300005339 | Bacteria | 2566 |
| 109 | Ga0070660_100278873 | 3300005339 | Bacteria | 1367 |
| 110 | Ga0070689_100000722 | 3300005340 | Bacteria | 20157 |
| 111 | Ga0070689_100037552 | 3300005340 | Bacteria | 3703 |
| 112 | Ga0070691_10000148 | 3300005341 | Bacteria | 22373 |
| 113 | Ga0070687_100000080 | 3300005343 | Bacteria | 31259 |
| 114 | Ga0070687_100020607 | 3300005343 | Bacteria | 3086 |
| 115 | Ga0070661_100000425 | 3300005344 | Bacteria | 32302 |
| 116 | Ga0070661_100083856 | 3300005344 | Bacteria | 2354 |
| 117 | Ga0070661_100198478 | 3300005344 | Bacteria | 1532 |
| 118 | Ga0070692_10000893 | 3300005345 | Bacteria | 10102 |
| 119 | Ga0070692_10028309 | 3300005345 | Bacteria | 2784 |
| 120 | Ga0070668_100005857 | 3300005347 | Bacteria | 9111 |
| 121 | Ga0070668_100052956 | 3300005347 | Bacteria | 3130 |
| 122 | Ga0070669_100000276 | 3300005353 | Bacteria | 41366 |
| 123 | Ga0070669_100002660 | 3300005353 | Bacteria | 12871 |
| 124 | Ga0070675_100000271 | 3300005354 | Bacteria | 34156 |
| 125 | Ga0070675_100008544 | 3300005354 | Bacteria | 7949 |
| 126 | Ga0070671_100000389 | 3300005355 | Bacteria | 30190 |
| 127 | Ga0070671_100012096 | 3300005355 | Bacteria | 6944 |
| 128 | Ga0070671_100023087 | 3300005355 | Bacteria | 5085 |
| 129 | Ga0070671_100263322 | 3300005355 | Bacteria | 1465 |
| 130 | Ga0070674_100000928 | 3300005356 | Bacteria | 15290 |
| 131 | Ga0070673_100001722 | 3300005364 | Bacteria | 13004 |
| 132 | Ga0070673_100008972 | 3300005364 | Bacteria | 6688 |
| 133 | Ga0070673_100066996 | 3300005364 | Bacteria | 2870 |
| 134 | Ga0070688_100001089 | 3300005365 | Bacteria | 13567 |
| 135 | Ga0070688_100023145 | 3300005365 | Bacteria | 3650 |
| 136 | Ga0070659_100006384 | 3300005366 | Bacteria | 8513 |
| 137 | Ga0070659_100023831 | 3300005366 | Bacteria | 4687 |
| 138 | Ga0070667_100001569 | 3300005367 | Bacteria | 20471 |
| 139 | Ga0070667_100073818 | 3300005367 | Bacteria | 2909 |
| 140 | Ga0070667_100096801 | 3300005367 | Bacteria | 2545 |
| 141 | Ga0070667_100267272 | 3300005367 | Bacteria | 1533 |
| 142 | Ga0070703_10049865 | 3300005406 | Bacteria | 1334 |
| 143 | Ga0070709_10009235 | 3300005434 | Bacteria | 5429 |
| 144 | Ga0070709_10106873 | 3300005434 | Bacteria | 1874 |
| 145 | Ga0070714_100013931 | 3300005435 | Bacteria | 6452 |
| 146 | Ga0070714_100058991 | 3300005435 | Bacteria | 3290 |
| 147 | Ga0070714_100208040 | 3300005435 | Bacteria | 1792 |
| 148 | Ga0070713_100002582 | 3300005436 | Bacteria | 11845 |
| 149 | Ga0070713_100017559 | 3300005436 | Bacteria | 5414 |
| 150 | Ga0070710_10002708 | 3300005437 | Bacteria | 8421 |
| 151 | Ga0070710_10026128 | 3300005437 | Bacteria | 3099 |
| 152 | Ga0070701_10000457 | 3300005438 | Bacteria | 13932 |
| 153 | Ga0070701_10011127 | 3300005438 | Bacteria | 4007 |
| 154 | Ga0070711_100007229 | 3300005439 | Bacteria | 6746 |
| 155 | Ga0070711_100086466 | 3300005439 | Bacteria | 2248 |
| 156 | Ga0070705_100000579 | 3300005440 | Bacteria | 21266 |
| 157 | Ga0070705_100223072 | 3300005440 | Bacteria | 1306 |
| 158 | Ga0070700_100000515 | 3300005441 | Bacteria | 19292 |
| 159 | Ga0070700_100027405 | 3300005441 | Bacteria | 3377 |
| 160 | Ga0070708_100027296 | 3300005445 | Bacteria | 4897 |
| 161 | Ga0070663_100000580 | 3300005455 | Bacteria | 19553 |
| 162 | Ga0070678_100000016 | 3300005456 | Bacteria | 53269 |
| 163 | Ga0070678_100008371 | 3300005456 | Bacteria | 6195 |
| 164 | Ga0070678_100085764 | 3300005456 | Bacteria | 2400 |
| 165 | Ga0070662_100001325 | 3300005457 | Bacteria | 15215 |
| 166 | Ga0070662_100016017 | 3300005457 | Bacteria | 5030 |
| 167 | Ga0070681_10001764 | 3300005458 | Bacteria | 19392 |
| 168 | Ga0070681_10025407 | 3300005458 | Bacteria | 5957 |
| 169 | Ga0070685_10000344 | 3300005466 | Bacteria | 28550 |
| 170 | Ga0070685_10013452 | 3300005466 | Bacteria | 4316 |
| 171 | Ga0070679_100001267 | 3300005530 | Bacteria | 22298 |
| 172 | Ga0070684_100002476 | 3300005535 | Bacteria | 13600 |
| 173 | Ga0070684_100052250 | 3300005535 | Bacteria | 3553 |
| 174 | Ga0070697_100192620 | 3300005536 | Bacteria | 1731 |
| 175 | Ga0068853_100001111 | 3300005539 | Bacteria | 19042 |
| 176 | Ga0070672_100000233 | 3300005543 | Bacteria | 31143 |
| 177 | Ga0070686_100000699 | 3300005544 | Bacteria | 19478 |
| 178 | Ga0070686_100083472 | 3300005544 | Bacteria | 2121 |
| 179 | Ga0070695_100020385 | 3300005545 | Bacteria | 4048 |
| 180 | Ga0070696_100001198 | 3300005546 | Bacteria | 16816 |
| 181 | Ga0070696_100123710 | 3300005546 | Bacteria | 1875 |
| 182 | Ga0070693_100000594 | 3300005547 | Bacteria | 16031 |
| 183 | Ga0070693_100017810 | 3300005547 | Bacteria | 3700 |
| 184 | Ga0070693_100039225 | 3300005547 | Bacteria | 2652 |
| 185 | Ga0070665_100053711 | 3300005548 | Bacteria | 4040 |
| 186 | Ga0070665_100123540 | 3300005548 | Bacteria | 2591 |
| 187 | Ga0070704_100000112 | 3300005549 | Bacteria | 28583 |
| 188 | Ga0070704_100001736 | 3300005549 | Bacteria | 11901 |
| 189 | Ga0068855_100007243 | 3300005563 | Bacteria | 13453 |
| 190 | Ga0068855_100039045 | 3300005563 | Bacteria | 5637 |
| 191 | Ga0068855_100059286 | 3300005563 | Bacteria | 4479 |
| 192 | Ga0070664_100000924 | 3300005564 | Bacteria | 22943 |
| 193 | Ga0068857_100000371 | 3300005577 | Bacteria | 31431 |
| 194 | Ga0068857_100191881 | 3300005577 | Bacteria | 1861 |
| 195 | Ga0068854_100000735 | 3300005578 | Bacteria | 19431 |
| 196 | Ga0068854_100188736 | 3300005578 | Bacteria | 1614 |
| 197 | Ga0068856_100000520 | 3300005614 | Bacteria | 42483 |
| 198 | Ga0068856_100133294 | 3300005614 | Bacteria | 2489 |
| 199 | Ga0068856_100138533 | 3300005614 | Bacteria | 2440 |
| 200 | Ga0068856_100247755 | 3300005614 | Bacteria | 1797 |
| 201 | Ga0068856_100349684 | 3300005614 | Bacteria | 1497 |
| 202 | Ga0070702_100009804 | 3300005615 | Bacteria | 4700 |
| 203 | Ga0068852_100001599 | 3300005616 | Bacteria | 15407 |
| 204 | Ga0068859_100010201 | 3300005617 | Bacteria | 9455 |
| 205 | Ga0068859_100019554 | 3300005617 | Bacteria | 6804 |
| 206 | Ga0068864_100000333 | 3300005618 | Bacteria | 41669 |
| 207 | Ga0068866_10000143 | 3300005718 | Bacteria | 32232 |
| 208 | Ga0068861_100000417 | 3300005719 | Bacteria | 24695 |
| 209 | Ga0068851_10048161 | 3300005834 | Bacteria | 2160 |
| 210 | Ga0068870_10000113 | 3300005840 | Bacteria | 27642 |
| 211 | Ga0068858_100000975 | 3300005842 | Bacteria | 29622 |
| 212 | Ga0068858_100099299 | 3300005842 | Bacteria | 2714 |
| 213 | Ga0068858_100335420 | 3300005842 | Bacteria | 1447 |
| 214 | Ga0068860_100001740 | 3300005843 | Bacteria | 23200 |
| 215 | Ga0068860_100033225 | 3300005843 | Bacteria | 4952 |
| 216 | Ga0068862_100001457 | 3300005844 | Bacteria | 21772 |
| 217 | Ga0068862_100107636 | 3300005844 | Bacteria | 2444 |
| 218 | Ga0081455_10000110 | 3300005937 | Bacteria | 92459 |
| 219 | Ga0070717_10002936 | 3300006028 | Bacteria | 12106 |
| 220 | Ga0075365_10004585 | 3300006038 | Bacteria | 7349 |
| 221 | Ga0075368_10003767 | 3300006042 | Bacteria | 5094 |
| 222 | Ga0075363_100080114 | 3300006048 | Bacteria | 1785 |
| 223 | Ga0075363_100095574 | 3300006048 | Bacteria | 1639 |
| 224 | Ga0070715_10001339 | 3300006163 | Bacteria | 7099 |
| 225 | Ga0070716_100004734 | 3300006173 | Bacteria | 6527 |
| 226 | Ga0075362_10015506 | 3300006177 | Bacteria | 3101 |
| 227 | Ga0075367_10009312 | 3300006178 | Bacteria | 5129 |
| 228 | Ga0097621_100000203 | 3300006237 | Bacteria | 38745 |
| 229 | Ga0097621_100017219 | 3300006237 | Bacteria | 5484 |
| 230 | Ga0097621_100043766 | 3300006237 | Bacteria | 3610 |
| 231 | Ga0075370_10091011 | 3300006353 | Bacteria | 1759 |
| 232 | Ga0068871_100000575 | 3300006358 | Bacteria | 25171 |
| 233 | Ga0068871_100028379 | 3300006358 | Bacteria | 4386 |
| 234 | Ga0075433_10005842 | 3300006852 | Bacteria | 9692 |
| 235 | Ga0075434_100010989 | 3300006871 | Bacteria | 8515 |
| 236 | Ga0068865_100000654 | 3300006881 | Bacteria | 19602 |
| 237 | Ga0068865_100020024 | 3300006881 | Bacteria | 4337 |
| 238 | Ga0075436_100157154 | 3300006914 | Bacteria | 1602 |
| 239 | Ga0097620_100010201 | 3300006931 | Bacteria | 9455 |
| 240 | Ga0097620_100019554 | 3300006931 | Bacteria | 6804 |
| 241 | Ga0079104_1000193 | 3300006946 | Bacteria | 85489 |
| 242 | Ga0079104_1001253 | 3300006946 | Bacteria | 17716 |
| 243 | Ga0099826_10001254 | 3300006948 | Bacteria | 14871 |
| 244 | Ga0099826_10039284 | 3300006948 | Bacteria | 3312 |
| 245 | Ga0075435_100041943 | 3300007076 | Bacteria | 3659 |
| 246 | Ga0105251_10029607 | 3300009011 | Bacteria | 2757 |
| 247 | Ga0105244_10022702 | 3300009036 | Bacteria | 3450 |
| 248 | Ga0105250_10005564 | 3300009092 | Bacteria | 5634 |
| 249 | Ga0105250_10057240 | 3300009092 | Bacteria | 1565 |
| 250 | Ga0105240_10000076 | 3300009093 | Bacteria | 198848 |
| 251 | Ga0105240_10092446 | 3300009093 | Bacteria | 3694 |
| 252 | Ga0105240_10352941 | 3300009093 | Bacteria | 1668 |
| 253 | Ga0111539_10000581 | 3300009094 | Bacteria | 47068 |
| 254 | Ga0111539_10004022 | 3300009094 | Bacteria | 19301 |
| 255 | Ga0111539_10432145 | 3300009094 | Bacteria | 1533 |
| 256 | Ga0105245_10000230 | 3300009098 | Bacteria | 53225 |
| 257 | Ga0105247_10009917 | 3300009101 | Bacteria | 5769 |
| 258 | Ga0105247_10046471 | 3300009101 | Bacteria | 2665 |
| 259 | Ga0105247_10096517 | 3300009101 | Bacteria | 1884 |
| 260 | Ga0105243_10002755 | 3300009148 | Bacteria | 14611 |
| 261 | Ga0105243_10074452 | 3300009148 | Bacteria | 2754 |
| 262 | Ga0105243_10215381 | 3300009148 | Bacteria | 1694 |
| 263 | Ga0105241_10001308 | 3300009174 | Bacteria | 18957 |
| 264 | Ga0105241_10009439 | 3300009174 | Bacteria | 7164 |
| 265 | Ga0105242_10000696 | 3300009176 | Bacteria | 26370 |
| 266 | Ga0105242_10012804 | 3300009176 | Bacteria | 6461 |
| 267 | Ga0105248_10001593 | 3300009177 | Bacteria | 25250 |
| 268 | Ga0105248_10031210 | 3300009177 | Bacteria | 5955 |
| 269 | Ga0105248_10043884 | 3300009177 | Bacteria | 5015 |
| 270 | Ga0105248_10249219 | 3300009177 | Bacteria | 1999 |
| 271 | Ga0105237_10000226 | 3300009545 | Bacteria | 79798 |
| 272 | Ga0105237_10011347 | 3300009545 | Bacteria | 9428 |
| 273 | Ga0105237_10033806 | 3300009545 | Bacteria | 5180 |
| 274 | Ga0105237_10366031 | 3300009545 | Bacteria | 1446 |
| 275 | Ga0105249_10001642 | 3300009553 | Bacteria | 19605 |
| 276 | Ga0105249_10081877 | 3300009553 | Bacteria | 3002 |
| 277 | Ga0123341_1000007 | 3300009765 | Bacteria | 147072 |
| 278 | Ga0123342_1004784 | 3300009766 | Bacteria | 20320 |
| 279 | Ga0123342_1022907 | 3300009766 | Bacteria | 4145 |
| 280 | Ga0105239_10000641 | 3300010375 | Bacteria | 49765 |
| 281 | Ga0105239_10009048 | 3300010375 | Bacteria | 11275 |
| 282 | Ga0105239_10478737 | 3300010375 | Bacteria | 1414 |
| 283 | Ga0105246_10000550 | 3300011119 | Bacteria | 20662 |
| 284 | Ga0157342_1000277 | 3300012507 | Bacteria | 2870 |
| 285 | Ga0157338_1004348 | 3300012515 | Bacteria | 1221 |
| 286 | Ga0157373_10090682 | 3300013100 | Bacteria | 2153 |
| 287 | Ga0157371_10000017 | 3300013102 | Bacteria | 320830 |
| 288 | Ga0157371_10004510 | 3300013102 | Bacteria | 12131 |
| 289 | Ga0157370_10000455 | 3300013104 | Bacteria | 51231 |
| 290 | Ga0157370_10000461 | 3300013104 | Bacteria | 50850 |
| 291 | Ga0157369_10043175 | 3300013105 | Bacteria | 4915 |
| 292 | Ga0157369_10191156 | 3300013105 | Bacteria | 2151 |
| 293 | Ga0157369_10354095 | 3300013105 | Bacteria | 1524 |
| 294 | Ga0157369_10436414 | 3300013105 | Bacteria | 1357 |
| 295 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 296 | Ga0157374_10016190 | 3300013296 | Bacteria | 6551 |
| 297 | Ga0157374_10044193 | 3300013296 | Bacteria | 4118 |
| 298 | Ga0157374_10116632 | 3300013296 | Bacteria | 2573 |
| 299 | Ga0157378_10000864 | 3300013297 | Bacteria | 28028 |
| 300 | Ga0163162_10000420 | 3300013306 | Bacteria | 39042 |
| 301 | Ga0163162_10016129 | 3300013306 | Bacteria | 7303 |
| 302 | Ga0163162_10059976 | 3300013306 | Bacteria | 3838 |
| 303 | Ga0157372_10024037 | 3300013307 | Bacteria | 6611 |
| 304 | Ga0157375_10001626 | 3300013308 | Bacteria | 19334 |
| 305 | Ga0157375_10039652 | 3300013308 | Bacteria | 4535 |
| 306 | Ga0157375_10061566 | 3300013308 | Bacteria | 3727 |
| 307 | Ga0163163_10003284 | 3300014325 | Bacteria | 13715 |
| 308 | Ga0157380_10000511 | 3300014326 | Bacteria | 23725 |
| 309 | Ga0157380_10535962 | 3300014326 | Bacteria | 1145 |
| 310 | Ga0157377_10000053 | 3300014745 | Bacteria | 89091 |
| 311 | Ga0157379_10001333 | 3300014968 | Bacteria | 20150 |
| 312 | Ga0157379_10016704 | 3300014968 | Bacteria | 6457 |
| 313 | Ga0157379_10024669 | 3300014968 | Bacteria | 5337 |
| 314 | Ga0157376_10000436 | 3300014969 | Bacteria | 26857 |
| 315 | Ga0157376_10030676 | 3300014969 | Bacteria | 4296 |
| 316 | Ga0182007_10001815 | 3300015262 | Bacteria | 11146 |
| 317 | Ga0182005_1005015 | 3300015265 | Bacteria | 4184 |
| 318 | Ga0183363_1025 | 3300015690 | Bacteria | 53844 |
| 319 | Ga0163161_10023487 | 3300017792 | Bacteria | 4350 |
| 320 | Ga0163161_10220368 | 3300017792 | Bacteria | 1469 |
| 321 | Ga0214544_1001800 | 3300021320 | Bacteria | 45046 |
| 322 | Ga0214542_1000012 | 3300021321 | Bacteria | 235800 |
| 323 | Ga0214543_1000024 | 3300021327 | Bacteria | 235745 |
| 324 | Ga0214543_1000038 | 3300021327 | Bacteria | 182106 |
| 325 | Ga0213873_10002489 | 3300021358 | Bacteria | 3190 |
| 326 | Ga0228711_1000008 | 3300022739 | Bacteria | 169893 |
| 327 | Ga0228710_1000009 | 3300022740 | Bacteria | 169770 |
| 328 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 329 | Ga0209436_100150 | 3300025208 | Bacteria | 33510 |
| 330 | Ga0209437_100051 | 3300025233 | Bacteria | 392523 |
| 331 | Ga0209437_100098 | 3300025233 | Bacteria | 229766 |
| 332 | Ga0207425_1000075 | 3300025245 | Bacteria | 107452 |
| 333 | Ga0207425_1001337 | 3300025245 | Bacteria | 10584 |
| 334 | Ga0207425_1004121 | 3300025245 | Bacteria | 4441 |
| 335 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 336 | Ga0209646_1001199 | 3300025246 | Bacteria | 7491 |
| 337 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 338 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 339 | Ga0209129_1000156 | 3300025258 | Bacteria | 107484 |
| 340 | Ga0209129_1000524 | 3300025258 | Bacteria | 26835 |
| 341 | Ga0209129_1001868 | 3300025258 | Bacteria | 11120 |
| 342 | Ga0209129_1002344 | 3300025258 | Bacteria | 9373 |
| 343 | Ga0209129_1004509 | 3300025258 | Bacteria | 5399 |
| 344 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 345 | Ga0209233_1000113 | 3300025261 | Bacteria | 253455 |
| 346 | Ga0209233_1000427 | 3300025261 | Bacteria | 30799 |
| 347 | Ga0207666_1000014 | 3300025271 | Bacteria | 41355 |
| 348 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 349 | Ga0209673_1000117 | 3300025273 | Bacteria | 172081 |
| 350 | Ga0209673_1000151 | 3300025273 | Bacteria | 148103 |
| 351 | Ga0209673_1000863 | 3300025273 | Bacteria | 39346 |
| 352 | Ga0209673_1001685 | 3300025273 | Bacteria | 18869 |
| 353 | Ga0209673_1002134 | 3300025273 | Bacteria | 14747 |
| 354 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 355 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 356 | Ga0209130_1000034 | 3300025284 | Bacteria | 302439 |
| 357 | Ga0209130_1013282 | 3300025284 | Bacteria | 2115 |
| 358 | Ga0207673_1000965 | 3300025290 | Bacteria | 3095 |
| 359 | Ga0209675_1011031 | 3300025291 | Bacteria | 3030 |
| 360 | Ga0209676_1000482 | 3300025292 | Bacteria | 65372 |
| 361 | Ga0209676_1011056 | 3300025292 | Bacteria | 3686 |
| 362 | Ga0209676_1031573 | 3300025292 | Bacteria | 1603 |
| 363 | Ga0209676_1041343 | 3300025292 | Bacteria | 1289 |
| 364 | Ga0209025_1000070 | 3300025294 | Bacteria | 287776 |
| 365 | Ga0209025_1000140 | 3300025294 | Bacteria | 184765 |
| 366 | Ga0209025_1000314 | 3300025294 | Bacteria | 107720 |
| 367 | Ga0209025_1000506 | 3300025294 | Bacteria | 74798 |
| 368 | Ga0209025_1001869 | 3300025294 | Bacteria | 24674 |
| 369 | Ga0209025_1003183 | 3300025294 | Bacteria | 15930 |
| 370 | Ga0209025_1005402 | 3300025294 | Bacteria | 10443 |
| 371 | Ga0209025_1014241 | 3300025294 | Bacteria | 4916 |
| 372 | Ga0209025_1028383 | 3300025294 | Bacteria | 2744 |
| 373 | Ga0209025_1035161 | 3300025294 | Bacteria | 2269 |
| 374 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 375 | Ga0209564_1000647 | 3300025295 | Bacteria | 52658 |
| 376 | Ga0209564_1001780 | 3300025295 | Bacteria | 19956 |
| 377 | Ga0209564_1001993 | 3300025295 | Bacteria | 17874 |
| 378 | Ga0209564_1009159 | 3300025295 | Bacteria | 4759 |
| 379 | Ga0209758_1000413 | 3300025297 | Bacteria | 72744 |
| 380 | Ga0209758_1000655 | 3300025297 | Bacteria | 52188 |
| 381 | Ga0209758_1000758 | 3300025297 | Bacteria | 46817 |
| 382 | Ga0209758_1001882 | 3300025297 | Bacteria | 22974 |
| 383 | Ga0209758_1002154 | 3300025297 | Bacteria | 20718 |
| 384 | Ga0209758_1003547 | 3300025297 | Bacteria | 14035 |
| 385 | Ga0209758_1025944 | 3300025297 | Bacteria | 2555 |
| 386 | Ga0209050_1000646 | 3300025298 | Bacteria | 54050 |
| 387 | Ga0209050_1004392 | 3300025298 | Bacteria | 9564 |
| 388 | Ga0209256_1001653 | 3300025299 | Bacteria | 21690 |
| 389 | Ga0209256_1001736 | 3300025299 | Bacteria | 20844 |
| 390 | Ga0209256_1002712 | 3300025299 | Bacteria | 13781 |
| 391 | Ga0209256_1003882 | 3300025299 | Bacteria | 9914 |
| 392 | Ga0209256_1004803 | 3300025299 | Bacteria | 8202 |
| 393 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 394 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 395 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 396 | Ga0207426_1000221 | 3300025302 | Bacteria | 134756 |
| 397 | Ga0207426_1000869 | 3300025302 | Bacteria | 31530 |
| 398 | Ga0209051_1000097 | 3300025303 | Bacteria | 167378 |
| 399 | Ga0209051_1000314 | 3300025303 | Bacteria | 74316 |
| 400 | Ga0209051_1002962 | 3300025303 | Bacteria | 11565 |
| 401 | Ga0209051_1004880 | 3300025303 | Bacteria | 8039 |
| 402 | Ga0209051_1006481 | 3300025303 | Bacteria | 6589 |
| 403 | Ga0209051_1008689 | 3300025303 | Bacteria | 5347 |
| 404 | Ga0209257_1001142 | 3300025304 | Bacteria | 33931 |
| 405 | Ga0209257_1002070 | 3300025304 | Bacteria | 21158 |
| 406 | Ga0209257_1008609 | 3300025304 | Bacteria | 5734 |
| 407 | Ga0207697_10000672 | 3300025315 | Bacteria | 19436 |
| 408 | Ga0207653_10000963 | 3300025885 | Bacteria | 9488 |
| 409 | Ga0207682_10000154 | 3300025893 | Bacteria | 31265 |
| 410 | Ga0207692_10003318 | 3300025898 | Bacteria | 6272 |
| 411 | Ga0207642_10002038 | 3300025899 | Bacteria | 6231 |
| 412 | Ga0207710_10001145 | 3300025900 | Bacteria | 13506 |
| 413 | Ga0207688_10000817 | 3300025901 | Bacteria | 15595 |
| 414 | Ga0207688_10023234 | 3300025901 | Bacteria | 3394 |
| 415 | Ga0207688_10164507 | 3300025901 | Bacteria | 1317 |
| 416 | Ga0207680_10014997 | 3300025903 | Bacteria | 4033 |
| 417 | Ga0207680_10097468 | 3300025903 | Bacteria | 1883 |
| 418 | Ga0207647_10005421 | 3300025904 | Bacteria | 9350 |
| 419 | Ga0207685_10013233 | 3300025905 | Bacteria | 2546 |
| 420 | Ga0207699_10004930 | 3300025906 | Bacteria | 6389 |
| 421 | Ga0207699_10099236 | 3300025906 | Bacteria | 1844 |
| 422 | Ga0207645_10000182 | 3300025907 | Bacteria | 50129 |
| 423 | Ga0207643_10000405 | 3300025908 | Bacteria | 28698 |
| 424 | Ga0207654_10000889 | 3300025911 | Bacteria | 16573 |
| 425 | Ga0207654_10045739 | 3300025911 | Bacteria | 2493 |
| 426 | Ga0207707_10001762 | 3300025912 | Bacteria | 19871 |
| 427 | Ga0207707_10088960 | 3300025912 | Bacteria | 2698 |
| 428 | Ga0207707_10216332 | 3300025912 | Bacteria | 1668 |
| 429 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 430 | Ga0207671_10000093 | 3300025914 | Bacteria | 138939 |
| 431 | Ga0207693_10000842 | 3300025915 | Bacteria | 27312 |
| 432 | Ga0207693_10007487 | 3300025915 | Bacteria | 8977 |
| 433 | Ga0207693_10013345 | 3300025915 | Bacteria | 6623 |
| 434 | Ga0207663_10006811 | 3300025916 | Bacteria | 5884 |
