metagRoot

F494690

General Info

Members	Datasets	Scaffolds	Average Seq Length
1546	715	3088	459

Family's Representative Sequence

Representative Sequence	3300048913\|Ga0496110_0003778\|Ga0496110_0003778_751_2397
Length	548
Sequence	VGSAAFSPERDVPRSRRGNGRAAVPAFASICSKLQRLPNKQAINFGFHPPGADRRGKSRPLQTRGLXXXLLIRAPTPVLPAGTTPERAAMSTFDNPFDPERRLNRTGCSCGRHRSQAEHDAQLALQCAQIESEDKRYQGVVASAVMRAVFPKDAARRAFLKSVGASTALAALSQLFPLKTATDVFAQGGAIEKKDLKVGFIPITCATPIIMAHPMGFYSKHGLNVEVIKTAGWAVIRDKTLNKEYDAAHMLSPMPLAITLGAGSNPMPYTMPAVENINGQAITLATKHKDKNDPKVWKGFKFAVPFDYSMHNYLLRYYVAEHGIDPDQDIQIRAVPPPEMVANLRADNIDGFLGPDPFNQRAVYDGVGFIHILSKQLWEGHPCCAFAASKEFVTTMPNTYAALLKSIIDATAFAHKAENRKEIAAAIAPANYLNQPEIVLEQILTGTYADGLGNVKRDPNRIDFDPFPWQSFAVWILTQMKRWGQIKGDVDYKAVAEQVYLATDTAKLMKEVGLTPPTTSSKSFKVMGKEFDPAKPDDYLKSFAIKRV

Samples

	Sample ID	Description	Type	Environment
1	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
2	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
3	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
4	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
5	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
6	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
7	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
8	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
9	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
10	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
11	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
12	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
13	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
14	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
15	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
16	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
17	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
18	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
19	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
20	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
21	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
22	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
23	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
24	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
25	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
26	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
27	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
28	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
29	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
30	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
31	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
32	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
33	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
34	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
35	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
36	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
37	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
38	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
39	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
40	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
41	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
42	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
43	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
44	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
45	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
46	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
47	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
48	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
49	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
50	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
51	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
52	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
53	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
54	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
55	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
56	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
57	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
58	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
59	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
60	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
61	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
62	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
63	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
64	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
65	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
66	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
67	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
68	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
69	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
70	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
71	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
72	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
73	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
74	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
75	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
76	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
77	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
78	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
79	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
80	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
81	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
82	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
83	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
84	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
85	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
86	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
87	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
88	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
89	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
90	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
91	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
92	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
93	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
94	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
95	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
96	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
97	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
98	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
99	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
100	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
101	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
102	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
103	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
104	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
105	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
106	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
107	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
108	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
109	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
110	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
111	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
112	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
113	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
114	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
115	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
116	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
117	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
118	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
119	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
120	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
121	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
122	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
123	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
124	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
125	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
126	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
127	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
128	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
129	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
130	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
131	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
132	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
133	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
134	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
135	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
136	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
137	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
138	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
139	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
140	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
141	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
142	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
143	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
144	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
145	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
146	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
147	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
148	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
149	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
150	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
151	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
152	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
153	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
154	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
155	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
156	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
157	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
158	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
159	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
160	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
161	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
162	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
163	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
164	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
165	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
166	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
167	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
168	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
169	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
170	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
171	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
172	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
173	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
174	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
175	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
176	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
177	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
178	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
179	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
180	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
181	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
182	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
183	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
184	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
185	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
188	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
189	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
192	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
193	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
194	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
195	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
197	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
198	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
200	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
201	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
202	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
203	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
204	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
205	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
206	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
207	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
208	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
209	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
210	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
276	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
277	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
278	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
279	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
285	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
289	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
290	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
291	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
292	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
293	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
294	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
295	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
296	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
297	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
298	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
299	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
300	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
301	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
302	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
303	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
304	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
305	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
306	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
307	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
308	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
309	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
310	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
311	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
312	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
313	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
314	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
315	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
316	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
317	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
318	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
319	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
320	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
321	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
322	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
323	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
324	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
325	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
326	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
327	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
328	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
329	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
330	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
331	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
332	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
333	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
334	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
335	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
336	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
337	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
338	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
339	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
340	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
341	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
342	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
343	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
344	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
345	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
346	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
347	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
348	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
349	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
350	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
351	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
352	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
353	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
354	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
355	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
356	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
357	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
358	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
359	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
360	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
361	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
362	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
363	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
364	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
365	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
366	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
367	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
368	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
369	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
370	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
371	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
372	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
373	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
374	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
375	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
376	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
377	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
378	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
379	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
380	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
381	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
382	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
383	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
384	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
385	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
386	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
387	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
388	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
389	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
390	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
391	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
392	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
393	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
394	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
395	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
396	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
397	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
398	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
399	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
400	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
401	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
402	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
403	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
404	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
405	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
406	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
407	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
408	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
409	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
410	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
411	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
412	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
413	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
414	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
415	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
416	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
417	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
418	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
419	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
420	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
421	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
422	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
423	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
424	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
425	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
426	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
427	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
428	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
429	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
430	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
431	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
432	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
433	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
434	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
435	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
436	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
437	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
438	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
439	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
440	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
441	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
442	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
443	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
444	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
445	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
446	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
447	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
448	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
449	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
450	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
451	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
452	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
453	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
454	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
455	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
456	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
457	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
458	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
459	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
460	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
461	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
462	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
463	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
464	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
465	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
466	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
467	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
468	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
469	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
470	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
471	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
472	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
473	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
474	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
475	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
476	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
477	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
478	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
479	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
480	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
481	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
482	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
483	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
484	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
485	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
486	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
487	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
488	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
489	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
490	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
491	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
492	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
493	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
494	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
495	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
496	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
497	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
498	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
499	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
500	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
501	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
502	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
503	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
504	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
505	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
506	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
507	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
508	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
509	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
510	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
511	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
512	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
513	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
514	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
515	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
516	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
517	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
518	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
519	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
520	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
521	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
522	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
523	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
524	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
525	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
526	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
527	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
528	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
529	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
530	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
531	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
532	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
533	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
534	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
535	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
536	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
537	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
538	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
539	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
540	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
541	2513237087	Azorhizobium doebereinerae UFLA1-100	Isolate	Nodule
542	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
543	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
544	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
545	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
546	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
547	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
548	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
549	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
550	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
551	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
552	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
553	2522572158	Azospirillum halopraeferens DSM 3675	Isolate	Unclassified
554	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
555	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
556	2545555834	Methylobacterium sp. WSM2598	Isolate	Nodule
557	2548876994	Herbaspirillum lusitanum P6-12	Isolate	Nodule
558	2595698237	Methylobacterium sp. UNCCL125	Isolate	Unclassified
559	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
560	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
561	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
562	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
563	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
564	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
565	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
566	2738541281	Methylobacterium sp. GV094	Isolate	Unclassified
567	2738543013	Variovorax sp. BT01	Isolate	Unclassified
568	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
569	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
570	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
571	2791355199
572	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
573	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
574	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
575	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
576	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
577	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
578	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
579	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
580	2821131069	Duganella sp. 1224	Isolate	Unclassified
581	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
582	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
583	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
584	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
585	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
586	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
587	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
588	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
589	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
590	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
591	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
592	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
593	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
594	2828305725	Xanthobacter tagetidis DSM 11105	Isolate	Unclassified
595	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
596	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
597	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
598	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
599	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
600	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
601	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
602	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
603	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
604	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
605	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
606	2842698319	Methylobacterium sp. R-72139	Isolate	Unclassified
607	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
608	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
609	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
610	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
611	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
612	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
613	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
614	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
615	2857553236	Duganella sp. R-74557	Isolate	Unclassified
616	2857558681	Duganella sp. R-74565	Isolate	Unclassified
617	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
618	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
619	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
620	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
621	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
622	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
623	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
624	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
625	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
626	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
627	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
628	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
629	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
630	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
631	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
632	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
633	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
634	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
635	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
636	2894772417	Roseomonas oryzicola KCTC 22478	Isolate	Rhizosphere
637	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
638	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
639	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
640	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
641	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
642	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
643	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
644	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
645	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
646	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
647	2904699407
648	2906610324
649	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
650	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
651	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
652	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
653	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
654	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
655	2917699015	Bosea sp. F3-2	Isolate	Rhizosphere
656	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
657	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
658	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
659	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
660	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
661	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
662	2922425934
663	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
664	2928125067	Methylobacterium sp. 1973	Isolate	Unclassified
665	2929199973	Roseomonas sp. R-73070 Hybrid assembly	Isolate	Unclassified
666	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
667	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
668	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
669	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
670	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
671	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
672	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
673	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
674	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
675	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
676	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
677	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
678	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
679	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
680	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
681	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
682	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
683	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
684	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
685	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
686	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
687	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
688	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
689	2941479691
690	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
691	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
692	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
693	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
694	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
695	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
696	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
697	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
698	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
699	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
700	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
701	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
702	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
703	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
704	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
705	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
706	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
707	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
708	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
709	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
710	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
711	8054002106	Azospirillum lipoferum 59b	Isolate	Unclassified
712	8055225921	Achromobacter panacis KCTC 42751	Isolate	Rhizosphere
713	8055909800	Plastoroseomonas hellenica LMG 31523	Isolate	Unclassified
714	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
715	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	88.46
Metatranscriptomes	0
Isolates	11.54

