F494674

General Info

Members Datasets Scaffolds Average Seq Length
1544 1058 967 368

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0000180|Ga0500636_0000180_19997_21163
Length 388
Sequence MQAFLRSKNMNKGIVLLAAGGTGGHVFPAEALAYELKARGYAVHLVTDSRAERYAGTFPADEIHVVPSATIGSKNPIAVAKALLKLWKGLRAARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSLIHEQNAVMGRANKALAKRVKAIAGGFLPETQGDYAEKTVATGNPVRPAVLAAAEVAYTPSNAGEPFQLVVFGGSQGAQFFSGAVPAAICLMPNEMRARISVTQQARPEDKESVIASYKKLGVNADVSPFFGDMAERIAGSDLVISRSGASTVSELSVIGRPSVLVPYPHALDHDQAANAAALSAAGGASVIKQSELSPQKLSSLLSDAMNDPDRLAQTAAAAKATGKPDAAQRLADLVEAIATGQSVQHFKLKNKEGMHP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
20 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
31 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
32 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
33 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
34 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
35 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
36 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
37 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
38 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
39 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
40 2516143018 Ensifer sp. BR816 Isolate Nodule
41 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
42 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
43 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
44 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
45 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
46 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
47 2519899620 Rhizobium sp. Pop5 Isolate Nodule
48 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
49 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
50 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
51 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
52 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
53 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
54 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
55 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
58 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
59 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
60 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
61 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
62 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
63 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
64 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
65 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
66 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
67 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
68 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
69 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
70 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
71 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
72 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
73 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
74 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
75 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
76 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
77 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
78 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
79 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
80 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
81 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
82 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
83 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
84 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
85 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
86 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
87 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
88 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
89 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
90 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
91 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
92 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
93 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
94 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
95 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
96 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
97 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
98 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
99 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
100 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
101 2643221557 Ensifer sp. Root558 Isolate Unclassified
102 2643221558 Rhizobium sp. Root149 Isolate Unclassified
103 2643221568 Rhizobium sp. Root564 Isolate Unclassified
104 2643221582 Rhizobium sp. Root651 Isolate Unclassified
105 2643221599 Rhizobium sp. Root708 Isolate Unclassified
106 2643221607 Rhizobium sp. Root73 Isolate Unclassified
107 2643221610 Ensifer sp. Root74 Isolate Unclassified
108 2643221618 Ensifer sp. Root231 Isolate Unclassified
109 2643221626 Ensifer sp. Root31 Isolate Unclassified
110 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
111 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
112 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
113 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
114 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
115 2643221655 Ensifer sp. Root1252 Isolate Unclassified
116 2643221659 Ensifer sp. Root127 Isolate Unclassified
117 2643221668 Ensifer sp. Root423 Isolate Unclassified
118 2643221675 Ensifer sp. Root1298 Isolate Unclassified
119 2643221680 Ensifer sp. Root1312 Isolate Unclassified
120 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
121 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
122 2643221693 Rhizobium sp. Root491 Isolate Unclassified
123 2643221698 Ensifer sp. Root142 Isolate Unclassified
124 2643221712 Ensifer sp. Root258 Isolate Unclassified
125 2643221718 Rhizobium sp. Root268 Isolate Unclassified
126 2643221719 Rhizobium sp. Root274 Isolate Unclassified
127 2643221723 Ensifer sp. Root278 Isolate Unclassified
128 2643221726 Ensifer sp. Root954 Isolate Unclassified
129 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
130 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
131 2718217882 Rhizobium sp. N741 Isolate Nodule
132 2718217927 Rhizobium sp. N324 Isolate Nodule
133 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
134 2718218009 Rhizobium sp. N561 Isolate Nodule
135 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
136 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
137 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
138 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
139 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
140 2718218363 Rhizobium sp. N113 Isolate Nodule
141 2718218365 Rhizobium sp. N731 Isolate Nodule
142 2718218366 Rhizobium sp. N621 Isolate Nodule
143 2718218423 Rhizobium sp. N941 Isolate Nodule
144 2721755514 Rhizobium sp. N6212 Isolate Nodule
145 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
146 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
147 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
148 2721755809 Rhizobium sp. N541 Isolate Nodule
149 2721755810 Rhizobium sp. N871 Isolate Nodule
150 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
151 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
152 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
153 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
154 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
155 2728369365 Rhizobium sp. N1341 Isolate Nodule
156 2728369397 Rhizobium sp. N1314 Isolate Nodule
157 2738541293 Rhizobium sp. GV031 Isolate Unclassified
158 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
159 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
160 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
161 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
162 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
163 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
164 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
165 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
166 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
167 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
168 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
169 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
170 2791355256 Rhizobium sp. M10 Isolate Nodule
171 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
172 2791355260 Rhizobium sp. L9 Isolate Nodule
173 2791355261 Rhizobium sp. J15 Isolate Nodule
174 2791355262 Rhizobium sp. M1 Isolate Nodule
175 2791355263 Rhizobium chutanense C5 Isolate Nodule
176 2791355264 Rhizobium sp. S9 Isolate Nodule
177 2791355265 Rhizobium sp. H4 Isolate Nodule
178 2791355266 Rhizobium sp. L43 Isolate Nodule
179 2791355267 Rhizobium sp. L18 Isolate Nodule
180 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
181 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
182 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
183 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
184 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
185 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
186 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
187 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
188 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
189 2802429633 Rhizobium anhuiense J3 Isolate Nodule
190 2802429634 Rhizobium anhuiense S10 Isolate Nodule
191 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
192 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
193 2802429637 Rhizobium anhuiense C15 Isolate Nodule
194 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
195 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
196 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
197 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
198 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
199 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
200 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
201 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
202 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
203 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
204 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
205 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
206 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
207 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
208 2838048938 Rhizobium pisi 27/80 Isolate Nodule
209 2838061910 Rhizobium phaseoli L15 Isolate Nodule
210 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
211 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
212 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
213 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
214 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
215 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
216 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
217 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
218 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
219 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
220 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
221 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
222 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
223 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
224 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
225 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
226 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
227 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
228 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
229 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
230 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
231 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
232 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
233 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
234 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
235 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
236 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
237 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
238 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
239 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
240 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
241 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
242 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
243 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
244 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
245 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
246 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
247 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
248 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
249 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
250 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
251 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
252 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
253 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
254 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
255 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
256 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
257 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
258 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
259 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
260 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
261 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
262 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
263 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
264 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
265 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
266 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
267 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
268 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
269 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
270 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
271 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
272 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
273 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
274 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
275 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
276 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
277 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
278 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
279 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
280 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
281 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
282 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
283 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
284 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
285 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
286 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
287 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
288 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
289 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
290 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
291 2844163670 Ensifer sp. 1H6 Isolate Unclassified
292 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
293 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
294 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
295 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
296 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
297 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
298 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
299 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
300 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
301 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
302 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
303 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
304 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
305 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
306 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
307 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
308 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
309 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
310 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
311 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
312 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
313 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
314 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
315 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
316 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
317 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
318 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
319 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
320 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
321 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
322 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
323 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
324 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
325 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
326 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
327 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
328 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
329 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
330 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
331 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
332 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
333 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
334 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
335 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
336 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
337 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
338 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
339 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
340 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
341 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
342 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
343 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
344 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
345 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
346 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
347 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
348 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
349 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
350 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
351 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
352 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
353 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
354 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
355 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
356 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
357 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
358 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
359 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
360 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
361 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
362 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
363 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
364 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
365 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
366 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
367 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
368 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
369 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
370 2933599457 Rhizobium phaseoli M3 Isolate Nodule
371 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
372 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
373 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
374 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
375 2936381700 Rhizobium chutanense C16 Isolate Unclassified
376 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
377 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
378 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
379 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
380 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
381 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
382 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
383 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
384 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
385 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
386 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
387 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
388 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
389 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
390 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
391 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
392 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
393 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
394 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
395 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
396 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
397 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
398 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
399 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
400 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
401 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
402 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
403 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
404 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
405 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
406 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
407 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
408 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
409 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
410 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
411 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
412 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
413 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
414 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
415 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
416 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
417 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
418 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
419 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
420 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
421 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
422 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
423 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
424 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
425 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
426 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
427 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
428 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
429 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
430 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
431 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
432 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
433 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
434 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
435 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
436 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
437 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
438 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
439 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
440 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
441 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
442 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
443 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
444 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
445 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
446 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
447 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
448 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
449 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
450 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
451 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
452 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
453 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
454 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
455 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
456 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
457 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
458 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
459 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
460 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
461 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
462 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
463 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
464 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
465 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
466 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
467 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
468 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
469 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
470 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
471 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
472 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
473 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
474 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
475 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
476 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
477 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
478 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
479 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
480 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
481 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
482 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
483 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
484 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
485 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
486 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
487 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
488 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
489 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
490 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
491 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
492 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
493 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
494 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
495 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
496 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
497 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
498 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
499 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
500 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
501 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
502 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
503 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
504 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
505 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
506 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
507 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
508 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
509 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
510 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
511 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
512 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
513 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
514 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
515 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
516 2996887358 Rhizobium sp. R711 Isolate Nodule
517 2996893221 Rhizobium sp. R635 Isolate Nodule
518 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
519 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
520 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
521 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
522 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
523 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
524 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
525 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
526 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
527 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
528 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
529 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
530 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
531 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
532 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
533 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
534 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
535 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
536 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
537 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
538 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
539 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
540 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
541 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
542 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
543 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
544 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
545 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
546 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
547 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
548 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
549 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
550 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
551 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
552 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
553 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
554 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
555 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
556 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
557 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
558 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
559 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
560 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
561 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
562 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
563 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
564 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
565 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
566 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
567 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
568 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
569 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
570 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
571 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
572 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
573 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
574 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
575 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
576 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
577 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
578 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
579 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
580 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
581 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
582 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
583 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
584 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
585 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
586 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
587 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
588 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
589 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
590 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
591 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
592 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
593 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
594 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
595 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
596 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
597 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
598 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
599 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
600 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
601 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
602 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
603 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
604 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
605 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
606 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
607 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
608 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
609 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
610 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
611 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
612 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
613 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
614 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
615 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
616 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
617 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
618 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
619 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
620 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
621 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
622 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
623 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
624 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
625 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
626 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
627 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
628 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
629 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
630 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
631 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
632 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
633 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
634 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
635 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
636 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