| 435 | Ga0207663_10035357 | 3300025916 | Bacteria | 2996 |
| 436 | Ga0207660_10000007 | 3300025917 | Bacteria | 102878 |
| 437 | Ga0207662_10000913 | 3300025918 | Bacteria | 13677 |
| 438 | Ga0207657_10005343 | 3300025919 | Bacteria | 13456 |
| 439 | Ga0207657_10010114 | 3300025919 | Bacteria | 9429 |
| 440 | Ga0207657_10103850 | 3300025919 | Bacteria | 2355 |
| 441 | Ga0207649_10101153 | 3300025920 | Bacteria | 1908 |
| 442 | Ga0207652_10000459 | 3300025921 | Bacteria | 42058 |
| 443 | Ga0207681_10000116 | 3300025923 | Bacteria | 67094 |
| 444 | Ga0207650_10004276 | 3300025925 | Bacteria | 9744 |
| 445 | Ga0207650_10009331 | 3300025925 | Bacteria | 6705 |
| 446 | Ga0207659_10000015 | 3300025926 | Bacteria | 168475 |
| 447 | Ga0207687_10000357 | 3300025927 | Bacteria | 30477 |
| 448 | Ga0207687_10004506 | 3300025927 | Bacteria | 9269 |
| 449 | Ga0207700_10001137 | 3300025928 | Bacteria | 15268 |
| 450 | Ga0207700_10016937 | 3300025928 | Bacteria | 4853 |
| 451 | Ga0207664_10027404 | 3300025929 | Bacteria | 4319 |
| 452 | Ga0207644_10000251 | 3300025931 | Bacteria | 36497 |
| 453 | Ga0207644_10005542 | 3300025931 | Bacteria | 8213 |
| 454 | Ga0207690_10000320 | 3300025932 | Bacteria | 32219 |
| 455 | Ga0207690_10027783 | 3300025932 | Bacteria | 3578 |
| 456 | Ga0207706_10002583 | 3300025933 | Bacteria | 17644 |
| 457 | Ga0207706_10012590 | 3300025933 | Bacteria | 7701 |
| 458 | Ga0207706_10042916 | 3300025933 | Bacteria | 4008 |
| 459 | Ga0207706_10134747 | 3300025933 | Bacteria | 2172 |
| 460 | Ga0207686_10000234 | 3300025934 | Bacteria | 42207 |
| 461 | Ga0207686_10012409 | 3300025934 | Bacteria | 4687 |
| 462 | Ga0207709_10000081 | 3300025935 | Bacteria | 164427 |
| 463 | Ga0207709_10248527 | 3300025935 | Bacteria | 1298 |
| 464 | Ga0207670_10000620 | 3300025936 | Bacteria | 19095 |
| 465 | Ga0207670_10018819 | 3300025936 | Bacteria | 4207 |
| 466 | Ga0207669_10000008 | 3300025937 | Bacteria | 168213 |
| 467 | Ga0207704_10002142 | 3300025938 | Bacteria | 8851 |
| 468 | Ga0207665_10001484 | 3300025939 | Bacteria | 15767 |
| 469 | Ga0207665_10113693 | 3300025939 | Bacteria | 1905 |
| 470 | Ga0207691_10002588 | 3300025940 | Bacteria | 17682 |
| 471 | Ga0207711_10082864 | 3300025941 | Bacteria | 2804 |
| 472 | Ga0207689_10000749 | 3300025942 | Bacteria | 31134 |
| 473 | Ga0207689_10043368 | 3300025942 | Bacteria | 3718 |
| 474 | Ga0207661_10000170 | 3300025944 | Bacteria | 41868 |
| 475 | Ga0207679_10000046 | 3300025945 | Bacteria | 119975 |
| 476 | Ga0207679_10010295 | 3300025945 | Bacteria | 6017 |
| 477 | Ga0207679_10250854 | 3300025945 | Bacteria | 1504 |
| 478 | Ga0207667_10010820 | 3300025949 | Bacteria | 10639 |
| 479 | Ga0207667_10038259 | 3300025949 | Bacteria | 5125 |
| 480 | Ga0207667_10078464 | 3300025949 | Bacteria | 3422 |
| 481 | Ga0207651_10000200 | 3300025960 | Bacteria | 26185 |
| 482 | Ga0207651_10048302 | 3300025960 | Bacteria | 2876 |
| 483 | Ga0207651_10138038 | 3300025960 | Bacteria | 1878 |
| 484 | Ga0207712_10000555 | 3300025961 | Bacteria | 30178 |
| 485 | Ga0207668_10000133 | 3300025972 | Bacteria | 52202 |
| 486 | Ga0207668_10075143 | 3300025972 | Bacteria | 2429 |
| 487 | Ga0207640_10000191 | 3300025981 | Bacteria | 43590 |
| 488 | Ga0207640_10115336 | 3300025981 | Bacteria | 1913 |
| 489 | Ga0207658_10000535 | 3300025986 | Bacteria | 34617 |
| 490 | Ga0207658_10059229 | 3300025986 | Bacteria | 2853 |
| 491 | Ga0207658_10107007 | 3300025986 | Bacteria | 2203 |
| 492 | Ga0207703_10003074 | 3300026035 | Bacteria | 14117 |
| 493 | Ga0207703_10012070 | 3300026035 | Bacteria | 6731 |
| 494 | Ga0207703_10445528 | 3300026035 | Bacteria | 1209 |
| 495 | Ga0207639_10019773 | 3300026041 | Bacteria | 4809 |
| 496 | Ga0207639_10079176 | 3300026041 | Bacteria | 2596 |
| 497 | Ga0207639_10273538 | 3300026041 | Bacteria | 1482 |
| 498 | Ga0207678_10001859 | 3300026067 | Bacteria | 19293 |
| 499 | Ga0207678_10016738 | 3300026067 | Bacteria | 6439 |
| 500 | Ga0207678_10042909 | 3300026067 | Bacteria | 3915 |
| 501 | Ga0207708_10002476 | 3300026075 | Bacteria | 13580 |
| 502 | Ga0207708_10002480 | 3300026075 | Bacteria | 13573 |
| 503 | Ga0207702_10003065 | 3300026078 | Bacteria | 15534 |
| 504 | Ga0207702_10099863 | 3300026078 | Bacteria | 2559 |
| 505 | Ga0207702_10166063 | 3300026078 | Bacteria | 2019 |
| 506 | Ga0207702_10243758 | 3300026078 | Bacteria | 1685 |
| 507 | Ga0207702_10261845 | 3300026078 | Bacteria | 1629 |
| 508 | Ga0207641_10000593 | 3300026088 | Bacteria | 39825 |
| 509 | Ga0207641_10019300 | 3300026088 | Bacteria | 5594 |
| 510 | Ga0207648_10002417 | 3300026089 | Bacteria | 20105 |
| 511 | Ga0207648_10042100 | 3300026089 | Bacteria | 4010 |
| 512 | Ga0207674_10003381 | 3300026116 | Bacteria | 19581 |
| 513 | Ga0207675_100002182 | 3300026118 | Bacteria | 19438 |
| 514 | Ga0207675_100050415 | 3300026118 | Bacteria | 3884 |
| 515 | Ga0207675_100322807 | 3300026118 | Bacteria | 1508 |
| 516 | Ga0207683_10000002 | 3300026121 | Bacteria | 258441 |
| 517 | Ga0207683_10006919 | 3300026121 | Bacteria | 9710 |
| 518 | Ga0207683_10026216 | 3300026121 | Bacteria | 5031 |
| 519 | Ga0207698_10000545 | 3300026142 | Bacteria | 21874 |
| 520 | Ga0207698_10203687 | 3300026142 | Bacteria | 1774 |
| 521 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 522 | Ga0209281_1000106 | 3300027111 | Bacteria | 219666 |
| 523 | Ga0209281_1000318 | 3300027111 | Bacteria | 85039 |
| 524 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 525 | Ga0209371_1003359 | 3300027312 | Bacteria | 7858 |
| 526 | Ga0209371_1004133 | 3300027312 | Bacteria | 6511 |
| 527 | Ga0209970_1004629 | 3300027614 | Bacteria | 2279 |
| 528 | Ga0209282_1000024 | 3300027666 | Bacteria | 170348 |
| 529 | Ga0209282_1000531 | 3300027666 | Bacteria | 18489 |
| 530 | Ga0209966_1000800 | 3300027695 | Bacteria | 6283 |
| 531 | Ga0209998_10001951 | 3300027717 | Bacteria | 4843 |
| 532 | Ga0209998_10020008 | 3300027717 | Bacteria | 1429 |
| 533 | Ga0209813_10002584 | 3300027866 | Bacteria | 4157 |
| 534 | Ga0209974_10000944 | 3300027876 | Bacteria | 10160 |
| 535 | Ga0207428_10000011 | 3300027907 | Bacteria | 354388 |
| 536 | Ga0207428_10000046 | 3300027907 | Bacteria | 191032 |
| 537 | Ga0207428_10001276 | 3300027907 | Bacteria | 26949 |
| 538 | Ga0268266_10013893 | 3300028379 | Bacteria | 6934 |
| 539 | Ga0268266_10019605 | 3300028379 | Bacteria | 5762 |
| 540 | Ga0268265_10011194 | 3300028380 | Bacteria | 6062 |
| 541 | Ga0268264_10000340 | 3300028381 | Bacteria | 71850 |
| 542 | Ga0268264_10013402 | 3300028381 | Bacteria | 6748 |
| 543 | Ga0268264_10165969 | 3300028381 | Bacteria | 1993 |
| 544 | Ga0307515_10001559 | 3300028794 | Bacteria | 51153 |
| 545 | Ga0307515_10001978 | 3300028794 | Bacteria | 45366 |
| 546 | Ga0307515_10007368 | 3300028794 | Bacteria | 21770 |
| 547 | Ga0307515_10030752 | 3300028794 | Bacteria | 8997 |
| 548 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 549 | Ga0268256_1003591 | 3300030500 | Bacteria | 6913 |
| 550 | Ga0268256_1003875 | 3300030500 | Bacteria | 6511 |
| 551 | Ga0316181_1120346 | 3300030744 | Bacteria | 2308 |
| 552 | Ga0265328_10000786 | 3300031239 | Bacteria | 14685 |
| 553 | Ga0265328_10021456 | 3300031239 | Bacteria | 2464 |
| 554 | Ga0265325_10000117 | 3300031241 | Bacteria | 54546 |
| 555 | Ga0265331_10001293 | 3300031250 | Bacteria | 18633 |
| 556 | Ga0265327_10069561 | 3300031251 | Bacteria | 1766 |
| 557 | Ga0265316_10109642 | 3300031344 | Bacteria | 2091 |
| 558 | Ga0307513_10010539 | 3300031456 | Bacteria | 11570 |
| 559 | Ga0307513_10098774 | 3300031456 | Bacteria | 2949 |
| 560 | Ga0307513_10286834 | 3300031456 | Bacteria | 1420 |
| 561 | Ga0307408_100070114 | 3300031548 | Bacteria | 2587 |
| 562 | Ga0265313_10027782 | 3300031595 | Bacteria | 2956 |
| 563 | Ga0307405_10031398 | 3300031731 | Bacteria | 3127 |
| 564 | Ga0307412_10012769 | 3300031911 | Bacteria | 4902 |
| 565 | Ga0307412_10162794 | 3300031911 | Bacteria | 1660 |
| 566 | Ga0315914_1000012 | 3300031967 | Bacteria | 169896 |
| 567 | Ga0307416_100168787 | 3300032002 | Bacteria | 2034 |
| 568 | Ga0307510_10214573 | 3300033180 | Bacteria | 1443 |
| 569 | Ga0315913_1000006 | 3300033430 | Bacteria | 169893 |
| 570 | Ga0315915_1000010 | 3300033464 | Bacteria | 240214 |
| 571 | Ga0373930_0017182 | 3300034816 | Bacteria | 1376 |
| 572 | Ga0373958_0000097 | 3300034819 | Bacteria | 9234 |
| 573 | Ga0373958_0002015 | 3300034819 | Bacteria | 2801 |
| 574 | Ga0373938_0000032 | 3300034957 | Bacteria | 17872 |
| 575 | Ga0373926_0004868 | 3300035083 | Bacteria | 4412 |
| 576 | Ga0373928_0000973 | 3300035084 | Bacteria | 5617 |
| 577 | Ga0373928_0008008 | 3300035084 | Bacteria | 2046 |
| 578 | Ga0373929_0001646 | 3300035085 | Bacteria | 4239 |
| 579 | Ga0373929_0001755 | 3300035085 | Bacteria | 4076 |
| 580 | Ga0373949_0001084 | 3300035090 | Bacteria | 8306 |
| 581 | Ga0373949_0006126 | 3300035090 | Bacteria | 2660 |
| 582 | Ga0373951_0000472 | 3300035091 | Bacteria | 11551 |
| 583 | Ga0373951_0002239 | 3300035091 | Bacteria | 4918 |
| 584 | Ga0373952_0000189 | 3300035092 | Bacteria | 9680 |
| 585 | Ga0373952_0000675 | 3300035092 | Bacteria | 6046 |
| 586 | Ga0373932_0000180 | 3300035112 | Bacteria | 18517 |
| 587 | Ga0373939_0000151 | 3300035114 | Bacteria | 19559 |
| 588 | Ga0373941_0002963 | 3300035115 | Bacteria | 3797 |
| 589 | Ga0373941_0003543 | 3300035115 | Bacteria | 3546 |
| 590 | Ga0373941_0070177 | 3300035115 | Bacteria | 1161 |
| 591 | Ga0373945_0001892 | 3300035116 | Bacteria | 6491 |
| 592 | Ga0373953_0001859 | 3300035117 | Bacteria | 6251 |
| 593 | Ga0373953_0046289 | 3300035117 | Bacteria | 1746 |
| 594 | Ga0373953_0064709 | 3300035117 | Bacteria | 1500 |
| 595 | Ga0373954_0032953 | 3300035118 | Bacteria | 2397 |
| 596 | Ga0373954_0036104 | 3300035118 | Bacteria | 2293 |
| 597 | Ga0373956_0052962 | 3300035119 | Bacteria | 1826 |
| 598 | Ga0373957_0007096 | 3300035120 | Bacteria | 3566 |
| 599 | Ga0373957_0018824 | 3300035120 | Bacteria | 2423 |
| 600 | Ga0373960_0000184 | 3300035121 | Bacteria | 11160 |
| 601 | Ga0373960_0003038 | 3300035121 | Bacteria | 3788 |
| 602 | Ga0373946_0012729 | 3300035171 | Bacteria | 3153 |
| 603 | Ga0373955_0001906 | 3300035172 | Bacteria | 9004 |
| 604 | Ga0373955_0008032 | 3300035172 | Bacteria | 4878 |
| 605 | Ga0373942_0005465 | 3300035207 | Bacteria | 2947 |
| 606 | Ga0373961_0002408 | 3300035241 | Bacteria | 4861 |
| 607 | Ga0373962_0000113 | 3300035242 | Bacteria | 16882 |
| 608 | Ga0373962_0000251 | 3300035242 | Bacteria | 11401 |
| 609 | Ga0373962_0002284 | 3300035242 | Bacteria | 4578 |
| 610 | Ga0373931_0000290 | 3300035691 | Bacteria | 21067 |
| 611 | Ga0373931_0009129 | 3300035691 | Bacteria | 4732 |
| 612 | Ga0373935_0023830 | 3300035692 | Bacteria | 3760 |
| 613 | Ga0373935_0178375 | 3300035692 | Bacteria | 1457 |
| 614 | Ga0373927_0000350 | 3300035695 | Bacteria | 36173 |
| 615 | Ga0373927_0062283 | 3300035695 | Bacteria | 2412 |
| 616 | Ga0373933_0015628 | 3300035724 | Bacteria | 4233 |
| 617 | Ga0373933_0020224 | 3300035724 | Bacteria | 3772 |
| 618 | Ga0373933_0034922 | 3300035724 | Bacteria | 2934 |
| 619 | Ga0373933_0048000 | 3300035724 | Bacteria | 2541 |
| 620 | Ga0373947_0085441 | 3300035725 | Bacteria | 1959 |
| 621 | Ga0373947_0163306 | 3300035725 | Bacteria | 1441 |
| 622 | Ga0373937_0031529 | 3300036401 | Bacteria | 4804 |
| 623 | Ga0373937_0062102 | 3300036401 | Bacteria | 3434 |
| 624 | Ga0395905_0000867 | 3300037471 | Bacteria | 39452 |
| 625 | Ga0395905_0190384 | 3300037471 | Bacteria | 1924 |
| 626 | Ga0436360_0259069 | 3300039438 | Bacteria | 1802 |
| 627 | Ga0436361_0366439 | 3300039447 | Bacteria | 1743 |
| 628 | Ga0436361_1207702 | 3300039447 | Bacteria | 3561 |
| 629 | Ga0436362_1105174 | 3300039453 | Bacteria | 4209 |
| 630 | Ga0439436_0009397 | 3300041404 | Bacteria | 2998 |
| 631 | Ga0439465_0002128 | 3300041413 | Bacteria | 6513 |
| 632 | Ga0439465_0007342 | 3300041413 | Bacteria | 3500 |
| 633 | Ga0439465_0045564 | 3300041413 | Bacteria | 1426 |
| 634 | Ga0451839_0580770 | 3300041496 | Bacteria | 1550 |
| 635 | Ga0451845_0247449 | 3300041501 | Bacteria | 1383 |
| 636 | Ga0451847_0129796 | 3300041503 | Bacteria | 2111 |
| 637 | Ga0451851_1171717 | 3300041507 | Bacteria | 5736 |
| 638 | Ga0451853_0242170 | 3300041512 | Bacteria | 5049 |
| 639 | Ga0439449_0036823 | 3300042007 | Bacteria | 1820 |
| 640 | Ga0439462_0028778 | 3300042015 | Bacteria | 1469 |
| 641 | Ga0450906_003061 | 3300042145 | Bacteria | 3623 |
| 642 | Ga0439434_0010648 | 3300042435 | Bacteria | 2712 |
| 643 | Ga0451577_0351198 | 3300042876 | Bacteria | 1338 |
| 644 | Ga0466966_0030974 | 3300044684 | Bacteria | 3470 |
| 645 | Ga0466963_0123948 | 3300044694 | Bacteria | 1780 |
| 646 | Ga0466970_0071921 | 3300044765 | Bacteria | 1860 |
| 647 | Ga0466957_0040532 | 3300044842 | Bacteria | 2813 |
| 648 | Ga0451576_0027624 | 3300045051 | Bacteria | 6091 |
| 649 | Ga0466958_0122257 | 3300045836 | Bacteria | 1630 |
| 650 | Ga0495592_0001276 | 3300046454 | Bacteria | 17453 |
| 651 | Ga0495592_0069851 | 3300046454 | Bacteria | 2560 |
| 652 | Ga0495603_0010478 | 3300046455 | Bacteria | 5617 |
| 653 | Ga0495629_0001536 | 3300046459 | Bacteria | 18162 |
| 654 | Ga0495638_0003695 | 3300046460 | Bacteria | 11911 |
| 655 | Ga0495638_0008934 | 3300046460 | Bacteria | 7066 |
| 656 | Ga0495638_0035932 | 3300046460 | Bacteria | 3156 |
| 657 | Ga0495638_0116317 | 3300046460 | Bacteria | 1584 |
| 658 | Ga0495641_0005001 | 3300046461 | Bacteria | 9146 |
| 659 | Ga0495651_0001053 | 3300046462 | Bacteria | 21347 |
| 660 | Ga0495651_0099331 | 3300046462 | Bacteria | 2170 |
| 661 | Ga0495653_0002829 | 3300046463 | Bacteria | 13841 |
| 662 | Ga0495653_0024422 | 3300046463 | Bacteria | 4871 |
| 663 | Ga0495653_0041780 | 3300046463 | Bacteria | 3577 |
| 664 | Ga0495580_0098448 | 3300046472 | Bacteria | 2034 |
| 665 | Ga0495580_0114397 | 3300046472 | Bacteria | 1874 |
| 666 | Ga0495582_0001755 | 3300046473 | Bacteria | 12244 |
| 667 | Ga0495582_0017971 | 3300046473 | Bacteria | 3865 |
| 668 | Ga0495582_0035249 | 3300046473 | Bacteria | 2751 |
| 669 | Ga0495605_0001952 | 3300046474 | Bacteria | 13095 |
| 670 | Ga0495662_0006938 | 3300046476 | Bacteria | 5628 |
| 671 | Ga0495662_0014082 | 3300046476 | Bacteria | 3893 |
| 672 | Ga0495662_0112139 | 3300046476 | Bacteria | 1337 |
| 673 | Ga0495664_0002940 | 3300046477 | Bacteria | 9201 |
| 674 | Ga0495584_0010859 | 3300046491 | Bacteria | 4674 |
| 675 | Ga0495584_0158528 | 3300046491 | Bacteria | 1150 |
| 676 | Ga0495585_0013529 | 3300046492 | Bacteria | 4770 |
| 677 | Ga0495585_0015360 | 3300046492 | Bacteria | 4449 |
| 678 | Ga0495585_0105092 | 3300046492 | Bacteria | 1506 |
| 679 | Ga0495594_0022203 | 3300046499 | Bacteria | 3393 |
| 680 | Ga0495594_0025988 | 3300046499 | Bacteria | 3148 |
| 681 | Ga0495607_0019305 | 3300046501 | Bacteria | 4333 |
| 682 | Ga0495607_0049524 | 3300046501 | Bacteria | 2449 |
| 683 | Ga0495583_0039022 | 3300046506 | Bacteria | 2240 |
| 684 | Ga0495606_0024450 | 3300046507 | Bacteria | 4352 |
| 685 | Ga0495608_0015143 | 3300046511 | Bacteria | 5350 |
| 686 | Ga0495608_0055006 | 3300046511 | Bacteria | 2630 |
| 687 | Ga0495610_0001969 | 3300046512 | Bacteria | 17628 |
| 688 | Ga0495610_0012085 | 3300046512 | Bacteria | 5221 |
| 689 | Ga0495618_0014797 | 3300046514 | Bacteria | 4759 |
| 690 | Ga0495628_0003193 | 3300046516 | Bacteria | 14701 |
| 691 | Ga0495628_0020292 | 3300046516 | Bacteria | 5484 |
| 692 | Ga0495630_0043308 | 3300046517 | Bacteria | 3362 |
| 693 | Ga0495631_0018333 | 3300046518 | Bacteria | 3296 |
| 694 | Ga0495631_0048409 | 3300046518 | Bacteria | 1864 |
| 695 | Ga0495632_0045086 | 3300046519 | Bacteria | 2198 |
| 696 | Ga0495637_0040485 | 3300046520 | Bacteria | 2006 |
| 697 | Ga0495643_0002725 | 3300046522 | Bacteria | 13593 |
| 698 | Ga0495643_0042055 | 3300046522 | Bacteria | 2490 |
| 699 | Ga0495643_0072367 | 3300046522 | Bacteria | 1808 |
| 700 | Ga0495644_0003283 | 3300046523 | Bacteria | 6397 |
| 701 | Ga0495666_0064539 | 3300046526 | Bacteria | 1747 |
| 702 | Ga0495652_0007926 | 3300046529 | Bacteria | 9749 |
| 703 | Ga0495652_0083477 | 3300046529 | Bacteria | 2629 |
| 704 | Ga0495654_0000110 | 3300046530 | Bacteria | 93042 |
| 705 | Ga0495654_0058718 | 3300046530 | Bacteria | 1855 |
| 706 | Ga0495640_0008740 | 3300046533 | Bacteria | 7936 |
| 707 | Ga0495586_0052937 | 3300046535 | Bacteria | 2198 |
| 708 | Ga0495587_0004533 | 3300046536 | Bacteria | 9126 |
| 709 | Ga0495587_0011251 | 3300046536 | Bacteria | 5673 |
| 710 | Ga0495587_0057656 | 3300046536 | Bacteria | 2283 |
| 711 | Ga0495587_0086962 | 3300046536 | Bacteria | 1809 |
| 712 | Ga0495598_0002896 | 3300046537 | Bacteria | 3591 |
| 713 | Ga0495609_0024830 | 3300046538 | Bacteria | 2748 |
| 714 | Ga0495609_0059601 | 3300046538 | Bacteria | 1688 |
| 715 | Ga0495609_0069379 | 3300046538 | Bacteria | 1550 |
| 716 | Ga0495645_0058959 | 3300046543 | Bacteria | 2784 |
| 717 | Ga0495622_0029386 | 3300046557 | Bacteria | 2568 |
| 718 | Ga0495633_0012648 | 3300046558 | Bacteria | 4479 |
| 719 | Ga0495633_0016527 | 3300046558 | Bacteria | 3803 |
| 720 | Ga0495667_0008100 | 3300046559 | Bacteria | 7132 |
| 721 | Ga0495667_0008220 | 3300046559 | Bacteria | 7081 |
| 722 | Ga0495667_0017063 | 3300046559 | Bacteria | 4903 |
| 723 | Ga0495667_0066737 | 3300046559 | Bacteria | 2351 |
| 724 | Ga0495656_0000812 | 3300046615 | Bacteria | 10072 |
| 725 | Ga0495668_0043958 | 3300046616 | Bacteria | 2483 |
| 726 | Ga0495625_0001387 | 3300046660 | Bacteria | 29722 |
| 727 | Ga0495625_0016011 | 3300046660 | Bacteria | 5912 |
| 728 | Ga0495635_0010665 | 3300046663 | Bacteria | 6433 |
| 729 | Ga0495635_0023313 | 3300046663 | Bacteria | 4314 |
| 730 | Ga0495635_0031183 | 3300046663 | Bacteria | 3703 |
| 731 | Ga0495635_0107746 | 3300046663 | Bacteria | 1903 |
| 732 | Ga0495588_0002364 | 3300046674 | Bacteria | 8071 |
| 733 | Ga0495588_0018215 | 3300046674 | Bacteria | 3420 |
| 734 | Ga0495657_0004137 | 3300046675 | Bacteria | 11618 |
| 735 | Ga0495657_0042723 | 3300046675 | Bacteria | 3093 |
| 736 | Ga0495657_0106108 | 3300046675 | Bacteria | 1784 |
| 737 | Ga0495599_0001605 | 3300046678 | Bacteria | 13038 |
| 738 | Ga0495599_0021267 | 3300046678 | Bacteria | 4047 |
| 739 | Ga0495623_0039671 | 3300046679 | Bacteria | 3008 |
| 740 | Ga0495646_0004146 | 3300046680 | Bacteria | 9100 |
| 741 | Ga0495646_0025939 | 3300046680 | Bacteria | 3681 |
| 742 | Ga0495647_0001979 | 3300046681 | Bacteria | 6401 |
| 743 | Ga0495647_0004833 | 3300046681 | Bacteria | 4402 |
| 744 | Ga0495658_0004872 | 3300046683 | Bacteria | 6586 |
| 745 | Ga0495658_0006624 | 3300046683 | Bacteria | 5692 |
| 746 | Ga0495658_0053111 | 3300046683 | Bacteria | 2300 |
| 747 | Ga0495658_0109237 | 3300046683 | Bacteria | 1661 |
| 748 | Ga0495613_0003386 | 3300046689 | Bacteria | 11918 |
| 749 | Ga0495624_0005667 | 3300046690 | Bacteria | 8960 |
| 750 | Ga0495624_0029990 | 3300046690 | Bacteria | 3545 |
| 751 | Ga0495670_0043399 | 3300046691 | Bacteria | 2244 |
| 752 | Ga0495600_0010128 | 3300046809 | Bacteria | 5845 |
| 753 | Ga0495600_0042175 | 3300046809 | Bacteria | 2974 |
| 754 | Ga0495600_0063552 | 3300046809 | Bacteria | 2412 |
| 755 | Ga0495660_0069277 | 3300046810 | Bacteria | 1875 |
| 756 | Ga0495604_0003926 | 3300047317 | Bacteria | 11841 |
| 757 | Ga0495604_0013426 | 3300047317 | Bacteria | 6525 |
| 758 | Ga0495604_0073948 | 3300047317 | Bacteria | 2570 |
| 759 | Ga0495604_0077859 | 3300047317 | Bacteria | 2490 |
| 760 | Ga0495674_0019302 | 3300047319 | Bacteria | 6328 |
| 761 | Ga0495674_0055776 | 3300047319 | Bacteria | 3464 |
| 762 | Ga0495672_0063455 | 3300047320 | Bacteria | 2120 |
| 763 | Ga0495676_0039718 | 3300047321 | Bacteria | 3893 |
| 764 | Ga0495680_0007202 | 3300047322 | Bacteria | 10242 |
| 765 | Ga0495680_0014111 | 3300047322 | Bacteria | 6938 |
| 766 | Ga0495680_0014519 | 3300047322 | Bacteria | 6818 |