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9.77
Nodule	6.27
Rhizoplane	6.47
Rhizosphere	67.46
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0496110_0003778	3300048913	Bacteria	11663
2	2214745205	2209111006	Bacteria	15596
3	ARcpr5oldR_c000087	3300000041	Bacteria	16704
4	ARSoilYngRDRAFT_c00048	3300000042	Bacteria	19122
5	ARcpr5yngRDRAFT_c000112	3300000043	Bacteria	12890
6	ARSoilOldRDRAFT_c000094	3300000044	Bacteria	16730
7	ARCol0yngRDRAFT_1000121	3300000652	Bacteria	13929
8	JGI24752J21851_1003222	3300001976	Bacteria	2152
9	JGI24739J22299_10002910	3300001989	Bacteria	6562
10	JGI24737J22298_10001520	3300001990	Bacteria	8263
11	JGI24743J22301_10002453	3300001991	Bacteria	2796
12	JGI24750J21931_1000426	3300002070	Bacteria	6876
13	JGI24745J21846_1000426	3300002073	Bacteria	3746
14	JGI24748J21848_1000786	3300002074	Bacteria	3432
15	JGI24738J21930_10000707	3300002075	Bacteria	9630
16	JGI24749J21850_1001137	3300002076	Bacteria	3773
17	JGI24744J21845_10004543	3300002077	Bacteria	2868
18	JGI24035J26624_1000282	3300002126	Bacteria	4781
19	JGI24034J26672_10000879	3300002239	Bacteria	3908
20	JGI24742J22300_10001239	3300002244	Bacteria	3999
21	JGI24742J22300_10003139	3300002244	Bacteria	2672
22	JGI24751J29686_10004754	3300002459	Bacteria	2760
23	JGI25155J39150_1000538	3300002704	Bacteria	8785
24	JGI25156J39149_1000150	3300002705	Bacteria	51558
25	JGI25154J39366_1000165	3300002738	Bacteria	51558
26	JGI25154J39366_1000210	3300002738	Bacteria	41877
27	JGI25157J39369_1000383	3300002741	Bacteria	30452
28	JGI25406J46586_10000801	3300003203	Bacteria	14848
29	JGI25406J46586_10001211	3300003203	Bacteria	12134
30	JGI25406J46586_10003389	3300003203	Bacteria	7501
31	JGI25406J46586_10003524	3300003203	Bacteria	7347
32	JGI25406J46586_10003889	3300003203	Bacteria	6980
33	JGI25153J46596_10002222	3300003215	Bacteria	11325
34	JGI25153J46596_10002589	3300003215	Bacteria	10366
35	JGI25153J46596_10003283	3300003215	Bacteria	9084
36	JGI25153J46596_10006877	3300003215	Bacteria	5680
37	JGI25153J46596_10014889	3300003215	Bacteria	3204
38	JGI25160J50197_1006259	3300003354	Bacteria	4838
39	JGI25160J50197_1006800	3300003354	Bacteria	4580
40	JGI25404J52841_10002956	3300003659	Bacteria	3298
41	Ga0055538_1000054	3300003751	Bacteria	123566
42	Ga0055539_1000066	3300003752	Bacteria	136557
43	Ga0055533_1000076	3300003756	Bacteria	136557
44	Ga0055532_1000097	3300003758	Bacteria	98781
45	Ga0055525_1000098	3300003759	Bacteria	136557
46	Ga0055535_1003562	3300003761	Bacteria	4319
47	Ga0055540_1002994	3300003792	Bacteria	8459
48	Ga0055531_10000152	3300003794	Bacteria	80208
49	Ga0055531_10003706	3300003794	Bacteria	9615
50	Ga0055541_1000056	3300003841	Bacteria	123566
51	Ga0055543_1002979	3300004625	Bacteria	5254
52	Ga0065165_1001284	3300005262	Bacteria	28344
53	Ga0065165_1022456	3300005262	Bacteria	2162
54	Ga0065704_10002258	3300005289	Bacteria	9242
55	Ga0065712_10068851	3300005290	Bacteria	8789
56	Ga0065712_10075439	3300005290	Bacteria	3861
57	Ga0065712_10084632	3300005290	Bacteria	2749
58	Ga0065715_10093263	3300005293	Bacteria	4731
59	Ga0065715_10105949	3300005293	Bacteria	2861
60	Ga0065715_10164299	3300005293	Bacteria	1600
61	Ga0065707_10021875	3300005295	Bacteria	1759
62	Ga0065707_10098445	3300005295	Bacteria	3085
63	Ga0070676_10022543	3300005328	Bacteria	3531
64	Ga0070676_10034566	3300005328	Bacteria	2902
65	Ga0070683_100018296	3300005329	Bacteria	6203
66	Ga0070683_100075511	3300005329	Bacteria	3149
67	Ga0070683_100178315	3300005329	Bacteria	2017
68	Ga0070690_100012396	3300005330	Bacteria	5017
69	Ga0070690_100084812	3300005330	Bacteria	2077
70	Ga0070670_100000081	3300005331	Bacteria	92043
71	Ga0070670_100002578	3300005331	Bacteria	14984
72	Ga0070670_100016676	3300005331	Bacteria	6304
73	Ga0070670_100041518	3300005331	Bacteria	3954
74	Ga0070670_100113853	3300005331	Bacteria	2332
75	Ga0070677_10000893	3300005333	Bacteria	9811
76	Ga0070677_10027474	3300005333	Bacteria	2143
77	Ga0068869_100007674	3300005334	Bacteria	6908
78	Ga0070666_10031431	3300005335	Bacteria	3505
79	Ga0070680_100022312	3300005336	Bacteria	5040
80	Ga0070682_100030025	3300005337	Bacteria	3277
81	Ga0068868_100006926	3300005338	Bacteria	8053
82	Ga0068868_100060713	3300005338	Bacteria	2994
83	Ga0070660_100008270	3300005339	Bacteria	7271
84	Ga0070660_100123502	3300005339	Bacteria	2067
85	Ga0070689_100003410	3300005340	Bacteria	10568
86	Ga0070689_100016937	3300005340	Bacteria	5343
87	Ga0070691_10005653	3300005341	Bacteria	5700
88	Ga0070687_100004982	3300005343	Bacteria	5344
89	Ga0070661_100020584	3300005344	Bacteria	4707
90	Ga0070661_100100792	3300005344	Bacteria	2147
91	Ga0070692_10002117	3300005345	Bacteria	7588
92	Ga0070668_100015686	3300005347	Bacteria	5666
93	Ga0070668_100171527	3300005347	Bacteria	1766
94	Ga0070669_100016043	3300005353	Bacteria	5345
95	Ga0070669_100112005	3300005353	Bacteria	2072
96	Ga0070675_100005492	3300005354	Bacteria	9707
97	Ga0070675_100038825	3300005354	Bacteria	3883
98	Ga0070675_100187170	3300005354	Bacteria	1792
99	Ga0070671_100011767	3300005355	Bacteria	7038
100	Ga0070671_100031211	3300005355	Bacteria	4400
101	Ga0070671_100109138	3300005355	Bacteria	2324
102	Ga0070674_100008724	3300005356	Bacteria	6047
103	Ga0070674_100021106	3300005356	Bacteria	4175
104	Ga0070674_100080008	3300005356	Bacteria	2332
105	Ga0070674_100085197	3300005356	Bacteria	2267
106	Ga0070673_100002682	3300005364	Bacteria	10899
107	Ga0070688_100004383	3300005365	Bacteria	7340
108	Ga0070659_100004732	3300005366	Bacteria	9722
109	Ga0070659_100146899	3300005366	Bacteria	1921
110	Ga0070667_100001429	3300005367	Bacteria	21397
111	Ga0070667_100029364	3300005367	Bacteria	4580
112	Ga0070667_100068653	3300005367	Bacteria	3016
113	Ga0070667_100100389	3300005367	Bacteria	2499
114	Ga0070703_10017295	3300005406	Bacteria	2076
115	Ga0070709_10001642	3300005434	Bacteria	12118
116	Ga0070709_10003602	3300005434	Bacteria	8319
117	Ga0070709_10005467	3300005434	Bacteria	6884
118	Ga0070714_100013820	3300005435	Bacteria	6473
119	Ga0070714_100033661	3300005435	Bacteria	4286
120	Ga0070713_100002130	3300005436	Bacteria	12807
121	Ga0070713_100003091	3300005436	Bacteria	10950
122	Ga0070713_100020726	3300005436	Bacteria	5045
123	Ga0070713_100094960	3300005436	Bacteria	2571
124	Ga0070713_100131037	3300005436	Bacteria	2211
125	Ga0070713_100254603	3300005436	Bacteria	1602
126	Ga0070710_10001132	3300005437	Bacteria	12626
127	Ga0070710_10003655	3300005437	Bacteria	7275
128	Ga0070710_10015367	3300005437	Bacteria	3873
129	Ga0070710_10031412	3300005437	Bacteria	2867
130	Ga0070701_10007846	3300005438	Bacteria	4588
131	Ga0070711_100037088	3300005439	Bacteria	3269
132	Ga0070711_100185497	3300005439	Bacteria	1595
133	Ga0070700_100010970	3300005441	Bacteria	5010
134	Ga0070700_100038270	3300005441	Bacteria	2922
135	Ga0070694_100006993	3300005444	Bacteria	6860
136	Ga0070694_100114741	3300005444	Bacteria	1924
137	Ga0070708_100005534	3300005445	Bacteria	10011
138	Ga0070708_100022450	3300005445	Bacteria	5353
139	Ga0070708_100137961	3300005445	Bacteria	2260
140	Ga0070663_100026359	3300005455	Bacteria	3937
141	Ga0070663_100072320	3300005455	Bacteria	2512
142	Ga0070678_100023744	3300005456	Bacteria	4092
143	Ga0070678_100033200	3300005456	Bacteria	3581
144	Ga0070678_100033206	3300005456	Bacteria	3580
145	Ga0070662_100013871	3300005457	Bacteria	5367
146	Ga0070662_100098404	3300005457	Bacteria	2209
147	Ga0070681_10006215	3300005458	Bacteria	11606
148	Ga0070681_10019127	3300005458	Bacteria	6854
149	Ga0068867_100018968	3300005459	Bacteria	4896
150	Ga0068867_100073968	3300005459	Bacteria	2553
151	Ga0070685_10024114	3300005466	Bacteria	3338
152	Ga0070685_10062627	3300005466	Bacteria	2181
153	Ga0070707_100003645	3300005468	Bacteria	14522
154	Ga0070707_100059338	3300005468	Bacteria	3671
155	Ga0070707_100313543	3300005468	Bacteria	1524
156	Ga0070698_100002784	3300005471	Bacteria	19250
157	Ga0070698_100166882	3300005471	Bacteria	2144
158	Ga0070699_100010274	3300005518	Bacteria	8095
159	Ga0070699_100198807	3300005518	Bacteria	1782
160	Ga0070679_100016263	3300005530	Bacteria	7168
161	Ga0070684_100042489	3300005535	Bacteria	3924
162	Ga0070684_100056596	3300005535	Bacteria	3423
163	Ga0070684_100090112	3300005535	Bacteria	2726
164	Ga0070697_100109945	3300005536	Bacteria	2296
165	Ga0070697_100111263	3300005536	Bacteria	2283
166	Ga0070672_100010094	3300005543	Bacteria	6539
167	Ga0070672_100037636	3300005543	Bacteria	3692
168	Ga0070672_100046964	3300005543	Bacteria	3348
169	Ga0070672_100060655	3300005543	Bacteria	2979
170	Ga0070686_100001845	3300005544	Bacteria	11820
171	Ga0070686_100153092	3300005544	Bacteria	1617
172	Ga0070695_100003597	3300005545	Bacteria	9050
173	Ga0070695_100156811	3300005545	Bacteria	1594
174	Ga0070696_100013188	3300005546	Bacteria	5545
175	Ga0070696_100054561	3300005546	Bacteria	2785
176	Ga0070693_100014637	3300005547	Bacteria	4023
177	Ga0070693_100020390	3300005547	Bacteria	3495
178	Ga0070693_100128699	3300005547	Bacteria	1580
179	Ga0070665_100102801	3300005548	Bacteria	2861
180	Ga0070665_100123475	3300005548	Bacteria	2591
181	Ga0070665_100224776	3300005548	Bacteria	1877
182	Ga0070665_100332681	3300005548	Bacteria	1523
183	Ga0070704_100003777	3300005549	Bacteria	8716
184	Ga0070704_100010479	3300005549	Bacteria	5642
185	Ga0068855_100147013	3300005563	Bacteria	2682
186	Ga0068855_100167406	3300005563	Bacteria	2491
187	Ga0070664_100057460	3300005564	Bacteria	3307
188	Ga0068857_100000825	3300005577	Bacteria	23201
189	Ga0068857_100071409	3300005577	Bacteria	3093
190	Ga0068854_100005746	3300005578	Bacteria	7847
191	Ga0068854_100006416	3300005578	Bacteria	7482
192	Ga0068854_100066660	3300005578	Bacteria	2620
193	Ga0068856_100004702	3300005614	Bacteria	13558
194	Ga0068856_100220812	3300005614	Bacteria	1910
195	Ga0070702_100007181	3300005615	Bacteria	5320
196	Ga0070702_100027848	3300005615	Bacteria	3054
197	Ga0068852_100005334	3300005616	Bacteria	9180
198	Ga0068852_100020468	3300005616	Bacteria	5263
199	Ga0068852_100055070	3300005616	Bacteria	3431
200	Ga0068859_100012382	3300005617	Bacteria	8581
201	Ga0068859_100058039	3300005617	Bacteria	3898
202	Ga0068859_100153704	3300005617	Bacteria	2377
203	Ga0068864_100000016	3300005618	Bacteria	292454
204	Ga0068864_100003085	3300005618	Bacteria	13757
205	Ga0068864_100030383	3300005618	Bacteria	4578
206	Ga0068864_100033236	3300005618	Bacteria	4385
207	Ga0068864_100084285	3300005618	Bacteria	2792
208	Ga0068864_100133971	3300005618	Bacteria	2229
209	Ga0068866_10001247	3300005718	Bacteria	11006
210	Ga0068861_100018109	3300005719	Bacteria	5010
211	Ga0068861_100018613	3300005719	Bacteria	4949
212	Ga0068861_100161561	3300005719	Bacteria	1848
213	Ga0068851_10077990	3300005834	Bacteria	1725
214	Ga0068870_10006935	3300005840	Bacteria	5024
215	Ga0068870_10010077	3300005840	Bacteria	4324
216	Ga0068870_10011056	3300005840	Bacteria	4170
217	Ga0068863_100001887	3300005841	Bacteria	20811
218	Ga0068863_100020493	3300005841	Bacteria	6319
219	Ga0068863_100093151	3300005841	Bacteria	2859
220	Ga0068863_100218130	3300005841	Bacteria	1837
221	Ga0068858_100063302	3300005842	Bacteria	3422
222	Ga0068858_100108934	3300005842	Bacteria	2586
223	Ga0068858_100122130	3300005842	Bacteria	2436
224	Ga0068858_100167279	3300005842	Bacteria	2072
225	Ga0068860_100002390	3300005843	Bacteria	19702
226	Ga0068860_100026283	3300005843	Bacteria	5612
227	Ga0068860_100075903	3300005843	Bacteria	3196
228	Ga0068860_100077921	3300005843	Bacteria	3152
229	Ga0068862_100000068	3300005844	Bacteria	123535
230	Ga0068862_100010699	3300005844	Bacteria	7576
231	Ga0068862_100133755	3300005844	Bacteria	2196
232	Ga0081455_10000200	3300005937	Bacteria	76013
233	Ga0081455_10000768	3300005937	Bacteria	41613
234	Ga0081455_10005811	3300005937	Bacteria	13435
235	Ga0081455_10028316	3300005937	Bacteria	5120
236	Ga0081455_10052106	3300005937	Bacteria	3506
237	Ga0081455_10067882	3300005937	Bacteria	2970
238	Ga0081538_10000527	3300005981	Bacteria	42416
239	Ga0081538_10041924	3300005981	Bacteria	2897
240	Ga0081538_10051173	3300005981	Bacteria	2484
241	Ga0081540_1000303	3300005983	Bacteria	50969
242	Ga0081540_1000459	3300005983	Bacteria	40435
243	Ga0081540_1000726	3300005983	Bacteria	30344
244	Ga0081540_1002649	3300005983	Bacteria	14558
245	Ga0081540_1003830	3300005983	Bacteria	11775
246	Ga0081540_1003910	3300005983	Bacteria	11604
247	Ga0081540_1006666	3300005983	Bacteria	8358
248	Ga0081540_1009787	3300005983	Bacteria	6562
249	Ga0081540_1012946	3300005983	Bacteria	5450
250	Ga0081540_1024563	3300005983	Bacteria	3495
251	Ga0081540_1026854	3300005983	Bacteria	3276
252	Ga0081540_1027228	3300005983	Bacteria	3243
253	Ga0081540_1036114	3300005983	Bacteria	2640
254	Ga0081539_10000008	3300005985	Bacteria	525071
255	Ga0081539_10000747	3300005985	Bacteria	64612
256	Ga0081539_10001010	3300005985	Bacteria	51943
257	Ga0081539_10002027	3300005985	Bacteria	30522
258	Ga0081539_10004951	3300005985	Bacteria	14150
259	Ga0081539_10039464	3300005985	Bacteria	2785
260	Ga0070717_10002186	3300006028	Bacteria	13725
261	Ga0070717_10018588	3300006028	Bacteria	5431
262	Ga0070717_10023179	3300006028	Bacteria	4915
263	Ga0075365_10025380	3300006038	Bacteria	3751
264	Ga0075365_10098867	3300006038	Bacteria	1996
265	Ga0075368_10002361	3300006042	Bacteria	6139
266	Ga0075368_10028649	3300006042	Bacteria	2152
267	Ga0075364_10001029	3300006051	Bacteria	14811
268	Ga0075364_10044728	3300006051	Bacteria	2880
269	Ga0075432_10007773	3300006058	Bacteria	3654
270	Ga0070715_10000320	3300006163	Bacteria	11866
271	Ga0070715_10000420	3300006163	Bacteria	10819
272	Ga0070715_10006169	3300006163	Bacteria	4057
273	Ga0070715_10010703	3300006163	Bacteria	3277
274	Ga0070715_10015703	3300006163	Bacteria	2830
275	Ga0070716_100001867	3300006173	Bacteria	9562
276	Ga0070716_100020203	3300006173	Bacteria	3493
277	Ga0070716_100044394	3300006173	Bacteria	2490
278	Ga0070716_100059932	3300006173	Bacteria	2196
279	Ga0070712_100001878	3300006175	Bacteria	12816
280	Ga0070712_100055421	3300006175	Bacteria	2777
281	Ga0075362_10009545	3300006177	Bacteria	3756
282	Ga0075362_10022812	3300006177	Bacteria	2641
283	Ga0075367_10006118	3300006178	Bacteria	6051
284	Ga0075367_10013796	3300006178	Bacteria	4357
285	Ga0075367_10021373	3300006178	Bacteria	3616
286	Ga0075367_10038273	3300006178	Bacteria	2791
287	Ga0075369_10011401	3300006186	Bacteria	3497
288	Ga0075366_10024479	3300006195	Bacteria	3521
289	Ga0075366_10045627	3300006195	Bacteria	2597
290	Ga0075366_10049192	3300006195	Bacteria	2502
291	Ga0075366_10063442	3300006195	Bacteria	2196
292	Ga0097621_100018375	3300006237	Bacteria	5338
293	Ga0097621_100186922	3300006237	Bacteria	1792
294	Ga0075370_10036524	3300006353	Bacteria	2759
295	Ga0068871_100017948	3300006358	Bacteria	5367
296	Ga0068871_100164342	3300006358	Bacteria	1899
297	Ga0075428_100000103	3300006844	Bacteria	71205
298	Ga0075428_100003399	3300006844	Bacteria	17407
299	Ga0075428_100009742	3300006844	Bacteria	10673
300	Ga0075428_100098353	3300006844	Bacteria	3190
301	Ga0075428_100138048	3300006844	Bacteria	2651
302	Ga0075428_100291397	3300006844	Bacteria	1755
303	Ga0075430_100000133	3300006846	Bacteria	47377
304	Ga0075430_100004771	3300006846	Bacteria	11408
305	Ga0075430_100065258	3300006846	Bacteria	3058
306	Ga0075430_100213323	3300006846	Bacteria	1602
307	Ga0075431_100001293	3300006847	Bacteria	22854
308	Ga0075431_100002259	3300006847	Bacteria	18467
309	Ga0075431_100037647	3300006847	Bacteria	4981
310	Ga0075431_100083102	3300006847	Bacteria	3306
311	Ga0075431_100208278	3300006847	Bacteria	1998
312	Ga0075433_10000506	3300006852	Bacteria	25421
313	Ga0075433_10001540	3300006852	Bacteria	17038
314	Ga0075433_10068973	3300006852	Bacteria	3104
315	Ga0075433_10159343	3300006852	Bacteria	2008
316	Ga0075434_100000472	3300006871	Bacteria	30053
317	Ga0075434_100001125	3300006871	Bacteria	21994
318	Ga0075434_100004709	3300006871	Bacteria	12330
319	Ga0075434_100021009	3300006871	Bacteria	6341
320	Ga0075434_100080376	3300006871	Bacteria	3256
321	Ga0075434_100115829	3300006871	Bacteria	2693
322	Ga0075434_100202054	3300006871	Bacteria	2007
323	Ga0075429_100000163	3300006880	Bacteria	42270
324	Ga0075429_100020211	3300006880	Bacteria	5774
325	Ga0075429_100075942	3300006880	Bacteria	2926
326	Ga0068865_100006160	3300006881	Bacteria	7310
327	Ga0068865_100021323	3300006881	Bacteria	4211
328	Ga0068865_100078669	3300006881	Bacteria	2359
329	Ga0097620_100012381	3300006931	Bacteria	8581
330	Ga0097620_100058038	3300006931	Bacteria	3898
331	Ga0097620_100153701	3300006931	Bacteria	2377
332	Ga0099824_1022507	3300006942	Bacteria	4141
333	Ga0075435_100005547	3300007076	Bacteria	8828
334	Ga0075435_100006632	3300007076	Bacteria	8201
335	Ga0075435_100029304	3300007076	Bacteria	4319
336	Ga0075435_100056294	3300007076	Bacteria	3178
337	Ga0075435_100076789	3300007076	Bacteria	2738
338	Ga0075435_100120272	3300007076	Bacteria	2191
339	Ga0075435_100163692	3300007076	Bacteria	1875
340	Ga0099794_10009565	3300007265	Bacteria	4083
341	Ga0099795_10000216	3300007788	Bacteria	9967
342	Ga0099795_10002853	3300007788	Bacteria	4177
343	Ga0105251_10002065	3300009011	Bacteria	16214
344	Ga0105240_10003119	3300009093	Bacteria	26094
345	Ga0105240_10015980	3300009093	Bacteria	10175
346	Ga0105240_10020880	3300009093	Bacteria	8723
347	Ga0105240_10062547	3300009093	Bacteria	4634
348	Ga0111539_10000389	3300009094	Bacteria	54333
349	Ga0111539_10004544	3300009094	Bacteria	18148
350	Ga0111539_10005030	3300009094	Bacteria	17186
351	Ga0111539_10005183	3300009094	Bacteria	16889
352	Ga0111539_10025207	3300009094	Bacteria	7290
353	Ga0111539_10027318	3300009094	Bacteria	6969
354	Ga0111539_10033030	3300009094	Bacteria	6283
355	Ga0111539_10066357	3300009094	Bacteria	4262
356	Ga0105245_10004886	3300009098	Bacteria	11794
357	Ga0105245_10015633	3300009098	Bacteria	6619
358	Ga0105245_10189971	3300009098	Bacteria	1967
359	Ga0105247_10003705	3300009101	Bacteria	9922
360	Ga0105247_10037800	3300009101	Bacteria	2945
361	Ga0105247_10040980	3300009101	Bacteria	2832
362	Ga0114129_10002163	3300009147	Bacteria	27081
363	Ga0114129_10003194	3300009147	Bacteria	22994
364	Ga0114129_10021030	3300009147	Bacteria	9267
365	Ga0114129_10022094	3300009147	Bacteria	9028
366	Ga0114129_10046959	3300009147	Bacteria	6068
367	Ga0114129_10172096	3300009147	Bacteria	2951
368	Ga0114129_10178412	3300009147	Bacteria	2892
369	Ga0114129_10202623	3300009147	Bacteria	2686
370	Ga0114129_10233588	3300009147	Bacteria	2476
371	Ga0105243_10006915	3300009148	Bacteria	8742