637 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
638 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
639 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
640 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
641 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
642 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
643 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
644 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
645 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
646 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
647 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
648 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
649 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
650 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
651 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
652 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
653 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
654 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
655 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
656 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
657 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
658 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
659 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
660 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
661 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
662 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
663 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
664 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
665 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
666 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
667 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
668 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
669 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
670 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
671 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
672 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
673 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
674 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
675 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
676 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
677 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
678 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
679 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
680 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
681 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
682 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
683 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
684 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
685 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
686 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
687 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
688 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
689 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
690 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
691 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
692 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
693 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
694 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
695 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
696 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
697 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
698 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
699 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
700 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
701 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
702 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
703 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
704 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
705 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
706 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
707 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
708 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
709 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
710 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
711 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
712 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
713 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
714 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
715 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
716 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
717 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
718 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
719 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
720 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
721 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
722 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
723 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
724 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
725 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
726 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
727 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
728 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
729 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
730 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
731 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
732 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
733 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
734 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
735 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
736 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
737 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
738 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
739 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
740 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
741 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
742 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
743 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
744 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
745 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
746 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
747 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
748 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
749 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
750 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
751 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
752 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
753 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
754 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
762 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
764 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
765 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
766 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
767 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
768 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
769 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
770 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
771 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
772 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
773 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
774 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
775 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
776 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
777 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
778 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
779 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
780 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
781 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
782 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
783 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
784 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
785 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
786 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
787 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
788 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
789 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
790 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
791 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
792 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
793 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
794 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
795 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
796 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
797 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
798 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
799 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
800 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
801 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
802 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
803 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
804 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
805 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
806 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
807 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
808 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
809 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
810 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
811 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
812 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
813 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
814 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
815 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
816 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
817 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
818 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
819 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
820 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
821 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
822 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
823 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
824 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
825 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
826 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
827 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
828 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
829 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
830 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
831 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
832 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
833 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
834 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
835 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
836 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
837 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
838 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
839 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
840 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
841 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
842 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
843 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
844 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
845 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
846 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
847 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
848 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
849 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
850 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
851 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
852 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
853 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
854 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
855 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
856 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
857 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
858 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
859 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
860 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
861 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
862 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
863 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
864 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
865 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
866 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
867 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
868 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
869 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
870 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
871 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
872 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
873 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
874 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
875 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
876 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
877 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
878 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
879 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
880 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
881 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
882 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
883 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
884 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
885 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
886 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
887 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
888 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
889 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
890 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
891 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
892 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
893 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
894 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
895 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
896 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
897 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
898 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
899 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
900 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
901 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
902 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
903 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
904 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
905 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
906 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
907 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
908 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
909 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
910 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
911 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
912 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
913 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
914 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
915 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
916 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
917 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
918 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
919 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
920 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
921 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
922 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
923 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
924 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
925 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
926 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
927 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
928 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
929 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
930 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
931 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
932 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
933 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
934 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
935 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
936 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
937 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
938 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
939 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
940 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
941 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
942 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
943 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
944 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
945 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
946 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
947 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
948 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
949 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
950 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
951 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
952 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
953 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
954 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
955 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
956 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
957 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
958 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
959 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
960 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
961 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
962 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
963 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
964 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
965 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
966 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
967 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
968 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
969 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
970 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
971 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
972 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
973 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
974 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
975 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
976 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
977 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
978 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
979 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
980 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
981 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
982 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
983 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
984 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
985 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
986 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
987 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
988 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
989 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
990 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
991 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
992 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
993 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
994 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
995 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
996 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
997 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
998 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
999 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1000 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1001 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1002 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1003 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1004 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1005 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1006 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1007 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1008 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1009 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1010 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1011 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1012 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1013 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1014 8005258706 Rhizobium sp. R693 Isolate Nodule
1015 8005275841 Rhizobium sp. N4311 Isolate Nodule
1016 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1017 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1018 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1019 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1020 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1021 8005321885 Rhizobium sp. R72 Isolate Nodule
1022 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1023 8005382845 Rhizobium sp. R634 Isolate Nodule
1024 8005395548 Rhizobium sp. R339 Isolate Nodule
1025 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1026 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1027 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1028 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1029 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1030 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1031 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1032 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1033 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1034 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1035 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1036 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1037 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1038 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1039 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1040 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1041 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1042 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1043 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1044 8018176218 Rhizobium sp. N122 Isolate Nodule
1045 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1046 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1047 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1048 8024501048 Rhizobium sp. H4 Isolate Nodule
1049 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1050 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1051 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1052 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1053 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1054 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1055 8056382006 Rhizobium croatiense 13T Isolate Nodule
1056 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1057 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1058 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.56
Metatranscriptomes 0.06
Isolates 37.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 11.53
Nodule 28.17
Rhizoplane 3.43
Rhizosphere 43.98
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214795217 2209111006 Bacteria 2132
2 ARSoilYngRDRAFT_c00890 3300000042 Bacteria 2307
3 ARSoilOldRDRAFT_c001247 3300000044 Bacteria 2419
4 JGI24736J21556_1017616 3300001904 Bacteria 1133
5 JGI24747J21853_1005660 3300001978 Bacteria 1160
6 JGI24740J21852_10000015 3300001979 Bacteria 58951
7 JGI24739J22299_10000203 3300001989 Bacteria 19736
8 JGI24737J22298_10002225 3300001990 Bacteria 6917
9 JGI24737J22298_10015628 3300001990 Bacteria 2455
10 JGI24750J21931_1000206 3300002070 Bacteria 9983
11 JGI24745J21846_1000036 3300002073 Bacteria 9023
12 JGI24748J21848_1000461 3300002074 Bacteria 4506
13 JGI24749J21850_1001705 3300002076 Bacteria 3116
14 JGI24744J21845_10004108 3300002077 Bacteria 3003
15 JGI24034J26672_10001100 3300002239 Bacteria 3524
16 JGI24742J22300_10000210 3300002244 Bacteria 8662
17 JGI25155J39150_1000001 3300002704 Bacteria 354543
18 JGI25156J39149_1000001 3300002705 Bacteria 354557
19 JGI25162J39368_1000366 3300002737 Bacteria 38535
20 JGI25162J39368_1000368 3300002737 Bacteria 38495
21 JGI25154J39366_1000122 3300002738 Bacteria 61892
22 JGI25158J39367_1000038 3300002739 Bacteria 30017
23 JGI25157J39369_1000044 3300002741 Bacteria 122466
24 JGI25152J39213_1000636 3300002773 Bacteria 18557
25 JGI25152J39213_1001315 3300002773 Bacteria 11089
26 JGI25152J39213_1003453 3300002773 Bacteria 5394
27 JGI25150J39212_1000107 3300002774 Bacteria 48306
28 JGI25159J45721_1000014 3300002987 Bacteria 147809
29 JGI25159J45721_1000154 3300002987 Bacteria 32025
30 JGI25159J45721_1001072 3300002987 Bacteria 11688
31 JGI25151J46595_10000374 3300003187 Bacteria 46807
32 JGI25151J46595_10000839 3300003187 Bacteria 24488
33 JGI25151J46595_10005074 3300003187 Bacteria 6846
34 JGI25151J46595_10016744 3300003187 Bacteria 3198
35 JGI25151J46595_10021278 3300003187 Bacteria 2717
36 JGI25151J46595_10021451 3300003187 Bacteria 2702
37 JGI25151J46595_10031522 3300003187 Bacteria 2069
38 JGI25165J46597_1000516 3300003214 Bacteria 36635
39 JGI25165J46597_1001042 3300003214 Bacteria 18102
40 JGI25165J46597_1002493 3300003214 Bacteria 5839
41 JGI25153J46596_10000696 3300003215 Bacteria 20557
42 JGI25153J46596_10003837 3300003215 Bacteria 8280
43 JGI25153J46596_10010733 3300003215 Bacteria 4115
44 JGI25153J46596_10011201 3300003215 Bacteria 3983
45 rootH1_10118411 3300003316 Bacteria 1635
46 rootH2_10034283 3300003320 Bacteria 2689
47 rootL2_10006964 3300003322 Bacteria 8628
48 rootH1_10280226 3300003323 Bacteria 1360
49 JGI25160J50197_1000001 3300003354 Bacteria 782301
50 JGI25160J50197_1000020 3300003354 Bacteria 232739
51 JGI25160J50197_1012216 3300003354 Bacteria 2996
52 JGI25161J50226_1000001 3300003374 Bacteria 655036
53 JGI25161J50226_1000174 3300003374 Bacteria 43080
54 JGI25161J50226_1001510 3300003374 Bacteria 6891
55 Ga0006562J51391_1050564 3300003578 Bacteria 1866
56 Ga0055526_1000597 3300003771 Bacteria 28415
57 Ga0055526_1001490 3300003771 Bacteria 16607
58 Ga0055526_1003626 3300003771 Bacteria 9665
59 Ga0055526_1006767 3300003771 Bacteria 6128
60 Ga0055524_1001814 3300003775 Bacteria 11704
61 Ga0055524_1004279 3300003775 Bacteria 6626
62 Ga0055524_1004359 3300003775 Bacteria 6539
63 Ga0055536_1000497 3300003781 Bacteria 27238
64 Ga0055536_1005415 3300003781 Bacteria 6250
65 Ga0055528_1002181 3300003790 Bacteria 10723
66 Ga0055528_1005558 3300003790 Bacteria 5838
67 Ga0055528_1011408 3300003790 Bacteria 3531
68 Ga0055528_1014643 3300003790 Bacteria 2886
69 Ga0055528_1015571 3300003790 Bacteria 2739
70 Ga0055530_10008497 3300003791 Bacteria 4101
71 Ga0055540_1000929 3300003792 Bacteria 19079
72 Ga0055540_1003312 3300003792 Bacteria 7857
73 Ga0055540_1019170 3300003792 Bacteria 1851
74 Ga0055531_10002881 3300003794 Bacteria 11207
75 Ga0055531_10008844 3300003794 Bacteria 5236
76 Ga0058692_1004850 3300003856 Bacteria 3912
77 JGI25405J52794_10004407 3300003911 Bacteria 2514
78 Ga0055543_1000003 3300004625 Bacteria 358656
79 Ga0055543_1000047 3300004625 Bacteria 111073
80 Ga0055543_1000350 3300004625 Bacteria 31311
81 Ga0055543_1000500 3300004625 Bacteria 22620
82 Ga0065165_1000013 3300005262 Bacteria 301887
83 Ga0065165_1000068 3300005262 Bacteria 170609
84 Ga0065165_1008935 3300005262 Bacteria 4591
85 Ga0065165_1011468 3300005262 Bacteria 3693
86 Ga0065165_1012221 3300005262 Bacteria 3512
87 Ga0065712_10001033 3300005290 Bacteria 10330
88 Ga0065715_10095332 3300005293 Bacteria 4107
89 Ga0065707_10174941 3300005295 Bacteria 1450
90 Ga0070676_10000499 3300005328 Bacteria 18707
91 Ga0070676_10032562 3300005328 Bacteria 2987
92 Ga0070683_100000265 3300005329 Bacteria 36059
93 Ga0070690_100000718 3300005330 Bacteria 16997
94 Ga0070690_100031150 3300005330 Bacteria 3320
95 Ga0070690_100044337 3300005330 Bacteria 2822
96 Ga0070670_100014626 3300005331 Bacteria 6737
97 Ga0070677_10001854 3300005333 Bacteria 6684
98 Ga0068869_100000414 3300005334 Bacteria 23258
99 Ga0068869_100056304 3300005334 Bacteria 2867
100 Ga0070666_10018983 3300005335 Bacteria 4431
101 Ga0070666_10020803 3300005335 Bacteria 4245
102 Ga0070680_100001359 3300005336 Bacteria 17686
103 Ga0070680_100046737 3300005336 Bacteria 3522
104 Ga0070682_100000745 3300005337 Bacteria 19431
105 Ga0070682_100074471 3300005337 Bacteria 2180
106 Ga0070660_100000136 3300005339 Bacteria 46892
107 Ga0070660_100043329 3300005339 Bacteria 3439
108 Ga0070660_100079857 3300005339 Bacteria 2566
109 Ga0070660_100278873 3300005339 Bacteria 1367
110 Ga0070689_100000722 3300005340 Bacteria 20157
111 Ga0070689_100037552 3300005340 Bacteria 3703
112 Ga0070691_10000148 3300005341 Bacteria 22373
113 Ga0070687_100000080 3300005343 Bacteria 31259
114 Ga0070687_100020607 3300005343 Bacteria 3086
115 Ga0070661_100000425 3300005344 Bacteria 32302
116 Ga0070661_100083856 3300005344 Bacteria 2354
117 Ga0070661_100198478 3300005344 Bacteria 1532
118 Ga0070692_10000893 3300005345 Bacteria 10102
119 Ga0070692_10028309 3300005345 Bacteria 2784
120 Ga0070668_100005857 3300005347 Bacteria 9111
121 Ga0070668_100052956 3300005347 Bacteria 3130
122 Ga0070669_100000276 3300005353 Bacteria 41366
123 Ga0070669_100002660 3300005353 Bacteria 12871
124 Ga0070675_100000271 3300005354 Bacteria 34156
125 Ga0070675_100008544 3300005354 Bacteria 7949
126 Ga0070671_100000389 3300005355 Bacteria 30190
127 Ga0070671_100012096 3300005355 Bacteria 6944
128 Ga0070671_100023087 3300005355 Bacteria 5085
129 Ga0070671_100263322 3300005355 Bacteria 1465
130 Ga0070674_100000928 3300005356 Bacteria 15290
131 Ga0070673_100001722 3300005364 Bacteria 13004
132 Ga0070673_100008972 3300005364 Bacteria 6688
133 Ga0070673_100066996 3300005364 Bacteria 2870
134 Ga0070688_100001089 3300005365 Bacteria 13567
135 Ga0070688_100023145 3300005365 Bacteria 3650
136 Ga0070659_100006384 3300005366 Bacteria 8513
137 Ga0070659_100023831 3300005366 Bacteria 4687
138 Ga0070667_100001569 3300005367 Bacteria 20471
139 Ga0070667_100073818 3300005367 Bacteria 2909
140 Ga0070667_100096801 3300005367 Bacteria 2545
141 Ga0070667_100267272 3300005367 Bacteria 1533
142 Ga0070703_10049865 3300005406 Bacteria 1334
143 Ga0070709_10009235 3300005434 Bacteria 5429
144 Ga0070709_10106873 3300005434 Bacteria 1874
145 Ga0070714_100013931 3300005435 Bacteria 6452
146 Ga0070714_100058991 3300005435 Bacteria 3290
147 Ga0070714_100208040 3300005435 Bacteria 1792
148 Ga0070713_100002582 3300005436 Bacteria 11845
149 Ga0070713_100017559 3300005436 Bacteria 5414
150 Ga0070710_10002708 3300005437 Bacteria 8421
151 Ga0070710_10026128 3300005437 Bacteria 3099
152 Ga0070701_10000457 3300005438 Bacteria 13932
153 Ga0070701_10011127 3300005438 Bacteria 4007
154 Ga0070711_100007229 3300005439 Bacteria 6746
155 Ga0070711_100086466 3300005439 Bacteria 2248
156 Ga0070705_100000579 3300005440 Bacteria 21266
157 Ga0070705_100223072 3300005440 Bacteria 1306
158 Ga0070700_100000515 3300005441 Bacteria 19292
159 Ga0070700_100027405 3300005441 Bacteria 3377
160 Ga0070708_100027296 3300005445 Bacteria 4897
161 Ga0070663_100000580 3300005455 Bacteria 19553
162 Ga0070678_100000016 3300005456 Bacteria 53269
163 Ga0070678_100008371 3300005456 Bacteria 6195
164 Ga0070678_100085764 3300005456 Bacteria 2400
165 Ga0070662_100001325 3300005457 Bacteria 15215
166 Ga0070662_100016017 3300005457 Bacteria 5030
167 Ga0070681_10001764 3300005458 Bacteria 19392
168 Ga0070681_10025407 3300005458 Bacteria 5957
169 Ga0070685_10000344 3300005466 Bacteria 28550
170 Ga0070685_10013452 3300005466 Bacteria 4316
171 Ga0070679_100001267 3300005530 Bacteria 22298
172 Ga0070684_100002476 3300005535 Bacteria 13600
173 Ga0070684_100052250 3300005535 Bacteria 3553
174 Ga0070697_100192620 3300005536 Bacteria 1731
175 Ga0068853_100001111 3300005539 Bacteria 19042
176 Ga0070672_100000233 3300005543 Bacteria 31143
177 Ga0070686_100000699 3300005544 Bacteria 19478
178 Ga0070686_100083472 3300005544 Bacteria 2121
179 Ga0070695_100020385 3300005545 Bacteria 4048
180 Ga0070696_100001198 3300005546 Bacteria 16816
181 Ga0070696_100123710 3300005546 Bacteria 1875
182 Ga0070693_100000594 3300005547 Bacteria 16031
183 Ga0070693_100017810 3300005547 Bacteria 3700
184 Ga0070693_100039225 3300005547 Bacteria 2652
185 Ga0070665_100053711 3300005548 Bacteria 4040
186 Ga0070665_100123540 3300005548 Bacteria 2591
187 Ga0070704_100000112 3300005549 Bacteria 28583
188 Ga0070704_100001736 3300005549 Bacteria 11901
189 Ga0068855_100007243 3300005563 Bacteria 13453
190 Ga0068855_100039045 3300005563 Bacteria 5637
191 Ga0068855_100059286 3300005563 Bacteria 4479
192 Ga0070664_100000924 3300005564 Bacteria 22943
193 Ga0068857_100000371 3300005577 Bacteria 31431
194 Ga0068857_100191881 3300005577 Bacteria 1861
195 Ga0068854_100000735 3300005578 Bacteria 19431
196 Ga0068854_100188736 3300005578 Bacteria 1614
197 Ga0068856_100000520 3300005614 Bacteria 42483
198 Ga0068856_100133294 3300005614 Bacteria 2489
199 Ga0068856_100138533 3300005614 Bacteria 2440
200 Ga0068856_100247755 3300005614 Bacteria 1797
201 Ga0068856_100349684 3300005614 Bacteria 1497
202 Ga0070702_100009804 3300005615 Bacteria 4700
203 Ga0068852_100001599 3300005616 Bacteria 15407
204 Ga0068859_100010201 3300005617 Bacteria 9455
205 Ga0068859_100019554 3300005617 Bacteria 6804
206 Ga0068864_100000333 3300005618 Bacteria 41669
207 Ga0068866_10000143 3300005718 Bacteria 32232
208 Ga0068861_100000417 3300005719 Bacteria 24695
209 Ga0068851_10048161 3300005834 Bacteria 2160
210 Ga0068870_10000113 3300005840 Bacteria 27642
211 Ga0068858_100000975 3300005842 Bacteria 29622
212 Ga0068858_100099299 3300005842 Bacteria 2714
213 Ga0068858_100335420 3300005842 Bacteria 1447
214 Ga0068860_100001740 3300005843 Bacteria 23200
215 Ga0068860_100033225 3300005843 Bacteria 4952
216 Ga0068862_100001457 3300005844 Bacteria 21772
217 Ga0068862_100107636 3300005844 Bacteria 2444
218 Ga0081455_10000110 3300005937 Bacteria 92459
219 Ga0070717_10002936 3300006028 Bacteria 12106
220 Ga0075365_10004585 3300006038 Bacteria 7349
221 Ga0075368_10003767 3300006042 Bacteria 5094
222 Ga0075363_100080114 3300006048 Bacteria 1785
223 Ga0075363_100095574 3300006048 Bacteria 1639
224 Ga0070715_10001339 3300006163 Bacteria 7099
225 Ga0070716_100004734 3300006173 Bacteria 6527
226 Ga0075362_10015506 3300006177 Bacteria 3101
227 Ga0075367_10009312 3300006178 Bacteria 5129
228 Ga0097621_100000203 3300006237 Bacteria 38745