| 767 | Ga0495680_0050515 | 3300047322 | Bacteria | 3251 |
| 768 | Ga0495680_0059684 | 3300047322 | Bacteria | 2943 |
| 769 | Ga0495675_0005926 | 3300047444 | Bacteria | 7468 |
| 770 | Ga0495675_0074346 | 3300047444 | Bacteria | 2142 |
| 771 | Ga0495677_0031383 | 3300047445 | Bacteria | 1934 |
| 772 | Ga0495681_0010028 | 3300047470 | Bacteria | 5769 |
| 773 | Ga0495684_0144381 | 3300047471 | Bacteria | 1783 |
| 774 | Ga0495686_0002729 | 3300047472 | Bacteria | 16131 |
| 775 | Ga0495686_0027671 | 3300047472 | Bacteria | 3700 |
| 776 | Ga0495686_0081202 | 3300047472 | Bacteria | 1980 |
| 777 | Ga0495593_0010592 | 3300047673 | Bacteria | 5319 |
| 778 | Ga0495593_0055294 | 3300047673 | Bacteria | 2089 |
| 779 | Ga0495602_0010712 | 3300048088 | Bacteria | 9507 |
| 780 | Ga0495602_0029454 | 3300048088 | Bacteria | 5227 |
| 781 | Ga0495602_0092286 | 3300048088 | Bacteria | 2509 |
| 782 | Ga0495614_0023721 | 3300048089 | Bacteria | 2648 |
| 783 | Ga0495626_0062634 | 3300048091 | Bacteria | 1689 |
| 784 | Ga0496100_0000171 | 3300048903 | Bacteria | 35989 |
| 785 | Ga0496100_0005513 | 3300048903 | Bacteria | 6827 |
| 786 | Ga0496100_0275748 | 3300048903 | Bacteria | 1252 |
| 787 | Ga0496101_0000246 | 3300048904 | Bacteria | 39478 |
| 788 | Ga0496101_0042308 | 3300048904 | Bacteria | 3251 |
| 789 | Ga0496102_0003080 | 3300048905 | Bacteria | 14123 |
| 790 | Ga0496102_0091876 | 3300048905 | Bacteria | 2810 |
| 791 | Ga0496102_0117550 | 3300048905 | Bacteria | 2481 |
| 792 | Ga0496102_0188362 | 3300048905 | Bacteria | 1944 |
| 793 | Ga0496102_0206606 | 3300048905 | Bacteria | 1851 |
| 794 | Ga0496103_0000753 | 3300048906 | Bacteria | 23863 |
| 795 | Ga0496104_0000159 | 3300048907 | Bacteria | 61494 |
| 796 | Ga0496104_0059838 | 3300048907 | Bacteria | 3607 |
| 797 | Ga0496104_0347566 | 3300048907 | Bacteria | 1396 |
| 798 | Ga0496105_0000410 | 3300048908 | Bacteria | 28167 |
| 799 | Ga0496105_0048636 | 3300048908 | Bacteria | 3500 |
| 800 | Ga0496106_0000183 | 3300048909 | Bacteria | 45053 |
| 801 | Ga0496106_0000982 | 3300048909 | Bacteria | 20805 |
| 802 | Ga0496106_0039718 | 3300048909 | Bacteria | 3524 |
| 803 | Ga0496107_0001430 | 3300048910 | Bacteria | 14748 |
| 804 | Ga0496107_0008995 | 3300048910 | Bacteria | 6922 |
| 805 | Ga0496107_0042322 | 3300048910 | Bacteria | 3271 |
| 806 | Ga0496108_0001856 | 3300048911 | Bacteria | 16893 |
| 807 | Ga0496109_0001350 | 3300048912 | Bacteria | 20293 |
| 808 | Ga0496109_0004165 | 3300048912 | Bacteria | 12074 |
| 809 | Ga0496110_0007624 | 3300048913 | Bacteria | 8654 |
| 810 | Ga0496110_0020911 | 3300048913 | Bacteria | 5528 |
| 811 | Ga0496111_0001815 | 3300048914 | Bacteria | 12543 |
| 812 | Ga0496111_0016105 | 3300048914 | Bacteria | 5148 |
| 813 | Ga0496111_0031351 | 3300048914 | Bacteria | 3786 |
| 814 | Ga0496112_0002096 | 3300048915 | Bacteria | 15835 |
| 815 | Ga0496112_0016298 | 3300048915 | Bacteria | 6958 |
| 816 | Ga0496112_0197523 | 3300048915 | Bacteria | 1972 |
| 817 | Ga0496113_0005725 | 3300048916 | Bacteria | 7785 |
| 818 | Ga0496113_0017451 | 3300048916 | Bacteria | 4983 |
| 819 | Ga0496113_0032840 | 3300048916 | Bacteria | 3773 |
| 820 | Ga0496114_0002224 | 3300048917 | Bacteria | 14788 |
| 821 | Ga0496114_0110677 | 3300048917 | Bacteria | 2353 |
| 822 | Ga0496115_0008771 | 3300048918 | Bacteria | 7494 |
| 823 | Ga0496115_0020141 | 3300048918 | Bacteria | 5142 |
| 824 | Ga0496115_0026952 | 3300048918 | Bacteria | 4491 |
| 825 | Ga0496115_0046600 | 3300048918 | Bacteria | 3466 |
| 826 | Ga0496115_0107581 | 3300048918 | Bacteria | 2289 |
| 827 | Ga0496116_0000142 | 3300048919 | Bacteria | 150342 |
| 828 | Ga0496116_0054835 | 3300048919 | Bacteria | 2622 |
| 829 | Ga0496116_0120874 | 3300048919 | Bacteria | 1516 |
| 830 | Ga0496116_0145923 | 3300048919 | Bacteria | 1322 |
| 831 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 832 | Ga0496117_0001574 | 3300048920 | Bacteria | 32408 |
| 833 | Ga0496117_0012510 | 3300048920 | Bacteria | 7471 |
| 834 | Ga0496117_0019627 | 3300048920 | Bacteria | 5544 |
| 835 | Ga0496117_0020764 | 3300048920 | Bacteria | 5344 |
| 836 | Ga0496117_0026708 | 3300048920 | Bacteria | 4512 |
| 837 | Ga0496117_0067682 | 3300048920 | Bacteria | 2415 |
| 838 | Ga0496117_0070011 | 3300048920 | Bacteria | 2359 |
| 839 | Ga0496118_0000087 | 3300048921 | Bacteria | 176693 |
| 840 | Ga0496118_0008894 | 3300048921 | Bacteria | 10262 |
| 841 | Ga0496118_0031016 | 3300048921 | Bacteria | 4444 |
| 842 | Ga0496118_0053725 | 3300048921 | Bacteria | 3058 |
| 843 | Ga0496118_0133076 | 3300048921 | Bacteria | 1592 |
| 844 | Ga0496118_0206234 | 3300048921 | Bacteria | 1158 |
| 845 | Ga0496119_0017375 | 3300048922 | Bacteria | 5411 |
| 846 | Ga0496119_0029282 | 3300048922 | Bacteria | 3739 |
| 847 | Ga0496120_0000413 | 3300048923 | Bacteria | 68125 |
| 848 | Ga0496120_0090675 | 3300048923 | Bacteria | 1633 |
| 849 | Ga0496120_0111746 | 3300048923 | Bacteria | 1426 |
| 850 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 851 | Ga0496121_0001116 | 3300048924 | Bacteria | 47237 |
| 852 | Ga0496121_0037820 | 3300048924 | Bacteria | 4281 |
| 853 | Ga0496121_0047409 | 3300048924 | Bacteria | 3666 |
| 854 | Ga0496121_0047624 | 3300048924 | Bacteria | 3655 |
| 855 | Ga0496121_0215751 | 3300048924 | Bacteria | 1356 |
| 856 | Ga0496121_0269634 | 3300048924 | Bacteria | 1170 |
| 857 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 858 | Ga0496122_0000190 | 3300048925 | Bacteria | 140376 |
| 859 | Ga0496122_0000215 | 3300048925 | Bacteria | 128810 |
| 860 | Ga0496122_0048385 | 3300048925 | Bacteria | 3270 |
| 861 | Ga0496122_0064502 | 3300048925 | Bacteria | 2664 |
| 862 | Ga0496122_0079953 | 3300048925 | Bacteria | 2282 |
| 863 | Ga0496122_0083845 | 3300048925 | Bacteria | 2207 |
| 864 | Ga0496122_0099516 | 3300048925 | Bacteria | 1949 |
| 865 | Ga0496122_0102039 | 3300048925 | Bacteria | 1914 |
| 866 | Ga0496122_0124926 | 3300048925 | Bacteria | 1649 |
| 867 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 868 | Ga0496123_0000306 | 3300048926 | Bacteria | 95266 |
| 869 | Ga0496123_0000336 | 3300048926 | Bacteria | 89161 |
| 870 | Ga0496123_0011423 | 3300048926 | Bacteria | 7697 |
| 871 | Ga0496123_0024244 | 3300048926 | Bacteria | 4617 |
| 872 | Ga0496123_0090207 | 3300048926 | Bacteria | 1823 |
| 873 | Ga0496123_0112305 | 3300048926 | Bacteria | 1554 |
| 874 | Ga0496123_0135038 | 3300048926 | Bacteria | 1359 |
| 875 | Ga0496124_0001040 | 3300048927 | Bacteria | 43813 |
| 876 | Ga0496124_0006855 | 3300048927 | Bacteria | 12267 |
| 877 | Ga0496124_0008840 | 3300048927 | Bacteria | 10458 |
| 878 | Ga0496124_0009838 | 3300048927 | Bacteria | 9779 |
| 879 | Ga0496124_0011355 | 3300048927 | Bacteria | 8905 |
| 880 | Ga0496124_0015066 | 3300048927 | Bacteria | 7434 |
| 881 | Ga0496124_0017234 | 3300048927 | Bacteria | 6814 |
| 882 | Ga0496124_0088148 | 3300048927 | Bacteria | 2537 |
| 883 | Ga0496124_0126002 | 3300048927 | Bacteria | 2040 |
| 884 | Ga0496124_0147634 | 3300048927 | Bacteria | 1849 |
| 885 | Ga0496125_0000039 | 3300048928 | Bacteria | 318665 |
| 886 | Ga0496125_0000248 | 3300048928 | Bacteria | 110840 |
| 887 | Ga0496125_0006049 | 3300048928 | Bacteria | 13230 |
| 888 | Ga0496125_0019665 | 3300048928 | Bacteria | 6360 |
| 889 | Ga0496125_0029309 | 3300048928 | Bacteria | 4949 |
| 890 | Ga0496125_0050756 | 3300048928 | Bacteria | 3430 |
| 891 | Ga0496125_0119558 | 3300048928 | Bacteria | 1884 |
| 892 | Ga0496126_0000866 | 3300048929 | Bacteria | 53241 |
| 893 | Ga0496126_0001294 | 3300048929 | Bacteria | 39967 |
| 894 | Ga0496126_0014931 | 3300048929 | Bacteria | 7831 |
| 895 | Ga0496126_0059759 | 3300048929 | Bacteria | 3431 |
| 896 | Ga0496126_0207248 | 3300048929 | Bacteria | 1652 |
| 897 | Ga0496126_0247101 | 3300048929 | Bacteria | 1488 |
| 898 | Ga0495678_005392 | 3300049459 | Bacteria | 7074 |
| 899 | Ga0495678_040275 | 3300049459 | Bacteria | 1879 |
| 900 | Ga0501033_0001862 | 3300049570 | Bacteria | 18338 |
| 901 | Ga0501034_0121230 | 3300049571 | Bacteria | 2601 |
| 902 | Ga0501034_0243144 | 3300049571 | Bacteria | 1745 |
| 903 | Ga0501036_0142376 | 3300049572 | Bacteria | 2023 |
| 904 | Ga0501043_0007295 | 3300049579 | Bacteria | 8775 |
| 905 | Ga0501047_0276960 | 3300049581 | Bacteria | 1523 |
| 906 | Ga0501068_0142099 | 3300049584 | Bacteria | 1505 |
| 907 | Ga0501077_0169863 | 3300049593 | Bacteria | 1385 |
| 908 | Ga0501079_0179105 | 3300049741 | Bacteria | 1654 |
| 909 | Ga0501080_0374935 | 3300049742 | Bacteria | 1283 |
| 910 | Ga0501035_0000584 | 3300049822 | Bacteria | 40265 |
| 911 | nmdc:mga03683_2117_c1 | 3300050489 | Bacteria | 6112 |
| 912 | nmdc:mga03683_31890_c1 | 3300050489 | Bacteria | 2117 |
| 913 | nmdc:mga03n38_29204_c1 | 3300050490 | Bacteria | 2305 |
| 914 | nmdc:mga00v17_12_c1 | 3300050491 | Bacteria | 129050 |
| 915 | nmdc:mga00v17_156564_c1 | 3300050491 | Bacteria | 1465 |
| 916 | nmdc:mga00v17_639_c1 | 3300050491 | Bacteria | 19367 |
| 917 | nmdc:mga0yw44_119621_c1 | 3300050492 | Bacteria | 1695 |
| 918 | nmdc:mga0yw44_291_c1 | 3300050492 | Bacteria | 17253 |
| 919 | nmdc:mga0yw44_73499_c1 | 3300050492 | Bacteria | 2127 |
| 920 | nmdc:mga06z11_30304_c1 | 3300050494 | Bacteria | 2617 |
| 921 | nmdc:mga07m45_93189_c1 | 3300050496 | Bacteria | 1727 |
| 922 | nmdc:mga05p37_16389_c1 | 3300050507 | Bacteria | 8927 |
| 923 | nmdc:mga08y16_9096_c1 | 3300050511 | Bacteria | 10430 |
| 924 | nmdc:mga0n895_971_c1 | 3300050512 | Bacteria | 20812 |
| 925 | nmdc:mga08x19_210538_c1 | 3300050514 | Bacteria | 1334 |
| 926 | nmdc:mga08x19_25741_c1 | 3300050514 | Bacteria | 3667 |
| 927 | nmdc:mga0a205_1026_c1 | 3300050515 | Bacteria | 23240 |
| 928 | nmdc:mga0a205_260176_c1 | 3300050515 | Bacteria | 1613 |
| 929 | nmdc:mga0sz30_1084_c1 | 3300050516 | Bacteria | 9781 |
| 930 | nmdc:mga0sz30_60381_c1 | 3300050516 | Bacteria | 1619 |
| 931 | Ga0495601_0002032 | 3300053077 | Bacteria | 11359 |
| 932 | Ga0495601_0002166 | 3300053077 | Bacteria | 11055 |
| 933 | Ga0495601_0058457 | 3300053077 | Bacteria | 2443 |
| 934 | Ga0495612_0000616 | 3300053078 | Bacteria | 14330 |
| 935 | Ga0495612_0014874 | 3300053078 | Bacteria | 3122 |
| 936 | Ga0495612_0035278 | 3300053078 | Bacteria | 2027 |
| 937 | Ga0495595_0001470 | 3300053084 | Bacteria | 9200 |
| 938 | Ga0495595_0003032 | 3300053084 | Bacteria | 6641 |
| 939 | Ga0495619_0000151 | 3300053085 | Bacteria | 51364 |
| 940 | Ga0495619_0000419 | 3300053085 | Bacteria | 28779 |
| 941 | Ga0495619_0001606 | 3300053085 | Bacteria | 14870 |
| 942 | Ga0500556_0027067 | 3300053104 | Bacteria | 1911 |
| 943 | Ga0500569_019514 | 3300053109 | Bacteria | 1765 |
| 944 | Ga0500569_030603 | 3300053109 | Bacteria | 1507 |
| 945 | Ga0500572_004012 | 3300053111 | Bacteria | 3346 |
| 946 | Ga0500608_022262 | 3300053122 | Bacteria | 2937 |
| 947 | Ga0500618_000314 | 3300053125 | Bacteria | 35813 |
| 948 | Ga0500618_000677 | 3300053125 | Bacteria | 20060 |
| 949 | Ga0500618_007431 | 3300053125 | Bacteria | 3128 |
| 950 | Ga0500618_026147 | 3300053125 | Bacteria | 1394 |
| 951 | Ga0500658_0000526 | 3300053134 | Bacteria | 16212 |
| 952 | Ga0500559_0002861 | 3300053136 | Bacteria | 8722 |
| 953 | Ga0500561_0000098 | 3300053137 | Bacteria | 16671 |
| 954 | Ga0500568_0022079 | 3300053139 | Bacteria | 2729 |
| 955 | Ga0500568_0023876 | 3300053139 | Bacteria | 2595 |
| 956 | Ga0500573_0001766 | 3300053140 | Bacteria | 10516 |
| 957 | Ga0500604_0025382 | 3300053151 | Bacteria | 1703 |
| 958 | Ga0500616_0000277 | 3300053153 | Bacteria | 76399 |
| 959 | Ga0500616_0004617 | 3300053153 | Bacteria | 9730 |
| 960 | Ga0500616_0055546 | 3300053153 | Bacteria | 2070 |
| 961 | Ga0500622_0000458 | 3300053156 | Bacteria | 38693 |
| 962 | Ga0500622_0000627 | 3300053156 | Bacteria | 31781 |
| 963 | Ga0500622_0135828 | 3300053156 | Bacteria | 1178 |
| 964 | Ga0500624_005981 | 3300053157 | Bacteria | 1635 |
| 965 | Ga0500634_0023465 | 3300053161 | Bacteria | 3353 |
| 966 | Ga0500636_0000180 | 3300053177 | Bacteria | 33813 |
| 967 | Ga0500636_0001459 | 3300053177 | Bacteria | 12853 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100023831 | Ga0070659_1000238313 | 293 |
| 2 | 3300005367 | Ga0070667_100096801 | Ga0070667_1000968014 | 293 |
| 3 | 3300005615 | Ga0070702_100009804 | Ga0070702_1000098043 | 293 |
| 4 | 3300035115 | Ga0373941_0070177 | Ga0373941_0070177_57_938 | 293 |
| 5 | 3300046476 | Ga0495662_0112139 | Ga0495662_0112139_282_1163 | 293 |
| 6 | 3300025898 | Ga0207692_10003318 | Ga0207692_100033184 | 302 |
| 7 | 3300025901 | Ga0207688_10023234 | Ga0207688_100232342 | 302 |
| 8 | 3300025925 | Ga0207650_10009331 | Ga0207650_100093313 | 302 |
| 9 | 3300026067 | Ga0207678_10016738 | Ga0207678_100167385 | 302 |
| 10 | 3300053109 | Ga0500569_030603 | Ga0500569_030603_541_1497 | 306 |
| 11 | 3300039438 | Ga0436360_0259069 | Ga0436360_0259069_116_1216 | 326 |
| 12 | 3300039447 | Ga0436361_1207702 | Ga0436361_1207702_994_2094 | 326 |
| 13 | 3300046512 | Ga0495610_0012085 | Ga0495610_0012085_10_1041 | 327 |
| 14 | 3300049459 | Ga0495678_040275 | Ga0495678_040275_831_1862 | 327 |
| 15 | 3300006948 | Ga0099826_10001254 | Ga0099826_100012547 | 328 |
| 16 | 3300027666 | Ga0209282_1000531 | Ga0209282_10005314 | 328 |
| 17 | 3300048919 | Ga0496116_0120874 | Ga0496116_0120874_215_1351 | 328 |
| 18 | 3300048920 | Ga0496117_0067682 | Ga0496117_0067682_1114_2250 | 328 |
| 19 | 3300048922 | Ga0496119_0029282 | Ga0496119_0029282_1469_2605 | 328 |
| 20 | 3300048928 | Ga0496125_0019665 | Ga0496125_0019665_1135_2271 | 328 |
| 21 | 3300035692 | Ga0373935_0178375 | Ga0373935_0178375_151_1275 | 329 |
| 22 | 3300035695 | Ga0373927_0000350 | Ga0373927_0000350_30682_31806 | 329 |
| 23 | 3300037471 | Ga0395905_0000867 | Ga0395905_0000867_9064_10191 | 329 |
| 24 | 3300048921 | Ga0496118_0206234 | Ga0496118_0206234_25_1107 | 331 |
| 25 | 3300037471 | Ga0395905_0190384 | Ga0395905_0190384_608_1735 | 333 |
| 26 | 3300002987 | JGI25159J45721_1001072 | JGI25159J45721_10010727 | 334 |
| 27 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001660 | 334 |
| 28 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_100000193 | 334 |
| 29 | 3300004625 | Ga0055543_1000003 | Ga0055543_1000003109 | 334 |
| 30 | 3300005262 | Ga0065165_1000068 | Ga0065165_100006860 | 334 |
| 31 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003117 | 334 |
| 32 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011662 | 334 |
| 33 | 3300028794 | Ga0307515_10001559 | Ga0307515_1000155927 | 335 |
| 34 | 3300027312 | Ga0209371_1000022 | Ga0209371_100002278 | 336 |
| 35 | 3300030500 | Ga0268256_1000019 | Ga0268256_1000019442 | 336 |
| 36 | 3300053125 | Ga0500618_000677 | Ga0500618_000677_10728_11864 | 336 |
| 37 | 3300053125 | Ga0500618_007431 | Ga0500618_007431_1511_2635 | 336 |
| 38 | iso_pu_bacteria | 2551306086 | 2551691433 | 336 |
| 39 | 3300046501 | Ga0495607_0019305 | Ga0495607_0019305_1224_2363 | 337 |
| 40 | 3300046558 | Ga0495633_0016527 | Ga0495633_0016527_2634_3770 | 337 |
| 41 | 3300047470 | Ga0495681_0010028 | Ga0495681_0010028_1328_2464 | 337 |
| 42 | 3300048924 | Ga0496121_0001116 | Ga0496121_0001116_37590_38714 | 337 |
| 43 | 3300048925 | Ga0496122_0000215 | Ga0496122_0000215_41796_42935 | 337 |
| 44 | 3300048926 | Ga0496123_0000306 | Ga0496123_0000306_85876_87015 | 337 |
| 45 | 3300053104 | Ga0500556_0027067 | Ga0500556_0027067_438_1562 | 337 |
| 46 | 3300053157 | Ga0500624_005981 | Ga0500624_005981_35_1171 | 337 |
| 47 | 3300053161 | Ga0500634_0023465 | Ga0500634_0023465_1378_2514 | 337 |
| 48 | iso_pu_bacteria | 2551306090 | 2551715887 | 337 |
| 49 | 3300025906 | Ga0207699_10099236 | Ga0207699_100992362 | 338 |
| 50 | 3300025915 | Ga0207693_10000842 | Ga0207693_1000084217 | 338 |
| 51 | 3300050491 | nmdc:mga00v17_639_c1 | nmdc:mga00v17_639_c1_8732_9856 | 338 |
| 52 | 3300013105 | Ga0157369_10436414 | Ga0157369_104364141 | 339 |
| 53 | 3300026041 | Ga0207639_10019773 | Ga0207639_100197732 | 339 |
| 54 | 3300046530 | Ga0495654_0058718 | Ga0495654_0058718_632_1756 | 339 |
| 55 | 3300046674 | Ga0495588_0018215 | Ga0495588_0018215_403_1545 | 339 |
| 56 | 3300053125 | Ga0500618_000314 | Ga0500618_000314_6933_8072 | 339 |
| 57 | 3300026041 | Ga0207639_10273538 | Ga0207639_102735381 | 340 |
| 58 | 3300031456 | Ga0307513_10098774 | Ga0307513_100987742 | 340 |
| 59 | 3300003771 | Ga0055526_1006767 | Ga0055526_10067672 | 341 |
| 60 | 3300005347 | Ga0070668_100052956 | Ga0070668_1000529562 | 341 |
| 61 | 3300005355 | Ga0070671_100263322 | Ga0070671_1002633221 | 341 |
| 62 | 3300009177 | Ga0105248_10031210 | Ga0105248_100312106 | 341 |
| 63 | 3300025273 | Ga0209673_1002134 | Ga0209673_100213410 | 341 |
| 64 | 3300025294 | Ga0209025_1035161 | Ga0209025_10351612 | 341 |
| 65 | 3300025302 | Ga0207426_1000869 | Ga0207426_10008695 | 341 |
| 66 | 3300025303 | Ga0209051_1002962 | Ga0209051_10029623 | 341 |
| 67 | 3300005435 | Ga0070714_100208040 | Ga0070714_1002080402 | 343 |
| 68 | 3300005614 | Ga0068856_100138533 | Ga0068856_1001385332 | 343 |
| 69 | 3300026142 | Ga0207698_10203687 | Ga0207698_102036872 | 343 |
| 70 | 3300049584 | Ga0501068_0142099 | Ga0501068_0142099_31_1155 | 343 |
| 71 | 3300048920 | Ga0496117_0012510 | Ga0496117_0012510_4754_5890 | 344 |
| 72 | 3300048923 | Ga0496120_0090675 | Ga0496120_0090675_443_1579 | 344 |
| 73 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_382741_383877 | 344 |
| 74 | 3300048927 | Ga0496124_0017234 | Ga0496124_0017234_5518_6654 | 344 |
| 75 | 3300048928 | Ga0496125_0000039 | Ga0496125_0000039_161379_162515 | 344 |
| 76 | 3300053156 | Ga0500622_0135828 | Ga0500622_0135828_12_1088 | 344 |
| 77 | 3300048927 | Ga0496124_0006855 | Ga0496124_0006855_6990_8120 | 345 |
| 78 | 3300003187 | JGI25151J46595_10005074 | JGI25151J46595_100050743 | 346 |
| 79 | 3300025294 | Ga0209025_1001869 | Ga0209025_100186914 | 346 |
| 80 | 3300048914 | Ga0496111_0016105 | Ga0496111_0016105_3432_4574 | 346 |
| 81 | 3300048925 | Ga0496122_0124926 | Ga0496122_0124926_407_1546 | 346 |
| 82 | 3300048926 | Ga0496123_0135038 | Ga0496123_0135038_101_1240 | 346 |
| 83 | 3300050507 | nmdc:mga05p37_16389_c1 | nmdc:mga05p37_16389_c1_3344_4459 | 346 |
| 84 | 3300002773 | JGI25152J39213_1000636 | JGI25152J39213_100063611 | 347 |
| 85 | 3300002774 | JGI25150J39212_1000107 | JGI25150J39212_100010713 | 347 |
| 86 | 3300003187 | JGI25151J46595_10000374 | JGI25151J46595_1000037433 | 347 |
| 87 | 3300003215 | JGI25153J46596_10000696 | JGI25153J46596_100006969 | 347 |
| 88 | 3300003578 | Ga0006562J51391_1050564 | Ga0006562J51391_10505642 | 347 |
| 89 | 3300025245 | Ga0207425_1000075 | Ga0207425_100007565 | 347 |
| 90 | 3300025258 | Ga0209129_1000156 | Ga0209129_100015633 | 347 |
| 91 | 3300025294 | Ga0209025_1000070 | Ga0209025_1000070244 | 347 |
| 92 | 3300025297 | Ga0209758_1000758 | Ga0209758_100075810 | 347 |
| 93 | 3300031731 | Ga0307405_10031398 | Ga0307405_100313982 | 347 |
| 94 | 3300031911 | Ga0307412_10012769 | Ga0307412_100127692 | 347 |
| 95 | 3300048920 | Ga0496117_0026708 | Ga0496117_0026708_2585_3715 | 347 |
| 96 | 3300048924 | Ga0496121_0047409 | Ga0496121_0047409_1311_2441 | 347 |
| 97 | 3300048924 | Ga0496121_0269634 | Ga0496121_0269634_18_1148 | 347 |
| 98 | 3300048925 | Ga0496122_0099516 | Ga0496122_0099516_705_1835 | 347 |
| 99 | 3300048926 | Ga0496123_0011423 | Ga0496123_0011423_3946_5076 | 347 |
| 100 | 3300048927 | Ga0496124_0011355 | Ga0496124_0011355_20_1150 | 347 |
| 101 | 3300048928 | Ga0496125_0006049 | Ga0496125_0006049_6620_7750 | 347 |
| 102 | 3300048929 | Ga0496126_0207248 | Ga0496126_0207248_45_1175 | 347 |
| 103 | 3300049571 | Ga0501034_0121230 | Ga0501034_0121230_1083_2207 | 347 |
| 104 | 3300049581 | Ga0501047_0276960 | Ga0501047_0276960_232_1356 | 347 |
| 105 | iso_pu_bacteria | 2551306092 | 2551732312 | 348 |
| 106 | 3300005458 | Ga0070681_10025407 | Ga0070681_100254073 | 349 |