372	Ga0105243_10016177	3300009148	Bacteria	5644
373	Ga0105243_10094100	3300009148	Bacteria	2474
374	Ga0105241_10012907	3300009174	Bacteria	6130
375	Ga0105241_10018500	3300009174	Bacteria	5125
376	Ga0105241_10056744	3300009174	Bacteria	3003
377	Ga0105242_10005843	3300009176	Bacteria	9482
378	Ga0105248_10008593	3300009177	Bacteria	11215
379	Ga0105248_10030646	3300009177	Bacteria	6007
380	Ga0105248_10090547	3300009177	Bacteria	3445
381	Ga0105248_10095407	3300009177	Bacteria	3349
382	Ga0105248_10122502	3300009177	Bacteria	2933
383	Ga0105248_10239281	3300009177	Bacteria	2043
384	Ga0105237_10025782	3300009545	Bacteria	6011
385	Ga0105237_10031793	3300009545	Bacteria	5346
386	Ga0105237_10134246	3300009545	Bacteria	2469
387	Ga0105237_10190843	3300009545	Bacteria	2049
388	Ga0105238_10003628	3300009551	Bacteria	15389
389	Ga0105238_10018690	3300009551	Bacteria	7059
390	Ga0105238_10052431	3300009551	Bacteria	4101
391	Ga0105249_10018756	3300009553	Bacteria	6163
392	Ga0105249_10094744	3300009553	Bacteria	2799
393	Ga0099796_10000421	3300010159	Bacteria	7021
394	Ga0099796_10006609	3300010159	Bacteria	2981
395	Ga0105239_10043580	3300010375	Bacteria	4919
396	Ga0105239_10044826	3300010375	Bacteria	4847
397	Ga0105239_10058713	3300010375	Bacteria	4222
398	Ga0105239_10078857	3300010375	Bacteria	3624
399	Ga0105239_10216347	3300010375	Bacteria	2148
400	Ga0105246_10017018	3300011119	Bacteria	4617
401	Ga0105246_10030521	3300011119	Bacteria	3561
402	Ga0105246_10034450	3300011119	Bacteria	3375
403	Ga0105246_10154825	3300011119	Bacteria	1740
404	Ga0157373_10150890	3300013100	Bacteria	1635
405	Ga0157371_10023732	3300013102	Bacteria	4484
406	Ga0157369_10249398	3300013105	Bacteria	1853
407	Ga0157374_10003804	3300013296	Bacteria	12691
408	Ga0157374_10010540	3300013296	Bacteria	7955
409	Ga0157374_10025104	3300013296	Bacteria	5346
410	Ga0157378_10007681	3300013297	Bacteria	9410
411	Ga0157378_10013539	3300013297	Bacteria	7135
412	Ga0157378_10065470	3300013297	Bacteria	3253
413	Ga0157378_10079320	3300013297	Bacteria	2964
414	Ga0163162_10013059	3300013306	Bacteria	8105
415	Ga0163162_10039006	3300013306	Bacteria	4743
416	Ga0157372_10031288	3300013307	Bacteria	5826
417	Ga0157375_10021128	3300013308	Bacteria	5962
418	Ga0157375_10037929	3300013308	Bacteria	4623
419	Ga0157375_10076771	3300013308	Bacteria	3369
420	Ga0157375_10173210	3300013308	Bacteria	2307
421	Ga0157375_10300125	3300013308	Bacteria	1770
422	Ga0157375_10431132	3300013308	Bacteria	1484
423	Ga0163163_10004872	3300014325	Bacteria	11539
424	Ga0163163_10009467	3300014325	Bacteria	8699
425	Ga0163163_10080858	3300014325	Bacteria	3250
426	Ga0163163_10099722	3300014325	Bacteria	2926
427	Ga0163163_10157549	3300014325	Bacteria	2315
428	Ga0157380_10001774	3300014326	Bacteria	14253
429	Ga0157377_10003064	3300014745	Bacteria	7499
430	Ga0157377_10052389	3300014745	Bacteria	2304
431	Ga0157377_10088694	3300014745	Bacteria	1822
432	Ga0157379_10031492	3300014968	Bacteria	4725
433	Ga0157379_10058893	3300014968	Bacteria	3435
434	Ga0157379_10073604	3300014968	Bacteria	3058
435	Ga0157376_10002959	3300014969	Bacteria	11657
436	Ga0157376_10004003	3300014969	Bacteria	10189
437	Ga0182006_1001196	3300015261	Bacteria	16214
438	Ga0163161_10003456	3300017792	Bacteria	11069
439	Ga0163161_10019750	3300017792	Bacteria	4726
440	Ga0214544_1000020	3300021320	Bacteria	178560
441	Ga0214542_1000024	3300021321	Bacteria	191218
442	Ga0214545_1000011	3300021324	Bacteria	190550
443	Ga0214545_1029344	3300021324	Bacteria	2491
444	Ga0214543_1000033	3300021327	Bacteria	190419
445	Ga0213872_10003584	3300021361	Bacteria	8540
446	Ga0213872_10016312	3300021361	Bacteria	3449
447	Ga0213872_10048178	3300021361	Bacteria	1937
448	Ga0213876_10001998	3300021384	Bacteria	12203
449	Ga0209435_100040	3300025206	Bacteria	115475
450	Ga0209784_100002	3300025224	Bacteria	1753105
451	Ga0209566_100003	3300025225	Bacteria	1753105
452	Ga0209674_100004	3300025226	Bacteria	1753105
453	Ga0209147_100141	3300025229	Bacteria	115466
454	Ga0209563_100006	3300025230	Bacteria	1753105
455	Ga0209563_101304	3300025230	Bacteria	6806
456	Ga0209437_100229	3300025233	Bacteria	95900
457	Ga0209258_100657	3300025242	Bacteria	25150
458	Ga0207425_1009865	3300025245	Bacteria	2352
459	Ga0209646_1000204	3300025246	Bacteria	69552
460	Ga0209646_1000253	3300025246	Bacteria	53522
461	Ga0209026_1000306	3300025250	Bacteria	53524
462	Ga0209677_100003	3300025253	Bacteria	1753105
463	Ga0209677_102281	3300025253	Bacteria	7406
464	Ga0209677_102285	3300025253	Bacteria	7388
465	Ga0209759_1000298	3300025256	Bacteria	68472
466	Ga0209759_1000398	3300025256	Bacteria	53628
467	Ga0209233_1001066	3300025261	Bacteria	11357
468	Ga0209233_1004907	3300025261	Bacteria	4499
469	Ga0209233_1005718	3300025261	Bacteria	4099
470	Ga0207666_1000077	3300025271	Bacteria	16262
471	Ga0209673_1014952	3300025273	Bacteria	2976
472	Ga0207673_1000891	3300025290	Bacteria	3206
473	Ga0209675_1003720	3300025291	Bacteria	7091
474	Ga0209676_1002143	3300025292	Bacteria	14987
475	Ga0209564_1014473	3300025295	Bacteria	3278
476	Ga0209758_1000294	3300025297	Bacteria	98618
477	Ga0209758_1000407	3300025297	Bacteria	73945
478	Ga0209758_1000952	3300025297	Bacteria	39040
479	Ga0209758_1001983	3300025297	Bacteria	22130
480	Ga0209758_1002883	3300025297	Bacteria	16636
481	Ga0209758_1008305	3300025297	Bacteria	6775
482	Ga0209758_1032704	3300025297	Bacteria	2105
483	Ga0209050_1000925	3300025298	Bacteria	38696
484	Ga0209256_1000545	3300025299	Bacteria	54076
485	Ga0209256_1006969	3300025299	Bacteria	5755
486	Ga0207426_1001388	3300025302	Bacteria	20462
487	Ga0207426_1006921	3300025302	Bacteria	4821
488	Ga0207426_1031258	3300025302	Bacteria	1738
489	Ga0209051_1000059	3300025303	Bacteria	260307
490	Ga0209257_1000022	3300025304	Bacteria	765258
491	Ga0209257_1001136	3300025304	Bacteria	34058
492	Ga0207697_10001615	3300025315	Bacteria	12170
493	Ga0207697_10029005	3300025315	Bacteria	2264
494	Ga0207697_10031871	3300025315	Bacteria	2157
495	Ga0207656_10018123	3300025321	Bacteria	2767
496	Ga0207713_1002261	3300025735	Bacteria	14219
497	Ga0207682_10000009	3300025893	Bacteria	86366
498	Ga0207682_10007879	3300025893	Bacteria	4230
499	Ga0207682_10008819	3300025893	Bacteria	3988
500	Ga0207692_10007013	3300025898	Bacteria	4600
501	Ga0207692_10008475	3300025898	Bacteria	4253
502	Ga0207642_10011334	3300025899	Bacteria	3176
503	Ga0207642_10089442	3300025899	Bacteria	1517
504	Ga0207710_10017532	3300025900	Bacteria	3038
505	Ga0207710_10018129	3300025900	Bacteria	2992
506	Ga0207710_10018417	3300025900	Bacteria	2969
507	Ga0207710_10023791	3300025900	Bacteria	2633
508	Ga0207688_10001372	3300025901	Bacteria	12640
509	Ga0207688_10010399	3300025901	Bacteria	5064
510	Ga0207688_10015227	3300025901	Bacteria	4173
511	Ga0207688_10058016	3300025901	Bacteria	2178
512	Ga0207688_10061197	3300025901	Bacteria	2122
513	Ga0207680_10055095	3300025903	Bacteria	2395
514	Ga0207647_10006480	3300025904	Bacteria	8506
515	Ga0207647_10035209	3300025904	Bacteria	3192
516	Ga0207685_10005926	3300025905	Bacteria	3277
517	Ga0207699_10001319	3300025906	Bacteria	11796
518	Ga0207699_10002443	3300025906	Bacteria	8765
519	Ga0207699_10049238	3300025906	Bacteria	2480
520	Ga0207645_10002502	3300025907	Bacteria	14418
521	Ga0207645_10018918	3300025907	Bacteria	4524
522	Ga0207643_10000292	3300025908	Bacteria	34914
523	Ga0207643_10000418	3300025908	Bacteria	28078
524	Ga0207643_10040888	3300025908	Bacteria	2611
525	Ga0207643_10064491	3300025908	Bacteria	2096
526	Ga0207654_10015148	3300025911	Bacteria	3995
527	Ga0207654_10017669	3300025911	Bacteria	3734
528	Ga0207654_10030110	3300025911	Bacteria	2977
529	Ga0207707_10002931	3300025912	Bacteria	15207
530	Ga0207695_10001540	3300025913	Bacteria	37977
531	Ga0207695_10017000	3300025913	Bacteria	8486
532	Ga0207695_10023519	3300025913	Bacteria	6958
533	Ga0207671_10032015	3300025914	Bacteria	3915
534	Ga0207671_10066825	3300025914	Bacteria	2677
535	Ga0207671_10139691	3300025914	Bacteria	1866
536	Ga0207671_10175033	3300025914	Bacteria	1668
537	Ga0207693_10001385	3300025915	Bacteria	21487
538	Ga0207693_10001566	3300025915	Bacteria	20200
539	Ga0207693_10011746	3300025915	Bacteria	7079
540	Ga0207693_10013334	3300025915	Bacteria	6626
541	Ga0207693_10064329	3300025915	Bacteria	2873
542	Ga0207663_10000136	3300025916	Bacteria	34085
543	Ga0207663_10006786	3300025916	Bacteria	5893
544	Ga0207660_10000893	3300025917	Bacteria	19637
545	Ga0207660_10180090	3300025917	Bacteria	1641
546	Ga0207662_10000861	3300025918	Bacteria	13998
547	Ga0207662_10064505	3300025918	Bacteria	2204
548	Ga0207657_10003725	3300025919	Bacteria	16199
549	Ga0207657_10012700	3300025919	Bacteria	8299
550	Ga0207657_10036461	3300025919	Bacteria	4401
551	Ga0207649_10004064	3300025920	Bacteria	7965
552	Ga0207649_10071124	3300025920	Bacteria	2221
553	Ga0207652_10002516	3300025921	Bacteria	15403
554	Ga0207646_10007486	3300025922	Bacteria	11082
555	Ga0207681_10008223	3300025923	Bacteria	6379
556	Ga0207681_10014965	3300025923	Bacteria	4833
557	Ga0207681_10040181	3300025923	Bacteria	3111
558	Ga0207694_10014930	3300025924	Bacteria	5857
559	Ga0207694_10035008	3300025924	Bacteria	3851
560	Ga0207650_10000288	3300025925	Bacteria	51267
561	Ga0207650_10001712	3300025925	Bacteria	15568
562	Ga0207650_10001829	3300025925	Bacteria	15043
563	Ga0207650_10002115	3300025925	Bacteria	13878
564	Ga0207650_10045906	3300025925	Bacteria	3215
565	Ga0207659_10001554	3300025926	Bacteria	13628
566	Ga0207659_10016654	3300025926	Bacteria	4789
567	Ga0207659_10116180	3300025926	Bacteria	2042
568	Ga0207687_10001197	3300025927	Bacteria	17741
569	Ga0207687_10006940	3300025927	Bacteria	7460
570	Ga0207687_10013222	3300025927	Bacteria	5391
571	Ga0207687_10124106	3300025927	Bacteria	1936
572	Ga0207700_10006688	3300025928	Bacteria	6994
573	Ga0207700_10023730	3300025928	Bacteria	4236
574	Ga0207700_10032460	3300025928	Bacteria	3724
575	Ga0207700_10041044	3300025928	Bacteria	3382
576	Ga0207664_10013549	3300025929	Bacteria	5857
577	Ga0207664_10060688	3300025929	Bacteria	3014
578	Ga0207664_10068985	3300025929	Bacteria	2842
579	Ga0207664_10079804	3300025929	Bacteria	2658
580	Ga0207644_10001963	3300025931	Bacteria	13295
581	Ga0207644_10014948	3300025931	Bacteria	5204
582	Ga0207644_10041902	3300025931	Bacteria	3241
583	Ga0207644_10104521	3300025931	Bacteria	2132
584	Ga0207690_10005575	3300025932	Bacteria	7436
585	Ga0207706_10002827	3300025933	Bacteria	16841
586	Ga0207706_10014998	3300025933	Bacteria	7015
587	Ga0207706_10024198	3300025933	Bacteria	5444
588	Ga0207706_10095387	3300025933	Bacteria	2616
589	Ga0207686_10001310	3300025934	Bacteria	14258
590	Ga0207686_10001988	3300025934	Bacteria	11265
591	Ga0207709_10002910	3300025935	Bacteria	10449
592	Ga0207709_10009749	3300025935	Bacteria	5293
593	Ga0207709_10016042	3300025935	Bacteria	4158
594	Ga0207709_10145261	3300025935	Bacteria	1636
595	Ga0207670_10002928	3300025936	Bacteria	9025
596	Ga0207670_10010411	3300025936	Bacteria	5356
597	Ga0207669_10000909	3300025937	Bacteria	12533
598	Ga0207669_10159702	3300025937	Bacteria	1590
599	Ga0207704_10004639	3300025938	Bacteria	6300
600	Ga0207704_10006693	3300025938	Bacteria	5397
601	Ga0207665_10000064	3300025939	Bacteria	68931
602	Ga0207665_10001510	3300025939	Bacteria	15663
603	Ga0207665_10002822	3300025939	Bacteria	11647
604	Ga0207665_10008638	3300025939	Bacteria	6706
605	Ga0207665_10049190	3300025939	Bacteria	2832
606	Ga0207691_10005519	3300025940	Bacteria	12220
607	Ga0207691_10025609	3300025940	Bacteria	5537
608	Ga0207691_10061618	3300025940	Bacteria	3407
609	Ga0207691_10091423	3300025940	Bacteria	2727
610	Ga0207691_10137905	3300025940	Bacteria	2151
611	Ga0207691_10198351	3300025940	Bacteria	1748
612	Ga0207691_10243719	3300025940	Bacteria	1553
613	Ga0207711_10001144	3300025941	Bacteria	25260
614	Ga0207711_10037712	3300025941	Bacteria	4107
615	Ga0207711_10043321	3300025941	Bacteria	3838
616	Ga0207689_10001448	3300025942	Bacteria	22699
617	Ga0207689_10019790	3300025942	Bacteria	5669
618	Ga0207689_10039992	3300025942	Bacteria	3882
619	Ga0207689_10065521	3300025942	Bacteria	2988
620	Ga0207661_10002433	3300025944	Bacteria	12827
621	Ga0207661_10048530	3300025944	Bacteria	3375
622	Ga0207661_10060818	3300025944	Bacteria	3050
623	Ga0207679_10003604	3300025945	Bacteria	9607
624	Ga0207679_10075413	3300025945	Bacteria	2559
625	Ga0207667_10111248	3300025949	Bacteria	2825
626	Ga0207651_10001703	3300025960	Bacteria	10145
627	Ga0207651_10047471	3300025960	Bacteria	2895
628	Ga0207712_10003650	3300025961	Bacteria	9700
629	Ga0207668_10001981	3300025972	Bacteria	11973
630	Ga0207640_10003763	3300025981	Bacteria	8180
631	Ga0207640_10008114	3300025981	Bacteria	5812
632	Ga0207640_10061301	3300025981	Bacteria	2491
633	Ga0207658_10000466	3300025986	Bacteria	37801
634	Ga0207658_10031138	3300025986	Bacteria	3785
635	Ga0207677_10001053	3300026023	Bacteria	15130
636	Ga0207677_10029878	3300026023	Bacteria	3470
637	Ga0207677_10219604	3300026023	Bacteria	1524
638	Ga0207703_10017302	3300026035	Bacteria	5627
639	Ga0207703_10023676	3300026035	Bacteria	4829
640	Ga0207703_10031824	3300026035	Bacteria	4173
641	Ga0207703_10084827	3300026035	Bacteria	2649
642	Ga0207703_10097711	3300026035	Bacteria	2482
643	Ga0207703_10279628	3300026035	Bacteria	1515
644	Ga0207639_10040853	3300026041	Bacteria	3465
645	Ga0207639_10051630	3300026041	Bacteria	3128
646	Ga0207678_10002714	3300026067	Bacteria	16050
647	Ga0207678_10006709	3300026067	Bacteria	10210
648	Ga0207678_10030296	3300026067	Bacteria	4724
649	Ga0207708_10002881	3300026075	Bacteria	12675
650	Ga0207708_10003108	3300026075	Bacteria	12219
651	Ga0207708_10038305	3300026075	Bacteria	3652
652	Ga0207708_10102100	3300026075	Bacteria	2220
653	Ga0207641_10000103	3300026088	Bacteria	122350
654	Ga0207641_10008745	3300026088	Bacteria	8365
655	Ga0207641_10009054	3300026088	Bacteria	8223
656	Ga0207641_10079739	3300026088	Bacteria	2839
657	Ga0207648_10003666	3300026089	Bacteria	16077
658	Ga0207648_10006999	3300026089	Bacteria	11151
659	Ga0207648_10009796	3300026089	Bacteria	9155
660	Ga0207648_10074823	3300026089	Bacteria	2952
661	Ga0207648_10108021	3300026089	Bacteria	2442
662	Ga0207676_10000044	3300026095	Bacteria	161679
663	Ga0207676_10010622	3300026095	Bacteria	6563
664	Ga0207676_10016879	3300026095	Bacteria	5285
665	Ga0207676_10052284	3300026095	Bacteria	3192
666	Ga0207676_10073921	3300026095	Bacteria	2744
667	Ga0207674_10024031	3300026116	Bacteria	6517
668	Ga0207674_10047126	3300026116	Bacteria	4421
669	Ga0207674_10151319	3300026116	Bacteria	2278
670	Ga0207674_10154307	3300026116	Bacteria	2252
671	Ga0207674_10258133	3300026116	Bacteria	1690
672	Ga0207675_100005413	3300026118	Bacteria	12230
673	Ga0207675_100029224	3300026118	Bacteria	5137
674	Ga0207675_100039892	3300026118	Bacteria	4381
675	Ga0207675_100042588	3300026118	Bacteria	4239
676	Ga0207683_10000782	3300026121	Bacteria	29001
677	Ga0207683_10001222	3300026121	Bacteria	23313
678	Ga0207683_10014258	3300026121	Bacteria	6772
679	Ga0207683_10030958	3300026121	Bacteria	4641
680	Ga0207683_10185100	3300026121	Bacteria	1889
681	Ga0207698_10000603	3300026142	Bacteria	21081
682	Ga0207698_10033824	3300026142	Bacteria	3719
683	Ga0207698_10045774	3300026142	Bacteria	3298
684	Ga0207698_10154018	3300026142	Bacteria	1999
685	Ga0209389_1000011	3300027296	Bacteria	223265
686	Ga0209389_1000424	3300027296	Bacteria	25082
687	Ga0209589_1004180	3300027357	Bacteria	25082
688	Ga0209489_100017	3300027361	Bacteria	223265
689	Ga0209489_104563	3300027361	Bacteria	25351
690	Ga0209700_100027	3300027363	Bacteria	223462
691	Ga0209179_1005548	3300027512	Bacteria	1982
692	Ga0210002_1003574	3300027617	Bacteria	2295
693	Ga0209588_1017593	3300027671	Bacteria	2217
694	Ga0209998_10001207	3300027717	Bacteria	6346
695	Ga0209998_10006448	3300027717	Bacteria	2437
696	Ga0209974_10001210	3300027876	Bacteria	9241
697	Ga0209974_10020357	3300027876	Bacteria	2199
698	Ga0207428_10000164	3300027907	Bacteria	91968
699	Ga0207428_10000391	3300027907	Bacteria	54825
700	Ga0207428_10002684	3300027907	Bacteria	17726
701	Ga0207428_10030850	3300027907	Bacteria	4428
702	Ga0207428_10033735	3300027907	Bacteria	4200
703	Ga0207428_10157801	3300027907	Bacteria	1724
704	Ga0268266_10003117	3300028379	Bacteria	16871
705	Ga0268266_10005300	3300028379	Bacteria	12094
706	Ga0268266_10137128	3300028379	Bacteria	2192
707	Ga0268266_10245286	3300028379	Bacteria	1655
708	Ga0268265_10000142	3300028380	Bacteria	91165
709	Ga0268265_10067166	3300028380	Bacteria	2775
710	Ga0268265_10157663	3300028380	Bacteria	1923
711	Ga0268264_10000035	3300028381	Bacteria	398196
712	Ga0268264_10007183	3300028381	Bacteria	9329
713	Ga0268264_10124929	3300028381	Bacteria	2273
714	Ga0265337_1019331	3300028556	Bacteria	2148
715	Ga0265319_1001186	3300028563	Bacteria	16109
716	Ga0265334_10004555	3300028573	Bacteria	6143
717	Ga0265334_10026011	3300028573	Bacteria	2365
718	Ga0265318_10002015	3300028577	Bacteria	11243
719	Ga0265318_10002315	3300028577	Bacteria	10231
720	Ga0265318_10002586	3300028577	Bacteria	9581
721	Ga0265323_10000768	3300028653	Bacteria	17199
722	Ga0265322_10003636	3300028654	Bacteria	4638
723	Ga0265336_10000106	3300028666	Bacteria	63839
724	Ga0307517_10000049	3300028786	Bacteria	160368
725	Ga0307515_10008473	3300028794	Bacteria	20029
726	Ga0265338_10000065	3300028800	Bacteria	188966
727	Ga0265324_10001808	3300029957	Bacteria	11615
728	Ga0307511_10000948	3300030521	Bacteria	30775
729	Ga0265330_10013442	3300031235	Bacteria	3814
730	Ga0265330_10020506	3300031235	Bacteria	3020
731	Ga0265332_10007484	3300031238	Bacteria	4937
732	Ga0265332_10028029	3300031238	Bacteria	2466
733	Ga0265328_10003748	3300031239	Bacteria	6699
734	Ga0265320_10009181	3300031240	Bacteria	5983
735	Ga0265320_10038913	3300031240	Bacteria	2381
736	Ga0265325_10012239	3300031241	Bacteria	4909
737	Ga0265325_10023047	3300031241	Bacteria	3405
738	Ga0265329_10008771	3300031242	Bacteria	3813
739	Ga0265329_10008995	3300031242	Bacteria	3753
740	Ga0265339_10021009	3300031249	Bacteria	3807
741	Ga0265331_10000945	3300031250	Bacteria	23156
742	Ga0265331_10025683	3300031250	Bacteria	2970
743	Ga0265327_10021443	3300031251	Bacteria	3898
744	Ga0265316_10071014	3300031344	Bacteria	2684
745	Ga0265316_10109432	3300031344	Bacteria	2094
746	Ga0265316_10122993	3300031344	Bacteria	1959
747	Ga0307513_10091203	3300031456	Bacteria	3106
748	Ga0307509_10029697	3300031507	Bacteria	6062
749	Ga0307509_10083377	3300031507	Bacteria	3295
750	Ga0307408_100018764	3300031548	Bacteria	4648