229 Ga0097621_100017219 3300006237 Bacteria 5484
230 Ga0097621_100043766 3300006237 Bacteria 3610
231 Ga0075370_10091011 3300006353 Bacteria 1759
232 Ga0068871_100000575 3300006358 Bacteria 25171
233 Ga0068871_100028379 3300006358 Bacteria 4386
234 Ga0075433_10005842 3300006852 Bacteria 9692
235 Ga0075434_100010989 3300006871 Bacteria 8515
236 Ga0068865_100000654 3300006881 Bacteria 19602
237 Ga0068865_100020024 3300006881 Bacteria 4337
238 Ga0075436_100157154 3300006914 Bacteria 1602
239 Ga0097620_100010201 3300006931 Bacteria 9455
240 Ga0097620_100019554 3300006931 Bacteria 6804
241 Ga0079104_1000193 3300006946 Bacteria 85489
242 Ga0079104_1001253 3300006946 Bacteria 17716
243 Ga0099826_10001254 3300006948 Bacteria 14871
244 Ga0099826_10039284 3300006948 Bacteria 3312
245 Ga0075435_100041943 3300007076 Bacteria 3659
246 Ga0105251_10029607 3300009011 Bacteria 2757
247 Ga0105244_10022702 3300009036 Bacteria 3450
248 Ga0105250_10005564 3300009092 Bacteria 5634
249 Ga0105250_10057240 3300009092 Bacteria 1565
250 Ga0105240_10000076 3300009093 Bacteria 198848
251 Ga0105240_10092446 3300009093 Bacteria 3694
252 Ga0105240_10352941 3300009093 Bacteria 1668
253 Ga0111539_10000581 3300009094 Bacteria 47068
254 Ga0111539_10004022 3300009094 Bacteria 19301
255 Ga0111539_10432145 3300009094 Bacteria 1533
256 Ga0105245_10000230 3300009098 Bacteria 53225
257 Ga0105247_10009917 3300009101 Bacteria 5769
258 Ga0105247_10046471 3300009101 Bacteria 2665
259 Ga0105247_10096517 3300009101 Bacteria 1884
260 Ga0105243_10002755 3300009148 Bacteria 14611
261 Ga0105243_10074452 3300009148 Bacteria 2754
262 Ga0105243_10215381 3300009148 Bacteria 1694
263 Ga0105241_10001308 3300009174 Bacteria 18957
264 Ga0105241_10009439 3300009174 Bacteria 7164
265 Ga0105242_10000696 3300009176 Bacteria 26370
266 Ga0105242_10012804 3300009176 Bacteria 6461
267 Ga0105248_10001593 3300009177 Bacteria 25250
268 Ga0105248_10031210 3300009177 Bacteria 5955
269 Ga0105248_10043884 3300009177 Bacteria 5015
270 Ga0105248_10249219 3300009177 Bacteria 1999
271 Ga0105237_10000226 3300009545 Bacteria 79798
272 Ga0105237_10011347 3300009545 Bacteria 9428
273 Ga0105237_10033806 3300009545 Bacteria 5180
274 Ga0105237_10366031 3300009545 Bacteria 1446
275 Ga0105249_10001642 3300009553 Bacteria 19605
276 Ga0105249_10081877 3300009553 Bacteria 3002
277 Ga0123341_1000007 3300009765 Bacteria 147072
278 Ga0123342_1004784 3300009766 Bacteria 20320
279 Ga0123342_1022907 3300009766 Bacteria 4145
280 Ga0105239_10000641 3300010375 Bacteria 49765
281 Ga0105239_10009048 3300010375 Bacteria 11275
282 Ga0105239_10478737 3300010375 Bacteria 1414
283 Ga0105246_10000550 3300011119 Bacteria 20662
284 Ga0157342_1000277 3300012507 Bacteria 2870
285 Ga0157338_1004348 3300012515 Bacteria 1221
286 Ga0157373_10090682 3300013100 Bacteria 2153
287 Ga0157371_10000017 3300013102 Bacteria 320830
288 Ga0157371_10004510 3300013102 Bacteria 12131
289 Ga0157370_10000455 3300013104 Bacteria 51231
290 Ga0157370_10000461 3300013104 Bacteria 50850
291 Ga0157369_10043175 3300013105 Bacteria 4915
292 Ga0157369_10191156 3300013105 Bacteria 2151
293 Ga0157369_10354095 3300013105 Bacteria 1524
294 Ga0157369_10436414 3300013105 Bacteria 1357
295 Ga0171463_1003 3300013249 Bacteria 695693
296 Ga0157374_10016190 3300013296 Bacteria 6551
297 Ga0157374_10044193 3300013296 Bacteria 4118
298 Ga0157374_10116632 3300013296 Bacteria 2573
299 Ga0157378_10000864 3300013297 Bacteria 28028
300 Ga0163162_10000420 3300013306 Bacteria 39042
301 Ga0163162_10016129 3300013306 Bacteria 7303
302 Ga0163162_10059976 3300013306 Bacteria 3838
303 Ga0157372_10024037 3300013307 Bacteria 6611
304 Ga0157375_10001626 3300013308 Bacteria 19334
305 Ga0157375_10039652 3300013308 Bacteria 4535
306 Ga0157375_10061566 3300013308 Bacteria 3727
307 Ga0163163_10003284 3300014325 Bacteria 13715
308 Ga0157380_10000511 3300014326 Bacteria 23725
309 Ga0157380_10535962 3300014326 Bacteria 1145
310 Ga0157377_10000053 3300014745 Bacteria 89091
311 Ga0157379_10001333 3300014968 Bacteria 20150
312 Ga0157379_10016704 3300014968 Bacteria 6457
313 Ga0157379_10024669 3300014968 Bacteria 5337
314 Ga0157376_10000436 3300014969 Bacteria 26857
315 Ga0157376_10030676 3300014969 Bacteria 4296
316 Ga0182007_10001815 3300015262 Bacteria 11146
317 Ga0182005_1005015 3300015265 Bacteria 4184
318 Ga0183363_1025 3300015690 Bacteria 53844
319 Ga0163161_10023487 3300017792 Bacteria 4350
320 Ga0163161_10220368 3300017792 Bacteria 1469
321 Ga0214544_1001800 3300021320 Bacteria 45046
322 Ga0214542_1000012 3300021321 Bacteria 235800
323 Ga0214543_1000024 3300021327 Bacteria 235745
324 Ga0214543_1000038 3300021327 Bacteria 182106
325 Ga0213873_10002489 3300021358 Bacteria 3190
326 Ga0228711_1000008 3300022739 Bacteria 169893
327 Ga0228710_1000009 3300022740 Bacteria 169770
328 Ga0209435_100012 3300025206 Bacteria 401621
329 Ga0209436_100150 3300025208 Bacteria 33510
330 Ga0209437_100051 3300025233 Bacteria 392523
331 Ga0209437_100098 3300025233 Bacteria 229766
332 Ga0207425_1000075 3300025245 Bacteria 107452
333 Ga0207425_1001337 3300025245 Bacteria 10584
334 Ga0207425_1004121 3300025245 Bacteria 4441
335 Ga0209646_1000026 3300025246 Bacteria 401621
336 Ga0209646_1001199 3300025246 Bacteria 7491
337 Ga0209026_1000014 3300025250 Bacteria 401621
338 Ga0209759_1000012 3300025256 Bacteria 401621
339 Ga0209129_1000156 3300025258 Bacteria 107484
340 Ga0209129_1000524 3300025258 Bacteria 26835
341 Ga0209129_1001868 3300025258 Bacteria 11120
342 Ga0209129_1002344 3300025258 Bacteria 9373
343 Ga0209129_1004509 3300025258 Bacteria 5399
344 Ga0209233_1000095 3300025261 Bacteria 303783
345 Ga0209233_1000113 3300025261 Bacteria 253455
346 Ga0209233_1000427 3300025261 Bacteria 30799
347 Ga0207666_1000014 3300025271 Bacteria 41355
348 Ga0209673_1000010 3300025273 Bacteria 596656
349 Ga0209673_1000117 3300025273 Bacteria 172081
350 Ga0209673_1000151 3300025273 Bacteria 148103
351 Ga0209673_1000863 3300025273 Bacteria 39346
352 Ga0209673_1001685 3300025273 Bacteria 18869
353 Ga0209673_1002134 3300025273 Bacteria 14747
354 Ga0209130_1000003 3300025284 Bacteria 677988
355 Ga0209130_1000020 3300025284 Bacteria 379297
356 Ga0209130_1000034 3300025284 Bacteria 302439
357 Ga0209130_1013282 3300025284 Bacteria 2115
358 Ga0207673_1000965 3300025290 Bacteria 3095
359 Ga0209675_1011031 3300025291 Bacteria 3030
360 Ga0209676_1000482 3300025292 Bacteria 65372
361 Ga0209676_1011056 3300025292 Bacteria 3686
362 Ga0209676_1031573 3300025292 Bacteria 1603
363 Ga0209676_1041343 3300025292 Bacteria 1289
364 Ga0209025_1000070 3300025294 Bacteria 287776
365 Ga0209025_1000140 3300025294 Bacteria 184765
366 Ga0209025_1000314 3300025294 Bacteria 107720
367 Ga0209025_1000506 3300025294 Bacteria 74798
368 Ga0209025_1001869 3300025294 Bacteria 24674
369 Ga0209025_1003183 3300025294 Bacteria 15930
370 Ga0209025_1005402 3300025294 Bacteria 10443
371 Ga0209025_1014241 3300025294 Bacteria 4916
372 Ga0209025_1028383 3300025294 Bacteria 2744
373 Ga0209025_1035161 3300025294 Bacteria 2269
374 Ga0209564_1000013 3300025295 Bacteria 775755
375 Ga0209564_1000647 3300025295 Bacteria 52658
376 Ga0209564_1001780 3300025295 Bacteria 19956
377 Ga0209564_1001993 3300025295 Bacteria 17874
378 Ga0209564_1009159 3300025295 Bacteria 4759
379 Ga0209758_1000413 3300025297 Bacteria 72744
380 Ga0209758_1000655 3300025297 Bacteria 52188
381 Ga0209758_1000758 3300025297 Bacteria 46817
382 Ga0209758_1001882 3300025297 Bacteria 22974
383 Ga0209758_1002154 3300025297 Bacteria 20718
384 Ga0209758_1003547 3300025297 Bacteria 14035
385 Ga0209758_1025944 3300025297 Bacteria 2555
386 Ga0209050_1000646 3300025298 Bacteria 54050
387 Ga0209050_1004392 3300025298 Bacteria 9564
388 Ga0209256_1001653 3300025299 Bacteria 21690
389 Ga0209256_1001736 3300025299 Bacteria 20844
390 Ga0209256_1002712 3300025299 Bacteria 13781
391 Ga0209256_1003882 3300025299 Bacteria 9914
392 Ga0209256_1004803 3300025299 Bacteria 8202
393 Ga0207426_1000006 3300025302 Bacteria 1025969
394 Ga0207426_1000008 3300025302 Bacteria 848730
395 Ga0207426_1000011 3300025302 Bacteria 791203
396 Ga0207426_1000221 3300025302 Bacteria 134756
397 Ga0207426_1000869 3300025302 Bacteria 31530
398 Ga0209051_1000097 3300025303 Bacteria 167378
399 Ga0209051_1000314 3300025303 Bacteria 74316
400 Ga0209051_1002962 3300025303 Bacteria 11565
401 Ga0209051_1004880 3300025303 Bacteria 8039
402 Ga0209051_1006481 3300025303 Bacteria 6589
403 Ga0209051_1008689 3300025303 Bacteria 5347
404 Ga0209257_1001142 3300025304 Bacteria 33931
405 Ga0209257_1002070 3300025304 Bacteria 21158
406 Ga0209257_1008609 3300025304 Bacteria 5734
407 Ga0207697_10000672 3300025315 Bacteria 19436
408 Ga0207653_10000963 3300025885 Bacteria 9488
409 Ga0207682_10000154 3300025893 Bacteria 31265
410 Ga0207692_10003318 3300025898 Bacteria 6272
411 Ga0207642_10002038 3300025899 Bacteria 6231
412 Ga0207710_10001145 3300025900 Bacteria 13506
413 Ga0207688_10000817 3300025901 Bacteria 15595
414 Ga0207688_10023234 3300025901 Bacteria 3394
415 Ga0207688_10164507 3300025901 Bacteria 1317
416 Ga0207680_10014997 3300025903 Bacteria 4033
417 Ga0207680_10097468 3300025903 Bacteria 1883
418 Ga0207647_10005421 3300025904 Bacteria 9350
419 Ga0207685_10013233 3300025905 Bacteria 2546
420 Ga0207699_10004930 3300025906 Bacteria 6389
421 Ga0207699_10099236 3300025906 Bacteria 1844
422 Ga0207645_10000182 3300025907 Bacteria 50129
423 Ga0207643_10000405 3300025908 Bacteria 28698
424 Ga0207654_10000889 3300025911 Bacteria 16573
425 Ga0207654_10045739 3300025911 Bacteria 2493
426 Ga0207707_10001762 3300025912 Bacteria 19871
427 Ga0207707_10088960 3300025912 Bacteria 2698
428 Ga0207707_10216332 3300025912 Bacteria 1668
429 Ga0207695_10000011 3300025913 Bacteria 910221
430 Ga0207671_10000093 3300025914 Bacteria 138939
431 Ga0207693_10000842 3300025915 Bacteria 27312
432 Ga0207693_10007487 3300025915 Bacteria 8977
433 Ga0207693_10013345 3300025915 Bacteria 6623
434 Ga0207663_10006811 3300025916 Bacteria 5884
435 Ga0207663_10035357 3300025916 Bacteria 2996
436 Ga0207660_10000007 3300025917 Bacteria 102878
437 Ga0207662_10000913 3300025918 Bacteria 13677
438 Ga0207657_10005343 3300025919 Bacteria 13456
439 Ga0207657_10010114 3300025919 Bacteria 9429
440 Ga0207657_10103850 3300025919 Bacteria 2355
441 Ga0207649_10101153 3300025920 Bacteria 1908
442 Ga0207652_10000459 3300025921 Bacteria 42058
443 Ga0207681_10000116 3300025923 Bacteria 67094
444 Ga0207650_10004276 3300025925 Bacteria 9744
445 Ga0207650_10009331 3300025925 Bacteria 6705
446 Ga0207659_10000015 3300025926 Bacteria 168475
447 Ga0207687_10000357 3300025927 Bacteria 30477
448 Ga0207687_10004506 3300025927 Bacteria 9269
449 Ga0207700_10001137 3300025928 Bacteria 15268
450 Ga0207700_10016937 3300025928 Bacteria 4853
451 Ga0207664_10027404 3300025929 Bacteria 4319
452 Ga0207644_10000251 3300025931 Bacteria 36497
453 Ga0207644_10005542 3300025931 Bacteria 8213
454 Ga0207690_10000320 3300025932 Bacteria 32219
455 Ga0207690_10027783 3300025932 Bacteria 3578
456 Ga0207706_10002583 3300025933 Bacteria 17644
457 Ga0207706_10012590 3300025933 Bacteria 7701
458 Ga0207706_10042916 3300025933 Bacteria 4008
459 Ga0207706_10134747 3300025933 Bacteria 2172
460 Ga0207686_10000234 3300025934 Bacteria 42207
461 Ga0207686_10012409 3300025934 Bacteria 4687
462 Ga0207709_10000081 3300025935 Bacteria 164427
463 Ga0207709_10248527 3300025935 Bacteria 1298
464 Ga0207670_10000620 3300025936 Bacteria 19095
465 Ga0207670_10018819 3300025936 Bacteria 4207
466 Ga0207669_10000008 3300025937 Bacteria 168213
467 Ga0207704_10002142 3300025938 Bacteria 8851
468 Ga0207665_10001484 3300025939 Bacteria 15767
469 Ga0207665_10113693 3300025939 Bacteria 1905
470 Ga0207691_10002588 3300025940 Bacteria 17682
471 Ga0207711_10082864 3300025941 Bacteria 2804
472 Ga0207689_10000749 3300025942 Bacteria 31134
473 Ga0207689_10043368 3300025942 Bacteria 3718
474 Ga0207661_10000170 3300025944 Bacteria 41868
475 Ga0207679_10000046 3300025945 Bacteria 119975
476 Ga0207679_10010295 3300025945 Bacteria 6017
477 Ga0207679_10250854 3300025945 Bacteria 1504
478 Ga0207667_10010820 3300025949 Bacteria 10639
479 Ga0207667_10038259 3300025949 Bacteria 5125
480 Ga0207667_10078464 3300025949 Bacteria 3422
481 Ga0207651_10000200 3300025960 Bacteria 26185
482 Ga0207651_10048302 3300025960 Bacteria 2876
483 Ga0207651_10138038 3300025960 Bacteria 1878
484 Ga0207712_10000555 3300025961 Bacteria 30178
485 Ga0207668_10000133 3300025972 Bacteria 52202
486 Ga0207668_10075143 3300025972 Bacteria 2429
487 Ga0207640_10000191 3300025981 Bacteria 43590
488 Ga0207640_10115336 3300025981 Bacteria 1913
489 Ga0207658_10000535 3300025986 Bacteria 34617
490 Ga0207658_10059229 3300025986 Bacteria 2853
491 Ga0207658_10107007 3300025986 Bacteria 2203
492 Ga0207703_10003074 3300026035 Bacteria 14117
493 Ga0207703_10012070 3300026035 Bacteria 6731
494 Ga0207703_10445528 3300026035 Bacteria 1209
495 Ga0207639_10019773 3300026041 Bacteria 4809
496 Ga0207639_10079176 3300026041 Bacteria 2596
497 Ga0207639_10273538 3300026041 Bacteria 1482
498 Ga0207678_10001859 3300026067 Bacteria 19293
499 Ga0207678_10016738 3300026067 Bacteria 6439
500 Ga0207678_10042909 3300026067 Bacteria 3915
501 Ga0207708_10002476 3300026075 Bacteria 13580
502 Ga0207708_10002480 3300026075 Bacteria 13573
503 Ga0207702_10003065 3300026078 Bacteria 15534
504 Ga0207702_10099863 3300026078 Bacteria 2559
505 Ga0207702_10166063 3300026078 Bacteria 2019
506 Ga0207702_10243758 3300026078 Bacteria 1685
507 Ga0207702_10261845 3300026078 Bacteria 1629
508 Ga0207641_10000593 3300026088 Bacteria 39825
509 Ga0207641_10019300 3300026088 Bacteria 5594
510 Ga0207648_10002417 3300026089 Bacteria 20105
511 Ga0207648_10042100 3300026089 Bacteria 4010
512 Ga0207674_10003381 3300026116 Bacteria 19581
513 Ga0207675_100002182 3300026118 Bacteria 19438
514 Ga0207675_100050415 3300026118 Bacteria 3884
515 Ga0207675_100322807 3300026118 Bacteria 1508
516 Ga0207683_10000002 3300026121 Bacteria 258441
517 Ga0207683_10006919 3300026121 Bacteria 9710
518 Ga0207683_10026216 3300026121 Bacteria 5031
519 Ga0207698_10000545 3300026142 Bacteria 21874
520 Ga0207698_10203687 3300026142 Bacteria 1774
521 Ga0209281_1000034 3300027111 Bacteria 382562
522 Ga0209281_1000106 3300027111 Bacteria 219666
523 Ga0209281_1000318 3300027111 Bacteria 85039
524 Ga0209371_1000022 3300027312 Bacteria 536342
525 Ga0209371_1003359 3300027312 Bacteria 7858
526 Ga0209371_1004133 3300027312 Bacteria 6511
527 Ga0209970_1004629 3300027614 Bacteria 2279
528 Ga0209282_1000024 3300027666 Bacteria 170348
529 Ga0209282_1000531 3300027666 Bacteria 18489
530 Ga0209966_1000800 3300027695 Bacteria 6283
531 Ga0209998_10001951 3300027717 Bacteria 4843
532 Ga0209998_10020008 3300027717 Bacteria 1429
533 Ga0209813_10002584 3300027866 Bacteria 4157
534 Ga0209974_10000944 3300027876 Bacteria 10160
535 Ga0207428_10000011 3300027907 Bacteria 354388
536 Ga0207428_10000046 3300027907 Bacteria 191032
537 Ga0207428_10001276 3300027907 Bacteria 26949
538 Ga0268266_10013893 3300028379 Bacteria 6934
539 Ga0268266_10019605 3300028379 Bacteria 5762
540 Ga0268265_10011194 3300028380 Bacteria 6062
541 Ga0268264_10000340 3300028381 Bacteria 71850
542 Ga0268264_10013402 3300028381 Bacteria 6748
543 Ga0268264_10165969 3300028381 Bacteria 1993
544 Ga0307515_10001559 3300028794 Bacteria 51153
545 Ga0307515_10001978 3300028794 Bacteria 45366
546 Ga0307515_10007368 3300028794 Bacteria 21770
547 Ga0307515_10030752 3300028794 Bacteria 8997
548 Ga0268256_1000019 3300030500 Bacteria 587949
549 Ga0268256_1003591 3300030500 Bacteria 6913
550 Ga0268256_1003875 3300030500 Bacteria 6511
551 Ga0316181_1120346 3300030744 Bacteria 2308
552 Ga0265328_10000786 3300031239 Bacteria 14685
553 Ga0265328_10021456 3300031239 Bacteria 2464
554 Ga0265325_10000117 3300031241 Bacteria 54546
555 Ga0265331_10001293 3300031250 Bacteria 18633
556 Ga0265327_10069561 3300031251 Bacteria 1766
557 Ga0265316_10109642 3300031344 Bacteria 2091
558 Ga0307513_10010539 3300031456 Bacteria 11570
559 Ga0307513_10098774 3300031456 Bacteria 2949
560 Ga0307513_10286834 3300031456 Bacteria 1420
561 Ga0307408_100070114 3300031548 Bacteria 2587
562 Ga0265313_10027782 3300031595 Bacteria 2956
563 Ga0307405_10031398 3300031731 Bacteria 3127
564 Ga0307412_10012769 3300031911 Bacteria 4902
565 Ga0307412_10162794 3300031911 Bacteria 1660
566 Ga0315914_1000012 3300031967 Bacteria 169896
567 Ga0307416_100168787 3300032002 Bacteria 2034
568 Ga0307510_10214573 3300033180 Bacteria 1443
569 Ga0315913_1000006 3300033430 Bacteria 169893
570 Ga0315915_1000010 3300033464 Bacteria 240214
571 Ga0373930_0017182 3300034816 Bacteria 1376
572 Ga0373958_0000097 3300034819 Bacteria 9234
573 Ga0373958_0002015 3300034819 Bacteria 2801
574 Ga0373938_0000032 3300034957 Bacteria 17872
575 Ga0373926_0004868 3300035083 Bacteria 4412
576 Ga0373928_0000973 3300035084 Bacteria 5617
577 Ga0373928_0008008 3300035084 Bacteria 2046
578 Ga0373929_0001646 3300035085 Bacteria 4239
579 Ga0373929_0001755 3300035085 Bacteria 4076
580 Ga0373949_0001084 3300035090 Bacteria 8306
581 Ga0373949_0006126 3300035090 Bacteria 2660
582 Ga0373951_0000472 3300035091 Bacteria 11551
583 Ga0373951_0002239 3300035091 Bacteria 4918
584 Ga0373952_0000189 3300035092 Bacteria 9680
585 Ga0373952_0000675 3300035092 Bacteria 6046
586 Ga0373932_0000180 3300035112 Bacteria 18517
587 Ga0373939_0000151 3300035114 Bacteria 19559
588 Ga0373941_0002963 3300035115 Bacteria 3797
589 Ga0373941_0003543 3300035115 Bacteria 3546
590 Ga0373941_0070177 3300035115 Bacteria 1161
591 Ga0373945_0001892 3300035116 Bacteria 6491
592 Ga0373953_0001859 3300035117 Bacteria 6251
593 Ga0373953_0046289 3300035117 Bacteria 1746
594 Ga0373953_0064709 3300035117 Bacteria 1500
595 Ga0373954_0032953 3300035118 Bacteria 2397
596 Ga0373954_0036104 3300035118 Bacteria 2293
597 Ga0373956_0052962 3300035119 Bacteria 1826
598 Ga0373957_0007096 3300035120 Bacteria 3566
599 Ga0373957_0018824 3300035120 Bacteria 2423
600 Ga0373960_0000184 3300035121 Bacteria 11160
601 Ga0373960_0003038 3300035121 Bacteria 3788
602 Ga0373946_0012729 3300035171 Bacteria 3153
603 Ga0373955_0001906 3300035172 Bacteria 9004
604 Ga0373955_0008032 3300035172 Bacteria 4878
605 Ga0373942_0005465 3300035207 Bacteria 2947
606 Ga0373961_0002408 3300035241 Bacteria 4861
607 Ga0373962_0000113 3300035242 Bacteria 16882
608 Ga0373962_0000251 3300035242 Bacteria 11401
609 Ga0373962_0002284 3300035242 Bacteria 4578
610 Ga0373931_0000290 3300035691 Bacteria 21067
611 Ga0373931_0009129 3300035691 Bacteria 4732
612 Ga0373935_0023830 3300035692 Bacteria 3760
613 Ga0373935_0178375 3300035692 Bacteria 1457
614 Ga0373927_0000350 3300035695 Bacteria 36173
615 Ga0373927_0062283 3300035695 Bacteria 2412
616 Ga0373933_0015628 3300035724 Bacteria 4233
617 Ga0373933_0020224 3300035724 Bacteria 3772
618 Ga0373933_0034922 3300035724 Bacteria 2934
619 Ga0373933_0048000 3300035724 Bacteria 2541
620 Ga0373947_0085441 3300035725 Bacteria 1959
621 Ga0373947_0163306 3300035725 Bacteria 1441
622 Ga0373937_0031529 3300036401 Bacteria 4804
623 Ga0373937_0062102 3300036401 Bacteria 3434
624 Ga0395905_0000867 3300037471 Bacteria 39452
625 Ga0395905_0190384 3300037471 Bacteria 1924
626 Ga0436360_0259069 3300039438 Bacteria 1802
627 Ga0436361_0366439 3300039447 Bacteria 1743
628 Ga0436361_1207702 3300039447 Bacteria 3561
629 Ga0436362_1105174 3300039453 Bacteria 4209
630 Ga0439436_0009397 3300041404 Bacteria 2998
631 Ga0439465_0002128 3300041413 Bacteria 6513
632 Ga0439465_0007342 3300041413 Bacteria 3500
633 Ga0439465_0045564 3300041413 Bacteria 1426
634 Ga0451839_0580770 3300041496 Bacteria 1550
635 Ga0451845_0247449 3300041501 Bacteria 1383
636 Ga0451847_0129796 3300041503 Bacteria 2111
637 Ga0451851_1171717 3300041507 Bacteria 5736
638 Ga0451853_0242170 3300041512 Bacteria 5049
639 Ga0439449_0036823 3300042007 Bacteria 1820
640 Ga0439462_0028778 3300042015 Bacteria 1469
641 Ga0450906_003061 3300042145 Bacteria 3623
642 Ga0439434_0010648 3300042435 Bacteria 2712
643 Ga0451577_0351198 3300042876 Bacteria 1338
644 Ga0466966_0030974 3300044684 Bacteria 3470
645 Ga0466963_0123948 3300044694 Bacteria 1780
646 Ga0466970_0071921 3300044765 Bacteria 1860
647 Ga0466957_0040532 3300044842 Bacteria 2813
648 Ga0451576_0027624 3300045051 Bacteria 6091
649 Ga0466958_0122257 3300045836 Bacteria 1630
650 Ga0495592_0001276 3300046454 Bacteria 17453
651 Ga0495592_0069851 3300046454 Bacteria 2560
652 Ga0495603_0010478 3300046455 Bacteria 5617
653 Ga0495629_0001536 3300046459 Bacteria 18162
654 Ga0495638_0003695 3300046460 Bacteria 11911
655 Ga0495638_0008934 3300046460 Bacteria 7066
656 Ga0495638_0035932 3300046460 Bacteria 3156
657 Ga0495638_0116317 3300046460 Bacteria 1584
658 Ga0495641_0005001 3300046461 Bacteria 9146
659 Ga0495651_0001053 3300046462 Bacteria 21347
660 Ga0495651_0099331 3300046462 Bacteria 2170
661 Ga0495653_0002829 3300046463 Bacteria 13841
662 Ga0495653_0024422 3300046463 Bacteria 4871
663 Ga0495653_0041780 3300046463 Bacteria 3577
664 Ga0495580_0098448 3300046472 Bacteria 2034
665 Ga0495580_0114397 3300046472 Bacteria 1874
666 Ga0495582_0001755 3300046473 Bacteria 12244
667 Ga0495582_0017971 3300046473 Bacteria 3865
668 Ga0495582_0035249 3300046473 Bacteria 2751
669 Ga0495605_0001952 3300046474 Bacteria 13095
670 Ga0495662_0006938 3300046476 Bacteria 5628
671 Ga0495662_0014082 3300046476 Bacteria 3893
672 Ga0495662_0112139 3300046476 Bacteria 1337
673 Ga0495664_0002940 3300046477 Bacteria 9201
674 Ga0495584_0010859 3300046491 Bacteria 4674
675 Ga0495584_0158528 3300046491 Bacteria 1150
676 Ga0495585_0013529 3300046492 Bacteria 4770
677 Ga0495585_0015360 3300046492 Bacteria 4449
678 Ga0495585_0105092 3300046492 Bacteria 1506
679 Ga0495594_0022203 3300046499 Bacteria 3393
680 Ga0495594_0025988 3300046499 Bacteria 3148
681 Ga0495607_0019305 3300046501 Bacteria 4333
682 Ga0495607_0049524 3300046501 Bacteria 2449
683 Ga0495583_0039022 3300046506 Bacteria 2240
684 Ga0495606_0024450 3300046507 Bacteria 4352
685 Ga0495608_0015143 3300046511 Bacteria 5350
686 Ga0495608_0055006 3300046511 Bacteria 2630
687 Ga0495610_0001969 3300046512 Bacteria 17628
688 Ga0495610_0012085 3300046512 Bacteria 5221
689 Ga0495618_0014797 3300046514 Bacteria 4759
690 Ga0495628_0003193 3300046516 Bacteria 14701
691 Ga0495628_0020292 3300046516 Bacteria 5484
692 Ga0495630_0043308 3300046517 Bacteria 3362
693 Ga0495631_0018333 3300046518 Bacteria 3296
694 Ga0495631_0048409 3300046518 Bacteria 1864
695 Ga0495632_0045086 3300046519 Bacteria 2198
696 Ga0495637_0040485 3300046520 Bacteria 2006
697 Ga0495643_0002725 3300046522 Bacteria 13593
698 Ga0495643_0042055 3300046522 Bacteria 2490
699 Ga0495643_0072367 3300046522 Bacteria 1808
700 Ga0495644_0003283 3300046523 Bacteria 6397
701 Ga0495666_0064539 3300046526 Bacteria 1747
702 Ga0495652_0007926 3300046529 Bacteria 9749
703 Ga0495652_0083477 3300046529 Bacteria 2629
704 Ga0495654_0000110 3300046530 Bacteria 93042
705 Ga0495654_0058718 3300046530 Bacteria 1855
706 Ga0495640_0008740 3300046533 Bacteria 7936
707 Ga0495586_0052937 3300046535 Bacteria 2198
708 Ga0495587_0004533 3300046536 Bacteria 9126
709 Ga0495587_0011251 3300046536 Bacteria 5673
710 Ga0495587_0057656 3300046536 Bacteria 2283
711 Ga0495587_0086962 3300046536 Bacteria 1809
712 Ga0495598_0002896 3300046537 Bacteria 3591
713 Ga0495609_0024830 3300046538 Bacteria 2748
714 Ga0495609_0059601 3300046538 Bacteria 1688
715 Ga0495609_0069379 3300046538 Bacteria 1550
716 Ga0495645_0058959 3300046543 Bacteria 2784
717 Ga0495622_0029386 3300046557 Bacteria 2568
718 Ga0495633_0012648 3300046558 Bacteria 4479
719 Ga0495633_0016527 3300046558 Bacteria 3803
720 Ga0495667_0008100 3300046559 Bacteria 7132
721 Ga0495667_0008220 3300046559 Bacteria 7081
722 Ga0495667_0017063 3300046559 Bacteria 4903
723 Ga0495667_0066737 3300046559 Bacteria 2351
724 Ga0495656_0000812 3300046615 Bacteria 10072
725 Ga0495668_0043958 3300046616 Bacteria 2483
726 Ga0495625_0001387 3300046660 Bacteria 29722
727 Ga0495625_0016011 3300046660 Bacteria 5912
728 Ga0495635_0010665 3300046663 Bacteria 6433
729 Ga0495635_0023313 3300046663 Bacteria 4314
730 Ga0495635_0031183 3300046663 Bacteria 3703
731 Ga0495635_0107746 3300046663 Bacteria 1903
732 Ga0495588_0002364 3300046674 Bacteria 8071
733 Ga0495588_0018215 3300046674 Bacteria 3420
734 Ga0495657_0004137 3300046675 Bacteria 11618
735 Ga0495657_0042723 3300046675 Bacteria 3093
736 Ga0495657_0106108 3300046675 Bacteria 1784
737 Ga0495599_0001605 3300046678 Bacteria 13038
738 Ga0495599_0021267 3300046678 Bacteria 4047
739 Ga0495623_0039671 3300046679 Bacteria 3008
740 Ga0495646_0004146 3300046680 Bacteria 9100
741 Ga0495646_0025939 3300046680 Bacteria 3681
742 Ga0495647_0001979 3300046681 Bacteria 6401
743 Ga0495647_0004833 3300046681 Bacteria 4402
744 Ga0495658_0004872 3300046683 Bacteria 6586
745 Ga0495658_0006624 3300046683 Bacteria 5692
746 Ga0495658_0053111 3300046683 Bacteria 2300
747 Ga0495658_0109237 3300046683 Bacteria 1661
748 Ga0495613_0003386 3300046689 Bacteria 11918
749 Ga0495624_0005667 3300046690 Bacteria 8960
750 Ga0495624_0029990 3300046690 Bacteria 3545
751 Ga0495670_0043399 3300046691 Bacteria 2244
752 Ga0495600_0010128 3300046809 Bacteria 5845
753 Ga0495600_0042175 3300046809 Bacteria 2974
754 Ga0495600_0063552 3300046809 Bacteria 2412
755 Ga0495660_0069277 3300046810 Bacteria 1875
756 Ga0495604_0003926 3300047317 Bacteria 11841
757 Ga0495604_0013426 3300047317 Bacteria 6525
758 Ga0495604_0073948 3300047317 Bacteria 2570
759 Ga0495604_0077859 3300047317 Bacteria 2490
760 Ga0495674_0019302 3300047319 Bacteria 6328
761 Ga0495674_0055776 3300047319 Bacteria 3464
762 Ga0495672_0063455 3300047320 Bacteria 2120
763 Ga0495676_0039718 3300047321 Bacteria 3893
764 Ga0495680_0007202 3300047322 Bacteria 10242
765 Ga0495680_0014111 3300047322 Bacteria 6938
766 Ga0495680_0014519 3300047322 Bacteria 6818
767 Ga0495680_0050515 3300047322 Bacteria 3251
768 Ga0495680_0059684 3300047322 Bacteria 2943
769 Ga0495675_0005926 3300047444 Bacteria 7468
770 Ga0495675_0074346 3300047444 Bacteria 2142
771 Ga0495677_0031383 3300047445 Bacteria 1934
772 Ga0495681_0010028 3300047470 Bacteria 5769
773 Ga0495684_0144381 3300047471 Bacteria 1783
774 Ga0495686_0002729 3300047472 Bacteria 16131
775 Ga0495686_0027671 3300047472 Bacteria 3700
776 Ga0495686_0081202 3300047472 Bacteria 1980
777 Ga0495593_0010592 3300047673 Bacteria 5319
778 Ga0495593_0055294 3300047673 Bacteria 2089
779 Ga0495602_0010712 3300048088 Bacteria 9507
780 Ga0495602_0029454 3300048088 Bacteria 5227
781 Ga0495602_0092286 3300048088 Bacteria 2509
782 Ga0495614_0023721 3300048089 Bacteria 2648
783 Ga0495626_0062634 3300048091 Bacteria 1689
784 Ga0496100_0000171 3300048903 Bacteria 35989
785 Ga0496100_0005513 3300048903 Bacteria 6827
786 Ga0496100_0275748 3300048903 Bacteria 1252
787 Ga0496101_0000246 3300048904 Bacteria 39478
788 Ga0496101_0042308 3300048904 Bacteria 3251
789 Ga0496102_0003080 3300048905 Bacteria 14123
790 Ga0496102_0091876 3300048905 Bacteria 2810
791 Ga0496102_0117550 3300048905 Bacteria 2481
792 Ga0496102_0188362 3300048905 Bacteria 1944
793 Ga0496102_0206606 3300048905 Bacteria 1851
794 Ga0496103_0000753 3300048906 Bacteria 23863
795 Ga0496104_0000159 3300048907 Bacteria 61494
796 Ga0496104_0059838 3300048907 Bacteria 3607
797 Ga0496104_0347566 3300048907 Bacteria 1396
798 Ga0496105_0000410 3300048908 Bacteria 28167
799 Ga0496105_0048636 3300048908 Bacteria 3500
800 Ga0496106_0000183 3300048909 Bacteria 45053
801 Ga0496106_0000982 3300048909 Bacteria 20805
802 Ga0496106_0039718 3300048909 Bacteria 3524
803 Ga0496107_0001430 3300048910 Bacteria 14748
804 Ga0496107_0008995 3300048910 Bacteria 6922
805 Ga0496107_0042322 3300048910 Bacteria 3271
806 Ga0496108_0001856 3300048911 Bacteria 16893
807 Ga0496109_0001350 3300048912 Bacteria 20293
808 Ga0496109_0004165 3300048912 Bacteria 12074
809 Ga0496110_0007624 3300048913 Bacteria 8654
810 Ga0496110_0020911 3300048913 Bacteria 5528
811 Ga0496111_0001815 3300048914 Bacteria 12543
812 Ga0496111_0016105 3300048914 Bacteria 5148
813 Ga0496111_0031351 3300048914 Bacteria 3786
814 Ga0496112_0002096 3300048915 Bacteria 15835
815 Ga0496112_0016298 3300048915 Bacteria 6958
816 Ga0496112_0197523 3300048915 Bacteria 1972
817 Ga0496113_0005725 3300048916 Bacteria 7785
818 Ga0496113_0017451 3300048916 Bacteria 4983
819 Ga0496113_0032840 3300048916 Bacteria 3773
820 Ga0496114_0002224 3300048917 Bacteria 14788
821 Ga0496114_0110677 3300048917 Bacteria 2353
822 Ga0496115_0008771 3300048918 Bacteria 7494
823 Ga0496115_0020141 3300048918 Bacteria 5142
824 Ga0496115_0026952 3300048918 Bacteria 4491
825 Ga0496115_0046600 3300048918 Bacteria 3466
826 Ga0496115_0107581 3300048918 Bacteria 2289
827 Ga0496116_0000142 3300048919 Bacteria 150342
828 Ga0496116_0054835 3300048919 Bacteria 2622
829 Ga0496116_0120874 3300048919 Bacteria 1516
830 Ga0496116_0145923 3300048919 Bacteria 1322
831 Ga0496117_0000002 3300048920 Bacteria 2483758
832 Ga0496117_0001574 3300048920 Bacteria 32408
833 Ga0496117_0012510 3300048920 Bacteria 7471
834 Ga0496117_0019627 3300048920 Bacteria 5544
835 Ga0496117_0020764 3300048920 Bacteria 5344
836 Ga0496117_0026708 3300048920 Bacteria 4512
837 Ga0496117_0067682 3300048920 Bacteria 2415
838 Ga0496117_0070011 3300048920 Bacteria 2359
839 Ga0496118_0000087 3300048921 Bacteria 176693
840 Ga0496118_0008894 3300048921 Bacteria 10262
841 Ga0496118_0031016 3300048921 Bacteria 4444
842 Ga0496118_0053725 3300048921 Bacteria 3058
843 Ga0496118_0133076 3300048921 Bacteria 1592
844 Ga0496118_0206234 3300048921 Bacteria 1158
845 Ga0496119_0017375 3300048922 Bacteria 5411
846 Ga0496119_0029282 3300048922 Bacteria 3739
847 Ga0496120_0000413 3300048923 Bacteria 68125
848 Ga0496120_0090675 3300048923 Bacteria 1633
849 Ga0496120_0111746 3300048923 Bacteria 1426
850 Ga0496121_0000003 3300048924 Bacteria 1191431
851 Ga0496121_0001116 3300048924 Bacteria 47237
852 Ga0496121_0037820 3300048924 Bacteria 4281
853 Ga0496121_0047409 3300048924 Bacteria 3666
854 Ga0496121_0047624 3300048924 Bacteria 3655
855 Ga0496121_0215751 3300048924 Bacteria 1356
856 Ga0496121_0269634 3300048924 Bacteria 1170
857 Ga0496122_0000004 3300048925 Bacteria 645283
858 Ga0496122_0000190 3300048925 Bacteria 140376
859 Ga0496122_0000215 3300048925 Bacteria 128810
860 Ga0496122_0048385 3300048925 Bacteria 3270
861 Ga0496122_0064502 3300048925 Bacteria 2664
862 Ga0496122_0079953 3300048925 Bacteria 2282
863 Ga0496122_0083845 3300048925 Bacteria 2207
864 Ga0496122_0099516 3300048925 Bacteria 1949
865 Ga0496122_0102039 3300048925 Bacteria 1914
866 Ga0496122_0124926 3300048925 Bacteria 1649
867 Ga0496123_0000007 3300048926 Bacteria 645283
868 Ga0496123_0000306 3300048926 Bacteria 95266
869 Ga0496123_0000336 3300048926 Bacteria 89161
870 Ga0496123_0011423 3300048926 Bacteria 7697
871 Ga0496123_0024244 3300048926 Bacteria 4617
872 Ga0496123_0090207 3300048926 Bacteria 1823
873 Ga0496123_0112305 3300048926 Bacteria 1554
874 Ga0496123_0135038 3300048926 Bacteria 1359
875 Ga0496124_0001040 3300048927 Bacteria 43813
876 Ga0496124_0006855 3300048927 Bacteria 12267
877 Ga0496124_0008840 3300048927 Bacteria 10458
878 Ga0496124_0009838 3300048927 Bacteria 9779
879 Ga0496124_0011355 3300048927 Bacteria 8905
880 Ga0496124_0015066 3300048927 Bacteria 7434
881 Ga0496124_0017234 3300048927 Bacteria 6814
882 Ga0496124_0088148 3300048927 Bacteria 2537
883 Ga0496124_0126002 3300048927 Bacteria 2040
884 Ga0496124_0147634 3300048927 Bacteria 1849
885 Ga0496125_0000039 3300048928 Bacteria 318665
886 Ga0496125_0000248 3300048928 Bacteria 110840
887 Ga0496125_0006049 3300048928 Bacteria 13230
888 Ga0496125_0019665 3300048928 Bacteria 6360
889 Ga0496125_0029309 3300048928 Bacteria 4949
890 Ga0496125_0050756 3300048928 Bacteria 3430
891 Ga0496125_0119558 3300048928 Bacteria 1884
892 Ga0496126_0000866 3300048929 Bacteria 53241
893 Ga0496126_0001294 3300048929 Bacteria 39967
894 Ga0496126_0014931 3300048929 Bacteria 7831
895 Ga0496126_0059759 3300048929 Bacteria 3431
896 Ga0496126_0207248 3300048929 Bacteria 1652
897 Ga0496126_0247101 3300048929 Bacteria 1488
898 Ga0495678_005392 3300049459 Bacteria 7074
899 Ga0495678_040275 3300049459 Bacteria 1879
900 Ga0501033_0001862 3300049570 Bacteria 18338
901 Ga0501034_0121230 3300049571 Bacteria 2601
902 Ga0501034_0243144 3300049571 Bacteria 1745
903 Ga0501036_0142376 3300049572 Bacteria 2023
904 Ga0501043_0007295 3300049579 Bacteria 8775
905 Ga0501047_0276960 3300049581 Bacteria 1523
906 Ga0501068_0142099 3300049584 Bacteria 1505
907 Ga0501077_0169863 3300049593 Bacteria 1385
908 Ga0501079_0179105 3300049741 Bacteria 1654
909 Ga0501080_0374935 3300049742 Bacteria 1283
910 Ga0501035_0000584 3300049822 Bacteria 40265
911 nmdc:mga03683_2117_c1 3300050489 Bacteria 6112
912 nmdc:mga03683_31890_c1 3300050489 Bacteria 2117
913 nmdc:mga03n38_29204_c1 3300050490 Bacteria 2305
914 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
915 nmdc:mga00v17_156564_c1 3300050491 Bacteria 1465
916 nmdc:mga00v17_639_c1 3300050491 Bacteria 19367
917 nmdc:mga0yw44_119621_c1 3300050492 Bacteria 1695
918 nmdc:mga0yw44_291_c1 3300050492 Bacteria 17253
919 nmdc:mga0yw44_73499_c1 3300050492 Bacteria 2127
920 nmdc:mga06z11_30304_c1 3300050494 Bacteria 2617
921 nmdc:mga07m45_93189_c1 3300050496 Bacteria 1727
922 nmdc:mga05p37_16389_c1 3300050507 Bacteria 8927
923 nmdc:mga08y16_9096_c1 3300050511 Bacteria 10430
924 nmdc:mga0n895_971_c1 3300050512 Bacteria 20812
925 nmdc:mga08x19_210538_c1 3300050514 Bacteria 1334
926 nmdc:mga08x19_25741_c1 3300050514 Bacteria 3667
927 nmdc:mga0a205_1026_c1 3300050515 Bacteria 23240
928 nmdc:mga0a205_260176_c1 3300050515 Bacteria 1613
929 nmdc:mga0sz30_1084_c1 3300050516 Bacteria 9781
930 nmdc:mga0sz30_60381_c1 3300050516 Bacteria 1619
931 Ga0495601_0002032 3300053077 Bacteria 11359
932 Ga0495601_0002166 3300053077 Bacteria 11055
933 Ga0495601_0058457 3300053077 Bacteria 2443
934 Ga0495612_0000616 3300053078 Bacteria 14330
935 Ga0495612_0014874 3300053078 Bacteria 3122
936 Ga0495612_0035278 3300053078 Bacteria 2027
937 Ga0495595_0001470 3300053084 Bacteria 9200
938 Ga0495595_0003032 3300053084 Bacteria 6641
939 Ga0495619_0000151 3300053085 Bacteria 51364
940 Ga0495619_0000419 3300053085 Bacteria 28779
941 Ga0495619_0001606 3300053085 Bacteria 14870
942 Ga0500556_0027067 3300053104 Bacteria 1911
943 Ga0500569_019514 3300053109 Bacteria 1765
944 Ga0500569_030603 3300053109 Bacteria 1507
945 Ga0500572_004012 3300053111 Bacteria 3346
946 Ga0500608_022262 3300053122 Bacteria 2937
947 Ga0500618_000314 3300053125 Bacteria 35813
948 Ga0500618_000677 3300053125 Bacteria 20060
949 Ga0500618_007431 3300053125 Bacteria 3128
950 Ga0500618_026147 3300053125 Bacteria 1394
951 Ga0500658_0000526 3300053134 Bacteria 16212
952 Ga0500559_0002861 3300053136 Bacteria 8722
953 Ga0500561_0000098 3300053137 Bacteria 16671
954 Ga0500568_0022079 3300053139 Bacteria 2729
955 Ga0500568_0023876 3300053139 Bacteria 2595
956 Ga0500573_0001766 3300053140 Bacteria 10516
957 Ga0500604_0025382 3300053151 Bacteria 1703
958 Ga0500616_0000277 3300053153 Bacteria 76399
959 Ga0500616_0004617 3300053153 Bacteria 9730
960 Ga0500616_0055546 3300053153 Bacteria 2070
961 Ga0500622_0000458 3300053156 Bacteria 38693
962 Ga0500622_0000627 3300053156 Bacteria 31781
963 Ga0500622_0135828 3300053156 Bacteria 1178
964 Ga0500624_005981 3300053157 Bacteria 1635
965 Ga0500634_0023465 3300053161 Bacteria 3353
966 Ga0500636_0000180 3300053177 Bacteria 33813
967 Ga0500636_0001459 3300053177 Bacteria 12853