| 107 | 3300005547 | Ga0070693_100017810 | Ga0070693_1000178102 | 349 |
| 108 | 3300009101 | Ga0105247_10096517 | Ga0105247_100965171 | 349 |
| 109 | 3300013308 | Ga0157375_10039652 | Ga0157375_100396524 | 349 |
| 110 | 3300025912 | Ga0207707_10088960 | Ga0207707_100889602 | 349 |
| 111 | 3300025919 | Ga0207657_10010114 | Ga0207657_100101145 | 349 |
| 112 | 3300025933 | Ga0207706_10134747 | Ga0207706_101347472 | 349 |
| 113 | 3300025972 | Ga0207668_10075143 | Ga0207668_100751432 | 349 |
| 114 | 3300025981 | Ga0207640_10115336 | Ga0207640_101153361 | 349 |
| 115 | 3300039447 | Ga0436361_0366439 | Ga0436361_0366439_514_1614 | 349 |
| 116 | 3300048905 | Ga0496102_0188362 | Ga0496102_0188362_286_1383 | 349 |
| 117 | 3300048918 | Ga0496115_0107581 | Ga0496115_0107581_495_1592 | 349 |
| 118 | 3300048907 | Ga0496104_0347566 | Ga0496104_0347566_121_1242 | 350 |
| 119 | 3300049579 | Ga0501043_0007295 | Ga0501043_0007295_1235_2356 | 350 |
| 120 | 3300021358 | Ga0213873_10002489 | Ga0213873_100024893 | 351 |
| 121 | 3300039453 | Ga0436362_1105174 | Ga0436362_1105174_2556_3656 | 351 |
| 122 | 3300005548 | Ga0070665_100123540 | Ga0070665_1001235402 | 352 |
| 123 | 3300006048 | Ga0075363_100080114 | Ga0075363_1000801141 | 353 |
| 124 | 3300006177 | Ga0075362_10015506 | Ga0075362_100155063 | 353 |
| 125 | 3300006178 | Ga0075367_10009312 | Ga0075367_100093124 | 353 |
| 126 | 3300025294 | Ga0209025_1014241 | Ga0209025_10142412 | 353 |
| 127 | 3300027866 | Ga0209813_10002584 | Ga0209813_100025842 | 353 |
| 128 | iso_pu_bacteria | 2894817345 | 2894820351 | 354 |
| 129 | iso_pu_bacteria | 2977530762 | 2977534061 | 354 |
| 130 | iso_pu_bacteria | 8055431914 | 8055432768 | 354 |
| 131 | 3300009093 | Ga0105240_10352941 | Ga0105240_103529412 | 355 |
| 132 | 3300013102 | Ga0157371_10000017 | Ga0157371_1000001750 | 355 |
| 133 | 3300013104 | Ga0157370_10000461 | Ga0157370_1000046130 | 355 |
| 134 | 3300026078 | Ga0207702_10243758 | Ga0207702_102437582 | 355 |
| 135 | 3300035724 | Ga0373933_0034922 | Ga0373933_0034922_307_1398 | 355 |
| 136 | 3300046463 | Ga0495653_0041780 | Ga0495653_0041780_2021_3112 | 355 |
| 137 | 3300046522 | Ga0495643_0072367 | Ga0495643_0072367_156_1298 | 355 |
| 138 | 3300046536 | Ga0495587_0086962 | Ga0495587_0086962_221_1312 | 355 |
| 139 | 3300046559 | Ga0495667_0017063 | Ga0495667_0017063_1601_2692 | 355 |
| 140 | 3300046663 | Ga0495635_0031183 | Ga0495635_0031183_830_1921 | 355 |
| 141 | 3300046675 | Ga0495657_0106108 | Ga0495657_0106108_259_1350 | 355 |
| 142 | 3300047317 | Ga0495604_0077859 | Ga0495604_0077859_1138_2229 | 355 |
| 143 | 3300047319 | Ga0495674_0055776 | Ga0495674_0055776_2349_3440 | 355 |
| 144 | 3300047322 | Ga0495680_0059684 | Ga0495680_0059684_901_1992 | 355 |
| 145 | 3300048918 | Ga0496115_0046600 | Ga0496115_0046600_126_1217 | 355 |
| 146 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_478640_479782 | 355 |
| 147 | 3300048921 | Ga0496118_0000087 | Ga0496118_0000087_90199_91341 | 355 |
| 148 | 3300048923 | Ga0496120_0000413 | Ga0496120_0000413_6179_7321 | 355 |
| 149 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_110076_111218 | 355 |
| 150 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_110076_111218 | 355 |
| 151 | 3300048928 | Ga0496125_0050756 | Ga0496125_0050756_48_1190 | 355 |
| 152 | 3300048929 | Ga0496126_0059759 | Ga0496126_0059759_2243_3385 | 355 |
| 153 | 3300050489 | nmdc:mga03683_31890_c1 | nmdc:mga03683_31890_c1_417_1559 | 355 |
| 154 | 3300050491 | nmdc:mga00v17_12_c1 | nmdc:mga00v17_12_c1_26491_27633 | 355 |
| 155 | 3300050492 | nmdc:mga0yw44_291_c1 | nmdc:mga0yw44_291_c1_13371_14513 | 355 |
| 156 | 3300050494 | nmdc:mga06z11_30304_c1 | nmdc:mga06z11_30304_c1_1181_2323 | 355 |
| 157 | 3300050516 | nmdc:mga0sz30_1084_c1 | nmdc:mga0sz30_1084_c1_4915_6057 | 355 |
| 158 | 3300053077 | Ga0495601_0002166 | Ga0495601_0002166_857_1948 | 355 |
| 159 | 3300053078 | Ga0495612_0014874 | Ga0495612_0014874_1707_2798 | 355 |
| 160 | 3300053084 | Ga0495595_0001470 | Ga0495595_0001470_6676_7767 | 355 |
| 161 | 3300053085 | Ga0495619_0000151 | Ga0495619_0000151_36231_37322 | 355 |
| 162 | 3300053137 | Ga0500561_0000098 | Ga0500561_0000098_6245_7387 | 355 |
| 163 | iso_pu_bacteria | 2510461069 | 2510843069 | 355 |
| 164 | iso_pu_bacteria | 2516143018 | 2516204138 | 355 |
| 165 | iso_pu_bacteria | 2558860983 | 2561468378 | 355 |
| 166 | iso_pu_bacteria | 2582581316 | 2585331483 | 355 |
| 167 | iso_pu_bacteria | 2615840698 | 2616554221 | 355 |
| 168 | iso_pu_bacteria | 2617270742 | 2617384725 | 355 |
| 169 | iso_pu_bacteria | 2643221653 | 2644298663 | 355 |
| 170 | iso_pu_bacteria | 2643221719 | 2644656892 | 355 |
| 171 | iso_pu_bacteria | 2667528174 | 2671111437 | 355 |
| 172 | iso_pu_bacteria | 2690316117 | 2692315549 | 355 |
| 173 | iso_pu_bacteria | 2738541317 | 2738947342 | 355 |
| 174 | iso_pu_bacteria | 2751185821 | 2753462021 | 355 |
| 175 | iso_pu_bacteria | 2775507049 | 2776913917 | 355 |
| 176 | iso_pu_bacteria | 2775507266 | 2778175408 | 355 |
| 177 | iso_pu_bacteria | 2791355091 | 2792620778 | 355 |
| 178 | iso_pu_bacteria | 2791355092 | 2792626137 | 355 |
| 179 | iso_pu_bacteria | 2791355094 | 2792639073 | 355 |
| 180 | iso_pu_bacteria | 2818991272 | 2819241411 | 355 |
| 181 | iso_pu_bacteria | 2818991448 | 2819609141 | 355 |
| 182 | iso_pu_bacteria | 2837651117 | 2837654485 | 355 |
| 183 | iso_pu_bacteria | 2838029111 | 2838029813 | 355 |
| 184 | iso_pu_bacteria | 2842298080 | 2842301362 | 355 |
| 185 | iso_pu_bacteria | 2842357229 | 2842357899 | 355 |
| 186 | iso_pu_bacteria | 2842475841 | 2842476902 | 355 |
| 187 | iso_pu_bacteria | 2842482326 | 2842484568 | 355 |
| 188 | iso_pu_bacteria | 2842502639 | 2842503341 | 355 |
| 189 | iso_pu_bacteria | 2842509118 | 2842511137 | 355 |
| 190 | iso_pu_bacteria | 2847417321 | 2847419390 | 355 |
| 191 | iso_pu_bacteria | 2848992105 | 2848994417 | 355 |
| 192 | iso_pu_bacteria | 2855872281 | 2855872528 | 355 |
| 193 | iso_pu_bacteria | 2891373044 | 2891373340 | 355 |
| 194 | iso_pu_bacteria | 2899803654 | 2899807276 | 355 |
| 195 | iso_pu_bacteria | 2913308742 | 2913312560 | 355 |
| 196 | iso_pu_bacteria | 2919408235 | 2919409972 | 355 |
| 197 | iso_pu_bacteria | 2989349275 | 2989349664 | 355 |
| 198 | iso_pu_bacteria | 2989776772 | 2989779198 | 355 |
| 199 | iso_pu_bacteria | 3005416602 | 3005419478 | 355 |
| 200 | iso_pu_bacteria | 643692032 | 643826306 | 355 |
| 201 | iso_pu_bacteria | 8005246636 | 8005248760 | 355 |
| 202 | iso_pu_bacteria | 8005314921 | 8005316769 | 355 |
| 203 | iso_pu_bacteria | 8005484373 | 8005489195 | 355 |
| 204 | iso_pu_bacteria | 8005645114 | 8005648129 | 355 |
| 205 | iso_pu_bacteria | 8005658619 | 8005659037 | 355 |
| 206 | iso_pu_bacteria | 8005682033 | 8005682897 | 355 |
| 207 | 3300035207 | Ga0373942_0005465 | Ga0373942_0005465_13_1083 | 356 |
| 208 | iso_pu_bacteria | 2508501122 | 2509108403 | 356 |
| 209 | iso_pu_bacteria | 2509276019 | 2509376464 | 356 |
| 210 | iso_pu_bacteria | 2509276021 | 2509392063 | 356 |
| 211 | iso_pu_bacteria | 2509276033 | 2509445654 | 356 |
| 212 | iso_pu_bacteria | 2509276033 | 2509447045 | 356 |
| 213 | iso_pu_bacteria | 2510065019 | 2510133947 | 356 |
| 214 | iso_pu_bacteria | 2510065057 | 2510306448 | 356 |
| 215 | iso_pu_bacteria | 2510461076 | 2510895365 | 356 |
| 216 | iso_pu_bacteria | 2510917022 | 2511135394 | 356 |
| 217 | iso_pu_bacteria | 2510917028 | 2511187047 | 356 |
| 218 | iso_pu_bacteria | 2510917030 | 2511199021 | 356 |
| 219 | iso_pu_bacteria | 2511231052 | 2511502238 | 356 |
| 220 | iso_pu_bacteria | 2512047086 | 2512533611 | 356 |
| 221 | iso_pu_bacteria | 2512875026 | 2512970700 | 356 |
| 222 | iso_pu_bacteria | 2513237084 | 2513567980 | 356 |
| 223 | iso_pu_bacteria | 2513237085 | 2513576934 | 356 |
| 224 | iso_pu_bacteria | 2513237086 | 2513584390 | 356 |
| 225 | iso_pu_bacteria | 2513237088 | 2513596467 | 356 |
| 226 | iso_pu_bacteria | 2513237089 | 2513604256 | 356 |
| 227 | iso_pu_bacteria | 2513237091 | 2513618798 | 356 |
| 228 | iso_pu_bacteria | 2513237093 | 2513633394 | 356 |
| 229 | iso_pu_bacteria | 2513237103 | 2513708056 | 356 |
| 230 | iso_pu_bacteria | 2513237138 | 2513865592 | 356 |
| 231 | iso_pu_bacteria | 2513237140 | 2513884411 | 356 |
| 232 | iso_pu_bacteria | 2513237143 | 2513905003 | 356 |
| 233 | iso_pu_bacteria | 2513237144 | 2513909009 | 356 |
| 234 | iso_pu_bacteria | 2513237146 | 2513925392 | 356 |
| 235 | iso_pu_bacteria | 2513237156 | 2513986831 | 356 |
| 236 | iso_pu_bacteria | 2513237159 | 2514001510 | 356 |
| 237 | iso_pu_bacteria | 2513237160 | 2514006395 | 356 |
| 238 | iso_pu_bacteria | 2513237162 | 2514020015 | 356 |
| 239 | iso_pu_bacteria | 2515075009 | 2515112996 | 356 |
| 240 | iso_pu_bacteria | 2515154107 | 2515609014 | 356 |
| 241 | iso_pu_bacteria | 2515154113 | 2515638506 | 356 |
| 242 | iso_pu_bacteria | 2515154114 | 2515640955 | 356 |
| 243 | iso_pu_bacteria | 2515154116 | 2515655363 | 356 |
| 244 | iso_pu_bacteria | 2515154134 | 2515739474 | 356 |
| 245 | iso_pu_bacteria | 2516653046 | 2516893617 | 356 |
| 246 | iso_pu_bacteria | 2516653077 | 2517036696 | 356 |
| 247 | iso_pu_bacteria | 2516653085 | 2517077055 | 356 |
| 248 | iso_pu_bacteria | 2517093000 | 2517095823 | 356 |
| 249 | iso_pu_bacteria | 2517287029 | 2517407395 | 356 |
| 250 | iso_pu_bacteria | 2517487022 | 2517570329 | 356 |
| 251 | iso_pu_bacteria | 2519899620 | 2520377199 | 356 |
| 252 | iso_pu_bacteria | 2524023207 | 2524448562 | 356 |
| 253 | iso_pu_bacteria | 2529292951 | 2530645961 | 356 |
| 254 | iso_pu_bacteria | 2534681796 | 2535516858 | 356 |
| 255 | iso_pu_bacteria | 2537561587 | 2537875441 | 356 |
| 256 | iso_pu_bacteria | 2551306084 | 2551674550 | 356 |
| 257 | iso_pu_bacteria | 2551306084 | 2551677931 | 356 |
| 258 | iso_pu_bacteria | 2551306085 | 2551687744 | 356 |
| 259 | iso_pu_bacteria | 2554235003 | 2554248225 | 356 |
| 260 | iso_pu_bacteria | 2558860100 | 2558864469 | 356 |
| 261 | iso_pu_bacteria | 2558860242 | 2559295341 | 356 |
| 262 | iso_pu_bacteria | 2582581283 | 2585166341 | 356 |
| 263 | iso_pu_bacteria | 2582581294 | 2585202278 | 356 |
| 264 | iso_pu_bacteria | 2582581298 | 2585222824 | 356 |
| 265 | iso_pu_bacteria | 2582581299 | 2585231735 | 356 |
| 266 | iso_pu_bacteria | 2582581304 | 2585255076 | 356 |
| 267 | iso_pu_bacteria | 2582581306 | 2585267431 | 356 |
| 268 | iso_pu_bacteria | 2582581307 | 2585271131 | 356 |
| 269 | iso_pu_bacteria | 2582581308 | 2585277475 | 356 |
| 270 | iso_pu_bacteria | 2582581315 | 2585323341 | 356 |
| 271 | iso_pu_bacteria | 2582581865 | 2585386499 | 356 |
| 272 | iso_pu_bacteria | 2582581866 | 2585393249 | 356 |
| 273 | iso_pu_bacteria | 2582581867 | 2585402405 | 356 |
| 274 | iso_pu_bacteria | 2585427526 | 2585527435 | 356 |
| 275 | iso_pu_bacteria | 2585427527 | 2585535102 | 356 |
| 276 | iso_pu_bacteria | 2585427528 | 2585538176 | 356 |
| 277 | iso_pu_bacteria | 2585427529 | 2585545407 | 356 |
| 278 | iso_pu_bacteria | 2585427530 | 2585555952 | 356 |
| 279 | iso_pu_bacteria | 2585427531 | 2585558855 | 356 |
| 280 | iso_pu_bacteria | 2585427590 | 2585822908 | 356 |
| 281 | iso_pu_bacteria | 2585427593 | 2585836125 | 356 |
| 282 | iso_pu_bacteria | 2585427594 | 2585843219 | 356 |
| 283 | iso_pu_bacteria | 2585427608 | 2585898237 | 356 |
| 284 | iso_pu_bacteria | 2585427609 | 2585904175 | 356 |
| 285 | iso_pu_bacteria | 2585427633 | 2585996196 | 356 |
| 286 | iso_pu_bacteria | 2585427634 | 2586000806 | 356 |
| 287 | iso_pu_bacteria | 2585428125 | 2587980708 | 356 |
| 288 | iso_pu_bacteria | 2599185156 | 2599331744 | 356 |
| 289 | iso_pu_bacteria | 2599185170 | 2599417308 | 356 |
| 290 | iso_pu_bacteria | 2599185210 | 2599601653 | 356 |
| 291 | iso_pu_bacteria | 2599185236 | 2599721919 | 356 |
| 292 | iso_pu_bacteria | 2599185352 | 2600194386 | 356 |
| 293 | iso_pu_bacteria | 2600254933 | 2600374366 | 356 |
| 294 | iso_pu_bacteria | 2600255279 | 2601610087 | 356 |
| 295 | iso_pu_bacteria | 2600255308 | 2601746862 | 356 |
| 296 | iso_pu_bacteria | 2615840624 | 2616293372 | 356 |
| 297 | iso_pu_bacteria | 2615840626 | 2616308950 | 356 |
| 298 | iso_pu_bacteria | 2643221557 | 2643803095 | 356 |
| 299 | iso_pu_bacteria | 2643221558 | 2643811539 | 356 |
| 300 | iso_pu_bacteria | 2643221568 | 2643856778 | 356 |
| 301 | iso_pu_bacteria | 2643221582 | 2643920351 | 356 |
| 302 | iso_pu_bacteria | 2643221599 | 2644003165 | 356 |
| 303 | iso_pu_bacteria | 2643221607 | 2644050526 | 356 |
| 304 | iso_pu_bacteria | 2643221610 | 2644063457 | 356 |
| 305 | iso_pu_bacteria | 2643221618 | 2644107286 | 356 |
| 306 | iso_pu_bacteria | 2643221626 | 2644150852 | 356 |
| 307 | iso_pu_bacteria | 2643221634 | 2644193501 | 356 |
| 308 | iso_pu_bacteria | 2643221636 | 2644205754 | 356 |
| 309 | iso_pu_bacteria | 2643221637 | 2644209036 | 356 |
| 310 | iso_pu_bacteria | 2643221643 | 2644238687 | 356 |
| 311 | iso_pu_bacteria | 2643221655 | 2644308681 | 356 |
| 312 | iso_pu_bacteria | 2643221659 | 2644335499 | 356 |
| 313 | iso_pu_bacteria | 2643221668 | 2644374740 | 356 |
| 314 | iso_pu_bacteria | 2643221675 | 2644414220 | 356 |
| 315 | iso_pu_bacteria | 2643221680 | 2644447748 | 356 |
| 316 | iso_pu_bacteria | 2643221686 | 2644483444 | 356 |
| 317 | iso_pu_bacteria | 2643221689 | 2644499655 | 356 |
| 318 | iso_pu_bacteria | 2643221693 | 2644521965 | 356 |
| 319 | iso_pu_bacteria | 2643221698 | 2644539904 | 356 |
| 320 | iso_pu_bacteria | 2643221712 | 2644614622 | 356 |
| 321 | iso_pu_bacteria | 2643221718 | 2644652566 | 356 |
| 322 | iso_pu_bacteria | 2643221723 | 2644676086 | 356 |
| 323 | iso_pu_bacteria | 2643221726 | 2644690221 | 356 |
| 324 | iso_pu_bacteria | 2718217882 | 2719181798 | 356 |
| 325 | iso_pu_bacteria | 2718217927 | 2719386401 | 356 |
| 326 | iso_pu_bacteria | 2718217997 | 2719666149 | 356 |
| 327 | iso_pu_bacteria | 2718218009 | 2719732462 | 356 |
| 328 | iso_pu_bacteria | 2718218199 | 2720492569 | 356 |
| 329 | iso_pu_bacteria | 2718218232 | 2720614004 | 356 |
| 330 | iso_pu_bacteria | 2718218233 | 2720620809 | 356 |
| 331 | iso_pu_bacteria | 2718218235 | 2720632134 | 356 |
| 332 | iso_pu_bacteria | 2718218269 | 2720775862 | 356 |
| 333 | iso_pu_bacteria | 2718218363 | 2721147889 | 356 |
| 334 | iso_pu_bacteria | 2718218365 | 2721159340 | 356 |
| 335 | iso_pu_bacteria | 2718218366 | 2721164725 | 356 |
| 336 | iso_pu_bacteria | 2718218423 | 2721400105 | 356 |
| 337 | iso_pu_bacteria | 2721755514 | 2722840895 | 356 |
| 338 | iso_pu_bacteria | 2721755556 | 2723027466 | 356 |
| 339 | iso_pu_bacteria | 2721755684 | 2723561085 | 356 |
| 340 | iso_pu_bacteria | 2721755685 | 2723567681 | 356 |
| 341 | iso_pu_bacteria | 2721755809 | 2724038918 | 356 |
| 342 | iso_pu_bacteria | 2721755810 | 2724045218 | 356 |
| 343 | iso_pu_bacteria | 2721755819 | 2724090469 | 356 |
| 344 | iso_pu_bacteria | 2721755822 | 2724104946 | 356 |
| 345 | iso_pu_bacteria | 2721755823 | 2724110805 | 356 |
| 346 | iso_pu_bacteria | 2724679232 | 2725952569 | 356 |
| 347 | iso_pu_bacteria | 2728369352 | 2730108402 | 356 |
| 348 | iso_pu_bacteria | 2728369365 | 2730165033 | 356 |
| 349 | iso_pu_bacteria | 2728369397 | 2730298972 | 356 |
| 350 | iso_pu_bacteria | 2738541293 | 2738800077 | 356 |
| 351 | iso_pu_bacteria | 2738541333 | 2739032833 | 356 |
| 352 | iso_pu_bacteria | 2765235802 | 2765464621 | 356 |
| 353 | iso_pu_bacteria | 2765235942 | 2766065861 | 356 |
| 354 | iso_pu_bacteria | 2791355253 | 2793280311 | 356 |
| 355 | iso_pu_bacteria | 2791355256 | 2793294445 | 356 |
| 356 | iso_pu_bacteria | 2791355259 | 2793314551 | 356 |
| 357 | iso_pu_bacteria | 2791355260 | 2793320379 | 356 |
| 358 | iso_pu_bacteria | 2791355261 | 2793329548 | 356 |
| 359 | iso_pu_bacteria | 2791355262 | 2793334482 | 356 |
| 360 | iso_pu_bacteria | 2791355263 | 2793339199 | 356 |
| 361 | iso_pu_bacteria | 2791355264 | 2793348872 | 356 |
| 362 | iso_pu_bacteria | 2791355265 | 2793351840 | 356 |
| 363 | iso_pu_bacteria | 2791355266 | 2793362592 | 356 |
| 364 | iso_pu_bacteria | 2791355267 | 2793368882 | 356 |
| 365 | iso_pu_bacteria | 2802428858 | 2802720024 | 356 |
| 366 | iso_pu_bacteria | 2802428859 | 2802727043 | 356 |
| 367 | iso_pu_bacteria | 2802428860 | 2802731954 | 356 |
| 368 | iso_pu_bacteria | 2802428861 | 2802739285 | 356 |
| 369 | iso_pu_bacteria | 2802428862 | 2802745734 | 356 |
| 370 | iso_pu_bacteria | 2802428863 | 2802752335 | 356 |
| 371 | iso_pu_bacteria | 2802429605 | 2805928809 | 356 |
| 372 | iso_pu_bacteria | 2802429606 | 2805935091 | 356 |
| 373 | iso_pu_bacteria | 2802429633 | 2806043813 | 356 |
| 374 | iso_pu_bacteria | 2802429634 | 2806050256 | 356 |
| 375 | iso_pu_bacteria | 2802429635 | 2806057072 | 356 |
| 376 | iso_pu_bacteria | 2802429636 | 2806064454 | 356 |
| 377 | iso_pu_bacteria | 2802429637 | 2806071721 | 356 |
| 378 | iso_pu_bacteria | 2808606387 | 2808987925 | 356 |
| 379 | iso_pu_bacteria | 2818991439 | 2819559054 | 356 |
| 380 | iso_pu_bacteria | 2818991453 | 2819637631 | 356 |
| 381 | iso_pu_bacteria | 2818991461 | 2819684904 | 356 |
| 382 | iso_pu_bacteria | 2821123053 | 2821127497 | 356 |
| 383 | iso_pu_bacteria | 2838016132 | 2838017661 | 356 |
| 384 | iso_pu_bacteria | 2838022645 | 2838027538 | 356 |
| 385 | iso_pu_bacteria | 2838035591 | 2838038492 | 356 |
| 386 | iso_pu_bacteria | 2838042994 | 2838043960 | 356 |
| 387 | iso_pu_bacteria | 2838048938 | 2838054394 | 356 |
| 388 | iso_pu_bacteria | 2838061910 | 2838068023 | 356 |
| 389 | iso_pu_bacteria | 2838068647 | 2838070151 | 356 |
| 390 | iso_pu_bacteria | 2838074704 | 2838076866 | 356 |
| 391 | iso_pu_bacteria | 2838661181 | 2838661597 | 356 |
| 392 | iso_pu_bacteria | 2838668709 | 2838670352 | 356 |
| 393 | iso_pu_bacteria | 2838675328 | 2838675784 | 356 |
| 394 | iso_pu_bacteria | 2838680041 | 2838683476 | 356 |
| 395 | iso_pu_bacteria | 2838686498 | 2838687063 | 356 |
| 396 | iso_pu_bacteria | 2838694306 | 2838697581 | 356 |
| 397 | iso_pu_bacteria | 2838701080 | 2838702723 | 356 |
| 398 | iso_pu_bacteria | 2838707686 | 2838710697 | 356 |
| 399 | iso_pu_bacteria | 2838714209 | 2838714666 | 356 |
| 400 | iso_pu_bacteria | 2838719591 | 2838721533 | 356 |
| 401 | iso_pu_bacteria | 2838724970 | 2838725426 | 356 |
| 402 | iso_pu_bacteria | 2838729681 | 2838729964 | 356 |
| 403 | iso_pu_bacteria | 2838736955 | 2838738021 | 356 |
| 404 | iso_pu_bacteria | 2838742623 | 2838743021 | 356 |
| 405 | iso_pu_bacteria | 2841840854 | 2841841610 | 356 |
| 406 | iso_pu_bacteria | 2841846520 | 2841848485 | 356 |
| 407 | iso_pu_bacteria | 2841851746 | 2841852507 | 356 |
| 408 | iso_pu_bacteria | 2841859092 | 2841862116 | 356 |
| 409 | iso_pu_bacteria | 2841864319 | 2841870774 | 356 |
| 410 | iso_pu_bacteria | 2842077413 | 2842078870 | 356 |
| 411 | iso_pu_bacteria | 2842110456 | 2842113278 | 356 |
| 412 | iso_pu_bacteria | 2842118031 | 2842118620 | 356 |
| 413 | iso_pu_bacteria | 2842124991 | 2842125484 | 356 |
| 414 | iso_pu_bacteria | 2842130223 | 2842130679 | 356 |
| 415 | iso_pu_bacteria | 2842140634 | 2842141388 | 356 |
| 416 | iso_pu_bacteria | 2842146304 | 2842148019 | 356 |
| 417 | iso_pu_bacteria | 2842152218 | 2842154151 | 356 |
| 418 | iso_pu_bacteria | 2842156927 | 2842158033 | 356 |
| 419 | iso_pu_bacteria | 2842163707 | 2842168803 | 356 |
| 420 | iso_pu_bacteria | 2842170452 | 2842170910 | 356 |
| 421 | iso_pu_bacteria | 2842175837 | 2842177771 | 356 |
| 422 | iso_pu_bacteria | 2842180545 | 2842181652 | 356 |
| 423 | iso_pu_bacteria | 2842187318 | 2842187775 | 356 |
| 424 | iso_pu_bacteria | 2842192696 | 2842197349 | 356 |
| 425 | iso_pu_bacteria | 2842198810 | 2842203548 | 356 |
| 426 | iso_pu_bacteria | 2842205361 | 2842205488 | 356 |
| 427 | iso_pu_bacteria | 2842211629 | 2842212086 | 356 |
| 428 | iso_pu_bacteria | 2842217011 | 2842217928 | 356 |
| 429 | iso_pu_bacteria | 2842224351 | 2842226295 | 356 |
| 430 | iso_pu_bacteria | 2842229732 | 2842230297 | 356 |
| 431 | iso_pu_bacteria | 2842237096 | 2842240532 | 356 |