751	Ga0307508_10000090	3300031616	Bacteria	106893
752	Ga0265314_10000220	3300031711	Bacteria	84921
753	Ga0265314_10026005	3300031711	Bacteria	4404
754	Ga0265314_10127697	3300031711	Bacteria	1590
755	Ga0265342_10006047	3300031712	Bacteria	9083
756	Ga0265342_10011954	3300031712	Bacteria	5900
757	Ga0265342_10021271	3300031712	Bacteria	4146
758	Ga0307516_10006682	3300031730	Bacteria	13475
759	Ga0307516_10103897	3300031730	Bacteria	2654
760	Ga0307413_10072121	3300031824	Bacteria	2179
761	Ga0307412_10000335	3300031911	Bacteria	29669
762	Ga0307412_10131089	3300031911	Bacteria	1821
763	Ga0307411_10053158	3300032005	Bacteria	2652
764	Ga0307507_10098971	3300033179	Bacteria	2452
765	Ga0307510_10019318	3300033180	Bacteria	7995
766	Ga0307510_10031887	3300033180	Bacteria	5944
767	Ga0307510_10044427	3300033180	Bacteria	4812
768	Ga0307510_10072820	3300033180	Bacteria	3410
769	Ga0315911_1000011	3300033442	Bacteria	264678
770	Ga0373950_0000340	3300034818	Bacteria	5861
771	Ga0373958_0000223	3300034819	Bacteria	6705
772	Ga0373959_0000418	3300034820	Bacteria	8131
773	Ga0373938_0000580	3300034957	Bacteria	5903
774	Ga0373928_0000151	3300035084	Bacteria	13297
775	Ga0373928_0014812	3300035084	Bacteria	1581
776	Ga0373929_0001036	3300035085	Bacteria	5391
777	Ga0373934_0009191	3300035086	Bacteria	3701
778	Ga0373940_0003150	3300035088	Bacteria	3328
779	Ga0373949_0001703	3300035090	Bacteria	6102
780	Ga0373951_0000232	3300035091	Bacteria	19022
781	Ga0373952_0000567	3300035092	Bacteria	6518
782	Ga0373923_0000595	3300035111	Bacteria	8982
783	Ga0373923_0003802	3300035111	Bacteria	4905
784	Ga0373932_0000366	3300035112	Bacteria	13946
785	Ga0373936_0002231	3300035113	Bacteria	7235
786	Ga0373936_0028657	3300035113	Bacteria	2190
787	Ga0373939_0000753	3300035114	Bacteria	7981
788	Ga0373939_0006530	3300035114	Bacteria	2813
789	Ga0373941_0001679	3300035115	Bacteria	4740
790	Ga0373945_0013753	3300035116	Bacteria	2704
791	Ga0373953_0002952	3300035117	Bacteria	5199
792	Ga0373953_0005683	3300035117	Bacteria	4065
793	Ga0373954_0000951	3300035118	Bacteria	11318
794	Ga0373954_0007519	3300035118	Bacteria	4768
795	Ga0373954_0010242	3300035118	Bacteria	4134
796	Ga0373960_0016590	3300035121	Bacteria	1898
797	Ga0373943_0004323	3300035170	Bacteria	6444
798	Ga0373943_0008124	3300035170	Bacteria	4708
799	Ga0373943_0066244	3300035170	Bacteria	1818
800	Ga0373946_0018323	3300035171	Bacteria	2687
801	Ga0373946_0043539	3300035171	Bacteria	1850
802	Ga0373946_0057985	3300035171	Bacteria	1639
803	Ga0373955_0000360	3300035172	Bacteria	19140
804	Ga0373955_0000643	3300035172	Bacteria	14950
805	Ga0373955_0030797	3300035172	Bacteria	2805
806	Ga0373942_0000780	3300035207	Bacteria	8788
807	Ga0373961_0004799	3300035241	Bacteria	3250
808	Ga0373961_0020487	3300035241	Bacteria	1750
809	Ga0373962_0001878	3300035242	Bacteria	5009
810	Ga0373924_0002747	3300035410	Bacteria	5940
811	Ga0373924_0030057	3300035410	Bacteria	2175
812	Ga0373931_0002260	3300035691	Bacteria	8511
813	Ga0373931_0006487	3300035691	Bacteria	5467
814	Ga0373931_0010679	3300035691	Bacteria	4418
815	Ga0373931_0010912	3300035691	Bacteria	4374
816	Ga0373931_0113141	3300035691	Bacteria	1542
817	Ga0373935_0000075	3300035692	Bacteria	42723
818	Ga0373935_0002949	3300035692	Bacteria	9803
819	Ga0373935_0019417	3300035692	Bacteria	4144
820	Ga0373927_0000950	3300035695	Bacteria	22071
821	Ga0373927_0007183	3300035695	Bacteria	7558
822	Ga0373927_0014279	3300035695	Bacteria	5262
823	Ga0373927_0132370	3300035695	Bacteria	1630
824	Ga0373933_0002546	3300035724	Bacteria	10225
825	Ga0373933_0002722	3300035724	Bacteria	9888
826	Ga0373933_0003920	3300035724	Bacteria	8208
827	Ga0373933_0015393	3300035724	Bacteria	4261
828	Ga0373933_0113081	3300035724	Bacteria	1695
829	Ga0373947_0000138	3300035725	Bacteria	37713
830	Ga0373947_0003025	3300035725	Bacteria	10019
831	Ga0373947_0040432	3300035725	Bacteria	2777
832	Ga0373947_0063903	3300035725	Bacteria	2243
833	Ga0373947_0075867	3300035725	Bacteria	2071
834	Ga0373937_0000057	3300036401	Bacteria	99491
835	Ga0373937_0008436	3300036401	Bacteria	8955
836	Ga0373937_0031959	3300036401	Bacteria	4772
837	Ga0373937_0116753	3300036401	Bacteria	2485
838	Ga0373925_0000078	3300037068	Bacteria	105238
839	Ga0373925_0007900	3300037068	Bacteria	7745
840	Ga0373925_0016899	3300037068	Bacteria	5282
841	Ga0373925_0023694	3300037068	Bacteria	4479
842	Ga0395900_0152680	3300037418	Bacteria	2359
843	Ga0395905_0039879	3300037471	Bacteria	4405
844	Ga0395905_0188380	3300037471	Bacteria	1936
845	Ga0395905_0203419	3300037471	Bacteria	1856
846	Ga0436364_0009978	3300037853	Bacteria	2047
847	Ga0436364_0810480	3300037853	Bacteria	2901
848	Ga0395901_0051193	3300038443	Bacteria	4293
849	Ga0395901_0073367	3300038443	Bacteria	3569
850	Ga0436365_0240210	3300039437	Bacteria	20191
851	Ga0436365_0355346	3300039437	Bacteria	16712
852	Ga0436365_0642532	3300039437	Bacteria	3284
853	Ga0436365_0729222	3300039437	Bacteria	5511
854	Ga0436365_1709207	3300039437	Bacteria	1942
855	Ga0436360_0811388	3300039438	Bacteria	3964
856	Ga0436360_0930029	3300039438	Bacteria	2601
857	Ga0436360_0953856	3300039438	Bacteria	1958
858	Ga0436361_0053786	3300039447	Bacteria	27680
859	Ga0436361_0356069	3300039447	Bacteria	2837
860	Ga0436361_0536912	3300039447	Bacteria	2398
861	Ga0436361_0671651	3300039447	Bacteria	7640
862	Ga0436362_0837923	3300039453	Bacteria	4261
863	Ga0439450_006325	3300042008	Bacteria	2128
864	Ga0439455_0011932	3300042012	Bacteria	1941
865	Ga0439435_0001852	3300042436	Bacteria	4040
866	Ga0439464_0016409	3300042439	Bacteria	2001
867	Ga0451577_0039655	3300042876	Bacteria	4232
868	Ga0466972_0000371	3300044658	Bacteria	24281
869	Ga0466966_0001015	3300044684	Bacteria	17896
870	Ga0466961_0003875	3300044693	Bacteria	9345
871	Ga0453684_0000063	3300044712	Bacteria	486079
872	Ga0453684_0005314	3300044712	Bacteria	25677
873	Ga0453684_0017221	3300044712	Bacteria	11217
874	Ga0453684_0045710	3300044712	Bacteria	5835
875	Ga0453684_0090641	3300044712	Bacteria	3777
876	Ga0466959_0008411	3300045049	Bacteria	7295
877	Ga0466959_0092197	3300045049	Bacteria	2175
878	Ga0451576_0017298	3300045051	Bacteria	7933
879	Ga0495592_0000233	3300046454	Bacteria	48027
880	Ga0495592_0006322	3300046454	Bacteria	8817
881	Ga0495592_0009069	3300046454	Bacteria	7481
882	Ga0495592_0022208	3300046454	Bacteria	4827
883	Ga0495592_0026673	3300046454	Bacteria	4379
884	Ga0495592_0133728	3300046454	Bacteria	1732
885	Ga0495603_0000200	3300046455	Bacteria	31435
886	Ga0495603_0004845	3300046455	Bacteria	8045
887	Ga0495603_0013905	3300046455	Bacteria	4869
888	Ga0495603_0021588	3300046455	Bacteria	3899
889	Ga0495603_0033822	3300046455	Bacteria	3075
890	Ga0495603_0035297	3300046455	Bacteria	3004
891	Ga0495603_0041698	3300046455	Bacteria	2744
892	Ga0495629_0000139	3300046459	Bacteria	63649
893	Ga0495629_0002535	3300046459	Bacteria	14008
894	Ga0495629_0003366	3300046459	Bacteria	12077
895	Ga0495629_0010260	3300046459	Bacteria	6822
896	Ga0495638_0004444	3300046460	Bacteria	10621
897	Ga0495638_0011979	3300046460	Bacteria	5961
898	Ga0495638_0054119	3300046460	Bacteria	2496
899	Ga0495641_0007101	3300046461	Bacteria	7084
900	Ga0495641_0008896	3300046461	Bacteria	6042
901	Ga0495641_0011896	3300046461	Bacteria	4913
902	Ga0495651_0002019	3300046462	Bacteria	15670
903	Ga0495651_0002101	3300046462	Bacteria	15375
904	Ga0495651_0027827	3300046462	Bacteria	4405
905	Ga0495653_0000464	3300046463	Bacteria	31572
906	Ga0495653_0001070	3300046463	Bacteria	21097
907	Ga0495653_0001537	3300046463	Bacteria	18040
908	Ga0495653_0028701	3300046463	Bacteria	4448
909	Ga0495580_0002104	3300046472	Bacteria	17472
910	Ga0495580_0034637	3300046472	Bacteria	3634
911	Ga0495582_0000354	3300046473	Bacteria	25130
912	Ga0495582_0100804	3300046473	Bacteria	1617
913	Ga0495639_0005177	3300046475	Bacteria	5601
914	Ga0495662_0001193	3300046476	Bacteria	12825
915	Ga0495662_0037215	3300046476	Bacteria	2350
916	Ga0495664_0000023	3300046477	Bacteria	126807
917	Ga0495664_0000915	3300046477	Bacteria	15177
918	Ga0495664_0008000	3300046477	Bacteria	5886
919	Ga0495664_0009369	3300046477	Bacteria	5477
920	Ga0495664_0074724	3300046477	Bacteria	2028
921	Ga0495584_0001897	3300046491	Bacteria	12061
922	Ga0495585_0094128	3300046492	Bacteria	1610
923	Ga0495594_0001396	3300046499	Bacteria	12540
924	Ga0495594_0020533	3300046499	Bacteria	3518
925	Ga0495607_0006400	3300046501	Bacteria	8294
926	Ga0495607_0022482	3300046501	Bacteria	3960
927	Ga0495606_0002687	3300046507	Bacteria	20107
928	Ga0495608_0000030	3300046511	Bacteria	145828
929	Ga0495608_0000832	3300046511	Bacteria	21541
930	Ga0495608_0005335	3300046511	Bacteria	9184
931	Ga0495608_0019297	3300046511	Bacteria	4694
932	Ga0495608_0042381	3300046511	Bacteria	3044
933	Ga0495608_0061824	3300046511	Bacteria	2462
934	Ga0495610_0011330	3300046512	Bacteria	5458
935	Ga0495618_0000585	3300046514	Bacteria	25962
936	Ga0495618_0019644	3300046514	Bacteria	4158
937	Ga0495618_0061547	3300046514	Bacteria	2381
938	Ga0495628_0000027	3300046516	Bacteria	126537
939	Ga0495628_0014573	3300046516	Bacteria	6584
940	Ga0495628_0067228	3300046516	Bacteria	2799
941	Ga0495630_0006673	3300046517	Bacteria	8227
942	Ga0495630_0018196	3300046517	Bacteria	5159
943	Ga0495630_0030591	3300046517	Bacteria	4006
944	Ga0495632_0005127	3300046519	Bacteria	8747
945	Ga0495637_0015591	3300046520	Bacteria	3565
946	Ga0495648_0008413	3300046524	Bacteria	8123
947	Ga0495652_0000041	3300046529	Bacteria	126519
948	Ga0495652_0006363	3300046529	Bacteria	10997
949	Ga0495652_0017901	3300046529	Bacteria	6323
950	Ga0495652_0023871	3300046529	Bacteria	5416
951	Ga0495652_0040925	3300046529	Bacteria	4003
952	Ga0495652_0074114	3300046529	Bacteria	2832
953	Ga0495665_0002145	3300046531	Bacteria	10679
954	Ga0495665_0002572	3300046531	Bacteria	9795
955	Ga0495640_0000056	3300046533	Bacteria	62074
956	Ga0495640_0017266	3300046533	Bacteria	5381
957	Ga0495640_0021984	3300046533	Bacteria	4671
958	Ga0495640_0030764	3300046533	Bacteria	3840
959	Ga0495640_0075383	3300046533	Bacteria	2253
960	Ga0495640_0094870	3300046533	Bacteria	1964
961	Ga0495586_0052757	3300046535	Bacteria	2202
962	Ga0495587_0000025	3300046536	Bacteria	147974
963	Ga0495587_0014270	3300046536	Bacteria	4985
964	Ga0495587_0017630	3300046536	Bacteria	4434
965	Ga0495587_0024566	3300046536	Bacteria	3691
966	Ga0495609_0000650	3300046538	Bacteria	27040
967	Ga0495609_0053131	3300046538	Bacteria	1802
968	Ga0495645_0000001	3300046543	Bacteria	657910
969	Ga0495645_0002752	3300046543	Bacteria	11949
970	Ga0495645_0087492	3300046543	Bacteria	2229
971	Ga0495622_0073150	3300046557	Bacteria	1581
972	Ga0495633_0002146	3300046558	Bacteria	14137
973	Ga0495667_0000001	3300046559	Bacteria	834831
974	Ga0495667_0003082	3300046559	Bacteria	11183
975	Ga0495667_0005379	3300046559	Bacteria	8657
976	Ga0495667_0014365	3300046559	Bacteria	5349
977	Ga0495667_0029156	3300046559	Bacteria	3714
978	Ga0495667_0037964	3300046559	Bacteria	3208
979	Ga0495667_0059628	3300046559	Bacteria	2504
980	Ga0495656_0000091	3300046615	Bacteria	38995
981	Ga0495656_0030882	3300046615	Bacteria	2168
982	Ga0495656_0059799	3300046615	Bacteria	1659
983	Ga0495668_0037116	3300046616	Bacteria	2728
984	Ga0495634_0001485	3300046642	Bacteria	20743
985	Ga0495634_0003609	3300046642	Bacteria	12362
986	Ga0495634_0006837	3300046642	Bacteria	8630
987	Ga0495634_0035941	3300046642	Bacteria	3390
988	Ga0495611_0031594	3300046648	Bacteria	2331
989	Ga0495625_0000657	3300046660	Bacteria	49342
990	Ga0495625_0054122	3300046660	Bacteria	2867
991	Ga0495635_0000077	3300046663	Bacteria	60215
992	Ga0495635_0001348	3300046663	Bacteria	16335
993	Ga0495635_0001667	3300046663	Bacteria	14944
994	Ga0495635_0005923	3300046663	Bacteria	8529
995	Ga0495635_0014408	3300046663	Bacteria	5531
996	Ga0495635_0026385	3300046663	Bacteria	4043
997	Ga0495659_0003716	3300046664	Bacteria	4852
998	Ga0495659_0013930	3300046664	Bacteria	2624
999	Ga0495588_0007030	3300046674	Bacteria	5102
1000	Ga0495588_0026608	3300046674	Bacteria	2889
1001	Ga0495588_0104312	3300046674	Bacteria	1491
1002	Ga0495657_0000390	3300046675	Bacteria	40745
1003	Ga0495657_0002643	3300046675	Bacteria	14975
1004	Ga0495657_0033520	3300046675	Bacteria	3574
1005	Ga0495657_0044165	3300046675	Bacteria	3033
1006	Ga0495599_0000021	3300046678	Bacteria	127591
1007	Ga0495599_0006501	3300046678	Bacteria	7052
1008	Ga0495599_0031977	3300046678	Bacteria	3303
1009	Ga0495599_0035992	3300046678	Bacteria	3107
1010	Ga0495623_0000141	3300046679	Bacteria	44491
1011	Ga0495623_0007128	3300046679	Bacteria	7258
1012	Ga0495646_0000051	3300046680	Bacteria	60085
1013	Ga0495646_0002199	3300046680	Bacteria	11877
1014	Ga0495646_0010792	3300046680	Bacteria	5803
1015	Ga0495646_0031676	3300046680	Bacteria	3294
1016	Ga0495646_0081565	3300046680	Bacteria	1884
1017	Ga0495658_0000065	3300046683	Bacteria	52835
1018	Ga0495658_0062648	3300046683	Bacteria	2138
1019	Ga0495658_0077884	3300046683	Bacteria	1939
1020	Ga0495669_0035333	3300046684	Bacteria	2206
1021	Ga0495613_0002672	3300046689	Bacteria	13380
1022	Ga0495624_0001939	3300046690	Bacteria	15749
1023	Ga0495624_0002275	3300046690	Bacteria	14611
1024	Ga0495624_0005832	3300046690	Bacteria	8812
1025	Ga0495624_0049899	3300046690	Bacteria	2653
1026	Ga0495670_0000199	3300046691	Bacteria	26898
1027	Ga0495589_0061358	3300046794	Bacteria	1846
1028	Ga0495600_0000114	3300046809	Bacteria	44972
1029	Ga0495600_0005269	3300046809	Bacteria	7784
1030	Ga0495600_0028768	3300046809	Bacteria	3597
1031	Ga0495600_0071798	3300046809	Bacteria	2261
1032	Ga0495600_0076891	3300046809	Bacteria	2180
1033	Ga0495660_0024370	3300046810	Bacteria	3447
1034	Ga0495581_0000851	3300047315	Bacteria	16242
1035	Ga0495581_0005368	3300047315	Bacteria	7416
1036	Ga0495581_0009905	3300047315	Bacteria	5512
1037	Ga0495604_0000036	3300047317	Bacteria	126707
1038	Ga0495604_0005569	3300047317	Bacteria	9982
1039	Ga0495604_0005625	3300047317	Bacteria	9939
1040	Ga0495604_0008438	3300047317	Bacteria	8136
1041	Ga0495604_0084461	3300047317	Bacteria	2370
1042	Ga0495674_0000102	3300047319	Bacteria	62602
1043	Ga0495674_0000559	3300047319	Bacteria	34585
1044	Ga0495674_0073584	3300047319	Bacteria	2945
1045	Ga0495674_0073683	3300047319	Bacteria	2942
1046	Ga0495674_0239130	3300047319	Bacteria	1497
1047	Ga0495672_0100931	3300047320	Bacteria	1565
1048	Ga0495676_0037239	3300047321	Bacteria	4051
1049	Ga0495680_0001061	3300047322	Bacteria	30436
1050	Ga0495680_0007181	3300047322	Bacteria	10259
1051	Ga0495680_0016879	3300047322	Bacteria	6253
1052	Ga0495680_0036826	3300047322	Bacteria	3923
1053	Ga0495687_004001	3300047443	Bacteria	10251
1054	Ga0495675_0000148	3300047444	Bacteria	49201
1055	Ga0495675_0010844	3300047444	Bacteria	5711
1056	Ga0495675_0024047	3300047444	Bacteria	3881
1057	Ga0495673_0000008	3300047469	Bacteria	752462
1058	Ga0495681_0000922	3300047470	Bacteria	22658
1059	Ga0495684_0000025	3300047471	Bacteria	127037
1060	Ga0495684_0001073	3300047471	Bacteria	22129
1061	Ga0495684_0005198	3300047471	Bacteria	10142
1062	Ga0495684_0051054	3300047471	Bacteria	3157
1063	Ga0495593_0000606	3300047673	Bacteria	20452
1064	Ga0495593_0000682	3300047673	Bacteria	19575
1065	Ga0495593_0000953	3300047673	Bacteria	16903
1066	Ga0495593_0002018	3300047673	Bacteria	12102
1067	Ga0495593_0022456	3300047673	Bacteria	3515
1068	Ga0495602_0000311	3300048088	Bacteria	44943
1069	Ga0495602_0002010	3300048088	Bacteria	20455
1070	Ga0495602_0117562	3300048088	Bacteria	2146
1071	Ga0495602_0165611	3300048088	Bacteria	1721
1072	Ga0495614_0011184	3300048089	Bacteria	3949
1073	Ga0495615_0017359	3300048090	Bacteria	1567
1074	Ga0496100_0001531	3300048903	Bacteria	11342
1075	Ga0496100_0009429	3300048903	Bacteria	5488
1076	Ga0496100_0047368	3300048903	Bacteria	2769
1077	Ga0496100_0072896	3300048903	Bacteria	2297
1078	Ga0496101_0002275	3300048904	Bacteria	11728
1079	Ga0496101_0005103	3300048904	Bacteria	8348
1080	Ga0496101_0015686	3300048904	Bacteria	5112
1081	Ga0496101_0023426	3300048904	Bacteria	4265
1082	Ga0496101_0035927	3300048904	Bacteria	3507
1083	Ga0496102_0002260	3300048905	Bacteria	16503
1084	Ga0496102_0004237	3300048905	Bacteria	12125
1085	Ga0496102_0009466	3300048905	Bacteria	8373
1086	Ga0496102_0072006	3300048905	Bacteria	3175
1087	Ga0496102_0097665	3300048905	Bacteria	2724
1088	Ga0496102_0167526	3300048905	Bacteria	2068
1089	Ga0496103_0004038	3300048906	Bacteria	8917
1090	Ga0496103_0021711	3300048906	Bacteria	3863
1091	Ga0496103_0027506	3300048906	Bacteria	3446
1092	Ga0496103_0032074	3300048906	Bacteria	3205
1093	Ga0496104_0002505	3300048907	Bacteria	15804
1094	Ga0496104_0003501	3300048907	Bacteria	13541
1095	Ga0496104_0005997	3300048907	Bacteria	10649
1096	Ga0496104_0009306	3300048907	Bacteria	8737
1097	Ga0496104_0013196	3300048907	Bacteria	7447
1098	Ga0496104_0054467	3300048907	Bacteria	3781
1099	Ga0496104_0115067	3300048907	Bacteria	2580
1100	Ga0496105_0019841	3300048908	Bacteria	5424
1101	Ga0496105_0025947	3300048908	Bacteria	4775
1102	Ga0496105_0102078	3300048908	Bacteria	2368
1103	Ga0496105_0128423	3300048908	Bacteria	2090
1104	Ga0496106_0000262	3300048909	Bacteria	36919
1105	Ga0496106_0015208	3300048909	Bacteria	5694
1106	Ga0496106_0046597	3300048909	Bacteria	3260
1107	Ga0496106_0075706	3300048909	Bacteria	2578
1108	Ga0496107_0001922	3300048910	Bacteria	13186
1109	Ga0496107_0005227	3300048910	Bacteria	8861
1110	Ga0496107_0063265	3300048910	Bacteria	2681
1111	Ga0496107_0074425	3300048910	Bacteria	2471
1112	Ga0496107_0088582	3300048910	Bacteria	2259
1113	Ga0496107_0089038	3300048910	Bacteria	2253
1114	Ga0496108_0000357	3300048911	Bacteria	38614
1115	Ga0496108_0018407	3300048911	Bacteria	5718
1116	Ga0496108_0029729	3300048911	Bacteria	4527
1117	Ga0496108_0032499	3300048911	Bacteria	4334
1118	Ga0496108_0057939	3300048911	Bacteria	3255
1119	Ga0496108_0059583	3300048911	Bacteria	3210
1120	Ga0496108_0067878	3300048911	Bacteria	3008
1121	Ga0496108_0097387	3300048911	Bacteria	2506
1122	Ga0496108_0098085	3300048911	Bacteria	2497
1123	Ga0496109_0002224	3300048912	Bacteria	16103
1124	Ga0496109_0002394	3300048912	Bacteria	15685
1125	Ga0496109_0008633	3300048912	Bacteria	8673
1126	Ga0496109_0035557	3300048912	Bacteria	4495
1127	Ga0496109_0048639	3300048912	Bacteria	3858
1128	Ga0496109_0055117	3300048912	Bacteria	3627
1129	Ga0496109_0060680	3300048912	Bacteria	3456
1130	Ga0496109_0083342	3300048912	Bacteria	2948
1131	Ga0496109_0262605	3300048912	Bacteria	1626
1132	Ga0496110_0000205	3300048913	Bacteria	37706
1133	Ga0496110_0003980	3300048913	Bacteria	11375