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100023831 Ga0070659_1000238313 293
2 3300005367 Ga0070667_100096801 Ga0070667_1000968014 293
3 3300005615 Ga0070702_100009804 Ga0070702_1000098043 293
4 3300035115 Ga0373941_0070177 Ga0373941_0070177_57_938 293
5 3300046476 Ga0495662_0112139 Ga0495662_0112139_282_1163 293
6 3300025898 Ga0207692_10003318 Ga0207692_100033184 302
7 3300025901 Ga0207688_10023234 Ga0207688_100232342 302
8 3300025925 Ga0207650_10009331 Ga0207650_100093313 302
9 3300026067 Ga0207678_10016738 Ga0207678_100167385 302
10 3300053109 Ga0500569_030603 Ga0500569_030603_541_1497 306
11 3300039438 Ga0436360_0259069 Ga0436360_0259069_116_1216 326
12 3300039447 Ga0436361_1207702 Ga0436361_1207702_994_2094 326
13 3300046512 Ga0495610_0012085 Ga0495610_0012085_10_1041 327
14 3300049459 Ga0495678_040275 Ga0495678_040275_831_1862 327
15 3300006948 Ga0099826_10001254 Ga0099826_100012547 328
16 3300027666 Ga0209282_1000531 Ga0209282_10005314 328
17 3300048919 Ga0496116_0120874 Ga0496116_0120874_215_1351 328
18 3300048920 Ga0496117_0067682 Ga0496117_0067682_1114_2250 328
19 3300048922 Ga0496119_0029282 Ga0496119_0029282_1469_2605 328
20 3300048928 Ga0496125_0019665 Ga0496125_0019665_1135_2271 328
21 3300035692 Ga0373935_0178375 Ga0373935_0178375_151_1275 329
22 3300035695 Ga0373927_0000350 Ga0373927_0000350_30682_31806 329
23 3300037471 Ga0395905_0000867 Ga0395905_0000867_9064_10191 329
24 3300048921 Ga0496118_0206234 Ga0496118_0206234_25_1107 331
25 3300037471 Ga0395905_0190384 Ga0395905_0190384_608_1735 333
26 3300002987 JGI25159J45721_1001072 JGI25159J45721_10010727 334
27 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001660 334
28 3300003374 JGI25161J50226_1000001 JGI25161J50226_100000193 334
29 3300004625 Ga0055543_1000003 Ga0055543_1000003109 334
30 3300005262 Ga0065165_1000068 Ga0065165_100006860 334
31 3300025284 Ga0209130_1000003 Ga0209130_1000003117 334
32 3300025302 Ga0207426_1000011 Ga0207426_1000011662 334
33 3300028794 Ga0307515_10001559 Ga0307515_1000155927 335
34 3300027312 Ga0209371_1000022 Ga0209371_100002278 336
35 3300030500 Ga0268256_1000019 Ga0268256_1000019442 336
36 3300053125 Ga0500618_000677 Ga0500618_000677_10728_11864 336
37 3300053125 Ga0500618_007431 Ga0500618_007431_1511_2635 336
38 iso_pu_bacteria 2551306086 2551691433 336
39 3300046501 Ga0495607_0019305 Ga0495607_0019305_1224_2363 337
40 3300046558 Ga0495633_0016527 Ga0495633_0016527_2634_3770 337
41 3300047470 Ga0495681_0010028 Ga0495681_0010028_1328_2464 337
42 3300048924 Ga0496121_0001116 Ga0496121_0001116_37590_38714 337
43 3300048925 Ga0496122_0000215 Ga0496122_0000215_41796_42935 337
44 3300048926 Ga0496123_0000306 Ga0496123_0000306_85876_87015 337
45 3300053104 Ga0500556_0027067 Ga0500556_0027067_438_1562 337
46 3300053157 Ga0500624_005981 Ga0500624_005981_35_1171 337
47 3300053161 Ga0500634_0023465 Ga0500634_0023465_1378_2514 337
48 iso_pu_bacteria 2551306090 2551715887 337
49 3300025906 Ga0207699_10099236 Ga0207699_100992362 338
50 3300025915 Ga0207693_10000842 Ga0207693_1000084217 338
51 3300050491 nmdc:mga00v17_639_c1 nmdc:mga00v17_639_c1_8732_9856 338
52 3300013105 Ga0157369_10436414 Ga0157369_104364141 339
53 3300026041 Ga0207639_10019773 Ga0207639_100197732 339
54 3300046530 Ga0495654_0058718 Ga0495654_0058718_632_1756 339
55 3300046674 Ga0495588_0018215 Ga0495588_0018215_403_1545 339
56 3300053125 Ga0500618_000314 Ga0500618_000314_6933_8072 339
57 3300026041 Ga0207639_10273538 Ga0207639_102735381 340
58 3300031456 Ga0307513_10098774 Ga0307513_100987742 340
59 3300003771 Ga0055526_1006767 Ga0055526_10067672 341
60 3300005347 Ga0070668_100052956 Ga0070668_1000529562 341
61 3300005355 Ga0070671_100263322 Ga0070671_1002633221 341
62 3300009177 Ga0105248_10031210 Ga0105248_100312106 341
63 3300025273 Ga0209673_1002134 Ga0209673_100213410 341
64 3300025294 Ga0209025_1035161 Ga0209025_10351612 341
65 3300025302 Ga0207426_1000869 Ga0207426_10008695 341
66 3300025303 Ga0209051_1002962 Ga0209051_10029623 341
67 3300005435 Ga0070714_100208040 Ga0070714_1002080402 343
68 3300005614 Ga0068856_100138533 Ga0068856_1001385332 343
69 3300026142 Ga0207698_10203687 Ga0207698_102036872 343
70 3300049584 Ga0501068_0142099 Ga0501068_0142099_31_1155 343
71 3300048920 Ga0496117_0012510 Ga0496117_0012510_4754_5890 344
72 3300048923 Ga0496120_0090675 Ga0496120_0090675_443_1579 344
73 3300048924 Ga0496121_0000003 Ga0496121_0000003_382741_383877 344
74 3300048927 Ga0496124_0017234 Ga0496124_0017234_5518_6654 344
75 3300048928 Ga0496125_0000039 Ga0496125_0000039_161379_162515 344
76 3300053156 Ga0500622_0135828 Ga0500622_0135828_12_1088 344
77 3300048927 Ga0496124_0006855 Ga0496124_0006855_6990_8120 345
78 3300003187 JGI25151J46595_10005074 JGI25151J46595_100050743 346
79 3300025294 Ga0209025_1001869 Ga0209025_100186914 346
80 3300048914 Ga0496111_0016105 Ga0496111_0016105_3432_4574 346
81 3300048925 Ga0496122_0124926 Ga0496122_0124926_407_1546 346
82 3300048926 Ga0496123_0135038 Ga0496123_0135038_101_1240 346
83 3300050507 nmdc:mga05p37_16389_c1 nmdc:mga05p37_16389_c1_3344_4459 346
84 3300002773 JGI25152J39213_1000636 JGI25152J39213_100063611 347
85 3300002774 JGI25150J39212_1000107 JGI25150J39212_100010713 347
86 3300003187 JGI25151J46595_10000374 JGI25151J46595_1000037433 347
87 3300003215 JGI25153J46596_10000696 JGI25153J46596_100006969 347
88 3300003578 Ga0006562J51391_1050564 Ga0006562J51391_10505642 347
89 3300025245 Ga0207425_1000075 Ga0207425_100007565 347
90 3300025258 Ga0209129_1000156 Ga0209129_100015633 347
91 3300025294 Ga0209025_1000070 Ga0209025_1000070244 347
92 3300025297 Ga0209758_1000758 Ga0209758_100075810 347
93 3300031731 Ga0307405_10031398 Ga0307405_100313982 347
94 3300031911 Ga0307412_10012769 Ga0307412_100127692 347
95 3300048920 Ga0496117_0026708 Ga0496117_0026708_2585_3715 347
96 3300048924 Ga0496121_0047409 Ga0496121_0047409_1311_2441 347
97 3300048924 Ga0496121_0269634 Ga0496121_0269634_18_1148 347
98 3300048925 Ga0496122_0099516 Ga0496122_0099516_705_1835 347
99 3300048926 Ga0496123_0011423 Ga0496123_0011423_3946_5076 347
100 3300048927 Ga0496124_0011355 Ga0496124_0011355_20_1150 347
101 3300048928 Ga0496125_0006049 Ga0496125_0006049_6620_7750 347
102 3300048929 Ga0496126_0207248 Ga0496126_0207248_45_1175 347
103 3300049571 Ga0501034_0121230 Ga0501034_0121230_1083_2207 347
104 3300049581 Ga0501047_0276960 Ga0501047_0276960_232_1356 347
105 iso_pu_bacteria 2551306092 2551732312 348
106 3300005458 Ga0070681_10025407 Ga0070681_100254073 349
107 3300005547 Ga0070693_100017810 Ga0070693_1000178102 349
108 3300009101 Ga0105247_10096517 Ga0105247_100965171 349
109 3300013308 Ga0157375_10039652 Ga0157375_100396524 349
110 3300025912 Ga0207707_10088960 Ga0207707_100889602 349
111 3300025919 Ga0207657_10010114 Ga0207657_100101145 349
112 3300025933 Ga0207706_10134747 Ga0207706_101347472 349
113 3300025972 Ga0207668_10075143 Ga0207668_100751432 349
114 3300025981 Ga0207640_10115336 Ga0207640_101153361 349
115 3300039447 Ga0436361_0366439 Ga0436361_0366439_514_1614 349
116 3300048905 Ga0496102_0188362 Ga0496102_0188362_286_1383 349
117 3300048918 Ga0496115_0107581 Ga0496115_0107581_495_1592 349
118 3300048907 Ga0496104_0347566 Ga0496104_0347566_121_1242 350
119 3300049579 Ga0501043_0007295 Ga0501043_0007295_1235_2356 350
120 3300021358 Ga0213873_10002489 Ga0213873_100024893 351
121 3300039453 Ga0436362_1105174 Ga0436362_1105174_2556_3656 351
122 3300005548 Ga0070665_100123540 Ga0070665_1001235402 352
123 3300006048 Ga0075363_100080114 Ga0075363_1000801141 353
124 3300006177 Ga0075362_10015506 Ga0075362_100155063 353
125 3300006178 Ga0075367_10009312 Ga0075367_100093124 353
126 3300025294 Ga0209025_1014241 Ga0209025_10142412 353
127 3300027866 Ga0209813_10002584 Ga0209813_100025842 353
128 iso_pu_bacteria 2894817345 2894820351 354
129 iso_pu_bacteria 2977530762 2977534061 354
130 iso_pu_bacteria 8055431914 8055432768 354
131 3300009093 Ga0105240_10352941 Ga0105240_103529412 355
132 3300013102 Ga0157371_10000017 Ga0157371_1000001750 355
133 3300013104 Ga0157370_10000461 Ga0157370_1000046130 355
134 3300026078 Ga0207702_10243758 Ga0207702_102437582 355
135 3300035724 Ga0373933_0034922 Ga0373933_0034922_307_1398 355
136 3300046463 Ga0495653_0041780 Ga0495653_0041780_2021_3112 355
137 3300046522 Ga0495643_0072367 Ga0495643_0072367_156_1298 355
138 3300046536 Ga0495587_0086962 Ga0495587_0086962_221_1312 355
139 3300046559 Ga0495667_0017063 Ga0495667_0017063_1601_2692 355
140 3300046663 Ga0495635_0031183 Ga0495635_0031183_830_1921 355
141 3300046675 Ga0495657_0106108 Ga0495657_0106108_259_1350 355
142 3300047317 Ga0495604_0077859 Ga0495604_0077859_1138_2229 355
143 3300047319 Ga0495674_0055776 Ga0495674_0055776_2349_3440 355
144 3300047322 Ga0495680_0059684 Ga0495680_0059684_901_1992 355
145 3300048918 Ga0496115_0046600 Ga0496115_0046600_126_1217 355
146 3300048920 Ga0496117_0000002 Ga0496117_0000002_478640_479782 355
147 3300048921 Ga0496118_0000087 Ga0496118_0000087_90199_91341 355
148 3300048923 Ga0496120_0000413 Ga0496120_0000413_6179_7321 355
149 3300048925 Ga0496122_0000004 Ga0496122_0000004_110076_111218 355
150 3300048926 Ga0496123_0000007 Ga0496123_0000007_110076_111218 355
151 3300048928 Ga0496125_0050756 Ga0496125_0050756_48_1190 355
152 3300048929 Ga0496126_0059759 Ga0496126_0059759_2243_3385 355
153 3300050489 nmdc:mga03683_31890_c1 nmdc:mga03683_31890_c1_417_1559 355
154 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_26491_27633 355
155 3300050492 nmdc:mga0yw44_291_c1 nmdc:mga0yw44_291_c1_13371_14513 355
156 3300050494 nmdc:mga06z11_30304_c1 nmdc:mga06z11_30304_c1_1181_2323 355
157 3300050516 nmdc:mga0sz30_1084_c1 nmdc:mga0sz30_1084_c1_4915_6057 355
158 3300053077 Ga0495601_0002166 Ga0495601_0002166_857_1948 355
159 3300053078 Ga0495612_0014874 Ga0495612_0014874_1707_2798 355
160 3300053084 Ga0495595_0001470 Ga0495595_0001470_6676_7767 355
161 3300053085 Ga0495619_0000151 Ga0495619_0000151_36231_37322 355
162 3300053137 Ga0500561_0000098 Ga0500561_0000098_6245_7387 355
163 iso_pu_bacteria 2510461069 2510843069 355
164 iso_pu_bacteria 2516143018 2516204138 355
165 iso_pu_bacteria 2558860983 2561468378 355
166 iso_pu_bacteria 2582581316 2585331483 355
167 iso_pu_bacteria 2615840698 2616554221 355
168 iso_pu_bacteria 2617270742 2617384725 355
169 iso_pu_bacteria 2643221653 2644298663 355
170 iso_pu_bacteria 2643221719 2644656892 355
171 iso_pu_bacteria 2667528174 2671111437 355
172 iso_pu_bacteria 2690316117 2692315549 355
173 iso_pu_bacteria 2738541317 2738947342 355
174 iso_pu_bacteria 2751185821 2753462021 355
175 iso_pu_bacteria 2775507049 2776913917 355
176 iso_pu_bacteria 2775507266 2778175408 355
177 iso_pu_bacteria 2791355091 2792620778 355
178 iso_pu_bacteria 2791355092 2792626137 355
179 iso_pu_bacteria 2791355094 2792639073 355
180 iso_pu_bacteria 2818991272 2819241411 355
181 iso_pu_bacteria 2818991448 2819609141 355
182 iso_pu_bacteria 2837651117 2837654485 355
183 iso_pu_bacteria 2838029111 2838029813 355
184 iso_pu_bacteria 2842298080 2842301362 355
185 iso_pu_bacteria 2842357229 2842357899 355
186 iso_pu_bacteria 2842475841 2842476902 355
187 iso_pu_bacteria 2842482326 2842484568 355
188 iso_pu_bacteria 2842502639 2842503341 355
189 iso_pu_bacteria 2842509118 2842511137 355
190 iso_pu_bacteria 2847417321 2847419390 355
191 iso_pu_bacteria 2848992105 2848994417 355
192 iso_pu_bacteria 2855872281 2855872528 355
193 iso_pu_bacteria 2891373044 2891373340 355
194 iso_pu_bacteria 2899803654 2899807276 355
195 iso_pu_bacteria 2913308742 2913312560 355
196 iso_pu_bacteria 2919408235 2919409972 355
197 iso_pu_bacteria 2989349275 2989349664 355
198 iso_pu_bacteria 2989776772 2989779198 355
199 iso_pu_bacteria 3005416602 3005419478 355
200 iso_pu_bacteria 643692032 643826306 355
201 iso_pu_bacteria 8005246636 8005248760 355
202 iso_pu_bacteria 8005314921 8005316769 355
203 iso_pu_bacteria 8005484373 8005489195 355
204 iso_pu_bacteria 8005645114 8005648129 355
205 iso_pu_bacteria 8005658619 8005659037 355
206 iso_pu_bacteria 8005682033 8005682897 355
207 3300035207 Ga0373942_0005465 Ga0373942_0005465_13_1083 356
208 iso_pu_bacteria 2508501122 2509108403 356
209 iso_pu_bacteria 2509276019 2509376464 356
210 iso_pu_bacteria 2509276021 2509392063 356
211 iso_pu_bacteria 2509276033 2509445654 356
212 iso_pu_bacteria 2509276033 2509447045 356
213 iso_pu_bacteria 2510065019 2510133947 356
214 iso_pu_bacteria 2510065057 2510306448 356
215 iso_pu_bacteria 2510461076 2510895365 356
216 iso_pu_bacteria 2510917022 2511135394 356
217 iso_pu_bacteria 2510917028 2511187047 356
218 iso_pu_bacteria 2510917030 2511199021 356
219 iso_pu_bacteria 2511231052 2511502238 356
220 iso_pu_bacteria 2512047086 2512533611 356
221 iso_pu_bacteria 2512875026 2512970700 356
222 iso_pu_bacteria 2513237084 2513567980 356
223 iso_pu_bacteria 2513237085 2513576934 356
224 iso_pu_bacteria 2513237086 2513584390 356
225 iso_pu_bacteria 2513237088 2513596467 356
226 iso_pu_bacteria 2513237089 2513604256 356
227 iso_pu_bacteria 2513237091 2513618798 356
228 iso_pu_bacteria 2513237093 2513633394 356
229 iso_pu_bacteria 2513237103 2513708056 356
230 iso_pu_bacteria 2513237138 2513865592 356
231 iso_pu_bacteria 2513237140 2513884411 356
232 iso_pu_bacteria 2513237143 2513905003 356
233 iso_pu_bacteria 2513237144 2513909009 356
234 iso_pu_bacteria 2513237146 2513925392 356
235 iso_pu_bacteria 2513237156 2513986831 356
236 iso_pu_bacteria 2513237159 2514001510 356
237 iso_pu_bacteria 2513237160 2514006395 356
238 iso_pu_bacteria 2513237162 2514020015 356
239 iso_pu_bacteria 2515075009 2515112996 356
240 iso_pu_bacteria 2515154107 2515609014 356
241 iso_pu_bacteria 2515154113 2515638506 356
242 iso_pu_bacteria 2515154114 2515640955 356
243 iso_pu_bacteria 2515154116 2515655363 356
244 iso_pu_bacteria 2515154134 2515739474 356
245 iso_pu_bacteria 2516653046 2516893617 356
246 iso_pu_bacteria 2516653077 2517036696 356
247 iso_pu_bacteria 2516653085 2517077055 356
248 iso_pu_bacteria 2517093000 2517095823 356
249 iso_pu_bacteria 2517287029 2517407395 356
250 iso_pu_bacteria 2517487022 2517570329 356
251 iso_pu_bacteria 2519899620 2520377199 356
252 iso_pu_bacteria 2524023207 2524448562 356
253 iso_pu_bacteria 2529292951 2530645961 356
254 iso_pu_bacteria 2534681796 2535516858 356
255 iso_pu_bacteria 2537561587 2537875441 356
256 iso_pu_bacteria 2551306084 2551674550 356
257 iso_pu_bacteria 2551306084 2551677931 356
258 iso_pu_bacteria 2551306085 2551687744 356
259 iso_pu_bacteria 2554235003 2554248225 356
260 iso_pu_bacteria 2558860100 2558864469 356
261 iso_pu_bacteria 2558860242 2559295341 356
262 iso_pu_bacteria 2582581283 2585166341 356
263 iso_pu_bacteria 2582581294 2585202278 356
264 iso_pu_bacteria 2582581298 2585222824 356
265 iso_pu_bacteria 2582581299 2585231735 356
266 iso_pu_bacteria 2582581304 2585255076 356
267 iso_pu_bacteria 2582581306 2585267431 356
268 iso_pu_bacteria 2582581307 2585271131 356
269 iso_pu_bacteria 2582581308 2585277475 356
270 iso_pu_bacteria 2582581315 2585323341 356
271 iso_pu_bacteria 2582581865 2585386499 356
272 iso_pu_bacteria 2582581866 2585393249 356
273 iso_pu_bacteria 2582581867 2585402405 356
274 iso_pu_bacteria 2585427526 2585527435 356
275 iso_pu_bacteria 2585427527 2585535102 356
276 iso_pu_bacteria 2585427528 2585538176 356
277 iso_pu_bacteria 2585427529 2585545407 356
278 iso_pu_bacteria 2585427530 2585555952 356
279 iso_pu_bacteria 2585427531 2585558855 356
280 iso_pu_bacteria 2585427590 2585822908 356
281 iso_pu_bacteria 2585427593 2585836125 356
282 iso_pu_bacteria 2585427594 2585843219 356
283 iso_pu_bacteria 2585427608 2585898237 356
284 iso_pu_bacteria 2585427609 2585904175 356
285 iso_pu_bacteria 2585427633 2585996196 356
286 iso_pu_bacteria 2585427634 2586000806 356
287 iso_pu_bacteria 2585428125 2587980708 356
288 iso_pu_bacteria 2599185156 2599331744 356
289 iso_pu_bacteria 2599185170 2599417308 356
290 iso_pu_bacteria 2599185210 2599601653 356
291 iso_pu_bacteria 2599185236 2599721919 356
292 iso_pu_bacteria 2599185352 2600194386 356
293 iso_pu_bacteria 2600254933 2600374366 356
294 iso_pu_bacteria 2600255279 2601610087 356
295 iso_pu_bacteria 2600255308 2601746862 356
296 iso_pu_bacteria 2615840624 2616293372 356
297 iso_pu_bacteria 2615840626 2616308950 356
298 iso_pu_bacteria 2643221557 2643803095 356
299 iso_pu_bacteria 2643221558 2643811539 356
300 iso_pu_bacteria 2643221568 2643856778 356
301 iso_pu_bacteria 2643221582 2643920351 356
302 iso_pu_bacteria 2643221599 2644003165 356
303 iso_pu_bacteria 2643221607 2644050526 356
304 iso_pu_bacteria 2643221610 2644063457 356
305 iso_pu_bacteria 2643221618 2644107286 356
306 iso_pu_bacteria 2643221626 2644150852 356
307 iso_pu_bacteria 2643221634 2644193501 356
308 iso_pu_bacteria 2643221636 2644205754 356
309 iso_pu_bacteria 2643221637 2644209036 356
310 iso_pu_bacteria 2643221643 2644238687 356
311 iso_pu_bacteria 2643221655 2644308681 356
312 iso_pu_bacteria 2643221659 2644335499 356
313 iso_pu_bacteria 2643221668 2644374740 356
314 iso_pu_bacteria 2643221675 2644414220 356
315 iso_pu_bacteria 2643221680 2644447748 356
316 iso_pu_bacteria 2643221686 2644483444 356
317 iso_pu_bacteria 2643221689 2644499655 356
318 iso_pu_bacteria 2643221693 2644521965 356
319 iso_pu_bacteria 2643221698 2644539904 356
320 iso_pu_bacteria 2643221712 2644614622 356
321 iso_pu_bacteria 2643221718 2644652566 356
322 iso_pu_bacteria 2643221723 2644676086 356
323 iso_pu_bacteria 2643221726 2644690221 356
324 iso_pu_bacteria 2718217882 2719181798 356
325 iso_pu_bacteria 2718217927 2719386401 356
326 iso_pu_bacteria 2718217997 2719666149 356
327 iso_pu_bacteria 2718218009 2719732462 356