| 432 | iso_pu_bacteria | 2842243621 | 2842244199 | 356 |
| 433 | iso_pu_bacteria | 2842250916 | 2842253085 | 356 |
| 434 | iso_pu_bacteria | 2842257432 | 2842257715 | 356 |
| 435 | iso_pu_bacteria | 2842264693 | 2842266258 | 356 |
| 436 | iso_pu_bacteria | 2842271015 | 2842271399 | 356 |
| 437 | iso_pu_bacteria | 2842278818 | 2842278945 | 356 |
| 438 | iso_pu_bacteria | 2842285085 | 2842285609 | 356 |
| 439 | iso_pu_bacteria | 2842291075 | 2842292532 | 356 |
| 440 | iso_pu_bacteria | 2842304105 | 2842305027 | 356 |
| 441 | iso_pu_bacteria | 2842311132 | 2842314921 | 356 |
| 442 | iso_pu_bacteria | 2842317721 | 2842320701 | 356 |
| 443 | iso_pu_bacteria | 2842341865 | 2842346450 | 356 |
| 444 | iso_pu_bacteria | 2842363717 | 2842368971 | 356 |
| 445 | iso_pu_bacteria | 2842370503 | 2842374107 | 356 |
| 446 | iso_pu_bacteria | 2842377471 | 2842378930 | 356 |
| 447 | iso_pu_bacteria | 2842384541 | 2842385131 | 356 |
| 448 | iso_pu_bacteria | 2842395702 | 2842399892 | 356 |
| 449 | iso_pu_bacteria | 2842402390 | 2842402969 | 356 |
| 450 | iso_pu_bacteria | 2842409023 | 2842409659 | 356 |
| 451 | iso_pu_bacteria | 2842415677 | 2842416310 | 356 |
| 452 | iso_pu_bacteria | 2842422224 | 2842423765 | 356 |
| 453 | iso_pu_bacteria | 2842428310 | 2842430721 | 356 |
| 454 | iso_pu_bacteria | 2842434925 | 2842437292 | 356 |
| 455 | iso_pu_bacteria | 2842441272 | 2842443662 | 356 |
| 456 | iso_pu_bacteria | 2842447887 | 2842454043 | 356 |
| 457 | iso_pu_bacteria | 2842462802 | 2842464864 | 356 |
| 458 | iso_pu_bacteria | 2842469257 | 2842471910 | 356 |
| 459 | iso_pu_bacteria | 2842489311 | 2842491969 | 356 |
| 460 | iso_pu_bacteria | 2842495871 | 2842496835 | 356 |
| 461 | iso_pu_bacteria | 2842515876 | 2842518900 | 356 |
| 462 | iso_pu_bacteria | 2842521101 | 2842521807 | 356 |
| 463 | iso_pu_bacteria | 2842922631 | 2842924149 | 356 |
| 464 | iso_pu_bacteria | 2844163670 | 2844164565 | 356 |
| 465 | iso_pu_bacteria | 2844454524 | 2844458430 | 356 |
| 466 | iso_pu_bacteria | 2850079185 | 2850081460 | 356 |
| 467 | iso_pu_bacteria | 2854896431 | 2854899581 | 356 |
| 468 | iso_pu_bacteria | 2854916844 | 2854918406 | 356 |
| 469 | iso_pu_bacteria | 2855825444 | 2855826337 | 356 |
| 470 | iso_pu_bacteria | 2855839649 | 2855841727 | 356 |
| 471 | iso_pu_bacteria | 2857516855 | 2857517442 | 356 |
| 472 | iso_pu_bacteria | 2857531043 | 2857536490 | 356 |
| 473 | iso_pu_bacteria | 2858800743 | 2858802512 | 356 |
| 474 | iso_pu_bacteria | 2891048133 | 2891050864 | 356 |
| 475 | iso_pu_bacteria | 2896384573 | 2896389033 | 356 |
| 476 | iso_pu_bacteria | 2899792073 | 2899796060 | 356 |
| 477 | iso_pu_bacteria | 2899845264 | 2899850638 | 356 |
| 478 | iso_pu_bacteria | 2904578770 | 2904580624 | 356 |
| 479 | iso_pu_bacteria | 2915980308 | 2915981436 | 356 |
| 480 | iso_pu_bacteria | 2915993759 | 2915998697 | 356 |
| 481 | iso_pu_bacteria | 2916000859 | 2916003490 | 356 |
| 482 | iso_pu_bacteria | 2916007675 | 2916011660 | 356 |
| 483 | iso_pu_bacteria | 2916014648 | 2916020774 | 356 |
| 484 | iso_pu_bacteria | 2916021584 | 2916024961 | 356 |
| 485 | iso_pu_bacteria | 2916028427 | 2916033774 | 356 |
| 486 | iso_pu_bacteria | 2916035215 | 2916037863 | 356 |
| 487 | iso_pu_bacteria | 2916041962 | 2916045337 | 356 |
| 488 | iso_pu_bacteria | 2916048683 | 2916049039 | 356 |
| 489 | iso_pu_bacteria | 2916055098 | 2916055723 | 356 |
| 490 | iso_pu_bacteria | 2916061851 | 2916064907 | 356 |
| 491 | iso_pu_bacteria | 2916068649 | 2916073998 | 356 |
| 492 | iso_pu_bacteria | 2916076590 | 2916082595 | 356 |
| 493 | iso_pu_bacteria | 2919100787 | 2919107665 | 356 |
| 494 | iso_pu_bacteria | 2919114240 | 2919114704 | 356 |
| 495 | iso_pu_bacteria | 2919119836 | 2919121659 | 356 |
| 496 | iso_pu_bacteria | 2919166419 | 2919169235 | 356 |
| 497 | iso_pu_bacteria | 2919171160 | 2919174718 | 356 |
| 498 | iso_pu_bacteria | 2920760137 | 2920761527 | 356 |
| 499 | iso_pu_bacteria | 2920822456 | 2920825207 | 356 |
| 500 | iso_pu_bacteria | 2921201388 | 2921203055 | 356 |
| 501 | iso_pu_bacteria | 2921208531 | 2921211115 | 356 |
| 502 | iso_pu_bacteria | 2921237296 | 2921240933 | 356 |
| 503 | iso_pu_bacteria | 2921244191 | 2921246777 | 356 |
| 504 | iso_pu_bacteria | 2921250672 | 2921252083 | 356 |
| 505 | iso_pu_bacteria | 2921257292 | 2921261404 | 356 |
| 506 | iso_pu_bacteria | 2921263974 | 2921266206 | 356 |
| 507 | iso_pu_bacteria | 2921282425 | 2921287972 | 356 |
| 508 | iso_pu_bacteria | 2921289301 | 2921290959 | 356 |
| 509 | iso_pu_bacteria | 2921296804 | 2921298405 | 356 |
| 510 | iso_pu_bacteria | 2923556063 | 2923558565 | 356 |
| 511 | iso_pu_bacteria | 2924144063 | 2924146757 | 356 |
| 512 | iso_pu_bacteria | 2924150972 | 2924157995 | 356 |
| 513 | iso_pu_bacteria | 2924158325 | 2924159271 | 356 |
| 514 | iso_pu_bacteria | 2924165586 | 2924169164 | 356 |
| 515 | iso_pu_bacteria | 2924172951 | 2924174572 | 356 |
| 516 | iso_pu_bacteria | 2924179722 | 2924183003 | 356 |
| 517 | iso_pu_bacteria | 2924186466 | 2924192714 | 356 |
| 518 | iso_pu_bacteria | 2924193448 | 2924195381 | 356 |
| 519 | iso_pu_bacteria | 2924200457 | 2924203328 | 356 |
| 520 | iso_pu_bacteria | 2924207177 | 2924210747 | 356 |
| 521 | iso_pu_bacteria | 2924214083 | 2924217480 | 356 |
| 522 | iso_pu_bacteria | 2924221636 | 2924223297 | 356 |
| 523 | iso_pu_bacteria | 2924228884 | 2924230517 | 356 |
| 524 | iso_pu_bacteria | 2926754445 | 2926755720 | 356 |
| 525 | iso_pu_bacteria | 2926760298 | 2926762835 | 356 |
| 526 | iso_pu_bacteria | 2929138655 | 2929140863 | 356 |
| 527 | iso_pu_bacteria | 2933006813 | 2933008796 | 356 |
| 528 | iso_pu_bacteria | 2933011516 | 2933014926 | 356 |
| 529 | iso_pu_bacteria | 2933016740 | 2933019435 | 356 |
| 530 | iso_pu_bacteria | 2933570622 | 2933570835 | 356 |
| 531 | iso_pu_bacteria | 2933586486 | 2933588666 | 356 |
| 532 | iso_pu_bacteria | 2933594066 | 2933596603 | 356 |
| 533 | iso_pu_bacteria | 2933599457 | 2933600957 | 356 |
| 534 | iso_pu_bacteria | 2935894831 | 2935897034 | 356 |
| 535 | iso_pu_bacteria | 2935901341 | 2935901967 | 356 |
| 536 | iso_pu_bacteria | 2936367885 | 2936372046 | 356 |
| 537 | iso_pu_bacteria | 2936375103 | 2936379909 | 356 |
| 538 | iso_pu_bacteria | 2936381700 | 2936382813 | 356 |
| 539 | iso_pu_bacteria | 2936996657 | 2937000701 | 356 |
| 540 | iso_pu_bacteria | 2937002841 | 2937004563 | 356 |
| 541 | iso_pu_bacteria | 2937009748 | 2937011193 | 356 |
| 542 | iso_pu_bacteria | 2937016420 | 2937019828 | 356 |
| 543 | iso_pu_bacteria | 2937023124 | 2937024579 | 356 |
| 544 | iso_pu_bacteria | 2937029754 | 2937030282 | 356 |
| 545 | iso_pu_bacteria | 2937036028 | 2937042664 | 356 |
| 546 | iso_pu_bacteria | 2937042894 | 2937045535 | 356 |
| 547 | iso_pu_bacteria | 2937049772 | 2937055112 | 356 |
| 548 | iso_pu_bacteria | 2937056579 | 2937063575 | 356 |
| 549 | iso_pu_bacteria | 2937063883 | 2937067769 | 356 |
| 550 | iso_pu_bacteria | 2937071275 | 2937074386 | 356 |
| 551 | iso_pu_bacteria | 2937078374 | 2937080280 | 356 |
| 552 | iso_pu_bacteria | 2937084907 | 2937086021 | 356 |
| 553 | iso_pu_bacteria | 2937091812 | 2937097216 | 356 |
| 554 | iso_pu_bacteria | 2937098957 | 2937103040 | 356 |
| 555 | iso_pu_bacteria | 2937106411 | 2937113296 | 356 |
| 556 | iso_pu_bacteria | 2937113482 | 2937116149 | 356 |
| 557 | iso_pu_bacteria | 2937119839 | 2937121980 | 356 |
| 558 | iso_pu_bacteria | 2937126314 | 2937128821 | 356 |
| 559 | iso_pu_bacteria | 2941499720 | 2941502144 | 356 |
| 560 | iso_pu_bacteria | 2957375807 | 2957376389 | 356 |
| 561 | iso_pu_bacteria | 2957382221 | 2957384282 | 356 |
| 562 | iso_pu_bacteria | 2957388812 | 2957390745 | 356 |
| 563 | iso_pu_bacteria | 2957395598 | 2957395901 | 356 |
| 564 | iso_pu_bacteria | 2957402308 | 2957404507 | 356 |
| 565 | iso_pu_bacteria | 2957408893 | 2957412094 | 356 |
| 566 | iso_pu_bacteria | 2957415311 | 2957421204 | 356 |
| 567 | iso_pu_bacteria | 2957422303 | 2957425700 | 356 |
| 568 | iso_pu_bacteria | 2957430029 | 2957431711 | 356 |
| 569 | iso_pu_bacteria | 2957437181 | 2957438175 | 356 |
| 570 | iso_pu_bacteria | 2957443900 | 2957446913 | 356 |
| 571 | iso_pu_bacteria | 2957450854 | 2957453755 | 356 |
| 572 | iso_pu_bacteria | 2957457609 | 2957461620 | 356 |
| 573 | iso_pu_bacteria | 2957464669 | 2957467049 | 356 |
| 574 | iso_pu_bacteria | 2957471148 | 2957476393 | 356 |
| 575 | iso_pu_bacteria | 2957478035 | 2957479609 | 356 |
| 576 | iso_pu_bacteria | 2957484790 | 2957490467 | 356 |
| 577 | iso_pu_bacteria | 2957491536 | 2957494102 | 356 |
| 578 | iso_pu_bacteria | 2957498199 | 2957503305 | 356 |
| 579 | iso_pu_bacteria | 2957505466 | 2957510609 | 356 |
| 580 | iso_pu_bacteria | 2960584000 | 2960585413 | 356 |
| 581 | iso_pu_bacteria | 2960591022 | 2960592082 | 356 |
| 582 | iso_pu_bacteria | 2960597568 | 2960599998 | 356 |
| 583 | iso_pu_bacteria | 2960603979 | 2960610584 | 356 |
| 584 | iso_pu_bacteria | 2960610863 | 2960612321 | 356 |
| 585 | iso_pu_bacteria | 2960617483 | 2960620459 | 356 |
| 586 | iso_pu_bacteria | 2960624210 | 2960624486 | 356 |
| 587 | iso_pu_bacteria | 2960631154 | 2960632042 | 356 |
| 588 | iso_pu_bacteria | 2960637947 | 2960644129 | 356 |
| 589 | iso_pu_bacteria | 2960645483 | 2960648420 | 356 |
| 590 | iso_pu_bacteria | 2960652885 | 2960656531 | 356 |
| 591 | iso_pu_bacteria | 2960660292 | 2960665572 | 356 |
| 592 | iso_pu_bacteria | 2960667422 | 2960669653 | 356 |
| 593 | iso_pu_bacteria | 2960674078 | 2960675165 | 356 |
| 594 | iso_pu_bacteria | 2960680706 | 2960681617 | 356 |
| 595 | iso_pu_bacteria | 2960687367 | 2960691473 | 356 |
| 596 | iso_pu_bacteria | 2960693952 | 2960694807 | 356 |
| 597 | iso_pu_bacteria | 2964607997 | 2964609779 | 356 |
| 598 | iso_pu_bacteria | 2964615318 | 2964617753 | 356 |
| 599 | iso_pu_bacteria | 2964621998 | 2964623638 | 356 |
| 600 | iso_pu_bacteria | 2964628898 | 2964632581 | 356 |
| 601 | iso_pu_bacteria | 2964636051 | 2964640824 | 356 |
| 602 | iso_pu_bacteria | 2964643177 | 2964645691 | 356 |
| 603 | iso_pu_bacteria | 2964649959 | 2964651550 | 356 |
| 604 | iso_pu_bacteria | 2964656573 | 2964660520 | 356 |
| 605 | iso_pu_bacteria | 2964663802 | 2964666928 | 356 |
| 606 | iso_pu_bacteria | 2964670856 | 2964674436 | 356 |
| 607 | iso_pu_bacteria | 2964678106 | 2964682869 | 356 |
| 608 | iso_pu_bacteria | 2964685014 | 2964688477 | 356 |
| 609 | iso_pu_bacteria | 2964691889 | 2964692474 | 356 |
| 610 | iso_pu_bacteria | 2964698721 | 2964701648 | 356 |
| 611 | iso_pu_bacteria | 2964705432 | 2964711098 | 356 |
| 612 | iso_pu_bacteria | 2964712639 | 2964715165 | 356 |
| 613 | iso_pu_bacteria | 2964719344 | 2964720673 | 356 |
| 614 | iso_pu_bacteria | 2967664464 | 2967666386 | 356 |
| 615 | iso_pu_bacteria | 2967671571 | 2967678419 | 356 |
| 616 | iso_pu_bacteria | 2967678726 | 2967684431 | 356 |
| 617 | iso_pu_bacteria | 2967686174 | 2967689721 | 356 |
| 618 | iso_pu_bacteria | 2967693043 | 2967694638 | 356 |
| 619 | iso_pu_bacteria | 2967706974 | 2967708616 | 356 |
| 620 | iso_pu_bacteria | 2967714385 | 2967714869 | 356 |
| 621 | iso_pu_bacteria | 2967721400 | 2967726129 | 356 |
| 622 | iso_pu_bacteria | 2967728569 | 2967728999 | 356 |
| 623 | iso_pu_bacteria | 2967735183 | 2967737142 | 356 |
| 624 | iso_pu_bacteria | 2967742019 | 2967742549 | 356 |
| 625 | iso_pu_bacteria | 2967748971 | 2967751608 | 356 |
| 626 | iso_pu_bacteria | 2967755722 | 2967760012 | 356 |
| 627 | iso_pu_bacteria | 2967762386 | 2967767509 | 356 |
| 628 | iso_pu_bacteria | 2967769361 | 2967772126 | 356 |
| 629 | iso_pu_bacteria | 2967775926 | 2967782234 | 356 |
| 630 | iso_pu_bacteria | 2970019648 | 2970021067 | 356 |
| 631 | iso_pu_bacteria | 2970026789 | 2970028349 | 356 |
| 632 | iso_pu_bacteria | 2970033650 | 2970040284 | 356 |
| 633 | iso_pu_bacteria | 2970040964 | 2970042634 | 356 |
| 634 | iso_pu_bacteria | 2970047711 | 2970050965 | 356 |
| 635 | iso_pu_bacteria | 2970054988 | 2970056695 | 356 |
| 636 | iso_pu_bacteria | 2970061556 | 2970067137 | 356 |
| 637 | iso_pu_bacteria | 2970068827 | 2970071581 | 356 |
| 638 | iso_pu_bacteria | 2970076120 | 2970078257 | 356 |
| 639 | iso_pu_bacteria | 2970082768 | 2970085239 | 356 |
| 640 | iso_pu_bacteria | 2970088815 | 2970092541 | 356 |
| 641 | iso_pu_bacteria | 2970095765 | 2970102161 | 356 |
| 642 | iso_pu_bacteria | 2970102677 | 2970108004 | 356 |
| 643 | iso_pu_bacteria | 2970109326 | 2970110703 | 356 |
| 644 | iso_pu_bacteria | 2970116247 | 2970117349 | 356 |
| 645 | iso_pu_bacteria | 2970122695 | 2970125828 | 356 |
| 646 | iso_pu_bacteria | 2970129317 | 2970131171 | 356 |
| 647 | iso_pu_bacteria | 2970136068 | 2970136287 | 356 |
| 648 | iso_pu_bacteria | 2970143518 | 2970146734 | 356 |
| 649 | iso_pu_bacteria | 2970149975 | 2970151621 | 356 |
| 650 | iso_pu_bacteria | 2970156795 | 2970159562 | 356 |
| 651 | iso_pu_bacteria | 2970164137 | 2970166983 | 356 |
| 652 | iso_pu_bacteria | 2970170962 | 2970174237 | 356 |
| 653 | iso_pu_bacteria | 2970177841 | 2970180819 | 356 |
| 654 | iso_pu_bacteria | 2970184632 | 2970189164 | 356 |
| 655 | iso_pu_bacteria | 2970191845 | 2970193594 | 356 |
| 656 | iso_pu_bacteria | 2977516862 | 2977519110 | 356 |
| 657 | iso_pu_bacteria | 2977523885 | 2977526323 | 356 |
| 658 | iso_pu_bacteria | 2977537788 | 2977539620 | 356 |
| 659 | iso_pu_bacteria | 2977544691 | 2977546354 | 356 |
| 660 | iso_pu_bacteria | 2977551784 | 2977558426 | 356 |
| 661 | iso_pu_bacteria | 2977558990 | 2977564447 | 356 |
| 662 | iso_pu_bacteria | 2977565890 | 2977567659 | 356 |
| 663 | iso_pu_bacteria | 2977572785 | 2977575752 | 356 |
| 664 | iso_pu_bacteria | 2977579622 | 2977582003 | 356 |
| 665 | iso_pu_bacteria | 2978969890 | 2978974611 | 356 |
| 666 | iso_pu_bacteria | 2979089926 | 2979094672 | 356 |
| 667 | iso_pu_bacteria | 2979095461 | 2979100763 | 356 |
| 668 | iso_pu_bacteria | 2979100975 | 2979103907 | 356 |
| 669 | iso_pu_bacteria | 2984509177 | 2984511526 | 356 |
| 670 | iso_pu_bacteria | 2984518228 | 2984522113 | 356 |
| 671 | iso_pu_bacteria | 2984537506 | 2984541411 | 356 |
| 672 | iso_pu_bacteria | 2984587000 | 2984589932 | 356 |
| 673 | iso_pu_bacteria | 2984601300 | 2984603689 | 356 |
| 674 | iso_pu_bacteria | 2989771324 | 2989774279 | 356 |
| 675 | iso_pu_bacteria | 2995392953 | 2995393041 | 356 |
| 676 | iso_pu_bacteria | 2996887358 | 2996889046 | 356 |
| 677 | iso_pu_bacteria | 2996893221 | 2996894339 | 356 |
| 678 | iso_pu_bacteria | 3003930520 | 3003934058 | 356 |
| 679 | iso_pu_bacteria | 3005409236 | 3005414608 | 356 |
| 680 | iso_pu_bacteria | 3005445848 | 3005448438 | 356 |
| 681 | iso_pu_bacteria | 3005452660 | 3005454628 | 356 |
| 682 | iso_pu_bacteria | 639633055 | 639649180 | 356 |
| 683 | iso_pu_bacteria | 648276728 | 648739206 | 356 |
| 684 | iso_pu_bacteria | 650716007 | 650740551 | 356 |
| 685 | iso_pu_bacteria | 8003570095 | 8003571616 | 356 |
| 686 | iso_pu_bacteria | 8003992118 | 8003994160 | 356 |
| 687 | iso_pu_bacteria | 8003999396 | 8004001792 | 356 |
| 688 | iso_pu_bacteria | 8005258706 | 8005260297 | 356 |
| 689 | iso_pu_bacteria | 8005275841 | 8005281198 | 356 |
| 690 | iso_pu_bacteria | 8005282627 | 8005283266 | 356 |
| 691 | iso_pu_bacteria | 8005289223 | 8005293628 | 356 |
| 692 | iso_pu_bacteria | 8005301065 | 8005303113 | 356 |
| 693 | iso_pu_bacteria | 8005307578 | 8005312822 | 356 |
| 694 | iso_pu_bacteria | 8005321885 | 8005323573 | 356 |
| 695 | iso_pu_bacteria | 8005376324 | 8005380916 | 356 |
| 696 | iso_pu_bacteria | 8005382845 | 8005389134 | 356 |
| 697 | iso_pu_bacteria | 8005395548 | 8005396114 | 356 |
| 698 | iso_pu_bacteria | 8005430974 | 8005435145 | 356 |
| 699 | iso_pu_bacteria | 8005460587 | 8005463675 | 356 |
| 700 | iso_pu_bacteria | 8005497431 | 8005500887 | 356 |
| 701 | iso_pu_bacteria | 8005542996 | 8005545610 | 356 |
| 702 | iso_pu_bacteria | 8005556819 | 8005557027 | 356 |
| 703 | iso_pu_bacteria | 8005563573 | 8005567981 | 356 |
| 704 | iso_pu_bacteria | 8005570704 | 8005573474 | 356 |
| 705 | iso_pu_bacteria | 8005619151 | 8005622260 | 356 |
| 706 | iso_pu_bacteria | 8005626139 | 8005632260 | 356 |
| 707 | iso_pu_bacteria | 8005668836 | 8005672304 | 356 |
| 708 | iso_pu_bacteria | 8005688590 | 8005692119 | 356 |
| 709 | iso_pu_bacteria | 8005695170 | 8005697388 | 356 |
| 710 | iso_pu_bacteria | 8018127388 | 8018134082 | 356 |
| 711 | iso_pu_bacteria | 8018150411 | 8018153220 | 356 |
| 712 | iso_pu_bacteria | 8018163183 | 8018164638 | 356 |
| 713 | iso_pu_bacteria | 8018176218 | 8018181337 | 356 |
| 714 | iso_pu_bacteria | 8023680758 | 8023683180 | 356 |
| 715 | iso_pu_bacteria | 8024479707 | 8024482875 | 356 |
| 716 | iso_pu_bacteria | 8024486573 | 8024488019 | 356 |
| 717 | iso_pu_bacteria | 8024501048 | 8024504411 | 356 |
| 718 | iso_pu_bacteria | 8046767195 | 8046771925 | 356 |
| 719 | iso_pu_bacteria | 8054460903 | 8054462967 | 356 |
| 720 | iso_pu_bacteria | 8054558443 | 8054562935 | 356 |
| 721 | iso_pu_bacteria | 8056375014 | 8056375922 | 356 |
| 722 | iso_pu_bacteria | 8056382006 | 8056386713 | 356 |
| 723 | iso_pu_bacteria | 8056875544 | 8056877305 | 356 |
| 724 | iso_pu_bacteria | 8057575449 | 8057575745 | 356 |
| 725 | iso_pu_bacteria | 8057874678 | 8057877686 | 356 |
| 726 | 3300001979 | JGI24740J21852_10000015 | JGI24740J21852_1000001536 | 357 |
| 727 | 3300002704 | JGI25155J39150_1000001 | JGI25155J39150_1000001286 | 357 |
| 728 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_100000147 | 357 |
| 729 | 3300002737 | JGI25162J39368_1000366 | JGI25162J39368_100036629 | 357 |
| 730 | 3300002737 | JGI25162J39368_1000368 | JGI25162J39368_100036827 | 357 |
| 731 | 3300002738 | JGI25154J39366_1000122 | JGI25154J39366_100012210 | 357 |
| 732 | 3300002741 | JGI25157J39369_1000044 | JGI25157J39369_100004446 | 357 |
| 733 | 3300003187 | JGI25151J46595_10016744 | JGI25151J46595_100167443 | 357 |
| 734 | 3300003214 | JGI25165J46597_1000516 | JGI25165J46597_10005167 | 357 |
| 735 | 3300003214 | JGI25165J46597_1001042 | JGI25165J46597_10010428 | 357 |
| 736 | 3300003316 | rootH1_10118411 | rootH1_101184112 | 357 |
| 737 | 3300003320 | rootH2_10034283 | rootH2_100342832 | 357 |
| 738 | 3300003322 | rootL2_10006964 | rootL2_100069648 | 357 |
| 739 | 3300009092 | Ga0105250_10057240 | Ga0105250_100572401 | 357 |
| 740 | 3300013100 | Ga0157373_10090682 | Ga0157373_100906821 | 357 |
| 741 | 3300025206 | Ga0209435_100012 | Ga0209435_100012337 | 357 |
| 742 | 3300025233 | Ga0209437_100051 | Ga0209437_100051334 | 357 |
| 743 | 3300025233 | Ga0209437_100098 | Ga0209437_100098174 | 357 |
| 744 | 3300025246 | Ga0209646_1000026 | Ga0209646_1000026337 | 357 |
| 745 | 3300025246 | Ga0209646_1001199 | Ga0209646_10011996 | 357 |
| 746 | 3300025250 | Ga0209026_1000014 | Ga0209026_1000014337 | 357 |
| 747 | 3300025256 | Ga0209759_1000012 | Ga0209759_1000012337 | 357 |
| 748 | 3300025261 | Ga0209233_1000095 | Ga0209233_1000095291 | 357 |
| 749 | 3300025261 | Ga0209233_1000113 | Ga0209233_10001139 | 357 |
| 750 | 3300025294 | Ga0209025_1000140 | Ga0209025_100014077 | 357 |
| 751 | 3300027312 | Ga0209371_1004133 | Ga0209371_10041333 | 357 |
| 752 | 3300030500 | Ga0268256_1003875 | Ga0268256_10038753 | 357 |
| 753 | 3300041404 | Ga0439436_0009397 | Ga0439436_0009397_1652_2773 | 357 |
| 754 | 3300044694 | Ga0466963_0123948 | Ga0466963_0123948_194_1315 | 357 |
| 755 | 3300044765 | Ga0466970_0071921 | Ga0466970_0071921_258_1379 | 357 |
| 756 | 3300044842 | Ga0466957_0040532 | Ga0466957_0040532_1283_2404 | 357 |
| 757 | 3300045836 | Ga0466958_0122257 | Ga0466958_0122257_42_1163 | 357 |
| 758 | 3300046683 | Ga0495658_0053111 | Ga0495658_0053111_758_1855 | 357 |
| 759 | 3300048920 | Ga0496117_0020764 | Ga0496117_0020764_670_1791 | 357 |
| 760 | 3300048922 | Ga0496119_0017375 | Ga0496119_0017375_409_1530 | 357 |
| 761 | 3300048925 | Ga0496122_0000190 | Ga0496122_0000190_124639_125760 | 357 |
| 762 | 3300048925 | Ga0496122_0079953 | Ga0496122_0079953_486_1607 | 357 |