1134	Ga0496110_0005741	3300048913	Bacteria	9749
1135	Ga0496110_0032897	3300048913	Bacteria	4483
1136	Ga0496110_0039631	3300048913	Bacteria	4103
1137	Ga0496110_0052971	3300048913	Bacteria	3565
1138	Ga0496110_0073614	3300048913	Bacteria	3031
1139	Ga0496110_0075322	3300048913	Bacteria	2998
1140	Ga0496111_0000632	3300048914	Bacteria	18585
1141	Ga0496111_0009563	3300048914	Bacteria	6477
1142	Ga0496111_0035729	3300048914	Bacteria	3553
1143	Ga0496111_0040066	3300048914	Bacteria	3360
1144	Ga0496111_0078761	3300048914	Bacteria	2403
1145	Ga0496111_0103383	3300048914	Bacteria	2095
1146	Ga0496111_0140573	3300048914	Bacteria	1789
1147	Ga0496112_0000117	3300048915	Bacteria	49274
1148	Ga0496112_0006469	3300048915	Bacteria	10288
1149	Ga0496112_0014600	3300048915	Bacteria	7297
1150	Ga0496112_0034574	3300048915	Bacteria	4918
1151	Ga0496112_0067283	3300048915	Bacteria	3535
1152	Ga0496112_0094153	3300048915	Bacteria	2966
1153	Ga0496112_0095342	3300048915	Bacteria	2946
1154	Ga0496112_0096518	3300048915	Bacteria	2926
1155	Ga0496112_0168066	3300048915	Bacteria	2159
1156	Ga0496113_0012280	3300048916	Bacteria	5751
1157	Ga0496113_0074000	3300048916	Bacteria	2597
1158	Ga0496114_0003638	3300048917	Bacteria	11856
1159	Ga0496114_0070632	3300048917	Bacteria	2933
1160	Ga0496114_0097793	3300048917	Bacteria	2501
1161	Ga0496114_0127142	3300048917	Bacteria	2198
1162	Ga0496114_0127904	3300048917	Bacteria	2191
1163	Ga0496115_0002584	3300048918	Bacteria	12996
1164	Ga0496115_0007856	3300048918	Bacteria	7867
1165	Ga0496115_0013022	3300048918	Bacteria	6279
1166	Ga0496115_0027835	3300048918	Bacteria	4425
1167	Ga0496115_0031895	3300048918	Bacteria	4154
1168	Ga0496115_0040608	3300048918	Bacteria	3699
1169	Ga0496115_0042767	3300048918	Bacteria	3611
1170	Ga0496115_0106870	3300048918	Bacteria	2297
1171	Ga0496115_0146166	3300048918	Bacteria	1951
1172	Ga0496116_0003967	3300048919	Bacteria	14367
1173	Ga0496116_0006130	3300048919	Bacteria	10995
1174	Ga0496116_0049570	3300048919	Bacteria	2806
1175	Ga0496116_0058030	3300048919	Bacteria	2526
1176	Ga0496116_0061093	3300048919	Bacteria	2441
1177	Ga0496117_0013767	3300048920	Bacteria	7025
1178	Ga0496117_0052341	3300048920	Bacteria	2877
1179	Ga0496117_0110843	3300048920	Bacteria	1710
1180	Ga0496118_0001099	3300048921	Bacteria	42066
1181	Ga0496118_0013843	3300048921	Bacteria	7594
1182	Ga0496118_0056535	3300048921	Bacteria	2949
1183	Ga0496119_0016661	3300048922	Bacteria	5577
1184	Ga0496119_0033910	3300048922	Bacteria	3374
1185	Ga0496120_0020029	3300048923	Bacteria	4262
1186	Ga0496120_0104179	3300048923	Bacteria	1493
1187	Ga0496121_0000094	3300048924	Bacteria	212726
1188	Ga0496121_0001006	3300048924	Bacteria	50348
1189	Ga0496121_0003460	3300048924	Bacteria	22502
1190	Ga0496121_0033601	3300048924	Bacteria	4637
1191	Ga0496121_0034449	3300048924	Bacteria	4557
1192	Ga0496121_0158666	3300048924	Bacteria	1657
1193	Ga0496122_0000214	3300048925	Bacteria	129132
1194	Ga0496122_0000693	3300048925	Bacteria	67068
1195	Ga0496122_0049843	3300048925	Bacteria	3200
1196	Ga0496123_0000187	3300048926	Bacteria	125396
1197	Ga0496123_0000433	3300048926	Bacteria	75427
1198	Ga0496123_0070311	3300048926	Bacteria	2191
1199	Ga0496124_0000004	3300048927	Bacteria	976131
1200	Ga0496124_0024007	3300048927	Bacteria	5551
1201	Ga0496124_0069590	3300048927	Bacteria	2921
1202	Ga0496125_0000363	3300048928	Bacteria	85601
1203	Ga0496125_0028136	3300048928	Bacteria	5082
1204	Ga0496125_0030111	3300048928	Bacteria	4862
1205	Ga0496125_0074343	3300048928	Bacteria	2635
1206	Ga0496126_0018230	3300048929	Bacteria	6965
1207	Ga0496126_0026719	3300048929	Bacteria	5527
1208	Ga0496126_0118838	3300048929	Bacteria	2294
1209	Ga0496126_0143480	3300048929	Bacteria	2053
1210	Ga0496126_0172212	3300048929	Bacteria	1843
1211	Ga0495678_000012	3300049459	Bacteria	333905
1212	Ga0495678_018166	3300049459	Bacteria	3168
1213	Ga0501036_0138972	3300049572	Bacteria	2050
1214	Ga0501038_0075199	3300049574	Bacteria	2855
1215	Ga0501072_0004057	3300049588	Bacteria	11086
1216	Ga0501076_0111397	3300049592	Bacteria	2212
1217	Ga0501080_0090377	3300049742	Bacteria	2845
1218	nmdc:mga03683_30513_c1	3300050489	Bacteria	2157
1219	nmdc:mga03n38_1633_c1	3300050490	Bacteria	6559
1220	nmdc:mga03n38_39900_c1	3300050490	Bacteria	2038
1221	nmdc:mga00v17_30628_c1	3300050491	Bacteria	3166
1222	nmdc:mga00v17_64616_c1	3300050491	Bacteria	2255
1223	nmdc:mga00v17_6544_c1	3300050491	Bacteria	6184
1224	nmdc:mga0yw44_12756_c1	3300050492	Bacteria	4394
1225	nmdc:mga0yw44_23299_c1	3300050492	Bacteria	3486
1226	nmdc:mga0yw44_5661_c1	3300050492	Bacteria	5946
1227	nmdc:mga0yw44_59421_c1	3300050492	Bacteria	2339
1228	nmdc:mga0yw44_95507_c1	3300050492	Bacteria	1886
1229	nmdc:mga0k408_1761_c1	3300050493	Bacteria	11603
1230	nmdc:mga0k408_48540_c1	3300050493	Bacteria	2456
1231	nmdc:mga06z11_110024_c1	3300050494	Bacteria	1524
1232	nmdc:mga06z11_45409_c1	3300050494	Bacteria	2221
1233	nmdc:mga06z11_68184_c1	3300050494	Bacteria	1875
1234	nmdc:mga06z11_72698_c1	3300050494	Bacteria	1824
1235	nmdc:mga06z11_8463_c1	3300050494	Bacteria	4291
1236	nmdc:mga07m45_13314_c1	3300050496	Bacteria	4362
1237	nmdc:mga07m45_61814_c1	3300050496	Bacteria	2122
1238	nmdc:mga07m45_9639_c1	3300050496	Bacteria	5019
1239	nmdc:mga05p37_1118_c3	3300050507	Bacteria	2050
1240	nmdc:mga05p37_13202_c1	3300050507	Bacteria	9887
1241	nmdc:mga05p37_151_c1	3300050507	Bacteria	65585
1242	nmdc:mga05p37_225993_c1	3300050507	Bacteria	2257
1243	nmdc:mga05p37_69744_c1	3300050507	Bacteria	4324
1244	nmdc:mga05p37_80496_c1	3300050507	Bacteria	4012
1245	nmdc:mga05p37_9089_c1	3300050507	Bacteria	11745
1246	nmdc:mga09592_11500_c1	3300050508	Bacteria	6607
1247	nmdc:mga09592_1771_c1	3300050508	Bacteria	17345
1248	nmdc:mga09592_7025_c1	3300050508	Bacteria	9151
1249	nmdc:mga0qj67_205141_c1	3300050509	Bacteria	1601
1250	nmdc:mga0qj67_3588_c1	3300050509	Bacteria	11199
1251	nmdc:mga0qj67_56258_c1	3300050509	Bacteria	3118
1252	nmdc:mga0qj67_933_c1	3300050509	Bacteria	20130
1253	nmdc:mga06r32_134364_c1	3300050510	Bacteria	2448
1254	nmdc:mga06r32_134961_c1	3300050510	Bacteria	2442
1255	nmdc:mga06r32_16885_c1	3300050510	Bacteria	6659
1256	nmdc:mga06r32_201_c1	3300050510	Bacteria	26944
1257	nmdc:mga08y16_108_c1	3300050511	Bacteria	69804
1258	nmdc:mga08y16_17978_c1	3300050511	Bacteria	7448
1259	nmdc:mga08y16_193529_c1	3300050511	Bacteria	2109
1260	nmdc:mga08y16_62145_c1	3300050511	Bacteria	3900
1261	nmdc:mga08y16_86448_c1	3300050511	Bacteria	3268
1262	nmdc:mga0n895_151330_c1	3300050512	Bacteria	2351
1263	nmdc:mga0n895_244857_c1	3300050512	Bacteria	1820
1264	nmdc:mga0n895_265_c1	3300050512	Bacteria	34107
1265	nmdc:mga0n895_404_c1	3300050512	Bacteria	29050
1266	nmdc:mga0n895_4878_c1	3300050512	Bacteria	11111
1267	nmdc:mga0n895_61632_c1	3300050512	Bacteria	3704
1268	nmdc:mga0n895_64657_c1	3300050512	Bacteria	3619
1269	nmdc:mga0n895_78921_c1	3300050512	Bacteria	3277
1270	nmdc:mga0rr50_10550_c1	3300050513	Bacteria	5869
1271	nmdc:mga0rr50_173038_c1	3300050513	Bacteria	1761
1272	nmdc:mga0rr50_65104_c1	3300050513	Bacteria	2760
1273	nmdc:mga0rr50_97526_c1	3300050513	Bacteria	2302
1274	nmdc:mga0a205_105418_c1	3300050515	Bacteria	2718
1275	nmdc:mga0a205_114960_c1	3300050515	Bacteria	2589
1276	nmdc:mga0a205_146_c1	3300050515	Bacteria	45616
1277	nmdc:mga0a205_1877_c1	3300050515	Bacteria	18205
1278	nmdc:mga0a205_30042_c1	3300050515	Bacteria	5201
1279	nmdc:mga0a205_63974_c1	3300050515	Bacteria	3553
1280	nmdc:mga0a205_78738_c1	3300050515	Bacteria	3184
1281	nmdc:mga0sz30_155_c2	3300050516	Bacteria	13523
1282	Ga0495601_0000025	3300053077	Bacteria	127736
1283	Ga0495601_0002768	3300053077	Bacteria	9957
1284	Ga0495601_0002986	3300053077	Bacteria	9633
1285	Ga0495601_0014260	3300053077	Bacteria	4788
1286	Ga0495601_0029067	3300053077	Bacteria	3426
1287	Ga0495601_0056086	3300053077	Bacteria	2495
1288	Ga0495612_0000046	3300053078	Bacteria	59912
1289	Ga0495612_0006837	3300053078	Bacteria	4670
1290	Ga0495612_0018845	3300053078	Bacteria	2763
1291	Ga0495612_0033529	3300053078	Bacteria	2078
1292	Ga0500610_0056426	3300053079	Bacteria	2050
1293	Ga0495595_0000054	3300053084	Bacteria	59828
1294	Ga0495595_0000696	3300053084	Bacteria	12842
1295	Ga0495595_0002171	3300053084	Bacteria	7628
1296	Ga0495595_0008608	3300053084	Bacteria	4196
1297	Ga0495619_0000035	3300053085	Bacteria	126262
1298	Ga0495619_0000048	3300053085	Bacteria	102117
1299	Ga0495619_0000966	3300053085	Bacteria	18840
1300	Ga0495619_0001255	3300053085	Bacteria	16631
1301	Ga0495619_0004720	3300053085	Bacteria	8676
1302	Ga0495619_0006396	3300053085	Bacteria	7464
1303	Ga0495619_0033264	3300053085	Bacteria	3348
1304	Ga0495619_0047709	3300053085	Bacteria	2821
1305	Ga0500643_000019	3300053087	Bacteria	294301
1306	Ga0500643_001637	3300053087	Bacteria	12517
1307	Ga0500644_0000670	3300053088	Bacteria	12478
1308	Ga0500646_0001743	3300053090	Bacteria	5718
1309	Ga0500583_0008143	3300053092	Bacteria	3741
1310	Ga0500651_0019640	3300053093	Bacteria	4201
1311	Ga0500651_0099808	3300053093	Bacteria	1780
1312	Ga0500566_0001280	3300053094	Bacteria	14651
1313	Ga0500566_0024756	3300053094	Bacteria	3521
1314	Ga0500640_048834	3300053095	Bacteria	1854
1315	Ga0500641_0007284	3300053096	Bacteria	3943
1316	Ga0500554_002430	3300053102	Bacteria	3664
1317	Ga0500555_004780	3300053103	Bacteria	3844
1318	Ga0500557_000039	3300053105	Bacteria	66862
1319	Ga0500569_007080	3300053109	Bacteria	2499
1320	Ga0500572_000559	3300053111	Bacteria	12701
1321	Ga0500572_001849	3300053111	Bacteria	5366
1322	Ga0500592_006852	3300053116	Bacteria	1814
1323	Ga0500595_000003	3300053119	Bacteria	419332
1324	Ga0500595_023204	3300053119	Bacteria	2184
1325	Ga0500614_001873	3300053123	Bacteria	4850
1326	Ga0500618_000286	3300053125	Bacteria	38499
1327	Ga0500618_001413	3300053125	Bacteria	10762
1328	Ga0500642_0000285	3300053130	Bacteria	18457
1329	Ga0500642_0023818	3300053130	Bacteria	2464
1330	Ga0500642_0028020	3300053130	Bacteria	2319
1331	Ga0500642_0032814	3300053130	Bacteria	2182
1332	Ga0500642_0066964	3300053130	Bacteria	1626
1333	Ga0500658_0016238	3300053134	Bacteria	2772
1334	Ga0500559_0008368	3300053136	Bacteria	4538
1335	Ga0500559_0020926	3300053136	Bacteria	2768
1336	Ga0500559_0044275	3300053136	Bacteria	1946
1337	Ga0500568_0004264	3300053139	Bacteria	7684
1338	Ga0500573_0040300	3300053140	Bacteria	2697
1339	Ga0500603_000423	3300053150	Bacteria	10988
1340	Ga0500603_002454	3300053150	Bacteria	4058
1341	Ga0500604_0006398	3300053151	Bacteria	3114
1342	Ga0500616_0000002	3300053153	Bacteria	1611257
1343	Ga0500616_0003426	3300053153	Bacteria	12139
1344	Ga0500616_0047643	3300053153	Bacteria	2275
1345	Ga0500616_0068270	3300053153	Bacteria	1821
1346	Ga0500630_001193	3300053159	Bacteria	12207
1347	Ga0500639_000025	3300053163	Bacteria	84839
1348	Ga0500636_0000313	3300053177	Bacteria	26675
1349	Ga0500636_0029794	3300053177	Bacteria	3225
1350	Ga0500636_0030709	3300053177	Bacteria	3180
1351	Ga0500637_0000655	3300053178	Bacteria	13752
1352	Ga0500637_0008929	3300053178	Bacteria	5078
1353	Ga0500625_007580	3300053729	Bacteria	4729
1354	Ga0500645_000078	3300053730	Bacteria	76931
1355	Ga0500596_001197	3300053735	Bacteria	5242
1356	Ga0500596_004849	3300053735	Bacteria	2428
1357	Ga0500596_007040	3300053735	Bacteria	1860
1358	Ga0500599_002587	3300053736	Bacteria	2174
1359	Ga0500601_000643	3300053737	Bacteria	4818
1360	Ga0501084_0142571	3300054114	Bacteria	2018
1361	Ga0501084_0167955	3300054114	Bacteria	1852
1362	Ga0466962_0066665	3300061719	Bacteria	1719
1363	2507510103	2507262055	Bacteria	8048963
1364	2508544105	2508501009	Bacteria	7784016
1365	2508697955	2508501042	Bacteria	8719808
1366	2509153533	2508501128	Bacteria	8613869
1367	2511252132	2511231003	Bacteria	5606035
1368	2511400834	2511231028	Bacteria	8046582
1369	2513592131	2513237087	Bacteria	5817514
1370	2513628335	2513237092	Bacteria	8341956
1371	2513648929	2513237095	Bacteria	8976980
1372	2513676462	2513237098	Bacteria	9902361
1373	2513697014	2513237101	Bacteria	7952346
1374	2513858194	2513237137	Bacteria	9558895
1375	2513878038	2513237139	Bacteria	8737671
1376	2513892003	2513237141	Bacteria	8496279
1377	2514012665	2513237161	Bacteria	8871253
1378	2517105161	2517093001	Bacteria	9002274
1379	2517893917	2517572143	Bacteria	9484767
1380	2521559258	2521172590	Bacteria	5047645
1381	2523102995	2522572158	Bacteria	6514390
1382	2524467068	2524023210	Bacteria	9029266
1383	2524540686	2524023228	Bacteria	10118060
1384	2545674442	2545555834	Bacteria	8130841
1385	2550693791	2548876994	Bacteria	4904866
1386	2596372893	2595698237	Bacteria	6712432
1387	2599907641	2599185292	Bacteria	6290804
1388	2617352560	2617270735	Bacteria	9163226
1389	2617379030	2617270741	Bacteria	8201522
1390	2643860940	2643221569	Bacteria	6064337
1391	2643981187	2643221594	Bacteria	5811388
1392	2644124239	2643221621	Bacteria	6212786
1393	2723846458	2721755755	Bacteria	8322773
1394	2723846462	2721755755	Bacteria	8322773
1395	2738744126	2738541281	Bacteria	5112672
1396	2739250194	2738543013	Bacteria	5618633
1397	2739353356	2738543032	Bacteria	5115625
1398	2765568569	2765235838	Bacteria	5445269
1399	2793059915	2791355196	Bacteria	7323613
1400	2793076881
1401	2805919998	2802429603	Bacteria	8777136
1402	2808981294	2808606386	Bacteria	4471946
1403	2809035036	2808606395	Bacteria	6020352
1404	2809128880	2808606415	Bacteria	4576710
1405	2809148501	2808606419	Bacteria	4576925
1406	2818241667	2816332527	Bacteria	8933356
1407	2819595072	2818991445	Bacteria	4955017
1408	2819615763	2818991449	Bacteria	5518009
1409	2821134904	2821131069	Bacteria	6108407
1410	2824622788	2824617872	Bacteria	8814715
1411	2824632379	2824626560	Bacteria	8813858
1412	2824640398	2824635225	Bacteria	8785348
1413	2824647387	2824644064	Bacteria	8743947
1414	2824674262	2824671348	Bacteria	8369588
1415	2824682547	2824679649	Bacteria	8248951
1416	2824690884	2824687955	Bacteria	8360029
1417	2824698542	2824696289	Bacteria	8335049
1418	2824718918	2824714736	Bacteria	8717648
1419	2824729422	2824723954	Bacteria	8758240
1420	2824737810	2824732956	Bacteria	7810675
1421	2824749968	2824746037	Bacteria	7911610
1422	2824778197	2824773399	Bacteria	8360218
1423	2828308236	2828305725	Bacteria	4916900
1424	2829747715	2829745981	Bacteria	5406054
1425	2838127449	2838122688	Bacteria	8803140
1426	2839096551	2839094727	Bacteria	5534556
1427	2841952386	2841949485	Bacteria	8680857
1428	2841959407	2841957949	Bacteria	8652217
1429	2841967743	2841966195	Bacteria	8673214
1430	2841982093	2841974524	Bacteria	8931498
1431	2841986410	2841983080	Bacteria	8395090
1432	2842038178	2842038055	Bacteria	8002051
1433	2842048876	2842045827	Bacteria	8006841
1434	2842697014	2842694124	Bacteria	4063419
1435	2842699593	2842698319	Bacteria	5190321
1436	2847934448	2847930680	Bacteria	9342022
1437	2847945043	2847939898	Bacteria	8606328
1438	2849080761	2849076700	Bacteria	7039503
1439	2852621035	2852618963	Bacteria	4577824
1440	2857509874	2857509624	Bacteria	7472071
1441	2857528893	2857524615	Bacteria	6615449
1442	2857540373	2857537821	Bacteria	5248181
1443	2857547413	2857542790	Bacteria	5326616
1444	2857558180	2857553236	Bacteria	6166726
1445	2857558841	2857558681	Bacteria	6617694
1446	2861694133	2861691609	Bacteria	5628931
1447	2874610576	2874604998	Bacteria	7834745
1448	2874618147	2874612657	Bacteria	8252029
1449	2874623140	2874620515	Bacteria	8290088
1450	2874636120	2874628541	Bacteria	8630250
1451	2876810065	2876808645	Bacteria	8824342
1452	2879089641	2879083081	Bacteria	8587928
1453	2879118634	2879110137	Bacteria	8907982
1454	2881367672	2881364244	Bacteria	7710352
1455	2881670896	2881665667	Bacteria	8175609
1456	2884814940	2884811622	Bacteria	5552861
1457	2884836774	2884836552	Bacteria	5219991
1458	2884853065	2884852848	Bacteria	5221161
1459	2885368857	2885366525	Bacteria	8326213
1460	2885390201	2885383462	Bacteria	9473874
1461	2888382382	2888378607	Bacteria	9652610
1462	2888388310	2888388044	Bacteria	7304136
1463	2889039027	2889033259	Bacteria	9099371
1464	2893069090	2893066018	Bacteria	6158120
1465	2894775121	2894772417	Bacteria	5305674
1466	2896155817	2896154374	Bacteria	5221518
1467	2903751924	2903748898	Bacteria	9972761
1468	2903771705	2903768456	Bacteria	9749579
1469	2904443635	2904439833	Bacteria	5931679
1470	2904532552	2904530477	Bacteria	5876334
1471	2904585021	2904584206	Bacteria	6028872
1472	2904593370	2904589729	Bacteria	6113573
1473	2904605564	2904601388	Bacteria	5884906
1474	2904669960	2904666416	Bacteria	8226587
1475	2904693431	2904690495	Bacteria	9412302
1476	2904700664
1477	2906610807
1478	2906634818	2906626472	Bacteria	8826946
1479	2906635967	2906635258	Bacteria	8601019
1480	2906646681	2906643746	Bacteria	8722424
1481	2906663934	2906660503	Bacteria	8595048
1482	2908761756	2908756301	Bacteria	8864324
1483	2908778629	2908775508	Bacteria	8092255
1484	2917705402	2917699015	Bacteria	7043791
1485	2919048137	2919046199	Bacteria	5567169
1486	2919079317	2919073203	Bacteria	6531949
1487	2919081337	2919079590	Bacteria	5946433
1488	2922362271	2922361189	Bacteria	7436256
1489	2922387976	2922386360	Bacteria	7017218
1490	2922394902	2922393267	Bacteria	8285685
1491	2922428520
1492	2928115935	2928115317	Bacteria	6477646
1493	2928125748	2928125067	Bacteria	5937560
1494	2929202432	2929199973	Bacteria	7260745
1495	2932797247	2932794094	Bacteria	7915132
1496	2932804868	2932801729	Bacteria	7987968
1497	2935610991	2935608549	Bacteria	8203142
1498	2935634500	2935630451	Bacteria	8169952
1499	2935648423	2935648319	Bacteria	8801166
1500	2935657589	2935656913	Bacteria	8965014
1501	2935820476	2935819856	Bacteria	8261050
1502	2935849515	2935847175	Bacteria	8228321
1503	2935884896	2935883170	Bacteria	7964738
1504	2935911712	2935908558	Bacteria	8568796
1505	2935919367	2935916978	Bacteria	9113783
1506	2935928741	2935926038	Bacteria	8601059
1507	2935938386	2935934488	Bacteria	8602579
1508	2935945722	2935942939	Bacteria	8599779
1509	2935954671	2935951376	Bacteria	8602333
1510	2935963271	2935959822	Bacteria	7869783
1511	2935970558	2935967501	Bacteria	8603075
1512	2935987782	2935984226	Bacteria	8302647
1513	2936011333	2936011229	Bacteria	8801034
1514	2936019928	2936019824	Bacteria	8804134
1515	2936028524	2936028420	Bacteria	8965941
1516	2936046651	2936046547	Bacteria	8903709
1517	2936062344	2936055302	Bacteria	8785755
1518	2941484555
1519	2941508986	2941507105	Bacteria	8166816
1520	2941516815	2941515067	Bacteria	8166720
1521	2941525090	2941523033	Bacteria	8169134
1522	3003669389	3003665799	Bacteria	7279786