328 iso_pu_bacteria 2718218199 2720492569 356
329 iso_pu_bacteria 2718218232 2720614004 356
330 iso_pu_bacteria 2718218233 2720620809 356
331 iso_pu_bacteria 2718218235 2720632134 356
332 iso_pu_bacteria 2718218269 2720775862 356
333 iso_pu_bacteria 2718218363 2721147889 356
334 iso_pu_bacteria 2718218365 2721159340 356
335 iso_pu_bacteria 2718218366 2721164725 356
336 iso_pu_bacteria 2718218423 2721400105 356
337 iso_pu_bacteria 2721755514 2722840895 356
338 iso_pu_bacteria 2721755556 2723027466 356
339 iso_pu_bacteria 2721755684 2723561085 356
340 iso_pu_bacteria 2721755685 2723567681 356
341 iso_pu_bacteria 2721755809 2724038918 356
342 iso_pu_bacteria 2721755810 2724045218 356
343 iso_pu_bacteria 2721755819 2724090469 356
344 iso_pu_bacteria 2721755822 2724104946 356
345 iso_pu_bacteria 2721755823 2724110805 356
346 iso_pu_bacteria 2724679232 2725952569 356
347 iso_pu_bacteria 2728369352 2730108402 356
348 iso_pu_bacteria 2728369365 2730165033 356
349 iso_pu_bacteria 2728369397 2730298972 356
350 iso_pu_bacteria 2738541293 2738800077 356
351 iso_pu_bacteria 2738541333 2739032833 356
352 iso_pu_bacteria 2765235802 2765464621 356
353 iso_pu_bacteria 2765235942 2766065861 356
354 iso_pu_bacteria 2791355253 2793280311 356
355 iso_pu_bacteria 2791355256 2793294445 356
356 iso_pu_bacteria 2791355259 2793314551 356
357 iso_pu_bacteria 2791355260 2793320379 356
358 iso_pu_bacteria 2791355261 2793329548 356
359 iso_pu_bacteria 2791355262 2793334482 356
360 iso_pu_bacteria 2791355263 2793339199 356
361 iso_pu_bacteria 2791355264 2793348872 356
362 iso_pu_bacteria 2791355265 2793351840 356
363 iso_pu_bacteria 2791355266 2793362592 356
364 iso_pu_bacteria 2791355267 2793368882 356
365 iso_pu_bacteria 2802428858 2802720024 356
366 iso_pu_bacteria 2802428859 2802727043 356
367 iso_pu_bacteria 2802428860 2802731954 356
368 iso_pu_bacteria 2802428861 2802739285 356
369 iso_pu_bacteria 2802428862 2802745734 356
370 iso_pu_bacteria 2802428863 2802752335 356
371 iso_pu_bacteria 2802429605 2805928809 356
372 iso_pu_bacteria 2802429606 2805935091 356
373 iso_pu_bacteria 2802429633 2806043813 356
374 iso_pu_bacteria 2802429634 2806050256 356
375 iso_pu_bacteria 2802429635 2806057072 356
376 iso_pu_bacteria 2802429636 2806064454 356
377 iso_pu_bacteria 2802429637 2806071721 356
378 iso_pu_bacteria 2808606387 2808987925 356
379 iso_pu_bacteria 2818991439 2819559054 356
380 iso_pu_bacteria 2818991453 2819637631 356
381 iso_pu_bacteria 2818991461 2819684904 356
382 iso_pu_bacteria 2821123053 2821127497 356
383 iso_pu_bacteria 2838016132 2838017661 356
384 iso_pu_bacteria 2838022645 2838027538 356
385 iso_pu_bacteria 2838035591 2838038492 356
386 iso_pu_bacteria 2838042994 2838043960 356
387 iso_pu_bacteria 2838048938 2838054394 356
388 iso_pu_bacteria 2838061910 2838068023 356
389 iso_pu_bacteria 2838068647 2838070151 356
390 iso_pu_bacteria 2838074704 2838076866 356
391 iso_pu_bacteria 2838661181 2838661597 356
392 iso_pu_bacteria 2838668709 2838670352 356
393 iso_pu_bacteria 2838675328 2838675784 356
394 iso_pu_bacteria 2838680041 2838683476 356
395 iso_pu_bacteria 2838686498 2838687063 356
396 iso_pu_bacteria 2838694306 2838697581 356
397 iso_pu_bacteria 2838701080 2838702723 356
398 iso_pu_bacteria 2838707686 2838710697 356
399 iso_pu_bacteria 2838714209 2838714666 356
400 iso_pu_bacteria 2838719591 2838721533 356
401 iso_pu_bacteria 2838724970 2838725426 356
402 iso_pu_bacteria 2838729681 2838729964 356
403 iso_pu_bacteria 2838736955 2838738021 356
404 iso_pu_bacteria 2838742623 2838743021 356
405 iso_pu_bacteria 2841840854 2841841610 356
406 iso_pu_bacteria 2841846520 2841848485 356
407 iso_pu_bacteria 2841851746 2841852507 356
408 iso_pu_bacteria 2841859092 2841862116 356
409 iso_pu_bacteria 2841864319 2841870774 356
410 iso_pu_bacteria 2842077413 2842078870 356
411 iso_pu_bacteria 2842110456 2842113278 356
412 iso_pu_bacteria 2842118031 2842118620 356
413 iso_pu_bacteria 2842124991 2842125484 356
414 iso_pu_bacteria 2842130223 2842130679 356
415 iso_pu_bacteria 2842140634 2842141388 356
416 iso_pu_bacteria 2842146304 2842148019 356
417 iso_pu_bacteria 2842152218 2842154151 356
418 iso_pu_bacteria 2842156927 2842158033 356
419 iso_pu_bacteria 2842163707 2842168803 356
420 iso_pu_bacteria 2842170452 2842170910 356
421 iso_pu_bacteria 2842175837 2842177771 356
422 iso_pu_bacteria 2842180545 2842181652 356
423 iso_pu_bacteria 2842187318 2842187775 356
424 iso_pu_bacteria 2842192696 2842197349 356
425 iso_pu_bacteria 2842198810 2842203548 356
426 iso_pu_bacteria 2842205361 2842205488 356
427 iso_pu_bacteria 2842211629 2842212086 356
428 iso_pu_bacteria 2842217011 2842217928 356
429 iso_pu_bacteria 2842224351 2842226295 356
430 iso_pu_bacteria 2842229732 2842230297 356
431 iso_pu_bacteria 2842237096 2842240532 356
432 iso_pu_bacteria 2842243621 2842244199 356
433 iso_pu_bacteria 2842250916 2842253085 356
434 iso_pu_bacteria 2842257432 2842257715 356
435 iso_pu_bacteria 2842264693 2842266258 356
436 iso_pu_bacteria 2842271015 2842271399 356
437 iso_pu_bacteria 2842278818 2842278945 356
438 iso_pu_bacteria 2842285085 2842285609 356
439 iso_pu_bacteria 2842291075 2842292532 356
440 iso_pu_bacteria 2842304105 2842305027 356
441 iso_pu_bacteria 2842311132 2842314921 356
442 iso_pu_bacteria 2842317721 2842320701 356
443 iso_pu_bacteria 2842341865 2842346450 356
444 iso_pu_bacteria 2842363717 2842368971 356
445 iso_pu_bacteria 2842370503 2842374107 356
446 iso_pu_bacteria 2842377471 2842378930 356
447 iso_pu_bacteria 2842384541 2842385131 356
448 iso_pu_bacteria 2842395702 2842399892 356
449 iso_pu_bacteria 2842402390 2842402969 356
450 iso_pu_bacteria 2842409023 2842409659 356
451 iso_pu_bacteria 2842415677 2842416310 356
452 iso_pu_bacteria 2842422224 2842423765 356
453 iso_pu_bacteria 2842428310 2842430721 356
454 iso_pu_bacteria 2842434925 2842437292 356
455 iso_pu_bacteria 2842441272 2842443662 356
456 iso_pu_bacteria 2842447887 2842454043 356
457 iso_pu_bacteria 2842462802 2842464864 356
458 iso_pu_bacteria 2842469257 2842471910 356
459 iso_pu_bacteria 2842489311 2842491969 356
460 iso_pu_bacteria 2842495871 2842496835 356
461 iso_pu_bacteria 2842515876 2842518900 356
462 iso_pu_bacteria 2842521101 2842521807 356
463 iso_pu_bacteria 2842922631 2842924149 356
464 iso_pu_bacteria 2844163670 2844164565 356
465 iso_pu_bacteria 2844454524 2844458430 356
466 iso_pu_bacteria 2850079185 2850081460 356
467 iso_pu_bacteria 2854896431 2854899581 356
468 iso_pu_bacteria 2854916844 2854918406 356
469 iso_pu_bacteria 2855825444 2855826337 356
470 iso_pu_bacteria 2855839649 2855841727 356
471 iso_pu_bacteria 2857516855 2857517442 356
472 iso_pu_bacteria 2857531043 2857536490 356
473 iso_pu_bacteria 2858800743 2858802512 356
474 iso_pu_bacteria 2891048133 2891050864 356
475 iso_pu_bacteria 2896384573 2896389033 356
476 iso_pu_bacteria 2899792073 2899796060 356
477 iso_pu_bacteria 2899845264 2899850638 356
478 iso_pu_bacteria 2904578770 2904580624 356
479 iso_pu_bacteria 2915980308 2915981436 356
480 iso_pu_bacteria 2915993759 2915998697 356
481 iso_pu_bacteria 2916000859 2916003490 356
482 iso_pu_bacteria 2916007675 2916011660 356
483 iso_pu_bacteria 2916014648 2916020774 356
484 iso_pu_bacteria 2916021584 2916024961 356
485 iso_pu_bacteria 2916028427 2916033774 356
486 iso_pu_bacteria 2916035215 2916037863 356
487 iso_pu_bacteria 2916041962 2916045337 356
488 iso_pu_bacteria 2916048683 2916049039 356
489 iso_pu_bacteria 2916055098 2916055723 356
490 iso_pu_bacteria 2916061851 2916064907 356
491 iso_pu_bacteria 2916068649 2916073998 356
492 iso_pu_bacteria 2916076590 2916082595 356
493 iso_pu_bacteria 2919100787 2919107665 356
494 iso_pu_bacteria 2919114240 2919114704 356
495 iso_pu_bacteria 2919119836 2919121659 356
496 iso_pu_bacteria 2919166419 2919169235 356
497 iso_pu_bacteria 2919171160 2919174718 356
498 iso_pu_bacteria 2920760137 2920761527 356
499 iso_pu_bacteria 2920822456 2920825207 356
500 iso_pu_bacteria 2921201388 2921203055 356
501 iso_pu_bacteria 2921208531 2921211115 356
502 iso_pu_bacteria 2921237296 2921240933 356
503 iso_pu_bacteria 2921244191 2921246777 356
504 iso_pu_bacteria 2921250672 2921252083 356
505 iso_pu_bacteria 2921257292 2921261404 356
506 iso_pu_bacteria 2921263974 2921266206 356
507 iso_pu_bacteria 2921282425 2921287972 356
508 iso_pu_bacteria 2921289301 2921290959 356
509 iso_pu_bacteria 2921296804 2921298405 356
510 iso_pu_bacteria 2923556063 2923558565 356
511 iso_pu_bacteria 2924144063 2924146757 356
512 iso_pu_bacteria 2924150972 2924157995 356
513 iso_pu_bacteria 2924158325 2924159271 356
514 iso_pu_bacteria 2924165586 2924169164 356
515 iso_pu_bacteria 2924172951 2924174572 356
516 iso_pu_bacteria 2924179722 2924183003 356
517 iso_pu_bacteria 2924186466 2924192714 356
518 iso_pu_bacteria 2924193448 2924195381 356
519 iso_pu_bacteria 2924200457 2924203328 356
520 iso_pu_bacteria 2924207177 2924210747 356
521 iso_pu_bacteria 2924214083 2924217480 356
522 iso_pu_bacteria 2924221636 2924223297 356
523 iso_pu_bacteria 2924228884 2924230517 356
524 iso_pu_bacteria 2926754445 2926755720 356
525 iso_pu_bacteria 2926760298 2926762835 356
526 iso_pu_bacteria 2929138655 2929140863 356
527 iso_pu_bacteria 2933006813 2933008796 356
528 iso_pu_bacteria 2933011516 2933014926 356
529 iso_pu_bacteria 2933016740 2933019435 356
530 iso_pu_bacteria 2933570622 2933570835 356
531 iso_pu_bacteria 2933586486 2933588666 356
532 iso_pu_bacteria 2933594066 2933596603 356
533 iso_pu_bacteria 2933599457 2933600957 356
534 iso_pu_bacteria 2935894831 2935897034 356
535 iso_pu_bacteria 2935901341 2935901967 356
536 iso_pu_bacteria 2936367885 2936372046 356
537 iso_pu_bacteria 2936375103 2936379909 356
538 iso_pu_bacteria 2936381700 2936382813 356
539 iso_pu_bacteria 2936996657 2937000701 356
540 iso_pu_bacteria 2937002841 2937004563 356
541 iso_pu_bacteria 2937009748 2937011193 356
542 iso_pu_bacteria 2937016420 2937019828 356
543 iso_pu_bacteria 2937023124 2937024579 356
544 iso_pu_bacteria 2937029754 2937030282 356
545 iso_pu_bacteria 2937036028 2937042664 356
546 iso_pu_bacteria 2937042894 2937045535 356
547 iso_pu_bacteria 2937049772 2937055112 356
548 iso_pu_bacteria 2937056579 2937063575 356
549 iso_pu_bacteria 2937063883 2937067769 356
550 iso_pu_bacteria 2937071275 2937074386 356
551 iso_pu_bacteria 2937078374 2937080280 356
552 iso_pu_bacteria 2937084907 2937086021 356
553 iso_pu_bacteria 2937091812 2937097216 356
554 iso_pu_bacteria 2937098957 2937103040 356
555 iso_pu_bacteria 2937106411 2937113296 356
556 iso_pu_bacteria 2937113482 2937116149 356
557 iso_pu_bacteria 2937119839 2937121980 356
558 iso_pu_bacteria 2937126314 2937128821 356
559 iso_pu_bacteria 2941499720 2941502144 356
560 iso_pu_bacteria 2957375807 2957376389 356
561 iso_pu_bacteria 2957382221 2957384282 356
562 iso_pu_bacteria 2957388812 2957390745 356
563 iso_pu_bacteria 2957395598 2957395901 356
564 iso_pu_bacteria 2957402308 2957404507 356
565 iso_pu_bacteria 2957408893 2957412094 356
566 iso_pu_bacteria 2957415311 2957421204 356
567 iso_pu_bacteria 2957422303 2957425700 356
568 iso_pu_bacteria 2957430029 2957431711 356
569 iso_pu_bacteria 2957437181 2957438175 356
570 iso_pu_bacteria 2957443900 2957446913 356
571 iso_pu_bacteria 2957450854 2957453755 356
572 iso_pu_bacteria 2957457609 2957461620 356
573 iso_pu_bacteria 2957464669 2957467049 356
574 iso_pu_bacteria 2957471148 2957476393 356
575 iso_pu_bacteria 2957478035 2957479609 356
576 iso_pu_bacteria 2957484790 2957490467 356
577 iso_pu_bacteria 2957491536 2957494102 356
578 iso_pu_bacteria 2957498199 2957503305 356
579 iso_pu_bacteria 2957505466 2957510609 356
580 iso_pu_bacteria 2960584000 2960585413 356
581 iso_pu_bacteria 2960591022 2960592082 356
582 iso_pu_bacteria 2960597568 2960599998 356
583 iso_pu_bacteria 2960603979 2960610584 356
584 iso_pu_bacteria 2960610863 2960612321 356
585 iso_pu_bacteria 2960617483 2960620459 356
586 iso_pu_bacteria 2960624210 2960624486 356
587 iso_pu_bacteria 2960631154 2960632042 356
588 iso_pu_bacteria 2960637947 2960644129 356
589 iso_pu_bacteria 2960645483 2960648420 356
590 iso_pu_bacteria 2960652885 2960656531 356
591 iso_pu_bacteria 2960660292 2960665572 356
592 iso_pu_bacteria 2960667422 2960669653 356
593 iso_pu_bacteria 2960674078 2960675165 356
594 iso_pu_bacteria 2960680706 2960681617 356
595 iso_pu_bacteria 2960687367 2960691473 356
596 iso_pu_bacteria 2960693952 2960694807 356
597 iso_pu_bacteria 2964607997 2964609779 356
598 iso_pu_bacteria 2964615318 2964617753 356
599 iso_pu_bacteria 2964621998 2964623638 356
600 iso_pu_bacteria 2964628898 2964632581 356
601 iso_pu_bacteria 2964636051 2964640824 356
602 iso_pu_bacteria 2964643177 2964645691 356
603 iso_pu_bacteria 2964649959 2964651550 356
604 iso_pu_bacteria 2964656573 2964660520 356
605 iso_pu_bacteria 2964663802 2964666928 356
606 iso_pu_bacteria 2964670856 2964674436 356
607 iso_pu_bacteria 2964678106 2964682869 356
608 iso_pu_bacteria 2964685014 2964688477 356
609 iso_pu_bacteria 2964691889 2964692474 356
610 iso_pu_bacteria 2964698721 2964701648 356
611 iso_pu_bacteria 2964705432 2964711098 356
612 iso_pu_bacteria 2964712639 2964715165 356
613 iso_pu_bacteria 2964719344 2964720673 356
614 iso_pu_bacteria 2967664464 2967666386 356
615 iso_pu_bacteria 2967671571 2967678419 356
616 iso_pu_bacteria 2967678726 2967684431 356
617 iso_pu_bacteria 2967686174 2967689721 356
618 iso_pu_bacteria 2967693043 2967694638 356
619 iso_pu_bacteria 2967706974 2967708616 356
620 iso_pu_bacteria 2967714385 2967714869 356
621 iso_pu_bacteria 2967721400 2967726129 356
622 iso_pu_bacteria 2967728569 2967728999 356
623 iso_pu_bacteria 2967735183 2967737142 356
624 iso_pu_bacteria 2967742019 2967742549 356
625 iso_pu_bacteria 2967748971 2967751608 356
626 iso_pu_bacteria 2967755722 2967760012 356
627 iso_pu_bacteria 2967762386 2967767509 356
628 iso_pu_bacteria 2967769361 2967772126 356
629 iso_pu_bacteria 2967775926 2967782234 356
630 iso_pu_bacteria 2970019648 2970021067 356
631 iso_pu_bacteria 2970026789 2970028349 356
632 iso_pu_bacteria 2970033650 2970040284 356
633 iso_pu_bacteria 2970040964 2970042634 356
634 iso_pu_bacteria 2970047711 2970050965 356
635 iso_pu_bacteria 2970054988 2970056695 356
636 iso_pu_bacteria 2970061556 2970067137 356
637 iso_pu_bacteria 2970068827 2970071581 356
638 iso_pu_bacteria 2970076120 2970078257 356
639 iso_pu_bacteria 2970082768 2970085239 356
640 iso_pu_bacteria 2970088815 2970092541 356
641 iso_pu_bacteria 2970095765 2970102161 356
642 iso_pu_bacteria 2970102677 2970108004 356
643 iso_pu_bacteria 2970109326 2970110703 356
644 iso_pu_bacteria 2970116247 2970117349 356
645 iso_pu_bacteria 2970122695 2970125828 356
646 iso_pu_bacteria 2970129317 2970131171 356
647 iso_pu_bacteria 2970136068 2970136287 356
648 iso_pu_bacteria 2970143518 2970146734 356
649 iso_pu_bacteria 2970149975 2970151621 356
650 iso_pu_bacteria 2970156795 2970159562 356
651 iso_pu_bacteria 2970164137 2970166983 356
652 iso_pu_bacteria 2970170962 2970174237 356
653 iso_pu_bacteria 2970177841 2970180819 356
654 iso_pu_bacteria 2970184632 2970189164 356
655 iso_pu_bacteria 2970191845 2970193594 356
656 iso_pu_bacteria 2977516862 2977519110 356
657 iso_pu_bacteria 2977523885 2977526323 356
658 iso_pu_bacteria 2977537788 2977539620 356
659 iso_pu_bacteria 2977544691 2977546354 356
660 iso_pu_bacteria 2977551784 2977558426 356
661 iso_pu_bacteria 2977558990 2977564447 356
662 iso_pu_bacteria 2977565890 2977567659 356
663 iso_pu_bacteria 2977572785 2977575752 356
664 iso_pu_bacteria 2977579622 2977582003 356
665 iso_pu_bacteria 2978969890 2978974611 356
666 iso_pu_bacteria 2979089926 2979094672 356
667 iso_pu_bacteria 2979095461 2979100763 356
668 iso_pu_bacteria 2979100975 2979103907 356
669 iso_pu_bacteria 2984509177 2984511526 356
670 iso_pu_bacteria 2984518228 2984522113 356
671 iso_pu_bacteria 2984537506 2984541411 356
672 iso_pu_bacteria 2984587000 2984589932 356
673 iso_pu_bacteria 2984601300 2984603689 356
674 iso_pu_bacteria 2989771324 2989774279 356
675 iso_pu_bacteria 2995392953 2995393041 356
676 iso_pu_bacteria 2996887358 2996889046 356
677 iso_pu_bacteria 2996893221 2996894339 356
678 iso_pu_bacteria 3003930520 3003934058 356
679 iso_pu_bacteria 3005409236 3005414608 356
680 iso_pu_bacteria 3005445848 3005448438 356
681 iso_pu_bacteria 3005452660 3005454628 356
682 iso_pu_bacteria 639633055 639649180 356
683 iso_pu_bacteria 648276728 648739206 356
684 iso_pu_bacteria 650716007 650740551 356
685 iso_pu_bacteria 8003570095 8003571616 356
686 iso_pu_bacteria 8003992118 8003994160 356
687 iso_pu_bacteria 8003999396 8004001792 356
688 iso_pu_bacteria 8005258706 8005260297 356
689 iso_pu_bacteria 8005275841 8005281198 356
690 iso_pu_bacteria 8005282627 8005283266 356
691 iso_pu_bacteria 8005289223 8005293628 356
692 iso_pu_bacteria 8005301065 8005303113 356
693 iso_pu_bacteria 8005307578 8005312822 356
694 iso_pu_bacteria 8005321885 8005323573 356
695 iso_pu_bacteria 8005376324 8005380916 356
696 iso_pu_bacteria 8005382845 8005389134 356
697 iso_pu_bacteria 8005395548 8005396114 356
698 iso_pu_bacteria 8005430974 8005435145 356
699 iso_pu_bacteria 8005460587 8005463675 356
700 iso_pu_bacteria 8005497431 8005500887 356
701 iso_pu_bacteria 8005542996 8005545610 356
702 iso_pu_bacteria 8005556819 8005557027 356
703 iso_pu_bacteria 8005563573 8005567981 356
704 iso_pu_bacteria 8005570704 8005573474 356
705 iso_pu_bacteria 8005619151 8005622260 356
706 iso_pu_bacteria 8005626139 8005632260 356
707 iso_pu_bacteria 8005668836 8005672304 356
708 iso_pu_bacteria 8005688590 8005692119 356
709 iso_pu_bacteria 8005695170 8005697388 356
710 iso_pu_bacteria 8018127388 8018134082 356