| 763 | 3300048926 | Ga0496123_0000336 | Ga0496123_0000336_8635_9756 | 357 |
| 764 | 3300048926 | Ga0496123_0112305 | Ga0496123_0112305_14_1135 | 357 |
| 765 | 3300048927 | Ga0496124_0008840 | Ga0496124_0008840_8626_9747 | 357 |
| 766 | 3300048927 | Ga0496124_0126002 | Ga0496124_0126002_289_1410 | 357 |
| 767 | 3300048928 | Ga0496125_0000248 | Ga0496125_0000248_100931_102052 | 357 |
| 768 | 3300048929 | Ga0496126_0000866 | Ga0496126_0000866_8668_9789 | 357 |
| 769 | 3300048929 | Ga0496126_0014931 | Ga0496126_0014931_5286_6407 | 357 |
| 770 | 3300049572 | Ga0501036_0142376 | Ga0501036_0142376_697_1812 | 357 |
| 771 | 3300053125 | Ga0500618_026147 | Ga0500618_026147_244_1365 | 357 |
| 772 | iso_pu_bacteria | 2513237087 | 2513590302 | 357 |
| 773 | iso_pu_bacteria | 2791355082 | 2792585134 | 357 |
| 774 | iso_pu_bacteria | 2802429268 | 2804752745 | 357 |
| 775 | iso_pu_bacteria | 2828305725 | 2828308674 | 357 |
| 776 | iso_pu_bacteria | 2913295892 | 2913299318 | 357 |
| 777 | iso_pu_bacteria | 8049293176 | 8049295314 | 357 |
| 778 | 3300002739 | JGI25158J39367_1000038 | JGI25158J39367_10000389 | 358 |
| 779 | 3300002773 | JGI25152J39213_1001315 | JGI25152J39213_10013152 | 358 |
| 780 | 3300002773 | JGI25152J39213_1003453 | JGI25152J39213_10034534 | 358 |
| 781 | 3300002987 | JGI25159J45721_1000014 | JGI25159J45721_100001450 | 358 |
| 782 | 3300002987 | JGI25159J45721_1000154 | JGI25159J45721_10001545 | 358 |
| 783 | 3300003187 | JGI25151J46595_10000839 | JGI25151J46595_1000083911 | 358 |
| 784 | 3300003187 | JGI25151J46595_10021278 | JGI25151J46595_100212781 | 358 |
| 785 | 3300003187 | JGI25151J46595_10021451 | JGI25151J46595_100214512 | 358 |
| 786 | 3300003187 | JGI25151J46595_10031522 | JGI25151J46595_100315222 | 358 |
| 787 | 3300003214 | JGI25165J46597_1002493 | JGI25165J46597_10024934 | 358 |
| 788 | 3300003215 | JGI25153J46596_10003837 | JGI25153J46596_100038376 | 358 |
| 789 | 3300003215 | JGI25153J46596_10010733 | JGI25153J46596_100107332 | 358 |
| 790 | 3300003215 | JGI25153J46596_10011201 | JGI25153J46596_100112012 | 358 |
| 791 | 3300003323 | rootH1_10280226 | rootH1_102802262 | 358 |
| 792 | 3300003354 | JGI25160J50197_1000020 | JGI25160J50197_100002050 | 358 |
| 793 | 3300003354 | JGI25160J50197_1012216 | JGI25160J50197_10122162 | 358 |
| 794 | 3300003374 | JGI25161J50226_1000174 | JGI25161J50226_100017431 | 358 |
| 795 | 3300003374 | JGI25161J50226_1001510 | JGI25161J50226_10015102 | 358 |
| 796 | 3300003771 | Ga0055526_1000597 | Ga0055526_100059718 | 358 |
| 797 | 3300003771 | Ga0055526_1001490 | Ga0055526_10014904 | 358 |
| 798 | 3300003771 | Ga0055526_1003626 | Ga0055526_10036268 | 358 |
| 799 | 3300003775 | Ga0055524_1001814 | Ga0055524_100181410 | 358 |
| 800 | 3300003775 | Ga0055524_1004279 | Ga0055524_10042793 | 358 |
| 801 | 3300003775 | Ga0055524_1004359 | Ga0055524_10043592 | 358 |
| 802 | 3300003781 | Ga0055536_1000497 | Ga0055536_10004973 | 358 |
| 803 | 3300003781 | Ga0055536_1005415 | Ga0055536_10054152 | 358 |
| 804 | 3300003790 | Ga0055528_1002181 | Ga0055528_10021818 | 358 |
| 805 | 3300003790 | Ga0055528_1005558 | Ga0055528_10055582 | 358 |
| 806 | 3300003790 | Ga0055528_1011408 | Ga0055528_10114082 | 358 |
| 807 | 3300003790 | Ga0055528_1014643 | Ga0055528_10146432 | 358 |
| 808 | 3300003790 | Ga0055528_1015571 | Ga0055528_10155712 | 358 |
| 809 | 3300003791 | Ga0055530_10008497 | Ga0055530_100084972 | 358 |
| 810 | 3300003792 | Ga0055540_1000929 | Ga0055540_10009298 | 358 |
| 811 | 3300003792 | Ga0055540_1003312 | Ga0055540_10033126 | 358 |
| 812 | 3300003792 | Ga0055540_1019170 | Ga0055540_10191703 | 358 |
| 813 | 3300003794 | Ga0055531_10002881 | Ga0055531_100028816 | 358 |
| 814 | 3300003794 | Ga0055531_10008844 | Ga0055531_100088443 | 358 |
| 815 | 3300003856 | Ga0058692_1004850 | Ga0058692_10048502 | 358 |
| 816 | 3300004625 | Ga0055543_1000047 | Ga0055543_100004748 | 358 |
| 817 | 3300004625 | Ga0055543_1000350 | Ga0055543_10003502 | 358 |
| 818 | 3300004625 | Ga0055543_1000500 | Ga0055543_100050011 | 358 |
| 819 | 3300005262 | Ga0065165_1000013 | Ga0065165_1000013170 | 358 |
| 820 | 3300005262 | Ga0065165_1008935 | Ga0065165_10089354 | 358 |
| 821 | 3300005262 | Ga0065165_1011468 | Ga0065165_10114682 | 358 |
| 822 | 3300005262 | Ga0065165_1012221 | Ga0065165_10122213 | 358 |
| 823 | 3300005367 | Ga0070667_100073818 | Ga0070667_1000738183 | 358 |
| 824 | 3300005563 | Ga0068855_100039045 | Ga0068855_1000390455 | 358 |
| 825 | 3300005563 | Ga0068855_100059286 | Ga0068855_1000592863 | 358 |
| 826 | 3300006038 | Ga0075365_10004585 | Ga0075365_100045855 | 358 |
| 827 | 3300006042 | Ga0075368_10003767 | Ga0075368_100037672 | 358 |
| 828 | 3300006048 | Ga0075363_100095574 | Ga0075363_1000955742 | 358 |
| 829 | 3300006353 | Ga0075370_10091011 | Ga0075370_100910112 | 358 |
| 830 | 3300006946 | Ga0079104_1000193 | Ga0079104_100019362 | 358 |
| 831 | 3300006946 | Ga0079104_1001253 | Ga0079104_10012536 | 358 |
| 832 | 3300006948 | Ga0099826_10039284 | Ga0099826_100392842 | 358 |
| 833 | 3300009093 | Ga0105240_10000076 | Ga0105240_10000076155 | 358 |
| 834 | 3300009148 | Ga0105243_10215381 | Ga0105243_102153811 | 358 |
| 835 | 3300009545 | Ga0105237_10000226 | Ga0105237_1000022640 | 358 |
| 836 | 3300009765 | Ga0123341_1000007 | Ga0123341_100000790 | 358 |
| 837 | 3300009766 | Ga0123342_1004784 | Ga0123342_100478416 | 358 |
| 838 | 3300009766 | Ga0123342_1022907 | Ga0123342_10229073 | 358 |
| 839 | 3300010375 | Ga0105239_10000641 | Ga0105239_1000064112 | 358 |
| 840 | 3300013102 | Ga0157371_10004510 | Ga0157371_100045109 | 358 |
| 841 | 3300013104 | Ga0157370_10000455 | Ga0157370_1000045536 | 358 |
| 842 | 3300013105 | Ga0157369_10043175 | Ga0157369_100431754 | 358 |
| 843 | 3300013105 | Ga0157369_10354095 | Ga0157369_103540951 | 358 |
| 844 | 3300013249 | Ga0171463_1003 | Ga0171463_1003171 | 358 |
| 845 | 3300015262 | Ga0182007_10001815 | Ga0182007_100018157 | 358 |
| 846 | 3300015265 | Ga0182005_1005015 | Ga0182005_10050152 | 358 |
| 847 | 3300015690 | Ga0183363_1025 | Ga0183363_102546 | 358 |
| 848 | 3300021327 | Ga0214543_1000038 | Ga0214543_100003873 | 358 |
| 849 | 3300022739 | Ga0228711_1000008 | Ga0228711_100000844 | 358 |
| 850 | 3300022740 | Ga0228710_1000009 | Ga0228710_100000943 | 358 |
| 851 | 3300025208 | Ga0209436_100150 | Ga0209436_10015027 | 358 |
| 852 | 3300025245 | Ga0207425_1001337 | Ga0207425_100133710 | 358 |
| 853 | 3300025245 | Ga0207425_1004121 | Ga0207425_10041213 | 358 |
| 854 | 3300025258 | Ga0209129_1000524 | Ga0209129_10005243 | 358 |
| 855 | 3300025258 | Ga0209129_1001868 | Ga0209129_10018685 | 358 |
| 856 | 3300025258 | Ga0209129_1002344 | Ga0209129_10023444 | 358 |
| 857 | 3300025258 | Ga0209129_1004509 | Ga0209129_10045093 | 358 |
| 858 | 3300025261 | Ga0209233_1000427 | Ga0209233_100042710 | 358 |
| 859 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010207 | 358 |
| 860 | 3300025273 | Ga0209673_1000117 | Ga0209673_100011787 | 358 |
| 861 | 3300025273 | Ga0209673_1000151 | Ga0209673_100015164 | 358 |
| 862 | 3300025273 | Ga0209673_1000863 | Ga0209673_100086323 | 358 |
| 863 | 3300025273 | Ga0209673_1001685 | Ga0209673_100168510 | 358 |
| 864 | 3300025284 | Ga0209130_1000020 | Ga0209130_1000020259 | 358 |
| 865 | 3300025284 | Ga0209130_1000034 | Ga0209130_1000034165 | 358 |
| 866 | 3300025284 | Ga0209130_1013282 | Ga0209130_10132822 | 358 |
| 867 | 3300025291 | Ga0209675_1011031 | Ga0209675_10110312 | 358 |
| 868 | 3300025292 | Ga0209676_1000482 | Ga0209676_100048238 | 358 |
| 869 | 3300025292 | Ga0209676_1011056 | Ga0209676_10110563 | 358 |
| 870 | 3300025292 | Ga0209676_1031573 | Ga0209676_10315731 | 358 |
| 871 | 3300025292 | Ga0209676_1041343 | Ga0209676_10413432 | 358 |
| 872 | 3300025294 | Ga0209025_1000314 | Ga0209025_100031427 | 358 |
| 873 | 3300025294 | Ga0209025_1000506 | Ga0209025_100050610 | 358 |
| 874 | 3300025294 | Ga0209025_1003183 | Ga0209025_10031839 | 358 |
| 875 | 3300025294 | Ga0209025_1005402 | Ga0209025_10054029 | 358 |
| 876 | 3300025294 | Ga0209025_1028383 | Ga0209025_10283832 | 358 |
| 877 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013164 | 358 |
| 878 | 3300025295 | Ga0209564_1000647 | Ga0209564_100064719 | 358 |
| 879 | 3300025295 | Ga0209564_1001780 | Ga0209564_10017808 | 358 |
| 880 | 3300025295 | Ga0209564_1001993 | Ga0209564_10019939 | 358 |
| 881 | 3300025295 | Ga0209564_1009159 | Ga0209564_10091592 | 358 |
| 882 | 3300025297 | Ga0209758_1000413 | Ga0209758_100041339 | 358 |
| 883 | 3300025297 | Ga0209758_1000655 | Ga0209758_100065510 | 358 |
| 884 | 3300025297 | Ga0209758_1001882 | Ga0209758_100188210 | 358 |
| 885 | 3300025297 | Ga0209758_1002154 | Ga0209758_100215410 | 358 |
| 886 | 3300025297 | Ga0209758_1003547 | Ga0209758_10035479 | 358 |
| 887 | 3300025297 | Ga0209758_1025944 | Ga0209758_10259442 | 358 |
| 888 | 3300025298 | Ga0209050_1000646 | Ga0209050_100064625 | 358 |
| 889 | 3300025298 | Ga0209050_1004392 | Ga0209050_10043925 | 358 |
| 890 | 3300025299 | Ga0209256_1001653 | Ga0209256_100165316 | 358 |
| 891 | 3300025299 | Ga0209256_1001736 | Ga0209256_100173616 | 358 |
| 892 | 3300025299 | Ga0209256_1002712 | Ga0209256_10027126 | 358 |
| 893 | 3300025299 | Ga0209256_1003882 | Ga0209256_10038828 | 358 |
| 894 | 3300025299 | Ga0209256_1004803 | Ga0209256_10048032 | 358 |
| 895 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006538 | 358 |
| 896 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008327 | 358 |
| 897 | 3300025302 | Ga0207426_1000221 | Ga0207426_1000221120 | 358 |
| 898 | 3300025303 | Ga0209051_1000097 | Ga0209051_100009755 | 358 |
| 899 | 3300025303 | Ga0209051_1000314 | Ga0209051_100031423 | 358 |
| 900 | 3300025303 | Ga0209051_1004880 | Ga0209051_10048803 | 358 |
| 901 | 3300025303 | Ga0209051_1006481 | Ga0209051_10064812 | 358 |
| 902 | 3300025303 | Ga0209051_1008689 | Ga0209051_10086892 | 358 |
| 903 | 3300025304 | Ga0209257_1001142 | Ga0209257_100114219 | 358 |
| 904 | 3300025304 | Ga0209257_1002070 | Ga0209257_100207011 | 358 |
| 905 | 3300025304 | Ga0209257_1008609 | Ga0209257_10086093 | 358 |
| 906 | 3300025913 | Ga0207695_10000011 | Ga0207695_1000001146 | 358 |
| 907 | 3300025914 | Ga0207671_10000093 | Ga0207671_1000009386 | 358 |
| 908 | 3300025949 | Ga0207667_10038259 | Ga0207667_100382593 | 358 |
| 909 | 3300025949 | Ga0207667_10078464 | Ga0207667_100784642 | 358 |
| 910 | 3300026078 | Ga0207702_10166063 | Ga0207702_101660632 | 358 |
| 911 | 3300027111 | Ga0209281_1000034 | Ga0209281_100003462 | 358 |
| 912 | 3300027111 | Ga0209281_1000106 | Ga0209281_1000106188 | 358 |
| 913 | 3300027111 | Ga0209281_1000318 | Ga0209281_100031831 | 358 |
| 914 | 3300027312 | Ga0209371_1003359 | Ga0209371_10033596 | 358 |
| 915 | 3300027666 | Ga0209282_1000024 | Ga0209282_1000024119 | 358 |
| 916 | 3300028794 | Ga0307515_10001978 | Ga0307515_1000197820 | 358 |
| 917 | 3300028794 | Ga0307515_10007368 | Ga0307515_1000736810 | 358 |
| 918 | 3300028794 | Ga0307515_10030752 | Ga0307515_100307526 | 358 |
| 919 | 3300030500 | Ga0268256_1003591 | Ga0268256_10035916 | 358 |
| 920 | 3300030744 | Ga0316181_1120346 | Ga0316181_11203462 | 358 |
| 921 | 3300031456 | Ga0307513_10010539 | Ga0307513_100105396 | 358 |
| 922 | 3300031456 | Ga0307513_10286834 | Ga0307513_102868341 | 358 |
| 923 | 3300031548 | Ga0307408_100070114 | Ga0307408_1000701142 | 358 |
| 924 | 3300031911 | Ga0307412_10162794 | Ga0307412_101627942 | 358 |
| 925 | 3300031967 | Ga0315914_1000012 | Ga0315914_100001244 | 358 |
| 926 | 3300032002 | Ga0307416_100168787 | Ga0307416_1001687872 | 358 |
| 927 | 3300033180 | Ga0307510_10214573 | Ga0307510_102145732 | 358 |
| 928 | 3300033430 | Ga0315913_1000006 | Ga0315913_100000644 | 358 |
| 929 | 3300033464 | Ga0315915_1000010 | Ga0315915_1000010221 | 358 |
| 930 | 3300041413 | Ga0439465_0002128 | Ga0439465_0002128_1401_2525 | 358 |
| 931 | 3300041413 | Ga0439465_0007342 | Ga0439465_0007342_1119_2243 | 358 |
| 932 | 3300041413 | Ga0439465_0045564 | Ga0439465_0045564_249_1373 | 358 |
| 933 | 3300041496 | Ga0451839_0580770 | Ga0451839_0580770_79_1203 | 358 |
| 934 | 3300041501 | Ga0451845_0247449 | Ga0451845_0247449_22_1146 | 358 |
| 935 | 3300041503 | Ga0451847_0129796 | Ga0451847_0129796_909_2033 | 358 |
| 936 | 3300041507 | Ga0451851_1171717 | Ga0451851_1171717_265_1389 | 358 |
| 937 | 3300041512 | Ga0451853_0242170 | Ga0451853_0242170_356_1480 | 358 |
| 938 | 3300042007 | Ga0439449_0036823 | Ga0439449_0036823_195_1319 | 358 |
| 939 | 3300042015 | Ga0439462_0028778 | Ga0439462_0028778_332_1456 | 358 |
| 940 | 3300042145 | Ga0450906_003061 | Ga0450906_003061_869_1993 | 358 |
| 941 | 3300042435 | Ga0439434_0010648 | Ga0439434_0010648_451_1575 | 358 |
| 942 | 3300046454 | Ga0495592_0069851 | Ga0495592_0069851_599_1723 | 358 |
| 943 | 3300046460 | Ga0495638_0003695 | Ga0495638_0003695_1169_2293 | 358 |
| 944 | 3300046460 | Ga0495638_0008934 | Ga0495638_0008934_5802_6926 | 358 |
| 945 | 3300046460 | Ga0495638_0116317 | Ga0495638_0116317_18_1142 | 358 |
| 946 | 3300046474 | Ga0495605_0001952 | Ga0495605_0001952_10246_11370 | 358 |
| 947 | 3300046476 | Ga0495662_0006938 | Ga0495662_0006938_2398_3522 | 358 |
| 948 | 3300046492 | Ga0495585_0013529 | Ga0495585_0013529_3008_4132 | 358 |
| 949 | 3300046492 | Ga0495585_0105092 | Ga0495585_0105092_234_1358 | 358 |
| 950 | 3300046506 | Ga0495583_0039022 | Ga0495583_0039022_885_2009 | 358 |
| 951 | 3300046507 | Ga0495606_0024450 | Ga0495606_0024450_254_1378 | 358 |
| 952 | 3300046512 | Ga0495610_0001969 | Ga0495610_0001969_1309_2433 | 358 |
| 953 | 3300046518 | Ga0495631_0018333 | Ga0495631_0018333_1005_2129 | 358 |
| 954 | 3300046518 | Ga0495631_0048409 | Ga0495631_0048409_639_1763 | 358 |
| 955 | 3300046519 | Ga0495632_0045086 | Ga0495632_0045086_503_1627 | 358 |
| 956 | 3300046522 | Ga0495643_0002725 | Ga0495643_0002725_7617_8741 | 358 |
| 957 | 3300046522 | Ga0495643_0042055 | Ga0495643_0042055_1332_2456 | 358 |
| 958 | 3300046530 | Ga0495654_0000110 | Ga0495654_0000110_56603_57742 | 358 |
| 959 | 3300046536 | Ga0495587_0057656 | Ga0495587_0057656_386_1510 | 358 |
| 960 | 3300046538 | Ga0495609_0069379 | Ga0495609_0069379_404_1528 | 358 |
| 961 | 3300046616 | Ga0495668_0043958 | Ga0495668_0043958_1124_2248 | 358 |
| 962 | 3300046660 | Ga0495625_0001387 | Ga0495625_0001387_28381_29505 | 358 |
| 963 | 3300046660 | Ga0495625_0016011 | Ga0495625_0016011_301_1425 | 358 |
| 964 | 3300046683 | Ga0495658_0109237 | Ga0495658_0109237_329_1453 | 358 |
| 965 | 3300046691 | Ga0495670_0043399 | Ga0495670_0043399_399_1523 | 358 |
| 966 | 3300046810 | Ga0495660_0069277 | Ga0495660_0069277_677_1801 | 358 |
| 967 | 3300047320 | Ga0495672_0063455 | Ga0495672_0063455_718_1842 | 358 |
| 968 | 3300047472 | Ga0495686_0002729 | Ga0495686_0002729_8541_9665 | 358 |
| 969 | 3300047472 | Ga0495686_0027671 | Ga0495686_0027671_314_1438 | 358 |
| 970 | 3300047472 | Ga0495686_0081202 | Ga0495686_0081202_838_1968 | 358 |
| 971 | 3300048091 | Ga0495626_0062634 | Ga0495626_0062634_364_1488 | 358 |
| 972 | 3300048903 | Ga0496100_0275748 | Ga0496100_0275748_86_1210 | 358 |
| 973 | 3300048905 | Ga0496102_0206606 | Ga0496102_0206606_545_1669 | 358 |
| 974 | 3300048909 | Ga0496106_0000982 | Ga0496106_0000982_9632_10756 | 358 |
| 975 | 3300048917 | Ga0496114_0110677 | Ga0496114_0110677_83_1207 | 358 |
| 976 | 3300048919 | Ga0496116_0000142 | Ga0496116_0000142_101346_102482 | 358 |
| 977 | 3300048919 | Ga0496116_0054835 | Ga0496116_0054835_1250_2374 | 358 |
| 978 | 3300048919 | Ga0496116_0145923 | Ga0496116_0145923_129_1253 | 358 |
| 979 | 3300048920 | Ga0496117_0001574 | Ga0496117_0001574_8862_9986 | 358 |
| 980 | 3300048920 | Ga0496117_0019627 | Ga0496117_0019627_2846_3970 | 358 |
| 981 | 3300048920 | Ga0496117_0070011 | Ga0496117_0070011_458_1582 | 358 |
| 982 | 3300048921 | Ga0496118_0008894 | Ga0496118_0008894_8681_9805 | 358 |
| 983 | 3300048921 | Ga0496118_0031016 | Ga0496118_0031016_2607_3731 | 358 |
| 984 | 3300048921 | Ga0496118_0053725 | Ga0496118_0053725_934_2058 | 358 |
| 985 | 3300048921 | Ga0496118_0133076 | Ga0496118_0133076_114_1253 | 358 |
| 986 | 3300048923 | Ga0496120_0111746 | Ga0496120_0111746_124_1248 | 358 |
| 987 | 3300048924 | Ga0496121_0037820 | Ga0496121_0037820_2678_3817 | 358 |
| 988 | 3300048924 | Ga0496121_0047624 | Ga0496121_0047624_1360_2484 | 358 |
| 989 | 3300048924 | Ga0496121_0215751 | Ga0496121_0215751_111_1250 | 358 |
| 990 | 3300048925 | Ga0496122_0048385 | Ga0496122_0048385_425_1549 | 358 |
| 991 | 3300048925 | Ga0496122_0064502 | Ga0496122_0064502_456_1595 | 358 |
| 992 | 3300048925 | Ga0496122_0083845 | Ga0496122_0083845_604_1728 | 358 |
| 993 | 3300048925 | Ga0496122_0102039 | Ga0496122_0102039_699_1835 | 358 |
| 994 | 3300048926 | Ga0496123_0024244 | Ga0496123_0024244_3259_4395 | 358 |
| 995 | 3300048926 | Ga0496123_0090207 | Ga0496123_0090207_115_1239 | 358 |
| 996 | 3300048927 | Ga0496124_0001040 | Ga0496124_0001040_8097_9233 | 358 |
| 997 | 3300048927 | Ga0496124_0009838 | Ga0496124_0009838_7799_8923 | 358 |
| 998 | 3300048927 | Ga0496124_0015066 | Ga0496124_0015066_5331_6455 | 358 |
| 999 | 3300048927 | Ga0496124_0088148 | Ga0496124_0088148_945_2069 | 358 |
| 1000 | 3300048927 | Ga0496124_0147634 | Ga0496124_0147634_664_1788 | 358 |
| 1001 | 3300048928 | Ga0496125_0029309 | Ga0496125_0029309_391_1515 | 358 |
| 1002 | 3300048929 | Ga0496126_0001294 | Ga0496126_0001294_8232_9368 | 358 |
| 1003 | 3300049459 | Ga0495678_005392 | Ga0495678_005392_1160_2284 | 358 |
| 1004 | 3300049570 | Ga0501033_0001862 | Ga0501033_0001862_7917_9041 | 358 |
| 1005 | 3300049822 | Ga0501035_0000584 | Ga0501035_0000584_2521_3645 | 358 |
| 1006 | 3300050489 | nmdc:mga03683_2117_c1 | nmdc:mga03683_2117_c1_2558_3682 | 358 |
| 1007 | 3300050490 | nmdc:mga03n38_29204_c1 | nmdc:mga03n38_29204_c1_860_1984 | 358 |
| 1008 | 3300050491 | nmdc:mga00v17_156564_c1 | nmdc:mga00v17_156564_c1_166_1302 | 358 |
| 1009 | 3300050492 | nmdc:mga0yw44_119621_c1 | nmdc:mga0yw44_119621_c1_84_1211 | 358 |
| 1010 | 3300050492 | nmdc:mga0yw44_73499_c1 | nmdc:mga0yw44_73499_c1_431_1555 | 358 |
| 1011 | 3300050496 | nmdc:mga07m45_93189_c1 | nmdc:mga07m45_93189_c1_128_1252 | 358 |
| 1012 | 3300050516 | nmdc:mga0sz30_60381_c1 | nmdc:mga0sz30_60381_c1_86_1222 | 358 |
| 1013 | 3300053109 | Ga0500569_019514 | Ga0500569_019514_137_1261 | 358 |
| 1014 | 3300053122 | Ga0500608_022262 | Ga0500608_022262_655_1779 | 358 |
| 1015 | 3300053134 | Ga0500658_0000526 | Ga0500658_0000526_13805_14929 | 358 |
| 1016 | 3300053136 | Ga0500559_0002861 | Ga0500559_0002861_7207_8334 | 358 |
| 1017 | 3300053139 | Ga0500568_0022079 | Ga0500568_0022079_1166_2290 | 358 |
| 1018 | 3300053139 | Ga0500568_0023876 | Ga0500568_0023876_375_1499 | 358 |
| 1019 | 3300053140 | Ga0500573_0001766 | Ga0500573_0001766_8230_9357 | 358 |
| 1020 | 3300053151 | Ga0500604_0025382 | Ga0500604_0025382_336_1460 | 358 |
| 1021 | 3300053153 | Ga0500616_0000277 | Ga0500616_0000277_30962_32086 | 358 |
| 1022 | 3300053153 | Ga0500616_0004617 | Ga0500616_0004617_7445_8569 | 358 |
| 1023 | 3300053153 | Ga0500616_0055546 | Ga0500616_0055546_11_1135 | 358 |
| 1024 | 3300053156 | Ga0500622_0000458 | Ga0500622_0000458_28064_29188 | 358 |
| 1025 | 3300053156 | Ga0500622_0000627 | Ga0500622_0000627_571_1695 | 358 |
| 1026 | 3300005435 | Ga0070714_100058991 | Ga0070714_1000589913 | 359 |
| 1027 | 3300021320 | Ga0214544_1001800 | Ga0214544_100180022 | 359 |
| 1028 | 3300021321 | Ga0214542_1000012 | Ga0214542_100001294 | 359 |
| 1029 | 3300021327 | Ga0214543_1000024 | Ga0214543_100002495 | 359 |
| 1030 | 3300025915 | Ga0207693_10013345 | Ga0207693_100133453 | 359 |
| 1031 | 3300035083 | Ga0373926_0004868 | Ga0373926_0004868_2049_3146 | 359 |
| 1032 | 3300035692 | Ga0373935_0023830 | Ga0373935_0023830_462_1559 | 359 |
| 1033 | 3300035725 | Ga0373947_0085441 | Ga0373947_0085441_849_1946 | 359 |
| 1034 | 3300046460 | Ga0495638_0035932 | Ga0495638_0035932_238_1383 | 359 |