1523	3005478648	3005474847	Bacteria	9259049
1524	3005487860	3005483717	Bacteria	7877331
1525	3005508823	3005506211	Bacteria	6943378
1526	3005589359	3005587118	Bacteria	7794411
1527	3005597395	3005594810	Bacteria	8716512
1528	3005713420	3005710791	Bacteria	7622528
1529	641644955	641522639	Bacteria	7737025
1530	8006928509	8006926726	Bacteria	6749210
1531	8006942716	8006933436	Bacteria	10410654
1532	8006964845	8006964411	Bacteria	8966052
1533	8006982439	8006973647	Bacteria	10679141
1534	8006991759	8006984368	Bacteria	9651211
1535	8006995580	8006994254	Bacteria	8309700
1536	8016632662	8016630954	Bacteria	9217207
1537	8019558477	8019555841	Bacteria	9642137
1538	8019566820	8019565922	Bacteria	9639779
1539	8019688358	8019687851	Bacteria	8712826
1540	8054005745	8054002106	Bacteria	7987183
1541	8055228327	8055225921	Bacteria	3341787
1542	8055915834	8055909800	Bacteria	7278581
1543	8056676372	8056673599	Bacteria	7871253
1544	8056685046	8056681323	Bacteria	8472857
1545	Ga0496110_0003778
1546	2214745205
1547	ARcpr5oldR_c000087
1548	ARSoilYngRDRAFT_c00048
1549	ARcpr5yngRDRAFT_c000112
1550	ARSoilOldRDRAFT_c000094
1551	ARCol0yngRDRAFT_1000121
1552	JGI24752J21851_1003222
1553	JGI24739J22299_10002910
1554	JGI24737J22298_10001520
1555	JGI24743J22301_10002453
1556	JGI24750J21931_1000426
1557	JGI24745J21846_1000426
1558	JGI24748J21848_1000786
1559	JGI24738J21930_10000707
1560	JGI24749J21850_1001137
1561	JGI24744J21845_10004543
1562	JGI24035J26624_1000282
1563	JGI24034J26672_10000879
1564	JGI24742J22300_10001239
1565	JGI24742J22300_10003139
1566	JGI24751J29686_10004754
1567	JGI25155J39150_1000538
1568	JGI25156J39149_1000150
1569	JGI25154J39366_1000165
1570	JGI25154J39366_1000210
1571	JGI25157J39369_1000383
1572	JGI25406J46586_10000801
1573	JGI25406J46586_10001211
1574	JGI25406J46586_10003389
1575	JGI25406J46586_10003524
1576	JGI25406J46586_10003889
1577	JGI25153J46596_10002222
1578	JGI25153J46596_10002589
1579	JGI25153J46596_10003283
1580	JGI25153J46596_10006877
1581	JGI25153J46596_10014889
1582	JGI25160J50197_1006259
1583	JGI25160J50197_1006800
1584	JGI25404J52841_10002956
1585	Ga0055538_1000054
1586	Ga0055539_1000066
1587	Ga0055533_1000076
1588	Ga0055532_1000097
1589	Ga0055525_1000098
1590	Ga0055535_1003562
1591	Ga0055540_1002994
1592	Ga0055531_10000152
1593	Ga0055531_10003706
1594	Ga0055541_1000056
1595	Ga0055543_1002979
1596	Ga0065165_1001284
1597	Ga0065165_1022456
1598	Ga0065704_10002258
1599	Ga0065712_10068851
1600	Ga0065712_10075439
1601	Ga0065712_10084632
1602	Ga0065715_10093263
1603	Ga0065715_10105949
1604	Ga0065715_10164299
1605	Ga0065707_10021875
1606	Ga0065707_10098445
1607	Ga0070676_10022543
1608	Ga0070676_10034566
1609	Ga0070683_100018296
1610	Ga0070683_100075511
1611	Ga0070683_100178315
1612	Ga0070690_100012396
1613	Ga0070690_100084812
1614	Ga0070670_100000081
1615	Ga0070670_100002578
1616	Ga0070670_100016676
1617	Ga0070670_100041518
1618	Ga0070670_100113853
1619	Ga0070677_10000893
1620	Ga0070677_10027474
1621	Ga0068869_100007674
1622	Ga0070666_10031431
1623	Ga0070680_100022312
1624	Ga0070682_100030025
1625	Ga0068868_100006926
1626	Ga0068868_100060713
1627	Ga0070660_100008270
1628	Ga0070660_100123502
1629	Ga0070689_100003410
1630	Ga0070689_100016937
1631	Ga0070691_10005653
1632	Ga0070687_100004982
1633	Ga0070661_100020584
1634	Ga0070661_100100792
1635	Ga0070692_10002117
1636	Ga0070668_100015686
1637	Ga0070668_100171527
1638	Ga0070669_100016043
1639	Ga0070669_100112005
1640	Ga0070675_100005492
1641	Ga0070675_100038825
1642	Ga0070675_100187170
1643	Ga0070671_100011767
1644	Ga0070671_100031211
1645	Ga0070671_100109138
1646	Ga0070674_100008724
1647	Ga0070674_100021106
1648	Ga0070674_100080008
1649	Ga0070674_100085197
1650	Ga0070673_100002682
1651	Ga0070688_100004383
1652	Ga0070659_100004732
1653	Ga0070659_100146899
1654	Ga0070667_100001429
1655	Ga0070667_100029364
1656	Ga0070667_100068653
1657	Ga0070667_100100389
1658	Ga0070703_10017295
1659	Ga0070709_10001642
1660	Ga0070709_10003602
1661	Ga0070709_10005467
1662	Ga0070714_100013820
1663	Ga0070714_100033661
1664	Ga0070713_100002130
1665	Ga0070713_100003091
1666	Ga0070713_100020726
1667	Ga0070713_100094960
1668	Ga0070713_100131037
1669	Ga0070713_100254603
1670	Ga0070710_10001132
1671	Ga0070710_10003655
1672	Ga0070710_10015367
1673	Ga0070710_10031412
1674	Ga0070701_10007846
1675	Ga0070711_100037088
1676	Ga0070711_100185497
1677	Ga0070700_100010970
1678	Ga0070700_100038270
1679	Ga0070694_100006993
1680	Ga0070694_100114741
1681	Ga0070708_100005534
1682	Ga0070708_100022450
1683	Ga0070708_100137961
1684	Ga0070663_100026359
1685	Ga0070663_100072320
1686	Ga0070678_100023744
1687	Ga0070678_100033200
1688	Ga0070678_100033206
1689	Ga0070662_100013871
1690	Ga0070662_100098404
1691	Ga0070681_10006215
1692	Ga0070681_10019127
1693	Ga0068867_100018968
1694	Ga0068867_100073968
1695	Ga0070685_10024114
1696	Ga0070685_10062627
1697	Ga0070707_100003645
1698	Ga0070707_100059338
1699	Ga0070707_100313543
1700	Ga0070698_100002784
1701	Ga0070698_100166882
1702	Ga0070699_100010274
1703	Ga0070699_100198807
1704	Ga0070679_100016263
1705	Ga0070684_100042489
1706	Ga0070684_100056596
1707	Ga0070684_100090112
1708	Ga0070697_100109945
1709	Ga0070697_100111263
1710	Ga0070672_100010094
1711	Ga0070672_100037636
1712	Ga0070672_100046964
1713	Ga0070672_100060655
1714	Ga0070686_100001845
1715	Ga0070686_100153092
1716	Ga0070695_100003597
1717	Ga0070695_100156811
1718	Ga0070696_100013188
1719	Ga0070696_100054561
1720	Ga0070693_100014637
1721	Ga0070693_100020390
1722	Ga0070693_100128699
1723	Ga0070665_100102801
1724	Ga0070665_100123475
1725	Ga0070665_100224776
1726	Ga0070665_100332681
1727	Ga0070704_100003777
1728	Ga0070704_100010479
1729	Ga0068855_100147013
1730	Ga0068855_100167406
1731	Ga0070664_100057460
1732	Ga0068857_100000825
1733	Ga0068857_100071409
1734	Ga0068854_100005746
1735	Ga0068854_100006416
1736	Ga0068854_100066660
1737	Ga0068856_100004702
1738	Ga0068856_100220812
1739	Ga0070702_100007181
1740	Ga0070702_100027848
1741	Ga0068852_100005334
1742	Ga0068852_100020468
1743	Ga0068852_100055070
1744	Ga0068859_100012382
1745	Ga0068859_100058039
1746	Ga0068859_100153704
1747	Ga0068864_100000016
1748	Ga0068864_100003085
1749	Ga0068864_100030383
1750	Ga0068864_100033236
1751	Ga0068864_100084285
1752	Ga0068864_100133971
1753	Ga0068866_10001247
1754	Ga0068861_100018109
1755	Ga0068861_100018613
1756	Ga0068861_100161561
1757	Ga0068851_10077990
1758	Ga0068870_10006935
1759	Ga0068870_10010077
1760	Ga0068870_10011056
1761	Ga0068863_100001887
1762	Ga0068863_100020493
1763	Ga0068863_100093151
1764	Ga0068863_100218130
1765	Ga0068858_100063302
1766	Ga0068858_100108934
1767	Ga0068858_100122130
1768	Ga0068858_100167279
1769	Ga0068860_100002390
1770	Ga0068860_100026283
1771	Ga0068860_100075903
1772	Ga0068860_100077921
1773	Ga0068862_100000068
1774	Ga0068862_100010699
1775	Ga0068862_100133755
1776	Ga0081455_10000200
1777	Ga0081455_10000768
1778	Ga0081455_10005811
1779	Ga0081455_10028316
1780	Ga0081455_10052106
1781	Ga0081455_10067882
1782	Ga0081538_10000527
1783	Ga0081538_10041924
1784	Ga0081538_10051173
1785	Ga0081540_1000303
1786	Ga0081540_1000459
1787	Ga0081540_1000726
1788	Ga0081540_1002649
1789	Ga0081540_1003830
1790	Ga0081540_1003910
1791	Ga0081540_1006666
1792	Ga0081540_1009787
1793	Ga0081540_1012946
1794	Ga0081540_1024563
1795	Ga0081540_1026854
1796	Ga0081540_1027228
1797	Ga0081540_1036114
1798	Ga0081539_10000008
1799	Ga0081539_10000747
1800	Ga0081539_10001010
1801	Ga0081539_10002027
1802	Ga0081539_10004951
1803	Ga0081539_10039464
1804	Ga0070717_10002186
1805	Ga0070717_10018588
1806	Ga0070717_10023179
1807	Ga0075365_10025380
1808	Ga0075365_10098867
1809	Ga0075368_10002361
1810	Ga0075368_10028649
1811	Ga0075364_10001029
1812	Ga0075364_10044728
1813	Ga0075432_10007773
1814	Ga0070715_10000320
1815	Ga0070715_10000420
1816	Ga0070715_10006169
1817	Ga0070715_10010703
1818	Ga0070715_10015703
1819	Ga0070716_100001867
1820	Ga0070716_100020203
1821	Ga0070716_100044394
1822	Ga0070716_100059932
1823	Ga0070712_100001878
1824	Ga0070712_100055421
1825	Ga0075362_10009545
1826	Ga0075362_10022812
1827	Ga0075367_10006118
1828	Ga0075367_10013796
1829	Ga0075367_10021373
1830	Ga0075367_10038273
1831	Ga0075369_10011401
1832	Ga0075366_10024479
1833	Ga0075366_10045627
1834	Ga0075366_10049192
1835	Ga0075366_10063442
1836	Ga0097621_100018375
1837	Ga0097621_100186922
1838	Ga0075370_10036524
1839	Ga0068871_100017948
1840	Ga0068871_100164342
1841	Ga0075428_100000103
1842	Ga0075428_100003399
1843	Ga0075428_100009742
1844	Ga0075428_100098353
1845	Ga0075428_100138048
1846	Ga0075428_100291397
1847	Ga0075430_100000133
1848	Ga0075430_100004771
1849	Ga0075430_100065258
1850	Ga0075430_100213323
1851	Ga0075431_100001293
1852	Ga0075431_100002259
1853	Ga0075431_100037647
1854	Ga0075431_100083102
1855	Ga0075431_100208278
1856	Ga0075433_10000506
1857	Ga0075433_10001540
1858	Ga0075433_10068973
1859	Ga0075433_10159343
1860	Ga0075434_100000472
1861	Ga0075434_100001125
1862	Ga0075434_100004709
1863	Ga0075434_100021009
1864	Ga0075434_100080376
1865	Ga0075434_100115829
1866	Ga0075434_100202054
1867	Ga0075429_100000163
1868	Ga0075429_100020211
1869	Ga0075429_100075942
1870	Ga0068865_100006160
1871	Ga0068865_100021323
1872	Ga0068865_100078669
1873	Ga0097620_100012381
1874	Ga0097620_100058038
1875	Ga0097620_100153701
1876	Ga0099824_1022507
1877	Ga0075435_100005547
1878	Ga0075435_100006632
1879	Ga0075435_100029304
1880	Ga0075435_100056294
1881	Ga0075435_100076789
1882	Ga0075435_100120272
1883	Ga0075435_100163692
1884	Ga0099794_10009565
1885	Ga0099795_10000216
1886	Ga0099795_10002853
1887	Ga0105251_10002065
1888	Ga0105240_10003119
1889	Ga0105240_10015980
1890	Ga0105240_10020880
1891	Ga0105240_10062547
1892	Ga0111539_10000389
1893	Ga0111539_10004544
1894	Ga0111539_10005030
1895	Ga0111539_10005183
1896	Ga0111539_10025207
1897	Ga0111539_10027318
1898	Ga0111539_10033030
1899	Ga0111539_10066357
1900	Ga0105245_10004886
1901	Ga0105245_10015633
1902	Ga0105245_10189971
1903	Ga0105247_10003705
1904	Ga0105247_10037800
1905	Ga0105247_10040980
1906	Ga0114129_10002163
1907	Ga0114129_10003194
1908	Ga0114129_10021030
1909	Ga0114129_10022094
1910	Ga0114129_10046959
1911	Ga0114129_10172096
1912	Ga0114129_10178412
1913	Ga0114129_10202623
1914	Ga0114129_10233588
1915	Ga0105243_10006915
1916	Ga0105243_10016177
1917	Ga0105243_10094100
1918	Ga0105241_10012907
1919	Ga0105241_10018500
1920	Ga0105241_10056744
1921	Ga0105242_10005843
1922	Ga0105248_10008593
1923	Ga0105248_10030646
1924	Ga0105248_10090547
1925	Ga0105248_10095407
1926	Ga0105248_10122502
1927	Ga0105248_10239281
1928	Ga0105237_10025782
1929	Ga0105237_10031793
1930	Ga0105237_10134246
1931	Ga0105237_10190843
1932	Ga0105238_10003628
1933	Ga0105238_10018690
1934	Ga0105238_10052431
1935	Ga0105249_10018756
1936	Ga0105249_10094744
1937	Ga0099796_10000421
1938	Ga0099796_10006609
1939	Ga0105239_10043580
1940	Ga0105239_10044826
1941	Ga0105239_10058713
1942	Ga0105239_10078857
1943	Ga0105239_10216347
1944	Ga0105246_10017018
1945	Ga0105246_10030521
1946	Ga0105246_10034450
1947	Ga0105246_10154825
1948	Ga0157373_10150890
1949	Ga0157371_10023732
1950	Ga0157369_10249398
1951	Ga0157374_10003804
1952	Ga0157374_10010540
1953	Ga0157374_10025104
1954	Ga0157378_10007681
1955	Ga0157378_10013539
1956	Ga0157378_10065470
1957	Ga0157378_10079320
1958	Ga0163162_10013059
1959	Ga0163162_10039006
1960	Ga0157372_10031288
1961	Ga0157375_10021128
1962	Ga0157375_10037929
1963	Ga0157375_10076771
1964	Ga0157375_10173210
1965	Ga0157375_10300125
1966	Ga0157375_10431132
1967	Ga0163163_10004872
1968	Ga0163163_10009467
1969	Ga0163163_10080858
1970	Ga0163163_10099722
1971	Ga0163163_10157549
1972	Ga0157380_10001774
1973	Ga0157377_10003064
1974	Ga0157377_10052389
1975	Ga0157377_10088694
1976	Ga0157379_10031492
1977	Ga0157379_10058893
1978	Ga0157379_10073604
1979	Ga0157376_10002959
1980	Ga0157376_10004003
1981	Ga0182006_1001196
1982	Ga0163161_10003456
1983	Ga0163161_10019750
1984	Ga0214544_1000020
1985	Ga0214542_1000024
1986	Ga0214545_1000011
1987	Ga0214545_1029344
1988	Ga0214543_1000033
1989	Ga0213872_10003584
1990	Ga0213872_10016312
1991	Ga0213872_10048178
1992	Ga0213876_10001998
1993	Ga0209435_100040
1994	Ga0209784_100002
1995	Ga0209566_100003
1996	Ga0209674_100004
1997	Ga0209147_100141
1998	Ga0209563_100006
1999	Ga0209563_101304
2000	Ga0209437_100229
2001	Ga0209258_100657
2002	Ga0207425_1009865
2003	Ga0209646_1000204
2004	Ga0209646_1000253
2005	Ga0209026_1000306
2006	Ga0209677_100003
2007	Ga0209677_102281
2008	Ga0209677_102285
2009	Ga0209759_1000298
2010	Ga0209759_1000398
2011	Ga0209233_1001066
2012	Ga0209233_1004907
2013	Ga0209233_1005718
2014	Ga0207666_1000077
2015	Ga0209673_1014952
2016	Ga0207673_1000891
2017	Ga0209675_1003720
2018	Ga0209676_1002143
2019	Ga0209564_1014473
2020	Ga0209758_1000294
2021	Ga0209758_1000407
2022	Ga0209758_1000952
2023	Ga0209758_1001983
2024	Ga0209758_1002883
2025	Ga0209758_1008305
2026	Ga0209758_1032704
2027	Ga0209050_1000925
2028	Ga0209256_1000545
2029	Ga0209256_1006969
2030	Ga0207426_1001388
2031	Ga0207426_1006921
2032	Ga0207426_1031258
2033	Ga0209051_1000059
2034	Ga0209257_1000022
2035	Ga0209257_1001136
2036	Ga0207697_10001615
2037	Ga0207697_10029005
2038	Ga0207697_10031871
2039	Ga0207656_10018123
2040	Ga0207713_1002261
2041	Ga0207682_10000009
2042	Ga0207682_10007879
2043	Ga0207682_10008819
2044	Ga0207692_10007013
2045	Ga0207692_10008475
2046	Ga0207642_10011334
2047	Ga0207642_10089442
2048	Ga0207710_10017532
2049	Ga0207710_10018129
2050	Ga0207710_10018417
2051	Ga0207710_10023791
2052	Ga0207688_10001372
2053	Ga0207688_10010399
2054	Ga0207688_10015227
2055	Ga0207688_10058016
2056	Ga0207688_10061197
2057	Ga0207680_10055095
2058	Ga0207647_10006480
2059	Ga0207647_10035209
2060	Ga0207685_10005926
2061	Ga0207699_10001319
2062	Ga0207699_10002443
2063	Ga0207699_10049238
2064	Ga0207645_10002502
2065	Ga0207645_10018918
2066	Ga0207643_10000292
2067	Ga0207643_10000418
2068	Ga0207643_10040888
2069	Ga0207643_10064491
2070	Ga0207654_10015148
2071	Ga0207654_10017669
2072	Ga0207654_10030110
2073	Ga0207707_10002931
2074	Ga0207695_10001540
2075	Ga0207695_10017000
2076	Ga0207695_10023519
2077	Ga0207671_10032015
2078	Ga0207671_10066825
2079	Ga0207671_10139691
2080	Ga0207671_10175033
2081	Ga0207693_10001385
2082	Ga0207693_10001566
2083	Ga0207693_10011746
2084	Ga0207693_10013334
2085	Ga0207693_10064329
2086	Ga0207663_10000136
2087	Ga0207663_10006786
2088	Ga0207660_10000893
2089	Ga0207660_10180090
2090	Ga0207662_10000861
2091	Ga0207662_10064505
2092	Ga0207657_10003725
2093	Ga0207657_10012700
2094	Ga0207657_10036461
2095	Ga0207649_10004064
2096	Ga0207649_10071124
2097	Ga0207652_10002516
2098	Ga0207646_10007486
2099	Ga0207681_10008223
2100	Ga0207681_10014965
2101	Ga0207681_10040181
2102	Ga0207694_10014930
2103	Ga0207694_10035008
2104	Ga0207650_10000288
2105	Ga0207650_10001712
2106	Ga0207650_10001829
2107	Ga0207650_10002115
2108	Ga0207650_10045906
2109	Ga0207659_10001554
2110	Ga0207659_10016654
2111	Ga0207659_10116180
2112	Ga0207687_10001197
2113	Ga0207687_10006940
2114	Ga0207687_10013222
2115	Ga0207687_10124106
2116	Ga0207700_10006688
2117	Ga0207700_10023730
2118	Ga0207700_10032460
2119	Ga0207700_10041044
2120	Ga0207664_10013549
2121	Ga0207664_10060688
2122	Ga0207664_10068985
2123	Ga0207664_10079804
2124	Ga0207644_10001963
2125	Ga0207644_10014948
2126	Ga0207644_10041902
2127	Ga0207644_10104521
2128	Ga0207690_10005575
2129	Ga0207706_10002827
2130	Ga0207706_10014998
2131	Ga0207706_10024198
2132	Ga0207706_10095387
2133	Ga0207686_10001310
2134	Ga0207686_10001988
2135	Ga0207709_10002910
2136	Ga0207709_10009749
2137	Ga0207709_10016042
2138	Ga0207709_10145261
2139	Ga0207670_10002928
2140	Ga0207670_10010411
2141	Ga0207669_10000909
2142	Ga0207669_10159702
2143	Ga0207704_10004639
2144	Ga0207704_10006693
2145	Ga0207665_10000064
2146	Ga0207665_10001510
2147	Ga0207665_10002822
2148	Ga0207665_10008638
2149	Ga0207665_10049190
2150	Ga0207691_10005519
2151	Ga0207691_10025609
2152	Ga0207691_10061618
2153	Ga0207691_10091423
2154	Ga0207691_10137905
2155	Ga0207691_10198351
2156	Ga0207691_10243719
2157	Ga0207711_10001144
2158	Ga0207711_10037712
2159	Ga0207711_10043321
2160	Ga0207689_10001448
2161	Ga0207689_10019790
2162	Ga0207689_10039992
2163	Ga0207689_10065521
2164	Ga0207661_10002433
2165	Ga0207661_10048530
2166	Ga0207661_10060818
2167	Ga0207679_10003604
2168	Ga0207679_10075413
2169	Ga0207667_10111248
2170	Ga0207651_10001703
2171	Ga0207651_10047471
2172	Ga0207712_10003650
2173	Ga0207668_10001981
2174	Ga0207640_10003763
2175	Ga0207640_10008114
2176	Ga0207640_10061301
2177	Ga0207658_10000466
2178	Ga0207658_10031138
2179	Ga0207677_10001053
2180	Ga0207677_10029878
2181	Ga0207677_10219604
2182	Ga0207703_10017302
2183	Ga0207703_10023676
2184	Ga0207703_10031824
2185	Ga0207703_10084827
2186	Ga0207703_10097711
2187	Ga0207703_10279628
2188	Ga0207639_10040853
2189	Ga0207639_10051630
2190	Ga0207678_10002714
2191	Ga0207678_10006709
2192	Ga0207678_10030296
2193	Ga0207708_10002881
2194	Ga0207708_10003108
2195	Ga0207708_10038305
2196	Ga0207708_10102100
2197	Ga0207641_10000103
2198	Ga0207641_10008745
2199	Ga0207641_10009054
2200	Ga0207641_10079739
2201	Ga0207648_10003666
2202	Ga0207648_10006999
2203	Ga0207648_10009796
2204	Ga0207648_10074823
2205	Ga0207648_10108021
2206	Ga0207676_10000044
2207	Ga0207676_10010622
2208	Ga0207676_10016879
2209	Ga0207676_10052284
2210	Ga0207676_10073921
2211	Ga0207674_10024031
2212	Ga0207674_10047126
2213	Ga0207674_10151319
2214	Ga0207674_10154307
2215	Ga0207674_10258133
2216	Ga0207675_100005413
2217	Ga0207675_100029224
2218	Ga0207675_100039892
2219	Ga0207675_100042588
2220	Ga0207683_10000782
2221	Ga0207683_10001222
2222	Ga0207683_10014258
2223	Ga0207683_10030958
2224	Ga0207683_10185100
2225	Ga0207698_10000603
2226	Ga0207698_10033824
2227	Ga0207698_10045774
2228	Ga0207698_10154018
2229	Ga0209389_1000011
2230	Ga0209389_1000424
2231	Ga0209589_1004180
2232	Ga0209489_100017
2233	Ga0209489_104563
2234	Ga0209700_100027
2235	Ga0209179_1005548
2236	Ga0210002_1003574
2237	Ga0209588_1017593
2238	Ga0209998_10001207
2239	Ga0209998_10006448
2240	Ga0209974_10001210
2241	Ga0209974_10020357
2242	Ga0207428_10000164
2243	Ga0207428_10000391
2244	Ga0207428_10002684
2245	Ga0207428_10030850
2246	Ga0207428_10033735
2247	Ga0207428_10157801
2248	Ga0268266_10003117
2249	Ga0268266_10005300
2250	Ga0268266_10137128
2251	Ga0268266_10245286
2252	Ga0268265_10000142
2253	Ga0268265_10067166
2254	Ga0268265_10157663
2255	Ga0268264_10000035