711 iso_pu_bacteria 8018150411 8018153220 356
712 iso_pu_bacteria 8018163183 8018164638 356
713 iso_pu_bacteria 8018176218 8018181337 356
714 iso_pu_bacteria 8023680758 8023683180 356
715 iso_pu_bacteria 8024479707 8024482875 356
716 iso_pu_bacteria 8024486573 8024488019 356
717 iso_pu_bacteria 8024501048 8024504411 356
718 iso_pu_bacteria 8046767195 8046771925 356
719 iso_pu_bacteria 8054460903 8054462967 356
720 iso_pu_bacteria 8054558443 8054562935 356
721 iso_pu_bacteria 8056375014 8056375922 356
722 iso_pu_bacteria 8056382006 8056386713 356
723 iso_pu_bacteria 8056875544 8056877305 356
724 iso_pu_bacteria 8057575449 8057575745 356
725 iso_pu_bacteria 8057874678 8057877686 356
726 3300001979 JGI24740J21852_10000015 JGI24740J21852_1000001536 357
727 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001286 357
728 3300002705 JGI25156J39149_1000001 JGI25156J39149_100000147 357
729 3300002737 JGI25162J39368_1000366 JGI25162J39368_100036629 357
730 3300002737 JGI25162J39368_1000368 JGI25162J39368_100036827 357
731 3300002738 JGI25154J39366_1000122 JGI25154J39366_100012210 357
732 3300002741 JGI25157J39369_1000044 JGI25157J39369_100004446 357
733 3300003187 JGI25151J46595_10016744 JGI25151J46595_100167443 357
734 3300003214 JGI25165J46597_1000516 JGI25165J46597_10005167 357
735 3300003214 JGI25165J46597_1001042 JGI25165J46597_10010428 357
736 3300003316 rootH1_10118411 rootH1_101184112 357
737 3300003320 rootH2_10034283 rootH2_100342832 357
738 3300003322 rootL2_10006964 rootL2_100069648 357
739 3300009092 Ga0105250_10057240 Ga0105250_100572401 357
740 3300013100 Ga0157373_10090682 Ga0157373_100906821 357
741 3300025206 Ga0209435_100012 Ga0209435_100012337 357
742 3300025233 Ga0209437_100051 Ga0209437_100051334 357
743 3300025233 Ga0209437_100098 Ga0209437_100098174 357
744 3300025246 Ga0209646_1000026 Ga0209646_1000026337 357
745 3300025246 Ga0209646_1001199 Ga0209646_10011996 357
746 3300025250 Ga0209026_1000014 Ga0209026_1000014337 357
747 3300025256 Ga0209759_1000012 Ga0209759_1000012337 357
748 3300025261 Ga0209233_1000095 Ga0209233_1000095291 357
749 3300025261 Ga0209233_1000113 Ga0209233_10001139 357
750 3300025294 Ga0209025_1000140 Ga0209025_100014077 357
751 3300027312 Ga0209371_1004133 Ga0209371_10041333 357
752 3300030500 Ga0268256_1003875 Ga0268256_10038753 357
753 3300041404 Ga0439436_0009397 Ga0439436_0009397_1652_2773 357
754 3300044694 Ga0466963_0123948 Ga0466963_0123948_194_1315 357
755 3300044765 Ga0466970_0071921 Ga0466970_0071921_258_1379 357
756 3300044842 Ga0466957_0040532 Ga0466957_0040532_1283_2404 357
757 3300045836 Ga0466958_0122257 Ga0466958_0122257_42_1163 357
758 3300046683 Ga0495658_0053111 Ga0495658_0053111_758_1855 357
759 3300048920 Ga0496117_0020764 Ga0496117_0020764_670_1791 357
760 3300048922 Ga0496119_0017375 Ga0496119_0017375_409_1530 357
761 3300048925 Ga0496122_0000190 Ga0496122_0000190_124639_125760 357
762 3300048925 Ga0496122_0079953 Ga0496122_0079953_486_1607 357
763 3300048926 Ga0496123_0000336 Ga0496123_0000336_8635_9756 357
764 3300048926 Ga0496123_0112305 Ga0496123_0112305_14_1135 357
765 3300048927 Ga0496124_0008840 Ga0496124_0008840_8626_9747 357
766 3300048927 Ga0496124_0126002 Ga0496124_0126002_289_1410 357
767 3300048928 Ga0496125_0000248 Ga0496125_0000248_100931_102052 357
768 3300048929 Ga0496126_0000866 Ga0496126_0000866_8668_9789 357
769 3300048929 Ga0496126_0014931 Ga0496126_0014931_5286_6407 357
770 3300049572 Ga0501036_0142376 Ga0501036_0142376_697_1812 357
771 3300053125 Ga0500618_026147 Ga0500618_026147_244_1365 357
772 iso_pu_bacteria 2513237087 2513590302 357
773 iso_pu_bacteria 2791355082 2792585134 357
774 iso_pu_bacteria 2802429268 2804752745 357
775 iso_pu_bacteria 2828305725 2828308674 357
776 iso_pu_bacteria 2913295892 2913299318 357
777 iso_pu_bacteria 8049293176 8049295314 357
778 3300002739 JGI25158J39367_1000038 JGI25158J39367_10000389 358
779 3300002773 JGI25152J39213_1001315 JGI25152J39213_10013152 358
780 3300002773 JGI25152J39213_1003453 JGI25152J39213_10034534 358
781 3300002987 JGI25159J45721_1000014 JGI25159J45721_100001450 358
782 3300002987 JGI25159J45721_1000154 JGI25159J45721_10001545 358
783 3300003187 JGI25151J46595_10000839 JGI25151J46595_1000083911 358
784 3300003187 JGI25151J46595_10021278 JGI25151J46595_100212781 358
785 3300003187 JGI25151J46595_10021451 JGI25151J46595_100214512 358
786 3300003187 JGI25151J46595_10031522 JGI25151J46595_100315222 358
787 3300003214 JGI25165J46597_1002493 JGI25165J46597_10024934 358
788 3300003215 JGI25153J46596_10003837 JGI25153J46596_100038376 358
789 3300003215 JGI25153J46596_10010733 JGI25153J46596_100107332 358
790 3300003215 JGI25153J46596_10011201 JGI25153J46596_100112012 358
791 3300003323 rootH1_10280226 rootH1_102802262 358
792 3300003354 JGI25160J50197_1000020 JGI25160J50197_100002050 358
793 3300003354 JGI25160J50197_1012216 JGI25160J50197_10122162 358
794 3300003374 JGI25161J50226_1000174 JGI25161J50226_100017431 358
795 3300003374 JGI25161J50226_1001510 JGI25161J50226_10015102 358
796 3300003771 Ga0055526_1000597 Ga0055526_100059718 358
797 3300003771 Ga0055526_1001490 Ga0055526_10014904 358
798 3300003771 Ga0055526_1003626 Ga0055526_10036268 358
799 3300003775 Ga0055524_1001814 Ga0055524_100181410 358
800 3300003775 Ga0055524_1004279 Ga0055524_10042793 358
801 3300003775 Ga0055524_1004359 Ga0055524_10043592 358
802 3300003781 Ga0055536_1000497 Ga0055536_10004973 358
803 3300003781 Ga0055536_1005415 Ga0055536_10054152 358
804 3300003790 Ga0055528_1002181 Ga0055528_10021818 358
805 3300003790 Ga0055528_1005558 Ga0055528_10055582 358
806 3300003790 Ga0055528_1011408 Ga0055528_10114082 358
807 3300003790 Ga0055528_1014643 Ga0055528_10146432 358
808 3300003790 Ga0055528_1015571 Ga0055528_10155712 358
809 3300003791 Ga0055530_10008497 Ga0055530_100084972 358
810 3300003792 Ga0055540_1000929 Ga0055540_10009298 358
811 3300003792 Ga0055540_1003312 Ga0055540_10033126 358
812 3300003792 Ga0055540_1019170 Ga0055540_10191703 358
813 3300003794 Ga0055531_10002881 Ga0055531_100028816 358
814 3300003794 Ga0055531_10008844 Ga0055531_100088443 358
815 3300003856 Ga0058692_1004850 Ga0058692_10048502 358
816 3300004625 Ga0055543_1000047 Ga0055543_100004748 358
817 3300004625 Ga0055543_1000350 Ga0055543_10003502 358
818 3300004625 Ga0055543_1000500 Ga0055543_100050011 358
819 3300005262 Ga0065165_1000013 Ga0065165_1000013170 358
820 3300005262 Ga0065165_1008935 Ga0065165_10089354 358
821 3300005262 Ga0065165_1011468 Ga0065165_10114682 358
822 3300005262 Ga0065165_1012221 Ga0065165_10122213 358
823 3300005367 Ga0070667_100073818 Ga0070667_1000738183 358
824 3300005563 Ga0068855_100039045 Ga0068855_1000390455 358
825 3300005563 Ga0068855_100059286 Ga0068855_1000592863 358
826 3300006038 Ga0075365_10004585 Ga0075365_100045855 358
827 3300006042 Ga0075368_10003767 Ga0075368_100037672 358
828 3300006048 Ga0075363_100095574 Ga0075363_1000955742 358
829 3300006353 Ga0075370_10091011 Ga0075370_100910112 358
830 3300006946 Ga0079104_1000193 Ga0079104_100019362 358
831 3300006946 Ga0079104_1001253 Ga0079104_10012536 358
832 3300006948 Ga0099826_10039284 Ga0099826_100392842 358
833 3300009093 Ga0105240_10000076 Ga0105240_10000076155 358
834 3300009148 Ga0105243_10215381 Ga0105243_102153811 358
835 3300009545 Ga0105237_10000226 Ga0105237_1000022640 358
836 3300009765 Ga0123341_1000007 Ga0123341_100000790 358
837 3300009766 Ga0123342_1004784 Ga0123342_100478416 358
838 3300009766 Ga0123342_1022907 Ga0123342_10229073 358
839 3300010375 Ga0105239_10000641 Ga0105239_1000064112 358
840 3300013102 Ga0157371_10004510 Ga0157371_100045109 358
841 3300013104 Ga0157370_10000455 Ga0157370_1000045536 358
842 3300013105 Ga0157369_10043175 Ga0157369_100431754 358
843 3300013105 Ga0157369_10354095 Ga0157369_103540951 358
844 3300013249 Ga0171463_1003 Ga0171463_1003171 358
845 3300015262 Ga0182007_10001815 Ga0182007_100018157 358
846 3300015265 Ga0182005_1005015 Ga0182005_10050152 358
847 3300015690 Ga0183363_1025 Ga0183363_102546 358
848 3300021327 Ga0214543_1000038 Ga0214543_100003873 358
849 3300022739 Ga0228711_1000008 Ga0228711_100000844 358
850 3300022740 Ga0228710_1000009 Ga0228710_100000943 358
851 3300025208 Ga0209436_100150 Ga0209436_10015027 358
852 3300025245 Ga0207425_1001337 Ga0207425_100133710 358
853 3300025245 Ga0207425_1004121 Ga0207425_10041213 358
854 3300025258 Ga0209129_1000524 Ga0209129_10005243 358
855 3300025258 Ga0209129_1001868 Ga0209129_10018685 358
856 3300025258 Ga0209129_1002344 Ga0209129_10023444 358
857 3300025258 Ga0209129_1004509 Ga0209129_10045093 358
858 3300025261 Ga0209233_1000427 Ga0209233_100042710 358
859 3300025273 Ga0209673_1000010 Ga0209673_1000010207 358
860 3300025273 Ga0209673_1000117 Ga0209673_100011787 358
861 3300025273 Ga0209673_1000151 Ga0209673_100015164 358
862 3300025273 Ga0209673_1000863 Ga0209673_100086323 358
863 3300025273 Ga0209673_1001685 Ga0209673_100168510 358
864 3300025284 Ga0209130_1000020 Ga0209130_1000020259 358
865 3300025284 Ga0209130_1000034 Ga0209130_1000034165 358
866 3300025284 Ga0209130_1013282 Ga0209130_10132822 358
867 3300025291 Ga0209675_1011031 Ga0209675_10110312 358
868 3300025292 Ga0209676_1000482 Ga0209676_100048238 358
869 3300025292 Ga0209676_1011056 Ga0209676_10110563 358
870 3300025292 Ga0209676_1031573 Ga0209676_10315731 358
871 3300025292 Ga0209676_1041343 Ga0209676_10413432 358
872 3300025294 Ga0209025_1000314 Ga0209025_100031427 358
873 3300025294 Ga0209025_1000506 Ga0209025_100050610 358
874 3300025294 Ga0209025_1003183 Ga0209025_10031839 358
875 3300025294 Ga0209025_1005402 Ga0209025_10054029 358
876 3300025294 Ga0209025_1028383 Ga0209025_10283832 358
877 3300025295 Ga0209564_1000013 Ga0209564_1000013164 358
878 3300025295 Ga0209564_1000647 Ga0209564_100064719 358
879 3300025295 Ga0209564_1001780 Ga0209564_10017808 358
880 3300025295 Ga0209564_1001993 Ga0209564_10019939 358
881 3300025295 Ga0209564_1009159 Ga0209564_10091592 358
882 3300025297 Ga0209758_1000413 Ga0209758_100041339 358
883 3300025297 Ga0209758_1000655 Ga0209758_100065510 358
884 3300025297 Ga0209758_1001882 Ga0209758_100188210 358
885 3300025297 Ga0209758_1002154 Ga0209758_100215410 358
886 3300025297 Ga0209758_1003547 Ga0209758_10035479 358
887 3300025297 Ga0209758_1025944 Ga0209758_10259442 358
888 3300025298 Ga0209050_1000646 Ga0209050_100064625 358
889 3300025298 Ga0209050_1004392 Ga0209050_10043925 358
890 3300025299 Ga0209256_1001653 Ga0209256_100165316 358
891 3300025299 Ga0209256_1001736 Ga0209256_100173616 358
892 3300025299 Ga0209256_1002712 Ga0209256_10027126 358
893 3300025299 Ga0209256_1003882 Ga0209256_10038828 358
894 3300025299 Ga0209256_1004803 Ga0209256_10048032 358
895 3300025302 Ga0207426_1000006 Ga0207426_1000006538 358
896 3300025302 Ga0207426_1000008 Ga0207426_1000008327 358
897 3300025302 Ga0207426_1000221 Ga0207426_1000221120 358
898 3300025303 Ga0209051_1000097 Ga0209051_100009755 358
899 3300025303 Ga0209051_1000314 Ga0209051_100031423 358
900 3300025303 Ga0209051_1004880 Ga0209051_10048803 358
901 3300025303 Ga0209051_1006481 Ga0209051_10064812 358
902 3300025303 Ga0209051_1008689 Ga0209051_10086892 358
903 3300025304 Ga0209257_1001142 Ga0209257_100114219 358
904 3300025304 Ga0209257_1002070 Ga0209257_100207011 358
905 3300025304 Ga0209257_1008609 Ga0209257_10086093 358
906 3300025913 Ga0207695_10000011 Ga0207695_1000001146 358
907 3300025914 Ga0207671_10000093 Ga0207671_1000009386 358
908 3300025949 Ga0207667_10038259 Ga0207667_100382593 358
909 3300025949 Ga0207667_10078464 Ga0207667_100784642 358
910 3300026078 Ga0207702_10166063 Ga0207702_101660632 358
911 3300027111 Ga0209281_1000034 Ga0209281_100003462 358
912 3300027111 Ga0209281_1000106 Ga0209281_1000106188 358
913 3300027111 Ga0209281_1000318 Ga0209281_100031831 358
914 3300027312 Ga0209371_1003359 Ga0209371_10033596 358
915 3300027666 Ga0209282_1000024 Ga0209282_1000024119 358
916 3300028794 Ga0307515_10001978 Ga0307515_1000197820 358
917 3300028794 Ga0307515_10007368 Ga0307515_1000736810 358
918 3300028794 Ga0307515_10030752 Ga0307515_100307526 358
919 3300030500 Ga0268256_1003591 Ga0268256_10035916 358
920 3300030744 Ga0316181_1120346 Ga0316181_11203462 358
921 3300031456 Ga0307513_10010539 Ga0307513_100105396 358
922 3300031456 Ga0307513_10286834 Ga0307513_102868341 358
923 3300031548 Ga0307408_100070114 Ga0307408_1000701142 358
924 3300031911 Ga0307412_10162794 Ga0307412_101627942 358
925 3300031967 Ga0315914_1000012 Ga0315914_100001244 358
926 3300032002 Ga0307416_100168787 Ga0307416_1001687872 358
927 3300033180 Ga0307510_10214573 Ga0307510_102145732 358
928 3300033430 Ga0315913_1000006 Ga0315913_100000644 358
929 3300033464 Ga0315915_1000010 Ga0315915_1000010221 358
930 3300041413 Ga0439465_0002128 Ga0439465_0002128_1401_2525 358
931 3300041413 Ga0439465_0007342 Ga0439465_0007342_1119_2243 358
932 3300041413 Ga0439465_0045564 Ga0439465_0045564_249_1373 358
933 3300041496 Ga0451839_0580770 Ga0451839_0580770_79_1203 358
934 3300041501 Ga0451845_0247449 Ga0451845_0247449_22_1146 358
935 3300041503 Ga0451847_0129796 Ga0451847_0129796_909_2033 358
936 3300041507 Ga0451851_1171717 Ga0451851_1171717_265_1389 358
937 3300041512 Ga0451853_0242170 Ga0451853_0242170_356_1480 358
938 3300042007 Ga0439449_0036823 Ga0439449_0036823_195_1319 358
939 3300042015 Ga0439462_0028778 Ga0439462_0028778_332_1456 358
940 3300042145 Ga0450906_003061 Ga0450906_003061_869_1993 358
941 3300042435 Ga0439434_0010648 Ga0439434_0010648_451_1575 358
942 3300046454 Ga0495592_0069851 Ga0495592_0069851_599_1723 358
943 3300046460 Ga0495638_0003695 Ga0495638_0003695_1169_2293 358
944 3300046460 Ga0495638_0008934 Ga0495638_0008934_5802_6926 358
945 3300046460 Ga0495638_0116317 Ga0495638_0116317_18_1142 358
946 3300046474 Ga0495605_0001952 Ga0495605_0001952_10246_11370 358
947 3300046476 Ga0495662_0006938 Ga0495662_0006938_2398_3522 358
948 3300046492 Ga0495585_0013529 Ga0495585_0013529_3008_4132 358
949 3300046492 Ga0495585_0105092 Ga0495585_0105092_234_1358 358
950 3300046506 Ga0495583_0039022 Ga0495583_0039022_885_2009 358
951 3300046507 Ga0495606_0024450 Ga0495606_0024450_254_1378 358
952 3300046512 Ga0495610_0001969 Ga0495610_0001969_1309_2433 358
953 3300046518 Ga0495631_0018333 Ga0495631_0018333_1005_2129 358
954 3300046518 Ga0495631_0048409 Ga0495631_0048409_639_1763 358
955 3300046519 Ga0495632_0045086 Ga0495632_0045086_503_1627 358
956 3300046522 Ga0495643_0002725 Ga0495643_0002725_7617_8741 358
957 3300046522 Ga0495643_0042055 Ga0495643_0042055_1332_2456 358
958 3300046530 Ga0495654_0000110 Ga0495654_0000110_56603_57742 358
959 3300046536 Ga0495587_0057656 Ga0495587_0057656_386_1510 358
960 3300046538 Ga0495609_0069379 Ga0495609_0069379_404_1528 358
961 3300046616 Ga0495668_0043958 Ga0495668_0043958_1124_2248 358
962 3300046660 Ga0495625_0001387 Ga0495625_0001387_28381_29505 358
963 3300046660 Ga0495625_0016011 Ga0495625_0016011_301_1425 358
964 3300046683 Ga0495658_0109237 Ga0495658_0109237_329_1453 358
965 3300046691 Ga0495670_0043399 Ga0495670_0043399_399_1523 358
966 3300046810 Ga0495660_0069277 Ga0495660_0069277_677_1801 358
967 3300047320 Ga0495672_0063455 Ga0495672_0063455_718_1842 358
968 3300047472 Ga0495686_0002729 Ga0495686_0002729_8541_9665 358
969 3300047472 Ga0495686_0027671 Ga0495686_0027671_314_1438 358
970 3300047472 Ga0495686_0081202 Ga0495686_0081202_838_1968 358
971 3300048091 Ga0495626_0062634 Ga0495626_0062634_364_1488 358
972 3300048903 Ga0496100_0275748 Ga0496100_0275748_86_1210 358
973 3300048905 Ga0496102_0206606 Ga0496102_0206606_545_1669 358
974 3300048909 Ga0496106_0000982 Ga0496106_0000982_9632_10756 358
975 3300048917 Ga0496114_0110677 Ga0496114_0110677_83_1207 358
976 3300048919 Ga0496116_0000142 Ga0496116_0000142_101346_102482 358
977 3300048919 Ga0496116_0054835 Ga0496116_0054835_1250_2374 358
978 3300048919 Ga0496116_0145923 Ga0496116_0145923_129_1253 358
979 3300048920 Ga0496117_0001574 Ga0496117_0001574_8862_9986 358
980 3300048920 Ga0496117_0019627 Ga0496117_0019627_2846_3970 358
981 3300048920 Ga0496117_0070011 Ga0496117_0070011_458_1582 358
982 3300048921 Ga0496118_0008894 Ga0496118_0008894_8681_9805 358
983 3300048921 Ga0496118_0031016 Ga0496118_0031016_2607_3731 358
984 3300048921 Ga0496118_0053725 Ga0496118_0053725_934_2058 358
985 3300048921 Ga0496118_0133076 Ga0496118_0133076_114_1253 358
986 3300048923 Ga0496120_0111746 Ga0496120_0111746_124_1248 358
987 3300048924 Ga0496121_0037820 Ga0496121_0037820_2678_3817 358
988 3300048924 Ga0496121_0047624 Ga0496121_0047624_1360_2484 358
989 3300048924 Ga0496121_0215751 Ga0496121_0215751_111_1250 358
990 3300048925 Ga0496122_0048385 Ga0496122_0048385_425_1549 358
991 3300048925 Ga0496122_0064502 Ga0496122_0064502_456_1595 358
992 3300048925 Ga0496122_0083845 Ga0496122_0083845_604_1728 358
993 3300048925 Ga0496122_0102039 Ga0496122_0102039_699_1835 358
994 3300048926 Ga0496123_0024244 Ga0496123_0024244_3259_4395 358
995 3300048926 Ga0496123_0090207 Ga0496123_0090207_115_1239 358
996 3300048927 Ga0496124_0001040 Ga0496124_0001040_8097_9233 358
997 3300048927 Ga0496124_0009838 Ga0496124_0009838_7799_8923 358
998 3300048927 Ga0496124_0015066 Ga0496124_0015066_5331_6455 358
999 3300048927 Ga0496124_0088148 Ga0496124_0088148_945_2069 358
1000 3300048927 Ga0496124_0147634 Ga0496124_0147634_664_1788 358
1001 3300048928 Ga0496125_0029309 Ga0496125_0029309_391_1515 358
1002 3300048929 Ga0496126_0001294 Ga0496126_0001294_8232_9368 358
1003 3300049459 Ga0495678_005392 Ga0495678_005392_1160_2284 358
1004 3300049570 Ga0501033_0001862 Ga0501033_0001862_7917_9041 358
1005 3300049822 Ga0501035_0000584 Ga0501035_0000584_2521_3645 358
1006 3300050489 nmdc:mga03683_2117_c1 nmdc:mga03683_2117_c1_2558_3682 358