| 1035 | 3300046472 | Ga0495580_0098448 | Ga0495580_0098448_568_1665 | 359 |
| 1036 | 3300046473 | Ga0495582_0017971 | Ga0495582_0017971_304_1401 | 359 |
| 1037 | 3300046476 | Ga0495662_0014082 | Ga0495662_0014082_1096_2193 | 359 |
| 1038 | 3300046477 | Ga0495664_0002940 | Ga0495664_0002940_3154_4251 | 359 |
| 1039 | 3300046533 | Ga0495640_0008740 | Ga0495640_0008740_1251_2348 | 359 |
| 1040 | 3300046681 | Ga0495647_0004833 | Ga0495647_0004833_795_1892 | 359 |
| 1041 | 3300046690 | Ga0495624_0029990 | Ga0495624_0029990_2320_3417 | 359 |
| 1042 | 3300047319 | Ga0495674_0019302 | Ga0495674_0019302_580_1677 | 359 |
| 1043 | 3300047321 | Ga0495676_0039718 | Ga0495676_0039718_1020_2117 | 359 |
| 1044 | 3300048089 | Ga0495614_0023721 | Ga0495614_0023721_589_1686 | 359 |
| 1045 | 3300048929 | Ga0496126_0247101 | Ga0496126_0247101_113_1243 | 359 |
| 1046 | 3300049571 | Ga0501034_0243144 | Ga0501034_0243144_118_1248 | 359 |
| 1047 | 3300049742 | Ga0501080_0374935 | Ga0501080_0374935_160_1254 | 359 |
| 1048 | iso_pu_bacteria | 2524023209 | 2524459581 | 359 |
| 1049 | 3300031239 | Ga0265328_10000786 | Ga0265328_100007866 | 360 |
| 1050 | 3300031239 | Ga0265328_10021456 | Ga0265328_100214562 | 360 |
| 1051 | 3300031250 | Ga0265331_10001293 | Ga0265331_100012935 | 360 |
| 1052 | 3300031251 | Ga0265327_10069561 | Ga0265327_100695612 | 360 |
| 1053 | 3300031344 | Ga0265316_10109642 | Ga0265316_101096422 | 360 |
| 1054 | 3300046536 | Ga0495587_0011251 | Ga0495587_0011251_1530_2621 | 360 |
| 1055 | 3300053111 | Ga0500572_004012 | Ga0500572_004012_336_1499 | 360 |
| 1056 | 3300053177 | Ga0500636_0000180 | Ga0500636_0000180_19997_21163 | 360 |
| 1057 | 3300053177 | Ga0500636_0001459 | Ga0500636_0001459_3328_4491 | 360 |
| 1058 | 3300044684 | Ga0466966_0030974 | Ga0466966_0030974_1902_3011 | 363 |
| 1059 | iso_pu_bacteria | 2919450847 | 2919452463 | 363 |
| 1060 | iso_pu_bacteria | 8001845381 | 8001846145 | 363 |
| 1061 | 3300003911 | JGI25405J52794_10004407 | JGI25405J52794_100044072 | 364 |
| 1062 | 3300005328 | Ga0070676_10032562 | Ga0070676_100325622 | 364 |
| 1063 | 3300005330 | Ga0070690_100031150 | Ga0070690_1000311502 | 364 |
| 1064 | 3300005334 | Ga0068869_100056304 | Ga0068869_1000563043 | 364 |
| 1065 | 3300005335 | Ga0070666_10018983 | Ga0070666_100189832 | 364 |
| 1066 | 3300005337 | Ga0070682_100074471 | Ga0070682_1000744712 | 364 |
| 1067 | 3300005339 | Ga0070660_100043329 | Ga0070660_1000433293 | 364 |
| 1068 | 3300005340 | Ga0070689_100037552 | Ga0070689_1000375522 | 364 |
| 1069 | 3300005343 | Ga0070687_100020607 | Ga0070687_1000206072 | 364 |
| 1070 | 3300005344 | Ga0070661_100083856 | Ga0070661_1000838561 | 364 |
| 1071 | 3300005355 | Ga0070671_100023087 | Ga0070671_1000230873 | 364 |
| 1072 | 3300005364 | Ga0070673_100008972 | Ga0070673_1000089725 | 364 |
| 1073 | 3300005365 | Ga0070688_100023145 | Ga0070688_1000231452 | 364 |
| 1074 | 3300005434 | Ga0070709_10009235 | Ga0070709_100092354 | 364 |
| 1075 | 3300005435 | Ga0070714_100013931 | Ga0070714_1000139313 | 364 |
| 1076 | 3300005436 | Ga0070713_100002582 | Ga0070713_1000025823 | 364 |
| 1077 | 3300005437 | Ga0070710_10002708 | Ga0070710_100027085 | 364 |
| 1078 | 3300005439 | Ga0070711_100086466 | Ga0070711_1000864662 | 364 |
| 1079 | 3300005456 | Ga0070678_100008371 | Ga0070678_1000083713 | 364 |
| 1080 | 3300005466 | Ga0070685_10013452 | Ga0070685_100134522 | 364 |
| 1081 | 3300005547 | Ga0070693_100039225 | Ga0070693_1000392252 | 364 |
| 1082 | 3300005548 | Ga0070665_100053711 | Ga0070665_1000537113 | 364 |
| 1083 | 3300005614 | Ga0068856_100133294 | Ga0068856_1001332941 | 364 |
| 1084 | 3300005842 | Ga0068858_100099299 | Ga0068858_1000992991 | 364 |
| 1085 | 3300005843 | Ga0068860_100033225 | Ga0068860_1000332254 | 364 |
| 1086 | 3300006028 | Ga0070717_10002936 | Ga0070717_100029367 | 364 |
| 1087 | 3300006163 | Ga0070715_10001339 | Ga0070715_100013393 | 364 |
| 1088 | 3300006173 | Ga0070716_100004734 | Ga0070716_1000047343 | 364 |
| 1089 | 3300006237 | Ga0097621_100017219 | Ga0097621_1000172194 | 364 |
| 1090 | 3300006358 | Ga0068871_100028379 | Ga0068871_1000283794 | 364 |
| 1091 | 3300006881 | Ga0068865_100020024 | Ga0068865_1000200242 | 364 |
| 1092 | 3300009011 | Ga0105251_10029607 | Ga0105251_100296073 | 364 |
| 1093 | 3300009094 | Ga0111539_10432145 | Ga0111539_104321452 | 364 |
| 1094 | 3300009174 | Ga0105241_10009439 | Ga0105241_100094395 | 364 |
| 1095 | 3300009176 | Ga0105242_10012804 | Ga0105242_100128043 | 364 |
| 1096 | 3300009177 | Ga0105248_10043884 | Ga0105248_100438843 | 364 |
| 1097 | 3300009545 | Ga0105237_10011347 | Ga0105237_100113473 | 364 |
| 1098 | 3300012507 | Ga0157342_1000277 | Ga0157342_10002772 | 364 |
| 1099 | 3300013105 | Ga0157369_10191156 | Ga0157369_101911561 | 364 |
| 1100 | 3300013296 | Ga0157374_10116632 | Ga0157374_101166323 | 364 |
| 1101 | 3300017792 | Ga0163161_10023487 | Ga0163161_100234872 | 364 |
| 1102 | 3300025903 | Ga0207680_10014997 | Ga0207680_100149973 | 364 |
| 1103 | 3300025905 | Ga0207685_10013233 | Ga0207685_100132332 | 364 |
| 1104 | 3300025906 | Ga0207699_10004930 | Ga0207699_100049303 | 364 |
| 1105 | 3300025911 | Ga0207654_10045739 | Ga0207654_100457392 | 364 |
| 1106 | 3300025915 | Ga0207693_10007487 | Ga0207693_100074873 | 364 |
| 1107 | 3300025927 | Ga0207687_10004506 | Ga0207687_100045067 | 364 |
| 1108 | 3300025928 | Ga0207700_10001137 | Ga0207700_1000113712 | 364 |
| 1109 | 3300025929 | Ga0207664_10027404 | Ga0207664_100274042 | 364 |
| 1110 | 3300025931 | Ga0207644_10005542 | Ga0207644_100055424 | 364 |
| 1111 | 3300025933 | Ga0207706_10042916 | Ga0207706_100429163 | 364 |
| 1112 | 3300025934 | Ga0207686_10012409 | Ga0207686_100124094 | 364 |
| 1113 | 3300025939 | Ga0207665_10001484 | Ga0207665_100014847 | 364 |
| 1114 | 3300025942 | Ga0207689_10043368 | Ga0207689_100433683 | 364 |
| 1115 | 3300025945 | Ga0207679_10010295 | Ga0207679_100102952 | 364 |
| 1116 | 3300025960 | Ga0207651_10138038 | Ga0207651_101380382 | 364 |
| 1117 | 3300026035 | Ga0207703_10012070 | Ga0207703_100120703 | 364 |
| 1118 | 3300026078 | Ga0207702_10099863 | Ga0207702_100998632 | 364 |
| 1119 | 3300026088 | Ga0207641_10019300 | Ga0207641_100193003 | 364 |
| 1120 | 3300026089 | Ga0207648_10042100 | Ga0207648_100421002 | 364 |
| 1121 | 3300026121 | Ga0207683_10006919 | Ga0207683_100069194 | 364 |
| 1122 | 3300028379 | Ga0268266_10019605 | Ga0268266_100196053 | 364 |
| 1123 | 3300028381 | Ga0268264_10165969 | Ga0268264_101659691 | 364 |
| 1124 | 3300034819 | Ga0373958_0002015 | Ga0373958_0002015_741_1835 | 364 |
| 1125 | 3300035084 | Ga0373928_0008008 | Ga0373928_0008008_783_1877 | 364 |
| 1126 | 3300035116 | Ga0373945_0001892 | Ga0373945_0001892_2097_3191 | 364 |
| 1127 | 3300035117 | Ga0373953_0064709 | Ga0373953_0064709_143_1237 | 364 |
| 1128 | 3300035171 | Ga0373946_0012729 | Ga0373946_0012729_1854_2948 | 364 |
| 1129 | 3300035242 | Ga0373962_0002284 | Ga0373962_0002284_309_1403 | 364 |
| 1130 | 3300035695 | Ga0373927_0062283 | Ga0373927_0062283_315_1409 | 364 |
| 1131 | 3300035724 | Ga0373933_0020224 | Ga0373933_0020224_1232_2326 | 364 |
| 1132 | 3300046455 | Ga0495603_0010478 | Ga0495603_0010478_842_1936 | 364 |
| 1133 | 3300046459 | Ga0495629_0001536 | Ga0495629_0001536_4304_5398 | 364 |
| 1134 | 3300046461 | Ga0495641_0005001 | Ga0495641_0005001_3591_4685 | 364 |
| 1135 | 3300046463 | Ga0495653_0002829 | Ga0495653_0002829_9452_10546 | 364 |
| 1136 | 3300046472 | Ga0495580_0114397 | Ga0495580_0114397_230_1324 | 364 |
| 1137 | 3300046473 | Ga0495582_0001755 | Ga0495582_0001755_3503_4597 | 364 |
| 1138 | 3300046473 | Ga0495582_0035249 | Ga0495582_0035249_533_1627 | 364 |
| 1139 | 3300046491 | Ga0495584_0010859 | Ga0495584_0010859_2052_3146 | 364 |
| 1140 | 3300046492 | Ga0495585_0015360 | Ga0495585_0015360_491_1585 | 364 |
| 1141 | 3300046499 | Ga0495594_0022203 | Ga0495594_0022203_1331_2425 | 364 |
| 1142 | 3300046499 | Ga0495594_0025988 | Ga0495594_0025988_1020_2114 | 364 |
| 1143 | 3300046501 | Ga0495607_0049524 | Ga0495607_0049524_532_1626 | 364 |
| 1144 | 3300046511 | Ga0495608_0055006 | Ga0495608_0055006_1337_2431 | 364 |
| 1145 | 3300046520 | Ga0495637_0040485 | Ga0495637_0040485_532_1626 | 364 |
| 1146 | 3300046523 | Ga0495644_0003283 | Ga0495644_0003283_1215_2309 | 364 |
| 1147 | 3300046526 | Ga0495666_0064539 | Ga0495666_0064539_123_1217 | 364 |
| 1148 | 3300046529 | Ga0495652_0083477 | Ga0495652_0083477_1508_2602 | 364 |
| 1149 | 3300046537 | Ga0495598_0002896 | Ga0495598_0002896_1464_2558 | 364 |
| 1150 | 3300046538 | Ga0495609_0024830 | Ga0495609_0024830_674_1768 | 364 |
| 1151 | 3300046557 | Ga0495622_0029386 | Ga0495622_0029386_294_1388 | 364 |
| 1152 | 3300046558 | Ga0495633_0012648 | Ga0495633_0012648_953_2047 | 364 |
| 1153 | 3300046559 | Ga0495667_0008220 | Ga0495667_0008220_1986_3080 | 364 |
| 1154 | 3300046615 | Ga0495656_0000812 | Ga0495656_0000812_2487_3581 | 364 |
| 1155 | 3300046663 | Ga0495635_0010665 | Ga0495635_0010665_4184_5278 | 364 |
| 1156 | 3300046663 | Ga0495635_0107746 | Ga0495635_0107746_447_1541 | 364 |
| 1157 | 3300046674 | Ga0495588_0002364 | Ga0495588_0002364_3086_4180 | 364 |
| 1158 | 3300046680 | Ga0495646_0025939 | Ga0495646_0025939_1196_2290 | 364 |
| 1159 | 3300046681 | Ga0495647_0001979 | Ga0495647_0001979_3678_4772 | 364 |
| 1160 | 3300046683 | Ga0495658_0004872 | Ga0495658_0004872_4099_5193 | 364 |
| 1161 | 3300046683 | Ga0495658_0006624 | Ga0495658_0006624_3296_4390 | 364 |
| 1162 | 3300046689 | Ga0495613_0003386 | Ga0495613_0003386_7364_8458 | 364 |
| 1163 | 3300046690 | Ga0495624_0005667 | Ga0495624_0005667_7024_8118 | 364 |
| 1164 | 3300046809 | Ga0495600_0042175 | Ga0495600_0042175_1089_2183 | 364 |
| 1165 | 3300047317 | Ga0495604_0013426 | Ga0495604_0013426_3738_4832 | 364 |
| 1166 | 3300047322 | Ga0495680_0007202 | Ga0495680_0007202_3432_4526 | 364 |
| 1167 | 3300047322 | Ga0495680_0014519 | Ga0495680_0014519_1619_2713 | 364 |
| 1168 | 3300047445 | Ga0495677_0031383 | Ga0495677_0031383_503_1597 | 364 |
| 1169 | 3300047673 | Ga0495593_0010592 | Ga0495593_0010592_2884_3978 | 364 |
| 1170 | 3300047673 | Ga0495593_0055294 | Ga0495593_0055294_607_1701 | 364 |
| 1171 | 3300048088 | Ga0495602_0092286 | Ga0495602_0092286_1402_2496 | 364 |
| 1172 | 3300048903 | Ga0496100_0005513 | Ga0496100_0005513_2220_3314 | 364 |
| 1173 | 3300048904 | Ga0496101_0042308 | Ga0496101_0042308_1550_2644 | 364 |
| 1174 | 3300048905 | Ga0496102_0117550 | Ga0496102_0117550_780_1874 | 364 |
| 1175 | 3300048910 | Ga0496107_0008995 | Ga0496107_0008995_2058_3152 | 364 |
| 1176 | 3300048913 | Ga0496110_0020911 | Ga0496110_0020911_2611_3705 | 364 |
| 1177 | 3300048914 | Ga0496111_0031351 | Ga0496111_0031351_210_1304 | 364 |
| 1178 | 3300048915 | Ga0496112_0016298 | Ga0496112_0016298_4528_5622 | 364 |
| 1179 | 3300048916 | Ga0496113_0032840 | Ga0496113_0032840_401_1495 | 364 |
| 1180 | 3300048918 | Ga0496115_0008771 | Ga0496115_0008771_731_1825 | 364 |
| 1181 | 3300048928 | Ga0496125_0119558 | Ga0496125_0119558_268_1362 | 364 |
| 1182 | 3300050514 | nmdc:mga08x19_210538_c1 | nmdc:mga08x19_210538_c1_70_1164 | 364 |
| 1183 | 3300050515 | nmdc:mga0a205_260176_c1 | nmdc:mga0a205_260176_c1_409_1503 | 364 |
| 1184 | 3300053078 | Ga0495612_0035278 | Ga0495612_0035278_133_1227 | 364 |
| 1185 | 3300053085 | Ga0495619_0000419 | Ga0495619_0000419_13746_14840 | 364 |
| 1186 | 2209111006 | 2214795217 | 2213822648 | 365 |
| 1187 | 3300000042 | ARSoilYngRDRAFT_c00890 | ARSoilYngRDRAFT_008902 | 365 |
| 1188 | 3300000044 | ARSoilOldRDRAFT_c001247 | ARSoilOldRDRAFT_0012472 | 365 |
| 1189 | 3300001904 | JGI24736J21556_1017616 | JGI24736J21556_10176161 | 365 |
| 1190 | 3300001978 | JGI24747J21853_1005660 | JGI24747J21853_10056601 | 365 |
| 1191 | 3300001989 | JGI24739J22299_10000203 | JGI24739J22299_100002032 | 365 |
| 1192 | 3300001990 | JGI24737J22298_10002225 | JGI24737J22298_100022256 | 365 |
| 1193 | 3300001990 | JGI24737J22298_10015628 | JGI24737J22298_100156282 | 365 |
| 1194 | 3300002070 | JGI24750J21931_1000206 | JGI24750J21931_10002067 | 365 |
| 1195 | 3300002073 | JGI24745J21846_1000036 | JGI24745J21846_10000363 | 365 |
| 1196 | 3300002074 | JGI24748J21848_1000461 | JGI24748J21848_10004612 | 365 |
| 1197 | 3300002076 | JGI24749J21850_1001705 | JGI24749J21850_10017053 | 365 |
| 1198 | 3300002077 | JGI24744J21845_10004108 | JGI24744J21845_100041082 | 365 |
| 1199 | 3300002239 | JGI24034J26672_10001100 | JGI24034J26672_100011002 | 365 |
| 1200 | 3300002244 | JGI24742J22300_10000210 | JGI24742J22300_100002103 | 365 |
| 1201 | 3300005290 | Ga0065712_10001033 | Ga0065712_100010336 | 365 |
| 1202 | 3300005293 | Ga0065715_10095332 | Ga0065715_100953321 | 365 |
| 1203 | 3300005295 | Ga0065707_10174941 | Ga0065707_101749411 | 365 |
| 1204 | 3300005328 | Ga0070676_10000499 | Ga0070676_1000049912 | 365 |
| 1205 | 3300005329 | Ga0070683_100000265 | Ga0070683_10000026515 | 365 |
| 1206 | 3300005330 | Ga0070690_100000718 | Ga0070690_1000007184 | 365 |
| 1207 | 3300005330 | Ga0070690_100044337 | Ga0070690_1000443372 | 365 |
| 1208 | 3300005331 | Ga0070670_100014626 | Ga0070670_1000146264 | 365 |
| 1209 | 3300005333 | Ga0070677_10001854 | Ga0070677_100018543 | 365 |
| 1210 | 3300005334 | Ga0068869_100000414 | Ga0068869_1000004141 | 365 |
| 1211 | 3300005335 | Ga0070666_10020803 | Ga0070666_100208031 | 365 |
| 1212 | 3300005336 | Ga0070680_100001359 | Ga0070680_1000013595 | 365 |
| 1213 | 3300005336 | Ga0070680_100046737 | Ga0070680_1000467371 | 365 |
| 1214 | 3300005337 | Ga0070682_100000745 | Ga0070682_10000074512 | 365 |
| 1215 | 3300005339 | Ga0070660_100000136 | Ga0070660_10000013633 | 365 |
| 1216 | 3300005339 | Ga0070660_100079857 | Ga0070660_1000798573 | 365 |
| 1217 | 3300005339 | Ga0070660_100278873 | Ga0070660_1002788732 | 365 |
| 1218 | 3300005340 | Ga0070689_100000722 | Ga0070689_10000072212 | 365 |
| 1219 | 3300005341 | Ga0070691_10000148 | Ga0070691_1000014812 | 365 |
| 1220 | 3300005343 | Ga0070687_100000080 | Ga0070687_10000008012 | 365 |
| 1221 | 3300005344 | Ga0070661_100000425 | Ga0070661_1000004256 | 365 |
| 1222 | 3300005344 | Ga0070661_100198478 | Ga0070661_1001984781 | 365 |
| 1223 | 3300005345 | Ga0070692_10000893 | Ga0070692_100008937 | 365 |
| 1224 | 3300005345 | Ga0070692_10028309 | Ga0070692_100283093 | 365 |
| 1225 | 3300005347 | Ga0070668_100005857 | Ga0070668_1000058572 | 365 |
| 1226 | 3300005353 | Ga0070669_100000276 | Ga0070669_10000027615 | 365 |
| 1227 | 3300005353 | Ga0070669_100002660 | Ga0070669_1000026607 | 365 |
| 1228 | 3300005354 | Ga0070675_100000271 | Ga0070675_10000027112 | 365 |
| 1229 | 3300005354 | Ga0070675_100008544 | Ga0070675_1000085446 | 365 |
| 1230 | 3300005355 | Ga0070671_100000389 | Ga0070671_10000038912 | 365 |
| 1231 | 3300005355 | Ga0070671_100012096 | Ga0070671_1000120962 | 365 |
| 1232 | 3300005356 | Ga0070674_100000928 | Ga0070674_10000092812 | 365 |
| 1233 | 3300005364 | Ga0070673_100001722 | Ga0070673_1000017226 | 365 |
| 1234 | 3300005364 | Ga0070673_100066996 | Ga0070673_1000669962 | 365 |
| 1235 | 3300005365 | Ga0070688_100001089 | Ga0070688_1000010891 | 365 |
| 1236 | 3300005366 | Ga0070659_100006384 | Ga0070659_1000063843 | 365 |
| 1237 | 3300005367 | Ga0070667_100001569 | Ga0070667_10000156912 | 365 |
| 1238 | 3300005367 | Ga0070667_100267272 | Ga0070667_1002672722 | 365 |
| 1239 | 3300005406 | Ga0070703_10049865 | Ga0070703_100498651 | 365 |
| 1240 | 3300005434 | Ga0070709_10106873 | Ga0070709_101068732 | 365 |
| 1241 | 3300005436 | Ga0070713_100017559 | Ga0070713_1000175593 | 365 |
| 1242 | 3300005437 | Ga0070710_10026128 | Ga0070710_100261282 | 365 |
| 1243 | 3300005438 | Ga0070701_10000457 | Ga0070701_100004576 | 365 |
| 1244 | 3300005438 | Ga0070701_10011127 | Ga0070701_100111271 | 365 |
| 1245 | 3300005439 | Ga0070711_100007229 | Ga0070711_1000072294 | 365 |
| 1246 | 3300005440 | Ga0070705_100000579 | Ga0070705_1000005797 | 365 |
| 1247 | 3300005440 | Ga0070705_100223072 | Ga0070705_1002230721 | 365 |
| 1248 | 3300005441 | Ga0070700_100000515 | Ga0070700_1000005156 | 365 |
| 1249 | 3300005441 | Ga0070700_100027405 | Ga0070700_1000274053 | 365 |
| 1250 | 3300005445 | Ga0070708_100027296 | Ga0070708_1000272964 | 365 |
| 1251 | 3300005455 | Ga0070663_100000580 | Ga0070663_10000058012 | 365 |
| 1252 | 3300005456 | Ga0070678_100000016 | Ga0070678_10000001614 | 365 |
| 1253 | 3300005456 | Ga0070678_100085764 | Ga0070678_1000857642 | 365 |
| 1254 | 3300005457 | Ga0070662_100001325 | Ga0070662_10000132512 | 365 |
| 1255 | 3300005457 | Ga0070662_100016017 | Ga0070662_1000160173 | 365 |
| 1256 | 3300005458 | Ga0070681_10001764 | Ga0070681_1000176412 | 365 |
| 1257 | 3300005466 | Ga0070685_10000344 | Ga0070685_1000034421 | 365 |
| 1258 | 3300005530 | Ga0070679_100001267 | Ga0070679_10000126712 | 365 |
| 1259 | 3300005535 | Ga0070684_100002476 | Ga0070684_10000247612 | 365 |
| 1260 | 3300005535 | Ga0070684_100052250 | Ga0070684_1000522502 | 365 |
| 1261 | 3300005536 | Ga0070697_100192620 | Ga0070697_1001926201 | 365 |
| 1262 | 3300005539 | Ga0068853_100001111 | Ga0068853_10000111113 | 365 |
| 1263 | 3300005543 | Ga0070672_100000233 | Ga0070672_10000023312 | 365 |
| 1264 | 3300005544 | Ga0070686_100000699 | Ga0070686_1000006996 | 365 |
| 1265 | 3300005544 | Ga0070686_100083472 | Ga0070686_1000834722 | 365 |
| 1266 | 3300005545 | Ga0070695_100020385 | Ga0070695_1000203853 | 365 |
| 1267 | 3300005546 | Ga0070696_100001198 | Ga0070696_1000011985 | 365 |
| 1268 | 3300005546 | Ga0070696_100123710 | Ga0070696_1001237102 | 365 |
| 1269 | 3300005547 | Ga0070693_100000594 | Ga0070693_1000005946 | 365 |
| 1270 | 3300005549 | Ga0070704_100000112 | Ga0070704_10000011215 | 365 |
| 1271 | 3300005549 | Ga0070704_100001736 | Ga0070704_1000017366 | 365 |
| 1272 | 3300005563 | Ga0068855_100007243 | Ga0068855_1000072436 | 365 |
| 1273 | 3300005564 | Ga0070664_100000924 | Ga0070664_1000009243 | 365 |
| 1274 | 3300005577 | Ga0068857_100000371 | Ga0068857_10000037124 | 365 |
| 1275 | 3300005577 | Ga0068857_100191881 | Ga0068857_1001918811 | 365 |
| 1276 | 3300005578 | Ga0068854_100000735 | Ga0068854_10000073512 | 365 |
| 1277 | 3300005578 | Ga0068854_100188736 | Ga0068854_1001887362 | 365 |
| 1278 | 3300005614 | Ga0068856_100000520 | Ga0068856_10000052036 | 365 |
| 1279 | 3300005614 | Ga0068856_100247755 | Ga0068856_1002477551 | 365 |
| 1280 | 3300005614 | Ga0068856_100349684 | Ga0068856_1003496842 | 365 |
| 1281 | 3300005616 | Ga0068852_100001599 | Ga0068852_1000015993 | 365 |
| 1282 | 3300005617 | Ga0068859_100010201 | Ga0068859_1000102013 | 365 |
| 1283 | 3300005617 | Ga0068859_100019554 | Ga0068859_1000195546 | 365 |
| 1284 | 3300005618 | Ga0068864_100000333 | Ga0068864_10000033331 | 365 |
| 1285 | 3300005718 | Ga0068866_10000143 | Ga0068866_100001432 | 365 |
| 1286 | 3300005719 | Ga0068861_100000417 | Ga0068861_10000041712 | 365 |
| 1287 | 3300005834 | Ga0068851_10048161 | Ga0068851_100481612 | 365 |
| 1288 | 3300005840 | Ga0068870_10000113 | Ga0068870_1000011312 | 365 |
| 1289 | 3300005842 | Ga0068858_100000975 | Ga0068858_10000097520 | 365 |
| 1290 | 3300005842 | Ga0068858_100335420 | Ga0068858_1003354202 | 365 |
| 1291 | 3300005843 | Ga0068860_100001740 | Ga0068860_1000017406 | 365 |
| 1292 | 3300005844 | Ga0068862_100001457 | Ga0068862_1000014573 | 365 |
| 1293 | 3300005844 | Ga0068862_100107636 | Ga0068862_1001076363 | 365 |
| 1294 | 3300005937 | Ga0081455_10000110 | Ga0081455_1000011040 | 365 |
| 1295 | 3300006237 | Ga0097621_100000203 | Ga0097621_1000002036 | 365 |
| 1296 | 3300006237 | Ga0097621_100043766 | Ga0097621_1000437662 | 365 |
| 1297 | 3300006358 | Ga0068871_100000575 | Ga0068871_1000005753 | 365 |
| 1298 | 3300006852 | Ga0075433_10005842 | Ga0075433_100058427 | 365 |
| 1299 | 3300006871 | Ga0075434_100010989 | Ga0075434_1000109893 | 365 |
| 1300 | 3300006881 | Ga0068865_100000654 | Ga0068865_10000065412 | 365 |