2256	Ga0268264_10007183
2257	Ga0268264_10124929
2258	Ga0265337_1019331
2259	Ga0265319_1001186
2260	Ga0265334_10004555
2261	Ga0265334_10026011
2262	Ga0265318_10002015
2263	Ga0265318_10002315
2264	Ga0265318_10002586
2265	Ga0265323_10000768
2266	Ga0265322_10003636
2267	Ga0265336_10000106
2268	Ga0307517_10000049
2269	Ga0307515_10008473
2270	Ga0265338_10000065
2271	Ga0265324_10001808
2272	Ga0307511_10000948
2273	Ga0265330_10013442
2274	Ga0265330_10020506
2275	Ga0265332_10007484
2276	Ga0265332_10028029
2277	Ga0265328_10003748
2278	Ga0265320_10009181
2279	Ga0265320_10038913
2280	Ga0265325_10012239
2281	Ga0265325_10023047
2282	Ga0265329_10008771
2283	Ga0265329_10008995
2284	Ga0265339_10021009
2285	Ga0265331_10000945
2286	Ga0265331_10025683
2287	Ga0265327_10021443
2288	Ga0265316_10071014
2289	Ga0265316_10109432
2290	Ga0265316_10122993
2291	Ga0307513_10091203
2292	Ga0307509_10029697
2293	Ga0307509_10083377
2294	Ga0307408_100018764
2295	Ga0307508_10000090
2296	Ga0265314_10000220
2297	Ga0265314_10026005
2298	Ga0265314_10127697
2299	Ga0265342_10006047
2300	Ga0265342_10011954
2301	Ga0265342_10021271
2302	Ga0307516_10006682
2303	Ga0307516_10103897
2304	Ga0307413_10072121
2305	Ga0307412_10000335
2306	Ga0307412_10131089
2307	Ga0307411_10053158
2308	Ga0307507_10098971
2309	Ga0307510_10019318
2310	Ga0307510_10031887
2311	Ga0307510_10044427
2312	Ga0307510_10072820
2313	Ga0315911_1000011
2314	Ga0373950_0000340
2315	Ga0373958_0000223
2316	Ga0373959_0000418
2317	Ga0373938_0000580
2318	Ga0373928_0000151
2319	Ga0373928_0014812
2320	Ga0373929_0001036
2321	Ga0373934_0009191
2322	Ga0373940_0003150
2323	Ga0373949_0001703
2324	Ga0373951_0000232
2325	Ga0373952_0000567
2326	Ga0373923_0000595
2327	Ga0373923_0003802
2328	Ga0373932_0000366
2329	Ga0373936_0002231
2330	Ga0373936_0028657
2331	Ga0373939_0000753
2332	Ga0373939_0006530
2333	Ga0373941_0001679
2334	Ga0373945_0013753
2335	Ga0373953_0002952
2336	Ga0373953_0005683
2337	Ga0373954_0000951
2338	Ga0373954_0007519
2339	Ga0373954_0010242
2340	Ga0373960_0016590
2341	Ga0373943_0004323
2342	Ga0373943_0008124
2343	Ga0373943_0066244
2344	Ga0373946_0018323
2345	Ga0373946_0043539
2346	Ga0373946_0057985
2347	Ga0373955_0000360
2348	Ga0373955_0000643
2349	Ga0373955_0030797
2350	Ga0373942_0000780
2351	Ga0373961_0004799
2352	Ga0373961_0020487
2353	Ga0373962_0001878
2354	Ga0373924_0002747
2355	Ga0373924_0030057
2356	Ga0373931_0002260
2357	Ga0373931_0006487
2358	Ga0373931_0010679
2359	Ga0373931_0010912
2360	Ga0373931_0113141
2361	Ga0373935_0000075
2362	Ga0373935_0002949
2363	Ga0373935_0019417
2364	Ga0373927_0000950
2365	Ga0373927_0007183
2366	Ga0373927_0014279
2367	Ga0373927_0132370
2368	Ga0373933_0002546
2369	Ga0373933_0002722
2370	Ga0373933_0003920
2371	Ga0373933_0015393
2372	Ga0373933_0113081
2373	Ga0373947_0000138
2374	Ga0373947_0003025
2375	Ga0373947_0040432
2376	Ga0373947_0063903
2377	Ga0373947_0075867
2378	Ga0373937_0000057
2379	Ga0373937_0008436
2380	Ga0373937_0031959
2381	Ga0373937_0116753
2382	Ga0373925_0000078
2383	Ga0373925_0007900
2384	Ga0373925_0016899
2385	Ga0373925_0023694
2386	Ga0395900_0152680
2387	Ga0395905_0039879
2388	Ga0395905_0188380
2389	Ga0395905_0203419
2390	Ga0436364_0009978
2391	Ga0436364_0810480
2392	Ga0395901_0051193
2393	Ga0395901_0073367
2394	Ga0436365_0240210
2395	Ga0436365_0355346
2396	Ga0436365_0642532
2397	Ga0436365_0729222
2398	Ga0436365_1709207
2399	Ga0436360_0811388
2400	Ga0436360_0930029
2401	Ga0436360_0953856
2402	Ga0436361_0053786
2403	Ga0436361_0356069
2404	Ga0436361_0536912
2405	Ga0436361_0671651
2406	Ga0436362_0837923
2407	Ga0439450_006325
2408	Ga0439455_0011932
2409	Ga0439435_0001852
2410	Ga0439464_0016409
2411	Ga0451577_0039655
2412	Ga0466972_0000371
2413	Ga0466966_0001015
2414	Ga0466961_0003875
2415	Ga0453684_0000063
2416	Ga0453684_0005314
2417	Ga0453684_0017221
2418	Ga0453684_0045710
2419	Ga0453684_0090641
2420	Ga0466959_0008411
2421	Ga0466959_0092197
2422	Ga0451576_0017298
2423	Ga0495592_0000233
2424	Ga0495592_0006322
2425	Ga0495592_0009069
2426	Ga0495592_0022208
2427	Ga0495592_0026673
2428	Ga0495592_0133728
2429	Ga0495603_0000200
2430	Ga0495603_0004845
2431	Ga0495603_0013905
2432	Ga0495603_0021588
2433	Ga0495603_0033822
2434	Ga0495603_0035297
2435	Ga0495603_0041698
2436	Ga0495629_0000139
2437	Ga0495629_0002535
2438	Ga0495629_0003366
2439	Ga0495629_0010260
2440	Ga0495638_0004444
2441	Ga0495638_0011979
2442	Ga0495638_0054119
2443	Ga0495641_0007101
2444	Ga0495641_0008896
2445	Ga0495641_0011896
2446	Ga0495651_0002019
2447	Ga0495651_0002101
2448	Ga0495651_0027827
2449	Ga0495653_0000464
2450	Ga0495653_0001070
2451	Ga0495653_0001537
2452	Ga0495653_0028701
2453	Ga0495580_0002104
2454	Ga0495580_0034637
2455	Ga0495582_0000354
2456	Ga0495582_0100804
2457	Ga0495639_0005177
2458	Ga0495662_0001193
2459	Ga0495662_0037215
2460	Ga0495664_0000023
2461	Ga0495664_0000915
2462	Ga0495664_0008000
2463	Ga0495664_0009369
2464	Ga0495664_0074724
2465	Ga0495584_0001897
2466	Ga0495585_0094128
2467	Ga0495594_0001396
2468	Ga0495594_0020533
2469	Ga0495607_0006400
2470	Ga0495607_0022482
2471	Ga0495606_0002687
2472	Ga0495608_0000030
2473	Ga0495608_0000832
2474	Ga0495608_0005335
2475	Ga0495608_0019297
2476	Ga0495608_0042381
2477	Ga0495608_0061824
2478	Ga0495610_0011330
2479	Ga0495618_0000585
2480	Ga0495618_0019644
2481	Ga0495618_0061547
2482	Ga0495628_0000027
2483	Ga0495628_0014573
2484	Ga0495628_0067228
2485	Ga0495630_0006673
2486	Ga0495630_0018196
2487	Ga0495630_0030591
2488	Ga0495632_0005127
2489	Ga0495637_0015591
2490	Ga0495648_0008413
2491	Ga0495652_0000041
2492	Ga0495652_0006363
2493	Ga0495652_0017901
2494	Ga0495652_0023871
2495	Ga0495652_0040925
2496	Ga0495652_0074114
2497	Ga0495665_0002145
2498	Ga0495665_0002572
2499	Ga0495640_0000056
2500	Ga0495640_0017266
2501	Ga0495640_0021984
2502	Ga0495640_0030764
2503	Ga0495640_0075383
2504	Ga0495640_0094870
2505	Ga0495586_0052757
2506	Ga0495587_0000025
2507	Ga0495587_0014270
2508	Ga0495587_0017630
2509	Ga0495587_0024566
2510	Ga0495609_0000650
2511	Ga0495609_0053131
2512	Ga0495645_0000001
2513	Ga0495645_0002752
2514	Ga0495645_0087492
2515	Ga0495622_0073150
2516	Ga0495633_0002146
2517	Ga0495667_0000001
2518	Ga0495667_0003082
2519	Ga0495667_0005379
2520	Ga0495667_0014365
2521	Ga0495667_0029156
2522	Ga0495667_0037964
2523	Ga0495667_0059628
2524	Ga0495656_0000091
2525	Ga0495656_0030882
2526	Ga0495656_0059799
2527	Ga0495668_0037116
2528	Ga0495634_0001485
2529	Ga0495634_0003609
2530	Ga0495634_0006837
2531	Ga0495634_0035941
2532	Ga0495611_0031594
2533	Ga0495625_0000657
2534	Ga0495625_0054122
2535	Ga0495635_0000077
2536	Ga0495635_0001348
2537	Ga0495635_0001667
2538	Ga0495635_0005923
2539	Ga0495635_0014408
2540	Ga0495635_0026385
2541	Ga0495659_0003716
2542	Ga0495659_0013930
2543	Ga0495588_0007030
2544	Ga0495588_0026608
2545	Ga0495588_0104312
2546	Ga0495657_0000390
2547	Ga0495657_0002643
2548	Ga0495657_0033520
2549	Ga0495657_0044165
2550	Ga0495599_0000021
2551	Ga0495599_0006501
2552	Ga0495599_0031977
2553	Ga0495599_0035992
2554	Ga0495623_0000141
2555	Ga0495623_0007128
2556	Ga0495646_0000051
2557	Ga0495646_0002199
2558	Ga0495646_0010792
2559	Ga0495646_0031676
2560	Ga0495646_0081565
2561	Ga0495658_0000065
2562	Ga0495658_0062648
2563	Ga0495658_0077884
2564	Ga0495669_0035333
2565	Ga0495613_0002672
2566	Ga0495624_0001939
2567	Ga0495624_0002275
2568	Ga0495624_0005832
2569	Ga0495624_0049899
2570	Ga0495670_0000199
2571	Ga0495589_0061358
2572	Ga0495600_0000114
2573	Ga0495600_0005269
2574	Ga0495600_0028768
2575	Ga0495600_0071798
2576	Ga0495600_0076891
2577	Ga0495660_0024370
2578	Ga0495581_0000851
2579	Ga0495581_0005368
2580	Ga0495581_0009905
2581	Ga0495604_0000036
2582	Ga0495604_0005569
2583	Ga0495604_0005625
2584	Ga0495604_0008438
2585	Ga0495604_0084461
2586	Ga0495674_0000102
2587	Ga0495674_0000559
2588	Ga0495674_0073584
2589	Ga0495674_0073683
2590	Ga0495674_0239130
2591	Ga0495672_0100931
2592	Ga0495676_0037239
2593	Ga0495680_0001061
2594	Ga0495680_0007181
2595	Ga0495680_0016879
2596	Ga0495680_0036826
2597	Ga0495687_004001
2598	Ga0495675_0000148
2599	Ga0495675_0010844
2600	Ga0495675_0024047
2601	Ga0495673_0000008
2602	Ga0495681_0000922
2603	Ga0495684_0000025
2604	Ga0495684_0001073
2605	Ga0495684_0005198
2606	Ga0495684_0051054
2607	Ga0495593_0000606
2608	Ga0495593_0000682
2609	Ga0495593_0000953
2610	Ga0495593_0002018
2611	Ga0495593_0022456
2612	Ga0495602_0000311
2613	Ga0495602_0002010
2614	Ga0495602_0117562
2615	Ga0495602_0165611
2616	Ga0495614_0011184
2617	Ga0495615_0017359
2618	Ga0496100_0001531
2619	Ga0496100_0009429
2620	Ga0496100_0047368
2621	Ga0496100_0072896
2622	Ga0496101_0002275
2623	Ga0496101_0005103
2624	Ga0496101_0015686
2625	Ga0496101_0023426
2626	Ga0496101_0035927
2627	Ga0496102_0002260
2628	Ga0496102_0004237
2629	Ga0496102_0009466
2630	Ga0496102_0072006
2631	Ga0496102_0097665
2632	Ga0496102_0167526
2633	Ga0496103_0004038
2634	Ga0496103_0021711
2635	Ga0496103_0027506
2636	Ga0496103_0032074
2637	Ga0496104_0002505
2638	Ga0496104_0003501
2639	Ga0496104_0005997
2640	Ga0496104_0009306
2641	Ga0496104_0013196
2642	Ga0496104_0054467
2643	Ga0496104_0115067
2644	Ga0496105_0019841
2645	Ga0496105_0025947
2646	Ga0496105_0102078
2647	Ga0496105_0128423
2648	Ga0496106_0000262
2649	Ga0496106_0015208
2650	Ga0496106_0046597
2651	Ga0496106_0075706
2652	Ga0496107_0001922
2653	Ga0496107_0005227
2654	Ga0496107_0063265
2655	Ga0496107_0074425
2656	Ga0496107_0088582
2657	Ga0496107_0089038
2658	Ga0496108_0000357
2659	Ga0496108_0018407
2660	Ga0496108_0029729
2661	Ga0496108_0032499
2662	Ga0496108_0057939
2663	Ga0496108_0059583
2664	Ga0496108_0067878
2665	Ga0496108_0097387
2666	Ga0496108_0098085
2667	Ga0496109_0002224
2668	Ga0496109_0002394
2669	Ga0496109_0008633
2670	Ga0496109_0035557
2671	Ga0496109_0048639
2672	Ga0496109_0055117
2673	Ga0496109_0060680
2674	Ga0496109_0083342
2675	Ga0496109_0262605
2676	Ga0496110_0000205
2677	Ga0496110_0003980
2678	Ga0496110_0005741
2679	Ga0496110_0032897
2680	Ga0496110_0039631
2681	Ga0496110_0052971
2682	Ga0496110_0073614
2683	Ga0496110_0075322
2684	Ga0496111_0000632
2685	Ga0496111_0009563
2686	Ga0496111_0035729
2687	Ga0496111_0040066
2688	Ga0496111_0078761
2689	Ga0496111_0103383
2690	Ga0496111_0140573
2691	Ga0496112_0000117
2692	Ga0496112_0006469
2693	Ga0496112_0014600
2694	Ga0496112_0034574
2695	Ga0496112_0067283
2696	Ga0496112_0094153
2697	Ga0496112_0095342
2698	Ga0496112_0096518
2699	Ga0496112_0168066
2700	Ga0496113_0012280
2701	Ga0496113_0074000
2702	Ga0496114_0003638
2703	Ga0496114_0070632
2704	Ga0496114_0097793
2705	Ga0496114_0127142
2706	Ga0496114_0127904
2707	Ga0496115_0002584
2708	Ga0496115_0007856
2709	Ga0496115_0013022
2710	Ga0496115_0027835
2711	Ga0496115_0031895
2712	Ga0496115_0040608
2713	Ga0496115_0042767
2714	Ga0496115_0106870
2715	Ga0496115_0146166
2716	Ga0496116_0003967
2717	Ga0496116_0006130
2718	Ga0496116_0049570
2719	Ga0496116_0058030
2720	Ga0496116_0061093
2721	Ga0496117_0013767
2722	Ga0496117_0052341
2723	Ga0496117_0110843
2724	Ga0496118_0001099
2725	Ga0496118_0013843
2726	Ga0496118_0056535
2727	Ga0496119_0016661
2728	Ga0496119_0033910
2729	Ga0496120_0020029
2730	Ga0496120_0104179
2731	Ga0496121_0000094
2732	Ga0496121_0001006
2733	Ga0496121_0003460
2734	Ga0496121_0033601
2735	Ga0496121_0034449
2736	Ga0496121_0158666
2737	Ga0496122_0000214
2738	Ga0496122_0000693
2739	Ga0496122_0049843
2740	Ga0496123_0000187
2741	Ga0496123_0000433
2742	Ga0496123_0070311
2743	Ga0496124_0000004
2744	Ga0496124_0024007
2745	Ga0496124_0069590
2746	Ga0496125_0000363
2747	Ga0496125_0028136
2748	Ga0496125_0030111
2749	Ga0496125_0074343
2750	Ga0496126_0018230
2751	Ga0496126_0026719
2752	Ga0496126_0118838
2753	Ga0496126_0143480
2754	Ga0496126_0172212
2755	Ga0495678_000012
2756	Ga0495678_018166
2757	Ga0501036_0138972
2758	Ga0501038_0075199
2759	Ga0501072_0004057
2760	Ga0501076_0111397
2761	Ga0501080_0090377
2762	nmdc:mga03683_30513_c1
2763	nmdc:mga03n38_1633_c1
2764	nmdc:mga03n38_39900_c1
2765	nmdc:mga00v17_30628_c1
2766	nmdc:mga00v17_64616_c1
2767	nmdc:mga00v17_6544_c1
2768	nmdc:mga0yw44_12756_c1
2769	nmdc:mga0yw44_23299_c1
2770	nmdc:mga0yw44_5661_c1
2771	nmdc:mga0yw44_59421_c1
2772	nmdc:mga0yw44_95507_c1
2773	nmdc:mga0k408_1761_c1
2774	nmdc:mga0k408_48540_c1
2775	nmdc:mga06z11_110024_c1
2776	nmdc:mga06z11_45409_c1
2777	nmdc:mga06z11_68184_c1
2778	nmdc:mga06z11_72698_c1
2779	nmdc:mga06z11_8463_c1
2780	nmdc:mga07m45_13314_c1
2781	nmdc:mga07m45_61814_c1
2782	nmdc:mga07m45_9639_c1
2783	nmdc:mga05p37_1118_c3
2784	nmdc:mga05p37_13202_c1
2785	nmdc:mga05p37_151_c1
2786	nmdc:mga05p37_225993_c1
2787	nmdc:mga05p37_69744_c1
2788	nmdc:mga05p37_80496_c1
2789	nmdc:mga05p37_9089_c1
2790	nmdc:mga09592_11500_c1
2791	nmdc:mga09592_1771_c1
2792	nmdc:mga09592_7025_c1
2793	nmdc:mga0qj67_205141_c1
2794	nmdc:mga0qj67_3588_c1
2795	nmdc:mga0qj67_56258_c1
2796	nmdc:mga0qj67_933_c1
2797	nmdc:mga06r32_134364_c1
2798	nmdc:mga06r32_134961_c1
2799	nmdc:mga06r32_16885_c1
2800	nmdc:mga06r32_201_c1
2801	nmdc:mga08y16_108_c1
2802	nmdc:mga08y16_17978_c1
2803	nmdc:mga08y16_193529_c1
2804	nmdc:mga08y16_62145_c1
2805	nmdc:mga08y16_86448_c1
2806	nmdc:mga0n895_151330_c1
2807	nmdc:mga0n895_244857_c1
2808	nmdc:mga0n895_265_c1
2809	nmdc:mga0n895_404_c1
2810	nmdc:mga0n895_4878_c1
2811	nmdc:mga0n895_61632_c1
2812	nmdc:mga0n895_64657_c1
2813	nmdc:mga0n895_78921_c1
2814	nmdc:mga0rr50_10550_c1
2815	nmdc:mga0rr50_173038_c1
2816	nmdc:mga0rr50_65104_c1
2817	nmdc:mga0rr50_97526_c1
2818	nmdc:mga0a205_105418_c1
2819	nmdc:mga0a205_114960_c1
2820	nmdc:mga0a205_146_c1
2821	nmdc:mga0a205_1877_c1
2822	nmdc:mga0a205_30042_c1
2823	nmdc:mga0a205_63974_c1
2824	nmdc:mga0a205_78738_c1
2825	nmdc:mga0sz30_155_c2
2826	Ga0495601_0000025
2827	Ga0495601_0002768
2828	Ga0495601_0002986
2829	Ga0495601_0014260
2830	Ga0495601_0029067
2831	Ga0495601_0056086
2832	Ga0495612_0000046
2833	Ga0495612_0006837
2834	Ga0495612_0018845
2835	Ga0495612_0033529
2836	Ga0500610_0056426
2837	Ga0495595_0000054
2838	Ga0495595_0000696
2839	Ga0495595_0002171
2840	Ga0495595_0008608
2841	Ga0495619_0000035
2842	Ga0495619_0000048
2843	Ga0495619_0000966
2844	Ga0495619_0001255
2845	Ga0495619_0004720
2846	Ga0495619_0006396
2847	Ga0495619_0033264
2848	Ga0495619_0047709
2849	Ga0500643_000019
2850	Ga0500643_001637
2851	Ga0500644_0000670
2852	Ga0500646_0001743
2853	Ga0500583_0008143
2854	Ga0500651_0019640
2855	Ga0500651_0099808
2856	Ga0500566_0001280
2857	Ga0500566_0024756
2858	Ga0500640_048834
2859	Ga0500641_0007284
2860	Ga0500554_002430
2861	Ga0500555_004780
2862	Ga0500557_000039
2863	Ga0500569_007080
2864	Ga0500572_000559
2865	Ga0500572_001849
2866	Ga0500592_006852
2867	Ga0500595_000003
2868	Ga0500595_023204
2869	Ga0500614_001873
2870	Ga0500618_000286
2871	Ga0500618_001413
2872	Ga0500642_0000285
2873	Ga0500642_0023818
2874	Ga0500642_0028020
2875	Ga0500642_0032814
2876	Ga0500642_0066964
2877	Ga0500658_0016238
2878	Ga0500559_0008368
2879	Ga0500559_0020926
2880	Ga0500559_0044275
2881	Ga0500568_0004264
2882	Ga0500573_0040300
2883	Ga0500603_000423
2884	Ga0500603_002454
2885	Ga0500604_0006398
2886	Ga0500616_0000002
2887	Ga0500616_0003426
2888	Ga0500616_0047643
2889	Ga0500616_0068270
2890	Ga0500630_001193
2891	Ga0500639_000025
2892	Ga0500636_0000313
2893	Ga0500636_0029794
2894	Ga0500636_0030709
2895	Ga0500637_0000655
2896	Ga0500637_0008929
2897	Ga0500625_007580
2898	Ga0500645_000078
2899	Ga0500596_001197
2900	Ga0500596_004849
2901	Ga0500596_007040
2902	Ga0500599_002587
2903	Ga0500601_000643
2904	Ga0501084_0142571
2905	Ga0501084_0167955
2906	Ga0466962_0066665
2907	2507510103
2908	2508544105
2909	2508697955
2910	2509153533
2911	2511252132
2912	2511400834
2913	2513592131
2914	2513628335
2915	2513648929
2916	2513676462
2917	2513697014
2918	2513858194
2919	2513878038
2920	2513892003
2921	2514012665
2922	2517105161
2923	2517893917
2924	2521559258
2925	2523102995
2926	2524467068
2927	2524540686
2928	2545674442
2929	2550693791
2930	2596372893
2931	2599907641
2932	2617352560
2933	2617379030
2934	2643860940
2935	2643981187
2936	2644124239
2937	2723846458
2938	2723846462
2939	2738744126
2940	2739250194
2941	2739353356
2942	2765568569
2943	2793059915
2944	2793076881
2945	2805919998
2946	2808981294
2947	2809035036
2948	2809128880
2949	2809148501
2950	2818241667
2951	2819595072
2952	2819615763
2953	2821134904
2954	2824622788
2955	2824632379
2956	2824640398
2957	2824647387
2958	2824674262
2959	2824682547
2960	2824690884
2961	2824698542
2962	2824718918
2963	2824729422
2964	2824737810
2965	2824749968
2966	2824778197
2967	2828308236
2968	2829747715
2969	2838127449
2970	2839096551
2971	2841952386
2972	2841959407
2973	2841967743
2974	2841982093
2975	2841986410
2976	2842038178
2977	2842048876
2978	2842697014
2979	2842699593
2980	2847934448
2981	2847945043
2982	2849080761
2983	2852621035
2984	2857509874
2985	2857528893
2986	2857540373
2987	2857547413
2988	2857558180
2989	2857558841
2990	2861694133
2991	2874610576
2992	2874618147
2993	2874623140
2994	2874636120
2995	2876810065
2996	2879089641
2997	2879118634
2998	2881367672
2999	2881670896
3000	2884814940
3001	2884836774
3002	2884853065
3003	2885368857
3004	2885390201
3005	2888382382
3006	2888388310
3007	2889039027
3008	2893069090
3009	2894775121
3010	2896155817
3011	2903751924
3012	2903771705
3013	2904443635
3014	2904532552
3015	2904585021
3016	2904593370
3017	2904605564
3018	2904669960
3019	2904693431
3020	2904700664
3021	2906610807
3022	2906634818
3023	2906635967
3024	2906646681
3025	2906663934
3026	2908761756
3027	2908778629
3028	2917705402
3029	2919048137
3030	2919079317
3031	2919081337
3032	2922362271
3033	2922387976
3034	2922394902
3035	2922428520
3036	2928115935
3037	2928125748
3038	2929202432
3039	2932797247
3040	2932804868
3041	2935610991
3042	2935634500
3043	2935648423
3044	2935657589
3045	2935820476
3046	2935849515
3047	2935884896
3048	2935911712
3049	2935919367
3050	2935928741
3051	2935938386
3052	2935945722
3053	2935954671
3054	2935963271
3055	2935970558
3056	2935987782
3057	2936011333
3058	2936019928
3059	2936028524
3060	2936046651
3061	2936062344
3062	2941484555
3063	2941508986
3064	2941516815
3065	2941525090
3066	3003669389
3067	3005478648
3068	3005487860
3069	3005508823
3070	3005589359
3071	3005597395
3072	3005713420
3073	641644955
3074	8006928509
3075	8006942716
3076	8006964845
3077	8006982439
3078	8006991759
3079	8006995580
3080	8016632662
3081	8019558477
3082	8019566820
3083	8019688358
3084	8054005745
3085	8055228327
3086	8055915834
3087	8056676372
3088	8056685046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

189

428

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2g29-assembly1.cif.gz_A	crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803	0.9628	87	443
2i49-assembly1.cif.gz_A	crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803	0.9276	90	446
2g29-assembly1.cif.gz_A	crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803	0.8922	87	443
3un6-assembly1.cif.gz_A	2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound	0.8883	91	406
3un6-assembly1.cif.gz_A	2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound	0.8768	91	406

ID	Description	Score	Start	End	Superfamily
2g29A02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9245	176	273	3.40.190.10
2g29A01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8803	87	426	3.40.190.10
2g29A01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8737	87	426	3.40.190.10
3qslB02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8691	178	268	3.40.190.10
3ksxA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8661	175	271	3.40.190.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2W5IAF3-F1-model_v4	deleted	0.9868	148	446
AF-A0A352IQL9-F1-model_v4	Nitrate ABC transporter substrate-binding protein	0.9852	120	446	GO:0005886 GO:0012505
AF-A0A149VCP2-F1-model_v4	Nitrate ABC transporter substrate-binding protein	0.9849	84	432	GO:0005886 GO:0012505
AF-A0A352IQL9-F1-model_v4	Nitrate ABC transporter substrate-binding protein	0.9822	120	446	GO:0005886 GO:0012505
AF-A0A2W5IAF3-F1-model_v4	deleted	0.9803	148	446

F494690

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13379

NMT1_2

NMT1-like family

189

428

0.98

Structural Annotation

Top 5 Hits

Map