1007 3300050490 nmdc:mga03n38_29204_c1 nmdc:mga03n38_29204_c1_860_1984 358
1008 3300050491 nmdc:mga00v17_156564_c1 nmdc:mga00v17_156564_c1_166_1302 358
1009 3300050492 nmdc:mga0yw44_119621_c1 nmdc:mga0yw44_119621_c1_84_1211 358
1010 3300050492 nmdc:mga0yw44_73499_c1 nmdc:mga0yw44_73499_c1_431_1555 358
1011 3300050496 nmdc:mga07m45_93189_c1 nmdc:mga07m45_93189_c1_128_1252 358
1012 3300050516 nmdc:mga0sz30_60381_c1 nmdc:mga0sz30_60381_c1_86_1222 358
1013 3300053109 Ga0500569_019514 Ga0500569_019514_137_1261 358
1014 3300053122 Ga0500608_022262 Ga0500608_022262_655_1779 358
1015 3300053134 Ga0500658_0000526 Ga0500658_0000526_13805_14929 358
1016 3300053136 Ga0500559_0002861 Ga0500559_0002861_7207_8334 358
1017 3300053139 Ga0500568_0022079 Ga0500568_0022079_1166_2290 358
1018 3300053139 Ga0500568_0023876 Ga0500568_0023876_375_1499 358
1019 3300053140 Ga0500573_0001766 Ga0500573_0001766_8230_9357 358
1020 3300053151 Ga0500604_0025382 Ga0500604_0025382_336_1460 358
1021 3300053153 Ga0500616_0000277 Ga0500616_0000277_30962_32086 358
1022 3300053153 Ga0500616_0004617 Ga0500616_0004617_7445_8569 358
1023 3300053153 Ga0500616_0055546 Ga0500616_0055546_11_1135 358
1024 3300053156 Ga0500622_0000458 Ga0500622_0000458_28064_29188 358
1025 3300053156 Ga0500622_0000627 Ga0500622_0000627_571_1695 358
1026 3300005435 Ga0070714_100058991 Ga0070714_1000589913 359
1027 3300021320 Ga0214544_1001800 Ga0214544_100180022 359
1028 3300021321 Ga0214542_1000012 Ga0214542_100001294 359
1029 3300021327 Ga0214543_1000024 Ga0214543_100002495 359
1030 3300025915 Ga0207693_10013345 Ga0207693_100133453 359
1031 3300035083 Ga0373926_0004868 Ga0373926_0004868_2049_3146 359
1032 3300035692 Ga0373935_0023830 Ga0373935_0023830_462_1559 359
1033 3300035725 Ga0373947_0085441 Ga0373947_0085441_849_1946 359
1034 3300046460 Ga0495638_0035932 Ga0495638_0035932_238_1383 359
1035 3300046472 Ga0495580_0098448 Ga0495580_0098448_568_1665 359
1036 3300046473 Ga0495582_0017971 Ga0495582_0017971_304_1401 359
1037 3300046476 Ga0495662_0014082 Ga0495662_0014082_1096_2193 359
1038 3300046477 Ga0495664_0002940 Ga0495664_0002940_3154_4251 359
1039 3300046533 Ga0495640_0008740 Ga0495640_0008740_1251_2348 359
1040 3300046681 Ga0495647_0004833 Ga0495647_0004833_795_1892 359
1041 3300046690 Ga0495624_0029990 Ga0495624_0029990_2320_3417 359
1042 3300047319 Ga0495674_0019302 Ga0495674_0019302_580_1677 359
1043 3300047321 Ga0495676_0039718 Ga0495676_0039718_1020_2117 359
1044 3300048089 Ga0495614_0023721 Ga0495614_0023721_589_1686 359
1045 3300048929 Ga0496126_0247101 Ga0496126_0247101_113_1243 359
1046 3300049571 Ga0501034_0243144 Ga0501034_0243144_118_1248 359
1047 3300049742 Ga0501080_0374935 Ga0501080_0374935_160_1254 359
1048 iso_pu_bacteria 2524023209 2524459581 359
1049 3300031239 Ga0265328_10000786 Ga0265328_100007866 360
1050 3300031239 Ga0265328_10021456 Ga0265328_100214562 360
1051 3300031250 Ga0265331_10001293 Ga0265331_100012935 360
1052 3300031251 Ga0265327_10069561 Ga0265327_100695612 360
1053 3300031344 Ga0265316_10109642 Ga0265316_101096422 360
1054 3300046536 Ga0495587_0011251 Ga0495587_0011251_1530_2621 360
1055 3300053111 Ga0500572_004012 Ga0500572_004012_336_1499 360
1056 3300053177 Ga0500636_0000180 Ga0500636_0000180_19997_21163 360
1057 3300053177 Ga0500636_0001459 Ga0500636_0001459_3328_4491 360
1058 3300044684 Ga0466966_0030974 Ga0466966_0030974_1902_3011 363
1059 iso_pu_bacteria 2919450847 2919452463 363
1060 iso_pu_bacteria 8001845381 8001846145 363
1061 3300003911 JGI25405J52794_10004407 JGI25405J52794_100044072 364
1062 3300005328 Ga0070676_10032562 Ga0070676_100325622 364
1063 3300005330 Ga0070690_100031150 Ga0070690_1000311502 364
1064 3300005334 Ga0068869_100056304 Ga0068869_1000563043 364
1065 3300005335 Ga0070666_10018983 Ga0070666_100189832 364
1066 3300005337 Ga0070682_100074471 Ga0070682_1000744712 364
1067 3300005339 Ga0070660_100043329 Ga0070660_1000433293 364
1068 3300005340 Ga0070689_100037552 Ga0070689_1000375522 364
1069 3300005343 Ga0070687_100020607 Ga0070687_1000206072 364
1070 3300005344 Ga0070661_100083856 Ga0070661_1000838561 364
1071 3300005355 Ga0070671_100023087 Ga0070671_1000230873 364
1072 3300005364 Ga0070673_100008972 Ga0070673_1000089725 364
1073 3300005365 Ga0070688_100023145 Ga0070688_1000231452 364
1074 3300005434 Ga0070709_10009235 Ga0070709_100092354 364
1075 3300005435 Ga0070714_100013931 Ga0070714_1000139313 364
1076 3300005436 Ga0070713_100002582 Ga0070713_1000025823 364
1077 3300005437 Ga0070710_10002708 Ga0070710_100027085 364
1078 3300005439 Ga0070711_100086466 Ga0070711_1000864662 364
1079 3300005456 Ga0070678_100008371 Ga0070678_1000083713 364
1080 3300005466 Ga0070685_10013452 Ga0070685_100134522 364
1081 3300005547 Ga0070693_100039225 Ga0070693_1000392252 364
1082 3300005548 Ga0070665_100053711 Ga0070665_1000537113 364
1083 3300005614 Ga0068856_100133294 Ga0068856_1001332941 364
1084 3300005842 Ga0068858_100099299 Ga0068858_1000992991 364
1085 3300005843 Ga0068860_100033225 Ga0068860_1000332254 364
1086 3300006028 Ga0070717_10002936 Ga0070717_100029367 364
1087 3300006163 Ga0070715_10001339 Ga0070715_100013393 364
1088 3300006173 Ga0070716_100004734 Ga0070716_1000047343 364
1089 3300006237 Ga0097621_100017219 Ga0097621_1000172194 364
1090 3300006358 Ga0068871_100028379 Ga0068871_1000283794 364
1091 3300006881 Ga0068865_100020024 Ga0068865_1000200242 364
1092 3300009011 Ga0105251_10029607 Ga0105251_100296073 364
1093 3300009094 Ga0111539_10432145 Ga0111539_104321452 364
1094 3300009174 Ga0105241_10009439 Ga0105241_100094395 364
1095 3300009176 Ga0105242_10012804 Ga0105242_100128043 364
1096 3300009177 Ga0105248_10043884 Ga0105248_100438843 364
1097 3300009545 Ga0105237_10011347 Ga0105237_100113473 364
1098 3300012507 Ga0157342_1000277 Ga0157342_10002772 364
1099 3300013105 Ga0157369_10191156 Ga0157369_101911561 364
1100 3300013296 Ga0157374_10116632 Ga0157374_101166323 364
1101 3300017792 Ga0163161_10023487 Ga0163161_100234872 364
1102 3300025903 Ga0207680_10014997 Ga0207680_100149973 364
1103 3300025905 Ga0207685_10013233 Ga0207685_100132332 364
1104 3300025906 Ga0207699_10004930 Ga0207699_100049303 364
1105 3300025911 Ga0207654_10045739 Ga0207654_100457392 364
1106 3300025915 Ga0207693_10007487 Ga0207693_100074873 364
1107 3300025927 Ga0207687_10004506 Ga0207687_100045067 364
1108 3300025928 Ga0207700_10001137 Ga0207700_1000113712 364
1109 3300025929 Ga0207664_10027404 Ga0207664_100274042 364
1110 3300025931 Ga0207644_10005542 Ga0207644_100055424 364
1111 3300025933 Ga0207706_10042916 Ga0207706_100429163 364
1112 3300025934 Ga0207686_10012409 Ga0207686_100124094 364
1113 3300025939 Ga0207665_10001484 Ga0207665_100014847 364
1114 3300025942 Ga0207689_10043368 Ga0207689_100433683 364
1115 3300025945 Ga0207679_10010295 Ga0207679_100102952 364
1116 3300025960 Ga0207651_10138038 Ga0207651_101380382 364
1117 3300026035 Ga0207703_10012070 Ga0207703_100120703 364
1118 3300026078 Ga0207702_10099863 Ga0207702_100998632 364
1119 3300026088 Ga0207641_10019300 Ga0207641_100193003 364
1120 3300026089 Ga0207648_10042100 Ga0207648_100421002 364
1121 3300026121 Ga0207683_10006919 Ga0207683_100069194 364
1122 3300028379 Ga0268266_10019605 Ga0268266_100196053 364
1123 3300028381 Ga0268264_10165969 Ga0268264_101659691 364
1124 3300034819 Ga0373958_0002015 Ga0373958_0002015_741_1835 364
1125 3300035084 Ga0373928_0008008 Ga0373928_0008008_783_1877 364
1126 3300035116 Ga0373945_0001892 Ga0373945_0001892_2097_3191 364
1127 3300035117 Ga0373953_0064709 Ga0373953_0064709_143_1237 364
1128 3300035171 Ga0373946_0012729 Ga0373946_0012729_1854_2948 364
1129 3300035242 Ga0373962_0002284 Ga0373962_0002284_309_1403 364
1130 3300035695 Ga0373927_0062283 Ga0373927_0062283_315_1409 364
1131 3300035724 Ga0373933_0020224 Ga0373933_0020224_1232_2326 364
1132 3300046455 Ga0495603_0010478 Ga0495603_0010478_842_1936 364
1133 3300046459 Ga0495629_0001536 Ga0495629_0001536_4304_5398 364
1134 3300046461 Ga0495641_0005001 Ga0495641_0005001_3591_4685 364
1135 3300046463 Ga0495653_0002829 Ga0495653_0002829_9452_10546 364
1136 3300046472 Ga0495580_0114397 Ga0495580_0114397_230_1324 364
1137 3300046473 Ga0495582_0001755 Ga0495582_0001755_3503_4597 364
1138 3300046473 Ga0495582_0035249 Ga0495582_0035249_533_1627 364
1139 3300046491 Ga0495584_0010859 Ga0495584_0010859_2052_3146 364
1140 3300046492 Ga0495585_0015360 Ga0495585_0015360_491_1585 364
1141 3300046499 Ga0495594_0022203 Ga0495594_0022203_1331_2425 364
1142 3300046499 Ga0495594_0025988 Ga0495594_0025988_1020_2114 364
1143 3300046501 Ga0495607_0049524 Ga0495607_0049524_532_1626 364
1144 3300046511 Ga0495608_0055006 Ga0495608_0055006_1337_2431 364
1145 3300046520 Ga0495637_0040485 Ga0495637_0040485_532_1626 364
1146 3300046523 Ga0495644_0003283 Ga0495644_0003283_1215_2309 364
1147 3300046526 Ga0495666_0064539 Ga0495666_0064539_123_1217 364
1148 3300046529 Ga0495652_0083477 Ga0495652_0083477_1508_2602 364
1149 3300046537 Ga0495598_0002896 Ga0495598_0002896_1464_2558 364
1150 3300046538 Ga0495609_0024830 Ga0495609_0024830_674_1768 364
1151 3300046557 Ga0495622_0029386 Ga0495622_0029386_294_1388 364
1152 3300046558 Ga0495633_0012648 Ga0495633_0012648_953_2047 364
1153 3300046559 Ga0495667_0008220 Ga0495667_0008220_1986_3080 364
1154 3300046615 Ga0495656_0000812 Ga0495656_0000812_2487_3581 364
1155 3300046663 Ga0495635_0010665 Ga0495635_0010665_4184_5278 364
1156 3300046663 Ga0495635_0107746 Ga0495635_0107746_447_1541 364
1157 3300046674 Ga0495588_0002364 Ga0495588_0002364_3086_4180 364
1158 3300046680 Ga0495646_0025939 Ga0495646_0025939_1196_2290 364
1159 3300046681 Ga0495647_0001979 Ga0495647_0001979_3678_4772 364
1160 3300046683 Ga0495658_0004872 Ga0495658_0004872_4099_5193 364
1161 3300046683 Ga0495658_0006624 Ga0495658_0006624_3296_4390 364
1162 3300046689 Ga0495613_0003386 Ga0495613_0003386_7364_8458 364
1163 3300046690 Ga0495624_0005667 Ga0495624_0005667_7024_8118 364
1164 3300046809 Ga0495600_0042175 Ga0495600_0042175_1089_2183 364
1165 3300047317 Ga0495604_0013426 Ga0495604_0013426_3738_4832 364
1166 3300047322 Ga0495680_0007202 Ga0495680_0007202_3432_4526 364
1167 3300047322 Ga0495680_0014519 Ga0495680_0014519_1619_2713 364
1168 3300047445 Ga0495677_0031383 Ga0495677_0031383_503_1597 364
1169 3300047673 Ga0495593_0010592 Ga0495593_0010592_2884_3978 364
1170 3300047673 Ga0495593_0055294 Ga0495593_0055294_607_1701 364
1171 3300048088 Ga0495602_0092286 Ga0495602_0092286_1402_2496 364
1172 3300048903 Ga0496100_0005513 Ga0496100_0005513_2220_3314 364
1173 3300048904 Ga0496101_0042308 Ga0496101_0042308_1550_2644 364
1174 3300048905 Ga0496102_0117550 Ga0496102_0117550_780_1874 364
1175 3300048910 Ga0496107_0008995 Ga0496107_0008995_2058_3152 364
1176 3300048913 Ga0496110_0020911 Ga0496110_0020911_2611_3705 364
1177 3300048914 Ga0496111_0031351 Ga0496111_0031351_210_1304 364
1178 3300048915 Ga0496112_0016298 Ga0496112_0016298_4528_5622 364
1179 3300048916 Ga0496113_0032840 Ga0496113_0032840_401_1495 364
1180 3300048918 Ga0496115_0008771 Ga0496115_0008771_731_1825 364
1181 3300048928 Ga0496125_0119558 Ga0496125_0119558_268_1362 364
1182 3300050514 nmdc:mga08x19_210538_c1 nmdc:mga08x19_210538_c1_70_1164 364
1183 3300050515 nmdc:mga0a205_260176_c1 nmdc:mga0a205_260176_c1_409_1503 364
1184 3300053078 Ga0495612_0035278 Ga0495612_0035278_133_1227 364
1185 3300053085 Ga0495619_0000419 Ga0495619_0000419_13746_14840 364
1186 2209111006 2214795217 2213822648 365
1187 3300000042 ARSoilYngRDRAFT_c00890 ARSoilYngRDRAFT_008902 365
1188 3300000044 ARSoilOldRDRAFT_c001247 ARSoilOldRDRAFT_0012472 365
1189 3300001904 JGI24736J21556_1017616 JGI24736J21556_10176161 365
1190 3300001978 JGI24747J21853_1005660 JGI24747J21853_10056601 365
1191 3300001989 JGI24739J22299_10000203 JGI24739J22299_100002032 365
1192 3300001990 JGI24737J22298_10002225 JGI24737J22298_100022256 365
1193 3300001990 JGI24737J22298_10015628 JGI24737J22298_100156282 365
1194 3300002070 JGI24750J21931_1000206 JGI24750J21931_10002067 365
1195 3300002073 JGI24745J21846_1000036 JGI24745J21846_10000363 365
1196 3300002074 JGI24748J21848_1000461 JGI24748J21848_10004612 365
1197 3300002076 JGI24749J21850_1001705 JGI24749J21850_10017053 365
1198 3300002077 JGI24744J21845_10004108 JGI24744J21845_100041082 365
1199 3300002239 JGI24034J26672_10001100 JGI24034J26672_100011002 365
1200 3300002244 JGI24742J22300_10000210 JGI24742J22300_100002103 365
1201 3300005290 Ga0065712_10001033 Ga0065712_100010336 365
1202 3300005293 Ga0065715_10095332 Ga0065715_100953321 365
1203 3300005295 Ga0065707_10174941 Ga0065707_101749411 365
1204 3300005328 Ga0070676_10000499 Ga0070676_1000049912 365
1205 3300005329 Ga0070683_100000265 Ga0070683_10000026515 365
1206 3300005330 Ga0070690_100000718 Ga0070690_1000007184 365
1207 3300005330 Ga0070690_100044337 Ga0070690_1000443372 365
1208 3300005331 Ga0070670_100014626 Ga0070670_1000146264 365
1209 3300005333 Ga0070677_10001854 Ga0070677_100018543 365
1210 3300005334 Ga0068869_100000414 Ga0068869_1000004141 365
1211 3300005335 Ga0070666_10020803 Ga0070666_100208031 365
1212 3300005336 Ga0070680_100001359 Ga0070680_1000013595 365
1213 3300005336 Ga0070680_100046737 Ga0070680_1000467371 365
1214 3300005337 Ga0070682_100000745 Ga0070682_10000074512 365
1215 3300005339 Ga0070660_100000136 Ga0070660_10000013633 365
1216 3300005339 Ga0070660_100079857 Ga0070660_1000798573 365
1217 3300005339 Ga0070660_100278873 Ga0070660_1002788732 365
1218 3300005340 Ga0070689_100000722 Ga0070689_10000072212 365
1219 3300005341 Ga0070691_10000148 Ga0070691_1000014812 365
1220 3300005343 Ga0070687_100000080 Ga0070687_10000008012 365
1221 3300005344 Ga0070661_100000425 Ga0070661_1000004256 365
1222 3300005344 Ga0070661_100198478 Ga0070661_1001984781 365
1223 3300005345 Ga0070692_10000893 Ga0070692_100008937 365
1224 3300005345 Ga0070692_10028309 Ga0070692_100283093 365
1225 3300005347 Ga0070668_100005857 Ga0070668_1000058572 365
1226 3300005353 Ga0070669_100000276 Ga0070669_10000027615 365
1227 3300005353 Ga0070669_100002660 Ga0070669_1000026607 365
1228 3300005354 Ga0070675_100000271 Ga0070675_10000027112 365
1229 3300005354 Ga0070675_100008544 Ga0070675_1000085446 365
1230 3300005355 Ga0070671_100000389 Ga0070671_10000038912 365
1231 3300005355 Ga0070671_100012096 Ga0070671_1000120962 365
1232 3300005356 Ga0070674_100000928 Ga0070674_10000092812 365
1233 3300005364 Ga0070673_100001722 Ga0070673_1000017226 365
1234 3300005364 Ga0070673_100066996 Ga0070673_1000669962 365
1235 3300005365 Ga0070688_100001089 Ga0070688_1000010891 365
1236 3300005366 Ga0070659_100006384 Ga0070659_1000063843 365
1237 3300005367 Ga0070667_100001569 Ga0070667_10000156912 365
1238 3300005367 Ga0070667_100267272 Ga0070667_1002672722 365
1239 3300005406 Ga0070703_10049865 Ga0070703_100498651 365
1240 3300005434 Ga0070709_10106873 Ga0070709_101068732 365
1241 3300005436 Ga0070713_100017559 Ga0070713_1000175593 365
1242 3300005437 Ga0070710_10026128 Ga0070710_100261282 365
1243 3300005438 Ga0070701_10000457 Ga0070701_100004576 365
1244 3300005438 Ga0070701_10011127 Ga0070701_100111271 365
1245 3300005439 Ga0070711_100007229 Ga0070711_1000072294 365
1246 3300005440 Ga0070705_100000579 Ga0070705_1000005797 365
1247 3300005440 Ga0070705_100223072 Ga0070705_1002230721 365
1248 3300005441 Ga0070700_100000515 Ga0070700_1000005156 365
1249 3300005441 Ga0070700_100027405 Ga0070700_1000274053 365
1250 3300005445 Ga0070708_100027296 Ga0070708_1000272964 365
1251 3300005455 Ga0070663_100000580 Ga0070663_10000058012 365
1252 3300005456 Ga0070678_100000016 Ga0070678_10000001614 365
1253 3300005456 Ga0070678_100085764 Ga0070678_1000857642 365
1254 3300005457 Ga0070662_100001325 Ga0070662_10000132512 365
1255 3300005457 Ga0070662_100016017 Ga0070662_1000160173 365
1256 3300005458 Ga0070681_10001764 Ga0070681_1000176412 365
1257 3300005466 Ga0070685_10000344 Ga0070685_1000034421 365
1258 3300005530 Ga0070679_100001267 Ga0070679_10000126712 365
1259 3300005535 Ga0070684_100002476 Ga0070684_10000247612 365
1260 3300005535 Ga0070684_100052250 Ga0070684_1000522502 365
1261 3300005536 Ga0070697_100192620 Ga0070697_1001926201 365
1262 3300005539 Ga0068853_100001111 Ga0068853_10000111113 365
1263 3300005543 Ga0070672_100000233 Ga0070672_10000023312 365
1264 3300005544 Ga0070686_100000699 Ga0070686_1000006996 365
1265 3300005544 Ga0070686_100083472 Ga0070686_1000834722 365
1266 3300005545 Ga0070695_100020385 Ga0070695_1000203853 365
1267 3300005546 Ga0070696_100001198 Ga0070696_1000011985 365
1268 3300005546 Ga0070696_100123710 Ga0070696_1001237102 365
1269 3300005547 Ga0070693_100000594 Ga0070693_1000005946 365
1270 3300005549 Ga0070704_100000112 Ga0070704_10000011215 365
1271 3300005549 Ga0070704_100001736 Ga0070704_1000017366 365
1272 3300005563 Ga0068855_100007243 Ga0068855_1000072436 365
1273 3300005564 Ga0070664_100000924 Ga0070664_1000009243 365
1274 3300005577 Ga0068857_100000371 Ga0068857_10000037124 365
1275 3300005577 Ga0068857_100191881 Ga0068857_1001918811 365
1276 3300005578 Ga0068854_100000735 Ga0068854_10000073512 365
1277 3300005578 Ga0068854_100188736 Ga0068854_1001887362 365
1278 3300005614 Ga0068856_100000520 Ga0068856_10000052036 365
1279 3300005614 Ga0068856_100247755 Ga0068856_1002477551 365
1280 3300005614 Ga0068856_100349684 Ga0068856_1003496842 365
1281 3300005616 Ga0068852_100001599 Ga0068852_1000015993 365
1282 3300005617 Ga0068859_100010201 Ga0068859_1000102013 365
1283 3300005617 Ga0068859_100019554 Ga0068859_1000195546 365
1284 3300005618 Ga0068864_100000333 Ga0068864_10000033331 365
1285 3300005718 Ga0068866_10000143 Ga0068866_100001432 365
1286 3300005719 Ga0068861_100000417 Ga0068861_10000041712 365
1287 3300005834 Ga0068851_10048161 Ga0068851_100481612 365
1288 3300005840 Ga0068870_10000113 Ga0068870_1000011312 365
1289 3300005842 Ga0068858_100000975 Ga0068858_10000097520 365
1290 3300005842 Ga0068858_100335420 Ga0068858_1003354202 365
1291 3300005843 Ga0068860_100001740 Ga0068860_1000017406 365
1292 3300005844 Ga0068862_100001457 Ga0068862_1000014573 365
1293 3300005844 Ga0068862_100107636 Ga0068862_1001076363 365
1294 3300005937 Ga0081455_10000110 Ga0081455_1000011040 365
1295 3300006237 Ga0097621_100000203 Ga0097621_1000002036 365
1296 3300006237 Ga0097621_100043766 Ga0097621_1000437662 365
1297 3300006358 Ga0068871_100000575 Ga0068871_1000005753 365
1298 3300006852 Ga0075433_10005842 Ga0075433_100058427 365
1299 3300006871 Ga0075434_100010989 Ga0075434_1000109893 365
1300 3300006881 Ga0068865_100000654 Ga0068865_10000065412 365
1301 3300006914 Ga0075436_100157154 Ga0075436_1001571542 365
1302 3300006931 Ga0097620_100010201 Ga0097620_1000102013 365
1303 3300006931 Ga0097620_100019554 Ga0097620_1000195541 365
1304 3300007076 Ga0075435_100041943 Ga0075435_1000419433 365
1305 3300009036 Ga0105244_10022702 Ga0105244_100227023 365
1306 3300009092 Ga0105250_10005564 Ga0105250_100055645 365
1307 3300009093 Ga0105240_10092446 Ga0105240_100924463 365
1308 3300009094 Ga0111539_10000581 Ga0111539_1000058112 365
1309 3300009094 Ga0111539_10004022 Ga0111539_1000402212 365
1310 3300009098 Ga0105245_10000230 Ga0105245_1000023035 365
1311 3300009101 Ga0105247_10009917 Ga0105247_100099171 365
1312 3300009101 Ga0105247_10046471 Ga0105247_100464712 365
1313 3300009148 Ga0105243_10002755 Ga0105243_100027556 365
1314 3300009148 Ga0105243_10074452 Ga0105243_100744521 365
1315 3300009174 Ga0105241_10001308 Ga0105241_100013086 365
1316 3300009176 Ga0105242_10000696 Ga0105242_1000069614 365
1317 3300009177 Ga0105248_10001593 Ga0105248_1000159318 365
1318 3300009177 Ga0105248_10249219 Ga0105248_102492192 365
1319 3300009545 Ga0105237_10033806 Ga0105237_100338063 365
1320 3300009545 Ga0105237_10366031 Ga0105237_103660311 365
1321 3300009553 Ga0105249_10001642 Ga0105249_1000164212 365
1322 3300009553 Ga0105249_10081877 Ga0105249_100818771 365
1323 3300010375 Ga0105239_10009048 Ga0105239_100090482 365
1324 3300010375 Ga0105239_10478737 Ga0105239_104787372 365
1325 3300011119 Ga0105246_10000550 Ga0105246_100005507 365
1326 3300012515 Ga0157338_1004348 Ga0157338_10043481 365
1327 3300013296 Ga0157374_10016190 Ga0157374_100161902 365
1328 3300013296 Ga0157374_10044193 Ga0157374_100441932 365
1329 3300013297 Ga0157378_10000864 Ga0157378_100008647 365
1330 3300013306 Ga0163162_10000420 Ga0163162_100004206 365
1331 3300013306 Ga0163162_10016129 Ga0163162_100161295 365
1332 3300013306 Ga0163162_10059976 Ga0163162_100599763 365
1333 3300013307 Ga0157372_10024037 Ga0157372_100240373 365
1334 3300013308 Ga0157375_10001626 Ga0157375_100016266 365
1335 3300013308 Ga0157375_10061566 Ga0157375_100615663 365
1336 3300014325 Ga0163163_10003284 Ga0163163_100032842 365
1337 3300014326 Ga0157380_10000511 Ga0157380_100005119 365
1338 3300014326 Ga0157380_10535962 Ga0157380_105359621 365
1339 3300014745 Ga0157377_10000053 Ga0157377_1000005356 365
1340 3300014968 Ga0157379_10001333 Ga0157379_1000133312 365
1341 3300014968 Ga0157379_10016704 Ga0157379_100167043 365
1342 3300014968 Ga0157379_10024669 Ga0157379_100246695 365
1343 3300014969 Ga0157376_10000436 Ga0157376_1000043611 365
1344 3300014969 Ga0157376_10030676 Ga0157376_100306764 365
1345 3300017792 Ga0163161_10220368 Ga0163161_102203682 365
1346 3300025271 Ga0207666_1000014 Ga0207666_10000141 365
1347 3300025290 Ga0207673_1000965 Ga0207673_10009653 365
1348 3300025315 Ga0207697_10000672 Ga0207697_100006727 365
1349 3300025885 Ga0207653_10000963 Ga0207653_100009637 365
1350 3300025893 Ga0207682_10000154 Ga0207682_1000015428 365
1351 3300025899 Ga0207642_10002038 Ga0207642_100020384 365
1352 3300025900 Ga0207710_10001145 Ga0207710_1000114510 365
1353 3300025901 Ga0207688_10000817 Ga0207688_100008172 365
1354 3300025901 Ga0207688_10164507 Ga0207688_101645072 365
1355 3300025903 Ga0207680_10097468 Ga0207680_100974682 365
1356 3300025904 Ga0207647_10005421 Ga0207647_100054213 365
1357 3300025907 Ga0207645_10000182 Ga0207645_1000018243 365
1358 3300025908 Ga0207643_10000405 Ga0207643_1000040514 365
1359 3300025911 Ga0207654_10000889 Ga0207654_1000088913 365
1360 3300025912 Ga0207707_10001762 Ga0207707_1000176213 365
1361 3300025912 Ga0207707_10216332 Ga0207707_102163322 365
1362 3300025916 Ga0207663_10006811 Ga0207663_100068114 365
1363 3300025916 Ga0207663_10035357 Ga0207663_100353572 365
1364 3300025917 Ga0207660_10000007 Ga0207660_1000000735 365
1365 3300025918 Ga0207662_10000913 Ga0207662_100009131 365
1366 3300025919 Ga0207657_10005343 Ga0207657_1000534312 365
1367 3300025919 Ga0207657_10103850 Ga0207657_101038501 365
1368 3300025920 Ga0207649_10101153 Ga0207649_101011532 365
1369 3300025921 Ga0207652_10000459 Ga0207652_1000045934 365
1370 3300025923 Ga0207681_10000116 Ga0207681_1000011667 365
1371 3300025925 Ga0207650_10004276 Ga0207650_100042763 365
1372 3300025926 Ga0207659_10000015 Ga0207659_10000015136 365
1373 3300025927 Ga0207687_10000357 Ga0207687_100003579 365
1374 3300025928 Ga0207700_10016937 Ga0207700_100169374 365
1375 3300025931 Ga0207644_10000251 Ga0207644_1000025132 365
1376 3300025932 Ga0207690_10000320 Ga0207690_1000032030 365
1377 3300025932 Ga0207690_10027783 Ga0207690_100277833 365
1378 3300025933 Ga0207706_10002583 Ga0207706_1000258312 365
1379 3300025933 Ga0207706_10012590 Ga0207706_100125905 365
1380 3300025934 Ga0207686_10000234 Ga0207686_1000023417 365
1381 3300025935 Ga0207709_10000081 Ga0207709_10000081123 365
1382 3300025935 Ga0207709_10248527 Ga0207709_102485272 365
1383 3300025936 Ga0207670_10000620 Ga0207670_100006206 365
1384 3300025936 Ga0207670_10018819 Ga0207670_100188192 365
1385 3300025937 Ga0207669_10000008 Ga0207669_1000000826 365
1386 3300025938 Ga0207704_10002142 Ga0207704_100021427 365
1387 3300025939 Ga0207665_10113693 Ga0207665_101136932 365
1388 3300025940 Ga0207691_10002588 Ga0207691_1000258810 365
1389 3300025941 Ga0207711_10082864 Ga0207711_100828641 365
1390 3300025942 Ga0207689_10000749 Ga0207689_1000074914 365
1391 3300025944 Ga0207661_10000170 Ga0207661_1000017034 365
1392 3300025945 Ga0207679_10000046 Ga0207679_1000004678 365
1393 3300025945 Ga0207679_10250854 Ga0207679_102508542 365
1394 3300025949 Ga0207667_10010820 Ga0207667_100108207 365
1395 3300025960 Ga0207651_10000200 Ga0207651_1000020016 365
1396 3300025960 Ga0207651_10048302 Ga0207651_100483022 365
1397 3300025961 Ga0207712_10000555 Ga0207712_100005551 365
1398 3300025972 Ga0207668_10000133 Ga0207668_1000013331 365
1399 3300025981 Ga0207640_10000191 Ga0207640_1000019135 365
1400 3300025986 Ga0207658_10000535 Ga0207658_1000053526 365
1401 3300025986 Ga0207658_10059229 Ga0207658_100592292 365
1402 3300025986 Ga0207658_10107007 Ga0207658_101070072 365
1403 3300026035 Ga0207703_10003074 Ga0207703_100030747 365
1404 3300026035 Ga0207703_10445528 Ga0207703_104455281 365
1405 3300026041 Ga0207639_10079176 Ga0207639_100791762 365
1406 3300026067 Ga0207678_10001859 Ga0207678_100018596 365
1407 3300026067 Ga0207678_10042909 Ga0207678_100429091 365
1408 3300026075 Ga0207708_10002476 Ga0207708_1000247612 365
1409 3300026075 Ga0207708_10002480 Ga0207708_1000248012 365
1410 3300026078 Ga0207702_10003065 Ga0207702_1000306512 365
1411 3300026078 Ga0207702_10261845 Ga0207702_102618452 365
1412 3300026088 Ga0207641_10000593 Ga0207641_1000059315 365
1413 3300026089 Ga0207648_10002417 Ga0207648_100024177 365
1414 3300026116 Ga0207674_10003381 Ga0207674_100033817 365
1415 3300026118 Ga0207675_100002182 Ga0207675_10000218212 365
1416 3300026118 Ga0207675_100050415 Ga0207675_1000504151 365
1417 3300026118 Ga0207675_100322807 Ga0207675_1003228072 365
1418 3300026121 Ga0207683_10000002 Ga0207683_10000002258 365
1419 3300026121 Ga0207683_10026216 Ga0207683_100262164 365
1420 3300026142 Ga0207698_10000545 Ga0207698_1000054512 365
1421 3300027614 Ga0209970_1004629 Ga0209970_10046292 365
1422 3300027695 Ga0209966_1000800 Ga0209966_10008003 365
1423 3300027717 Ga0209998_10001951 Ga0209998_100019514 365
1424 3300027717 Ga0209998_10020008 Ga0209998_100200082 365
1425 3300027876 Ga0209974_10000944 Ga0209974_100009446 365
1426 3300027907 Ga0207428_10000011 Ga0207428_1000001144 365
1427 3300027907 Ga0207428_10000046 Ga0207428_10000046137 365
1428 3300027907 Ga0207428_10001276 Ga0207428_1000127611 365
1429 3300028379 Ga0268266_10013893 Ga0268266_100138932 365
1430 3300028380 Ga0268265_10011194 Ga0268265_100111944 365
1431 3300028381 Ga0268264_10000340 Ga0268264_100003406 365
1432 3300028381 Ga0268264_10013402 Ga0268264_100134022 365
1433 3300031241 Ga0265325_10000117 Ga0265325_1000011739 365
1434 3300031595 Ga0265313_10027782 Ga0265313_100277822 365
1435 3300034816 Ga0373930_0017182 Ga0373930_0017182_117_1214 365
1436 3300034819 Ga0373958_0000097 Ga0373958_0000097_4873_5970 365
1437 3300034957 Ga0373938_0000032 Ga0373938_0000032_5784_6881 365
1438 3300035084 Ga0373928_0000973 Ga0373928_0000973_407_1504 365
1439 3300035085 Ga0373929_0001646 Ga0373929_0001646_268_1365 365
1440 3300035085 Ga0373929_0001755 Ga0373929_0001755_517_1614 365
1441 3300035090 Ga0373949_0001084 Ga0373949_0001084_2996_4093 365
1442 3300035090 Ga0373949_0006126 Ga0373949_0006126_229_1326 365
1443 3300035091 Ga0373951_0000472 Ga0373951_0000472_5534_6631 365
1444 3300035091 Ga0373951_0002239 Ga0373951_0002239_1679_2776 365
1445 3300035092 Ga0373952_0000189 Ga0373952_0000189_8489_9586 365
1446 3300035092 Ga0373952_0000675 Ga0373952_0000675_859_1956 365
1447 3300035112 Ga0373932_0000180 Ga0373932_0000180_5659_6756 365
1448 3300035114 Ga0373939_0000151 Ga0373939_0000151_12452_13549 365
1449 3300035115 Ga0373941_0002963 Ga0373941_0002963_195_1292 365
1450 3300035115 Ga0373941_0003543 Ga0373941_0003543_220_1317 365
1451 3300035117 Ga0373953_0001859 Ga0373953_0001859_2124_3221 365
1452 3300035117 Ga0373953_0046289 Ga0373953_0046289_145_1242 365
1453 3300035118 Ga0373954_0032953 Ga0373954_0032953_504_1601 365
1454 3300035118 Ga0373954_0036104 Ga0373954_0036104_96_1193 365
1455 3300035119 Ga0373956_0052962 Ga0373956_0052962_339_1436 365
1456 3300035120 Ga0373957_0007096 Ga0373957_0007096_1475_2572 365
1457 3300035120 Ga0373957_0018824 Ga0373957_0018824_973_2070 365
1458 3300035121 Ga0373960_0000184 Ga0373960_0000184_5725_6822 365
1459 3300035121 Ga0373960_0003038 Ga0373960_0003038_250_1347 365
1460 3300035172 Ga0373955_0001906 Ga0373955_0001906_545_1642 365
1461 3300035172 Ga0373955_0008032 Ga0373955_0008032_984_2081 365
1462 3300035241 Ga0373961_0002408 Ga0373961_0002408_2864_3961 365
1463 3300035242 Ga0373962_0000113 Ga0373962_0000113_10865_11962 365
1464 3300035242 Ga0373962_0000251 Ga0373962_0000251_60_1157 365
1465 3300035691 Ga0373931_0000290 Ga0373931_0000290_12340_13437 365
1466 3300035691 Ga0373931_0009129 Ga0373931_0009129_784_1881 365
1467 3300035724 Ga0373933_0015628 Ga0373933_0015628_1715_2812 365
1468 3300035724 Ga0373933_0048000 Ga0373933_0048000_1188_2285 365
1469 3300035725 Ga0373947_0163306 Ga0373947_0163306_90_1187 365
1470 3300036401 Ga0373937_0031529 Ga0373937_0031529_1419_2516 365
1471 3300036401 Ga0373937_0062102 Ga0373937_0062102_1635_2732 365
1472 3300042876 Ga0451577_0351198 Ga0451577_0351198_106_1203 365
1473 3300045051 Ga0451576_0027624 Ga0451576_0027624_666_1763 365
1474 3300046454 Ga0495592_0001276 Ga0495592_0001276_1872_2969 365
1475 3300046462 Ga0495651_0001053 Ga0495651_0001053_13180_14277 365
1476 3300046462 Ga0495651_0099331 Ga0495651_0099331_396_1493 365
1477 3300046463 Ga0495653_0024422 Ga0495653_0024422_3100_4197 365
1478 3300046491 Ga0495584_0158528 Ga0495584_0158528_37_1134 365
1479 3300046511 Ga0495608_0015143 Ga0495608_0015143_2699_3796 365
1480 3300046514 Ga0495618_0014797 Ga0495618_0014797_3406_4503 365
1481 3300046516 Ga0495628_0003193 Ga0495628_0003193_2856_3953 365
1482 3300046516 Ga0495628_0020292 Ga0495628_0020292_1056_2153 365
1483 3300046517 Ga0495630_0043308 Ga0495630_0043308_254_1351 365
1484 3300046529 Ga0495652_0007926 Ga0495652_0007926_1967_3064 365
1485 3300046535 Ga0495586_0052937 Ga0495586_0052937_334_1431 365
1486 3300046536 Ga0495587_0004533 Ga0495587_0004533_3511_4608 365
1487 3300046538 Ga0495609_0059601 Ga0495609_0059601_521_1618 365
1488 3300046543 Ga0495645_0058959 Ga0495645_0058959_1624_2721 365
1489 3300046559 Ga0495667_0008100 Ga0495667_0008100_526_1623 365
1490 3300046559 Ga0495667_0066737 Ga0495667_0066737_265_1362 365
1491 3300046663 Ga0495635_0023313 Ga0495635_0023313_2034_3131 365
1492 3300046675 Ga0495657_0004137 Ga0495657_0004137_9815_10912 365
1493 3300046675 Ga0495657_0042723 Ga0495657_0042723_214_1311 365
1494 3300046678 Ga0495599_0001605 Ga0495599_0001605_11561_12658 365
1495 3300046678 Ga0495599_0021267 Ga0495599_0021267_1704_2801 365
1496 3300046679 Ga0495623_0039671 Ga0495623_0039671_503_1600 365
1497 3300046680 Ga0495646_0004146 Ga0495646_0004146_2454_3551 365
1498 3300046809 Ga0495600_0010128 Ga0495600_0010128_462_1559 365
1499 3300046809 Ga0495600_0063552 Ga0495600_0063552_487_1584 365
1500 3300047317 Ga0495604_0003926 Ga0495604_0003926_1666_2763 365
1501 3300047317 Ga0495604_0073948 Ga0495604_0073948_300_1397 365
1502 3300047322 Ga0495680_0014111 Ga0495680_0014111_3705_4802 365
1503 3300047322 Ga0495680_0050515 Ga0495680_0050515_1968_3065 365
1504 3300047444 Ga0495675_0005926 Ga0495675_0005926_3707_4804 365
1505 3300047444 Ga0495675_0074346 Ga0495675_0074346_635_1732 365
1506 3300047471 Ga0495684_0144381 Ga0495684_0144381_423_1520 365
1507 3300048088 Ga0495602_0010712 Ga0495602_0010712_7752_8849 365
1508 3300048088 Ga0495602_0029454 Ga0495602_0029454_3234_4331 365
1509 3300048903 Ga0496100_0000171 Ga0496100_0000171_28191_29288 365
1510 3300048904 Ga0496101_0000246 Ga0496101_0000246_14023_15120 365
1511 3300048905 Ga0496102_0003080 Ga0496102_0003080_11423_12520 365
1512 3300048905 Ga0496102_0091876 Ga0496102_0091876_1613_2710 365
1513 3300048906 Ga0496103_0000753 Ga0496103_0000753_20943_22040 365
1514 3300048907 Ga0496104_0000159 Ga0496104_0000159_2725_3822 365
1515 3300048907 Ga0496104_0059838 Ga0496104_0059838_1047_2144 365
1516 3300048908 Ga0496105_0000410 Ga0496105_0000410_14261_15358 365
1517 3300048908 Ga0496105_0048636 Ga0496105_0048636_233_1363 365
1518 3300048909 Ga0496106_0000183 Ga0496106_0000183_23419_24516 365
1519 3300048909 Ga0496106_0039718 Ga0496106_0039718_126_1223 365
1520 3300048910 Ga0496107_0001430 Ga0496107_0001430_1968_3065 365
1521 3300048910 Ga0496107_0042322 Ga0496107_0042322_71_1168 365
1522 3300048911 Ga0496108_0001856 Ga0496108_0001856_13034_14131 365
1523 3300048912 Ga0496109_0001350 Ga0496109_0001350_18856_19953 365
1524 3300048912 Ga0496109_0004165 Ga0496109_0004165_2650_3747 365
1525 3300048913 Ga0496110_0007624 Ga0496110_0007624_6666_7763 365
1526 3300048914 Ga0496111_0001815 Ga0496111_0001815_9513_10610 365
1527 3300048915 Ga0496112_0002096 Ga0496112_0002096_13706_14803 365
1528 3300048915 Ga0496112_0197523 Ga0496112_0197523_21_1118 365
1529 3300048916 Ga0496113_0005725 Ga0496113_0005725_1533_2630 365
1530 3300048916 Ga0496113_0017451 Ga0496113_0017451_187_1284 365
1531 3300048917 Ga0496114_0002224 Ga0496114_0002224_2202_3299 365
1532 3300048918 Ga0496115_0020141 Ga0496115_0020141_338_1435 365
1533 3300048918 Ga0496115_0026952 Ga0496115_0026952_3106_4203 365
1534 3300049593 Ga0501077_0169863 Ga0501077_0169863_77_1174 365
1535 3300049741 Ga0501079_0179105 Ga0501079_0179105_291_1388 365
1536 3300050511 nmdc:mga08y16_9096_c1 nmdc:mga08y16_9096_c1_8819_9916 365
1537 3300050512 nmdc:mga0n895_971_c1 nmdc:mga0n895_971_c1_14342_15439 365
1538 3300050514 nmdc:mga08x19_25741_c1 nmdc:mga08x19_25741_c1_2475_3572 365
1539 3300050515 nmdc:mga0a205_1026_c1 nmdc:mga0a205_1026_c1_5253_6350 365
1540 3300053077 Ga0495601_0002032 Ga0495601_0002032_5536_6633 365
1541 3300053077 Ga0495601_0058457 Ga0495601_0058457_291_1388 365
1542 3300053078 Ga0495612_0000616 Ga0495612_0000616_10450_11547 365
1543 3300053084 Ga0495595_0003032 Ga0495595_0003032_3443_4540 365
1544 3300053085 Ga0495619_0001606 Ga0495619_0001606_10815_11912 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

195

362

0.98

PF03033

Glyco_transf_28

Glycosyltransferase family 28 N-terminal domain

15

152

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.9008 8 362
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.893 8 362
1nlm-assembly1.cif.gz_B crystal structure of murg:glcnac complex 0.8783 8 365
1nlm-assembly1.cif.gz_B crystal structure of murg:glcnac complex 0.8736 8 365
7d1i-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii murg 0.8582 7 361
ID Description Score Start End Superfamily
af_Q2FYL5_1_178_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9086 7 170 3.40.50.2000
af_K7L509_198_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8915 221 345 3.40.50.2000
3s2uA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8909 8 166 3.40.50.2000
af_P17443_6_162_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8827 8 167 3.40.50.2000
3s2uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8791 167 345 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A431JB04-F1-model_v4 deleted 0.9893 217 362
AF-A0A519JEV0-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9847 219 363 GO:0050511
AF-A0A1G3IPJ4-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9818 107 362 GO:0050511
AF-A0A435JI80-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.981 186 364 GO:0050511
AF-A0A060BN88-F1-model_v4 Glyco_tran_28_C 0.9791 177 306 GO:0050511

Feature Viewer

pLDDT pTM Quality
92.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map