| 1301 | 3300006914 | Ga0075436_100157154 | Ga0075436_1001571542 | 365 |
| 1302 | 3300006931 | Ga0097620_100010201 | Ga0097620_1000102013 | 365 |
| 1303 | 3300006931 | Ga0097620_100019554 | Ga0097620_1000195541 | 365 |
| 1304 | 3300007076 | Ga0075435_100041943 | Ga0075435_1000419433 | 365 |
| 1305 | 3300009036 | Ga0105244_10022702 | Ga0105244_100227023 | 365 |
| 1306 | 3300009092 | Ga0105250_10005564 | Ga0105250_100055645 | 365 |
| 1307 | 3300009093 | Ga0105240_10092446 | Ga0105240_100924463 | 365 |
| 1308 | 3300009094 | Ga0111539_10000581 | Ga0111539_1000058112 | 365 |
| 1309 | 3300009094 | Ga0111539_10004022 | Ga0111539_1000402212 | 365 |
| 1310 | 3300009098 | Ga0105245_10000230 | Ga0105245_1000023035 | 365 |
| 1311 | 3300009101 | Ga0105247_10009917 | Ga0105247_100099171 | 365 |
| 1312 | 3300009101 | Ga0105247_10046471 | Ga0105247_100464712 | 365 |
| 1313 | 3300009148 | Ga0105243_10002755 | Ga0105243_100027556 | 365 |
| 1314 | 3300009148 | Ga0105243_10074452 | Ga0105243_100744521 | 365 |
| 1315 | 3300009174 | Ga0105241_10001308 | Ga0105241_100013086 | 365 |
| 1316 | 3300009176 | Ga0105242_10000696 | Ga0105242_1000069614 | 365 |
| 1317 | 3300009177 | Ga0105248_10001593 | Ga0105248_1000159318 | 365 |
| 1318 | 3300009177 | Ga0105248_10249219 | Ga0105248_102492192 | 365 |
| 1319 | 3300009545 | Ga0105237_10033806 | Ga0105237_100338063 | 365 |
| 1320 | 3300009545 | Ga0105237_10366031 | Ga0105237_103660311 | 365 |
| 1321 | 3300009553 | Ga0105249_10001642 | Ga0105249_1000164212 | 365 |
| 1322 | 3300009553 | Ga0105249_10081877 | Ga0105249_100818771 | 365 |
| 1323 | 3300010375 | Ga0105239_10009048 | Ga0105239_100090482 | 365 |
| 1324 | 3300010375 | Ga0105239_10478737 | Ga0105239_104787372 | 365 |
| 1325 | 3300011119 | Ga0105246_10000550 | Ga0105246_100005507 | 365 |
| 1326 | 3300012515 | Ga0157338_1004348 | Ga0157338_10043481 | 365 |
| 1327 | 3300013296 | Ga0157374_10016190 | Ga0157374_100161902 | 365 |
| 1328 | 3300013296 | Ga0157374_10044193 | Ga0157374_100441932 | 365 |
| 1329 | 3300013297 | Ga0157378_10000864 | Ga0157378_100008647 | 365 |
| 1330 | 3300013306 | Ga0163162_10000420 | Ga0163162_100004206 | 365 |
| 1331 | 3300013306 | Ga0163162_10016129 | Ga0163162_100161295 | 365 |
| 1332 | 3300013306 | Ga0163162_10059976 | Ga0163162_100599763 | 365 |
| 1333 | 3300013307 | Ga0157372_10024037 | Ga0157372_100240373 | 365 |
| 1334 | 3300013308 | Ga0157375_10001626 | Ga0157375_100016266 | 365 |
| 1335 | 3300013308 | Ga0157375_10061566 | Ga0157375_100615663 | 365 |
| 1336 | 3300014325 | Ga0163163_10003284 | Ga0163163_100032842 | 365 |
| 1337 | 3300014326 | Ga0157380_10000511 | Ga0157380_100005119 | 365 |
| 1338 | 3300014326 | Ga0157380_10535962 | Ga0157380_105359621 | 365 |
| 1339 | 3300014745 | Ga0157377_10000053 | Ga0157377_1000005356 | 365 |
| 1340 | 3300014968 | Ga0157379_10001333 | Ga0157379_1000133312 | 365 |
| 1341 | 3300014968 | Ga0157379_10016704 | Ga0157379_100167043 | 365 |
| 1342 | 3300014968 | Ga0157379_10024669 | Ga0157379_100246695 | 365 |
| 1343 | 3300014969 | Ga0157376_10000436 | Ga0157376_1000043611 | 365 |
| 1344 | 3300014969 | Ga0157376_10030676 | Ga0157376_100306764 | 365 |
| 1345 | 3300017792 | Ga0163161_10220368 | Ga0163161_102203682 | 365 |
| 1346 | 3300025271 | Ga0207666_1000014 | Ga0207666_10000141 | 365 |
| 1347 | 3300025290 | Ga0207673_1000965 | Ga0207673_10009653 | 365 |
| 1348 | 3300025315 | Ga0207697_10000672 | Ga0207697_100006727 | 365 |
| 1349 | 3300025885 | Ga0207653_10000963 | Ga0207653_100009637 | 365 |
| 1350 | 3300025893 | Ga0207682_10000154 | Ga0207682_1000015428 | 365 |
| 1351 | 3300025899 | Ga0207642_10002038 | Ga0207642_100020384 | 365 |
| 1352 | 3300025900 | Ga0207710_10001145 | Ga0207710_1000114510 | 365 |
| 1353 | 3300025901 | Ga0207688_10000817 | Ga0207688_100008172 | 365 |
| 1354 | 3300025901 | Ga0207688_10164507 | Ga0207688_101645072 | 365 |
| 1355 | 3300025903 | Ga0207680_10097468 | Ga0207680_100974682 | 365 |
| 1356 | 3300025904 | Ga0207647_10005421 | Ga0207647_100054213 | 365 |
| 1357 | 3300025907 | Ga0207645_10000182 | Ga0207645_1000018243 | 365 |
| 1358 | 3300025908 | Ga0207643_10000405 | Ga0207643_1000040514 | 365 |
| 1359 | 3300025911 | Ga0207654_10000889 | Ga0207654_1000088913 | 365 |
| 1360 | 3300025912 | Ga0207707_10001762 | Ga0207707_1000176213 | 365 |
| 1361 | 3300025912 | Ga0207707_10216332 | Ga0207707_102163322 | 365 |
| 1362 | 3300025916 | Ga0207663_10006811 | Ga0207663_100068114 | 365 |
| 1363 | 3300025916 | Ga0207663_10035357 | Ga0207663_100353572 | 365 |
| 1364 | 3300025917 | Ga0207660_10000007 | Ga0207660_1000000735 | 365 |
| 1365 | 3300025918 | Ga0207662_10000913 | Ga0207662_100009131 | 365 |
| 1366 | 3300025919 | Ga0207657_10005343 | Ga0207657_1000534312 | 365 |
| 1367 | 3300025919 | Ga0207657_10103850 | Ga0207657_101038501 | 365 |
| 1368 | 3300025920 | Ga0207649_10101153 | Ga0207649_101011532 | 365 |
| 1369 | 3300025921 | Ga0207652_10000459 | Ga0207652_1000045934 | 365 |
| 1370 | 3300025923 | Ga0207681_10000116 | Ga0207681_1000011667 | 365 |
| 1371 | 3300025925 | Ga0207650_10004276 | Ga0207650_100042763 | 365 |
| 1372 | 3300025926 | Ga0207659_10000015 | Ga0207659_10000015136 | 365 |
| 1373 | 3300025927 | Ga0207687_10000357 | Ga0207687_100003579 | 365 |
| 1374 | 3300025928 | Ga0207700_10016937 | Ga0207700_100169374 | 365 |
| 1375 | 3300025931 | Ga0207644_10000251 | Ga0207644_1000025132 | 365 |
| 1376 | 3300025932 | Ga0207690_10000320 | Ga0207690_1000032030 | 365 |
| 1377 | 3300025932 | Ga0207690_10027783 | Ga0207690_100277833 | 365 |
| 1378 | 3300025933 | Ga0207706_10002583 | Ga0207706_1000258312 | 365 |
| 1379 | 3300025933 | Ga0207706_10012590 | Ga0207706_100125905 | 365 |
| 1380 | 3300025934 | Ga0207686_10000234 | Ga0207686_1000023417 | 365 |
| 1381 | 3300025935 | Ga0207709_10000081 | Ga0207709_10000081123 | 365 |
| 1382 | 3300025935 | Ga0207709_10248527 | Ga0207709_102485272 | 365 |
| 1383 | 3300025936 | Ga0207670_10000620 | Ga0207670_100006206 | 365 |
| 1384 | 3300025936 | Ga0207670_10018819 | Ga0207670_100188192 | 365 |
| 1385 | 3300025937 | Ga0207669_10000008 | Ga0207669_1000000826 | 365 |
| 1386 | 3300025938 | Ga0207704_10002142 | Ga0207704_100021427 | 365 |
| 1387 | 3300025939 | Ga0207665_10113693 | Ga0207665_101136932 | 365 |
| 1388 | 3300025940 | Ga0207691_10002588 | Ga0207691_1000258810 | 365 |
| 1389 | 3300025941 | Ga0207711_10082864 | Ga0207711_100828641 | 365 |
| 1390 | 3300025942 | Ga0207689_10000749 | Ga0207689_1000074914 | 365 |
| 1391 | 3300025944 | Ga0207661_10000170 | Ga0207661_1000017034 | 365 |
| 1392 | 3300025945 | Ga0207679_10000046 | Ga0207679_1000004678 | 365 |
| 1393 | 3300025945 | Ga0207679_10250854 | Ga0207679_102508542 | 365 |
| 1394 | 3300025949 | Ga0207667_10010820 | Ga0207667_100108207 | 365 |
| 1395 | 3300025960 | Ga0207651_10000200 | Ga0207651_1000020016 | 365 |
| 1396 | 3300025960 | Ga0207651_10048302 | Ga0207651_100483022 | 365 |
| 1397 | 3300025961 | Ga0207712_10000555 | Ga0207712_100005551 | 365 |
| 1398 | 3300025972 | Ga0207668_10000133 | Ga0207668_1000013331 | 365 |
| 1399 | 3300025981 | Ga0207640_10000191 | Ga0207640_1000019135 | 365 |
| 1400 | 3300025986 | Ga0207658_10000535 | Ga0207658_1000053526 | 365 |
| 1401 | 3300025986 | Ga0207658_10059229 | Ga0207658_100592292 | 365 |
| 1402 | 3300025986 | Ga0207658_10107007 | Ga0207658_101070072 | 365 |
| 1403 | 3300026035 | Ga0207703_10003074 | Ga0207703_100030747 | 365 |
| 1404 | 3300026035 | Ga0207703_10445528 | Ga0207703_104455281 | 365 |
| 1405 | 3300026041 | Ga0207639_10079176 | Ga0207639_100791762 | 365 |
| 1406 | 3300026067 | Ga0207678_10001859 | Ga0207678_100018596 | 365 |
| 1407 | 3300026067 | Ga0207678_10042909 | Ga0207678_100429091 | 365 |
| 1408 | 3300026075 | Ga0207708_10002476 | Ga0207708_1000247612 | 365 |
| 1409 | 3300026075 | Ga0207708_10002480 | Ga0207708_1000248012 | 365 |
| 1410 | 3300026078 | Ga0207702_10003065 | Ga0207702_1000306512 | 365 |
| 1411 | 3300026078 | Ga0207702_10261845 | Ga0207702_102618452 | 365 |
| 1412 | 3300026088 | Ga0207641_10000593 | Ga0207641_1000059315 | 365 |
| 1413 | 3300026089 | Ga0207648_10002417 | Ga0207648_100024177 | 365 |
| 1414 | 3300026116 | Ga0207674_10003381 | Ga0207674_100033817 | 365 |
| 1415 | 3300026118 | Ga0207675_100002182 | Ga0207675_10000218212 | 365 |
| 1416 | 3300026118 | Ga0207675_100050415 | Ga0207675_1000504151 | 365 |
| 1417 | 3300026118 | Ga0207675_100322807 | Ga0207675_1003228072 | 365 |
| 1418 | 3300026121 | Ga0207683_10000002 | Ga0207683_10000002258 | 365 |
| 1419 | 3300026121 | Ga0207683_10026216 | Ga0207683_100262164 | 365 |
| 1420 | 3300026142 | Ga0207698_10000545 | Ga0207698_1000054512 | 365 |
| 1421 | 3300027614 | Ga0209970_1004629 | Ga0209970_10046292 | 365 |
| 1422 | 3300027695 | Ga0209966_1000800 | Ga0209966_10008003 | 365 |
| 1423 | 3300027717 | Ga0209998_10001951 | Ga0209998_100019514 | 365 |
| 1424 | 3300027717 | Ga0209998_10020008 | Ga0209998_100200082 | 365 |
| 1425 | 3300027876 | Ga0209974_10000944 | Ga0209974_100009446 | 365 |
| 1426 | 3300027907 | Ga0207428_10000011 | Ga0207428_1000001144 | 365 |
| 1427 | 3300027907 | Ga0207428_10000046 | Ga0207428_10000046137 | 365 |
| 1428 | 3300027907 | Ga0207428_10001276 | Ga0207428_1000127611 | 365 |
| 1429 | 3300028379 | Ga0268266_10013893 | Ga0268266_100138932 | 365 |
| 1430 | 3300028380 | Ga0268265_10011194 | Ga0268265_100111944 | 365 |
| 1431 | 3300028381 | Ga0268264_10000340 | Ga0268264_100003406 | 365 |
| 1432 | 3300028381 | Ga0268264_10013402 | Ga0268264_100134022 | 365 |
| 1433 | 3300031241 | Ga0265325_10000117 | Ga0265325_1000011739 | 365 |
| 1434 | 3300031595 | Ga0265313_10027782 | Ga0265313_100277822 | 365 |
| 1435 | 3300034816 | Ga0373930_0017182 | Ga0373930_0017182_117_1214 | 365 |
| 1436 | 3300034819 | Ga0373958_0000097 | Ga0373958_0000097_4873_5970 | 365 |
| 1437 | 3300034957 | Ga0373938_0000032 | Ga0373938_0000032_5784_6881 | 365 |
| 1438 | 3300035084 | Ga0373928_0000973 | Ga0373928_0000973_407_1504 | 365 |
| 1439 | 3300035085 | Ga0373929_0001646 | Ga0373929_0001646_268_1365 | 365 |
| 1440 | 3300035085 | Ga0373929_0001755 | Ga0373929_0001755_517_1614 | 365 |
| 1441 | 3300035090 | Ga0373949_0001084 | Ga0373949_0001084_2996_4093 | 365 |
| 1442 | 3300035090 | Ga0373949_0006126 | Ga0373949_0006126_229_1326 | 365 |
| 1443 | 3300035091 | Ga0373951_0000472 | Ga0373951_0000472_5534_6631 | 365 |
| 1444 | 3300035091 | Ga0373951_0002239 | Ga0373951_0002239_1679_2776 | 365 |
| 1445 | 3300035092 | Ga0373952_0000189 | Ga0373952_0000189_8489_9586 | 365 |
| 1446 | 3300035092 | Ga0373952_0000675 | Ga0373952_0000675_859_1956 | 365 |
| 1447 | 3300035112 | Ga0373932_0000180 | Ga0373932_0000180_5659_6756 | 365 |
| 1448 | 3300035114 | Ga0373939_0000151 | Ga0373939_0000151_12452_13549 | 365 |
| 1449 | 3300035115 | Ga0373941_0002963 | Ga0373941_0002963_195_1292 | 365 |
| 1450 | 3300035115 | Ga0373941_0003543 | Ga0373941_0003543_220_1317 | 365 |
| 1451 | 3300035117 | Ga0373953_0001859 | Ga0373953_0001859_2124_3221 | 365 |
| 1452 | 3300035117 | Ga0373953_0046289 | Ga0373953_0046289_145_1242 | 365 |
| 1453 | 3300035118 | Ga0373954_0032953 | Ga0373954_0032953_504_1601 | 365 |
| 1454 | 3300035118 | Ga0373954_0036104 | Ga0373954_0036104_96_1193 | 365 |
| 1455 | 3300035119 | Ga0373956_0052962 | Ga0373956_0052962_339_1436 | 365 |
| 1456 | 3300035120 | Ga0373957_0007096 | Ga0373957_0007096_1475_2572 | 365 |
| 1457 | 3300035120 | Ga0373957_0018824 | Ga0373957_0018824_973_2070 | 365 |
| 1458 | 3300035121 | Ga0373960_0000184 | Ga0373960_0000184_5725_6822 | 365 |
| 1459 | 3300035121 | Ga0373960_0003038 | Ga0373960_0003038_250_1347 | 365 |
| 1460 | 3300035172 | Ga0373955_0001906 | Ga0373955_0001906_545_1642 | 365 |
| 1461 | 3300035172 | Ga0373955_0008032 | Ga0373955_0008032_984_2081 | 365 |
| 1462 | 3300035241 | Ga0373961_0002408 | Ga0373961_0002408_2864_3961 | 365 |
| 1463 | 3300035242 | Ga0373962_0000113 | Ga0373962_0000113_10865_11962 | 365 |
| 1464 | 3300035242 | Ga0373962_0000251 | Ga0373962_0000251_60_1157 | 365 |
| 1465 | 3300035691 | Ga0373931_0000290 | Ga0373931_0000290_12340_13437 | 365 |
| 1466 | 3300035691 | Ga0373931_0009129 | Ga0373931_0009129_784_1881 | 365 |
| 1467 | 3300035724 | Ga0373933_0015628 | Ga0373933_0015628_1715_2812 | 365 |
| 1468 | 3300035724 | Ga0373933_0048000 | Ga0373933_0048000_1188_2285 | 365 |
| 1469 | 3300035725 | Ga0373947_0163306 | Ga0373947_0163306_90_1187 | 365 |
| 1470 | 3300036401 | Ga0373937_0031529 | Ga0373937_0031529_1419_2516 | 365 |
| 1471 | 3300036401 | Ga0373937_0062102 | Ga0373937_0062102_1635_2732 | 365 |
| 1472 | 3300042876 | Ga0451577_0351198 | Ga0451577_0351198_106_1203 | 365 |
| 1473 | 3300045051 | Ga0451576_0027624 | Ga0451576_0027624_666_1763 | 365 |
| 1474 | 3300046454 | Ga0495592_0001276 | Ga0495592_0001276_1872_2969 | 365 |
| 1475 | 3300046462 | Ga0495651_0001053 | Ga0495651_0001053_13180_14277 | 365 |
| 1476 | 3300046462 | Ga0495651_0099331 | Ga0495651_0099331_396_1493 | 365 |
| 1477 | 3300046463 | Ga0495653_0024422 | Ga0495653_0024422_3100_4197 | 365 |
| 1478 | 3300046491 | Ga0495584_0158528 | Ga0495584_0158528_37_1134 | 365 |
| 1479 | 3300046511 | Ga0495608_0015143 | Ga0495608_0015143_2699_3796 | 365 |
| 1480 | 3300046514 | Ga0495618_0014797 | Ga0495618_0014797_3406_4503 | 365 |
| 1481 | 3300046516 | Ga0495628_0003193 | Ga0495628_0003193_2856_3953 | 365 |
| 1482 | 3300046516 | Ga0495628_0020292 | Ga0495628_0020292_1056_2153 | 365 |
| 1483 | 3300046517 | Ga0495630_0043308 | Ga0495630_0043308_254_1351 | 365 |
| 1484 | 3300046529 | Ga0495652_0007926 | Ga0495652_0007926_1967_3064 | 365 |
| 1485 | 3300046535 | Ga0495586_0052937 | Ga0495586_0052937_334_1431 | 365 |
| 1486 | 3300046536 | Ga0495587_0004533 | Ga0495587_0004533_3511_4608 | 365 |
| 1487 | 3300046538 | Ga0495609_0059601 | Ga0495609_0059601_521_1618 | 365 |
| 1488 | 3300046543 | Ga0495645_0058959 | Ga0495645_0058959_1624_2721 | 365 |
| 1489 | 3300046559 | Ga0495667_0008100 | Ga0495667_0008100_526_1623 | 365 |
| 1490 | 3300046559 | Ga0495667_0066737 | Ga0495667_0066737_265_1362 | 365 |
| 1491 | 3300046663 | Ga0495635_0023313 | Ga0495635_0023313_2034_3131 | 365 |
| 1492 | 3300046675 | Ga0495657_0004137 | Ga0495657_0004137_9815_10912 | 365 |
| 1493 | 3300046675 | Ga0495657_0042723 | Ga0495657_0042723_214_1311 | 365 |
| 1494 | 3300046678 | Ga0495599_0001605 | Ga0495599_0001605_11561_12658 | 365 |
| 1495 | 3300046678 | Ga0495599_0021267 | Ga0495599_0021267_1704_2801 | 365 |
| 1496 | 3300046679 | Ga0495623_0039671 | Ga0495623_0039671_503_1600 | 365 |
| 1497 | 3300046680 | Ga0495646_0004146 | Ga0495646_0004146_2454_3551 | 365 |
| 1498 | 3300046809 | Ga0495600_0010128 | Ga0495600_0010128_462_1559 | 365 |
| 1499 | 3300046809 | Ga0495600_0063552 | Ga0495600_0063552_487_1584 | 365 |
| 1500 | 3300047317 | Ga0495604_0003926 | Ga0495604_0003926_1666_2763 | 365 |
| 1501 | 3300047317 | Ga0495604_0073948 | Ga0495604_0073948_300_1397 | 365 |
| 1502 | 3300047322 | Ga0495680_0014111 | Ga0495680_0014111_3705_4802 | 365 |
| 1503 | 3300047322 | Ga0495680_0050515 | Ga0495680_0050515_1968_3065 | 365 |
| 1504 | 3300047444 | Ga0495675_0005926 | Ga0495675_0005926_3707_4804 | 365 |
| 1505 | 3300047444 | Ga0495675_0074346 | Ga0495675_0074346_635_1732 | 365 |
| 1506 | 3300047471 | Ga0495684_0144381 | Ga0495684_0144381_423_1520 | 365 |
| 1507 | 3300048088 | Ga0495602_0010712 | Ga0495602_0010712_7752_8849 | 365 |
| 1508 | 3300048088 | Ga0495602_0029454 | Ga0495602_0029454_3234_4331 | 365 |
| 1509 | 3300048903 | Ga0496100_0000171 | Ga0496100_0000171_28191_29288 | 365 |
| 1510 | 3300048904 | Ga0496101_0000246 | Ga0496101_0000246_14023_15120 | 365 |
| 1511 | 3300048905 | Ga0496102_0003080 | Ga0496102_0003080_11423_12520 | 365 |
| 1512 | 3300048905 | Ga0496102_0091876 | Ga0496102_0091876_1613_2710 | 365 |
| 1513 | 3300048906 | Ga0496103_0000753 | Ga0496103_0000753_20943_22040 | 365 |
| 1514 | 3300048907 | Ga0496104_0000159 | Ga0496104_0000159_2725_3822 | 365 |
| 1515 | 3300048907 | Ga0496104_0059838 | Ga0496104_0059838_1047_2144 | 365 |
| 1516 | 3300048908 | Ga0496105_0000410 | Ga0496105_0000410_14261_15358 | 365 |
| 1517 | 3300048908 | Ga0496105_0048636 | Ga0496105_0048636_233_1363 | 365 |
| 1518 | 3300048909 | Ga0496106_0000183 | Ga0496106_0000183_23419_24516 | 365 |
| 1519 | 3300048909 | Ga0496106_0039718 | Ga0496106_0039718_126_1223 | 365 |
| 1520 | 3300048910 | Ga0496107_0001430 | Ga0496107_0001430_1968_3065 | 365 |
| 1521 | 3300048910 | Ga0496107_0042322 | Ga0496107_0042322_71_1168 | 365 |
| 1522 | 3300048911 | Ga0496108_0001856 | Ga0496108_0001856_13034_14131 | 365 |
| 1523 | 3300048912 | Ga0496109_0001350 | Ga0496109_0001350_18856_19953 | 365 |
| 1524 | 3300048912 | Ga0496109_0004165 | Ga0496109_0004165_2650_3747 | 365 |
| 1525 | 3300048913 | Ga0496110_0007624 | Ga0496110_0007624_6666_7763 | 365 |
| 1526 | 3300048914 | Ga0496111_0001815 | Ga0496111_0001815_9513_10610 | 365 |
| 1527 | 3300048915 | Ga0496112_0002096 | Ga0496112_0002096_13706_14803 | 365 |
| 1528 | 3300048915 | Ga0496112_0197523 | Ga0496112_0197523_21_1118 | 365 |
| 1529 | 3300048916 | Ga0496113_0005725 | Ga0496113_0005725_1533_2630 | 365 |
| 1530 | 3300048916 | Ga0496113_0017451 | Ga0496113_0017451_187_1284 | 365 |
| 1531 | 3300048917 | Ga0496114_0002224 | Ga0496114_0002224_2202_3299 | 365 |
| 1532 | 3300048918 | Ga0496115_0020141 | Ga0496115_0020141_338_1435 | 365 |
| 1533 | 3300048918 | Ga0496115_0026952 | Ga0496115_0026952_3106_4203 | 365 |
| 1534 | 3300049593 | Ga0501077_0169863 | Ga0501077_0169863_77_1174 | 365 |
| 1535 | 3300049741 | Ga0501079_0179105 | Ga0501079_0179105_291_1388 | 365 |
| 1536 | 3300050511 | nmdc:mga08y16_9096_c1 | nmdc:mga08y16_9096_c1_8819_9916 | 365 |
| 1537 | 3300050512 | nmdc:mga0n895_971_c1 | nmdc:mga0n895_971_c1_14342_15439 | 365 |
| 1538 | 3300050514 | nmdc:mga08x19_25741_c1 | nmdc:mga08x19_25741_c1_2475_3572 | 365 |
| 1539 | 3300050515 | nmdc:mga0a205_1026_c1 | nmdc:mga0a205_1026_c1_5253_6350 | 365 |
| 1540 | 3300053077 | Ga0495601_0002032 | Ga0495601_0002032_5536_6633 | 365 |
| 1541 | 3300053077 | Ga0495601_0058457 | Ga0495601_0058457_291_1388 | 365 |
| 1542 | 3300053078 | Ga0495612_0000616 | Ga0495612_0000616_10450_11547 | 365 |
| 1543 | 3300053084 | Ga0495595_0003032 | Ga0495595_0003032_3443_4540 | 365 |
| 1544 | 3300053085 | Ga0495619_0001606 | Ga0495619_0001606_10815_11912 | 365 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s2u-assembly1.cif.gz_A | crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex | 0.9008 | 8 | 362 |
| 3s2u-assembly1.cif.gz_A | crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex | 0.893 | 8 | 362 |
| 1nlm-assembly1.cif.gz_B | crystal structure of murg:glcnac complex | 0.8783 | 8 | 365 |
| 1nlm-assembly1.cif.gz_B | crystal structure of murg:glcnac complex | 0.8736 | 8 | 365 |
| 7d1i-assembly1.cif.gz_B-2 | crystal structure of acinetobacter baumannii murg | 0.8582 | 7 | 361 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYL5_1_178_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9086 | 7 | 170 | 3.40.50.2000 |
| af_K7L509_198_322_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8915 | 221 | 345 | 3.40.50.2000 |
| 3s2uA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8909 | 8 | 166 | 3.40.50.2000 |
| af_P17443_6_162_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8827 | 8 | 167 | 3.40.50.2000 |
| 3s2uA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8791 | 167 | 345 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431JB04-F1-model_v4 | deleted | 0.9893 | 217 | 362 |
|
| AF-A0A519JEV0-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9847 | 219 | 363 |
GO:0050511
|
| AF-A0A1G3IPJ4-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9818 | 107 | 362 |
GO:0050511
|
| AF-A0A435JI80-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.981 | 186 | 364 |
GO:0050511
|
| AF-A0A060BN88-F1-model_v4 | Glyco_tran_28_C | 0.9791 | 177 | 306 |
GO:0050511
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar