F494693

General Info

Members Datasets Scaffolds Average Seq Length
1546 414 3092 144

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000092|Ga0500616_0000092_3679_4113
Length 144
Sequence MRKQGPIGAAVDVLVPFHDVDLAGVVWHGHYIKYLENARWAVMDRIGFGLDAMMRSGFMWPVVGLEVKYVRAARYGDQLRVQASLVEWESRLVLNYLVLDAKNGARVGRAQTVQVAVEHETGTLQLMSPACLVERVQACLNEAK

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
84 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
85 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
99 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
174 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
175 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
176 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
177 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
198 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
199 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
205 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
214 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
215 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
216 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
217 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
218 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
219 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
220 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
221 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
222 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
223 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
224 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
225 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
226 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
227 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
228 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
231 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
232 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
235 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
236 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
237 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
240 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
253 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
256 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
324 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
325 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
326 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
349 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
350 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
351 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
354 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
373 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
376 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
377 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
378 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
379 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
380 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
381 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
382 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
383 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
386 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
387 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
388 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
389 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
390 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
391 2643221569 Achromobacter sp. Root565 Isolate Unclassified
392 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
393 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
394 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
395 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
396 2734482264 Dyella sp. AD052 Isolate Unclassified
397 2738543009 Luteibacter sp. OK325 Isolate Unclassified
398 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
399 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
400 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
401 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
402 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
403 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
404 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
405 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
406 2919085039 Luteibacter sp. 1214 Isolate Unclassified
407 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
408 2919404418 Luteibacter sp. 3190 Isolate Unclassified
409 2941471342 Luteibacter sp. 621 Isolate Unclassified
410 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
411 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
412 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
413 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
414 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0.13
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 8.47
Nodule 0.45
Rhizoplane 1.81
Rhizosphere 78.2
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000092 3300053153 Bacteria 183860
2 MRS2a_Contig_1649 2124908027 Bacteria 2813
3 MRS2a_Contig_66 2124908027 Bacteria 22945
4 SwRhRL2b_contig_3620071 2162886007 Bacteria 873
5 JGI24741J21665_1006921 3300001915 Bacteria 2236
6 JGI24737J22298_10049378 3300001990 Bacteria 1280
7 JGI24735J21928_10002867 3300002067 Bacteria 5945
8 JGI25156J39149_1010331 3300002705 Bacteria 2200
9 JGI25162J39368_1000140 3300002737 Bacteria 78251
10 JGI25162J39368_1001133 3300002737 Bacteria 16034
11 JGI25154J39366_1005869 3300002738 Bacteria 1883
12 JGI25154J39366_1011104 3300002738 Bacteria 1042
13 JGI25157J39369_1000532 3300002741 Bacteria 23104
14 JGI25157J39369_1001373 3300002741 Bacteria 9461
15 JGI25163J39215_1000195 3300002771 Bacteria 23525
16 JGI25163J39215_1000288 3300002771 Bacteria 17349
17 JGI25164J39214_1000045 3300002772 Bacteria 125909
18 JGI25164J39214_1000110 3300002772 Bacteria 78251
19 JGI25164J39214_1000146 3300002772 Bacteria 67817
20 JGI25165J46597_1000072 3300003214 Bacteria 192184
21 JGI25165J46597_1000228 3300003214 Bacteria 78251
22 JGI25165J46597_1000267 3300003214 Bacteria 67817
23 rootH1_10143501 3300003316 Bacteria 1762
24 rootH1_10144092 3300003316 Bacteria 1451
25 rootH2_10006901 3300003320 Bacteria 30703
26 rootH2_10102811 3300003320 Bacteria 1726
27 rootL2_10072169 3300003322 Bacteria 2831
28 rootH1_10194158 3300003323 Bacteria 3347
29 Ga0055538_1000037 3300003751 Bacteria 190238
30 Ga0055539_1000048 3300003752 Bacteria 190238
31 Ga0055533_1000059 3300003756 Bacteria 190238
32 Ga0055532_1000105 3300003758 Bacteria 91428
33 Ga0055525_1000027 3300003759 Bacteria 340506
34 Ga0055525_1000128 3300003759 Bacteria 113553
35 Ga0055527_1000199 3300003760 Bacteria 39633
36 Ga0055527_1003841 3300003760 Bacteria 2154
37 Ga0055535_1000096 3300003761 Bacteria 96196
38 Ga0055535_1000527 3300003761 Bacteria 33210
39 Ga0055535_1000585 3300003761 Bacteria 30486
40 Ga0055535_1000854 3300003761 Bacteria 21603
41 Ga0055535_1001004 3300003761 Bacteria 18069
42 Ga0055535_1003385 3300003761 Bacteria 4562
43 Ga0055542_1000242 3300003762 Bacteria 62798
44 Ga0055542_1000647 3300003762 Bacteria 28749
45 Ga0055542_1000687 3300003762 Bacteria 26887
46 Ga0055542_1000693 3300003762 Bacteria 26579
47 Ga0055529_1000091 3300003763 Bacteria 138369
48 Ga0055529_1000204 3300003763 Bacteria 78293
49 Ga0055529_1000590 3300003763 Bacteria 28472
50 Ga0055529_1001016 3300003763 Bacteria 13476
51 Ga0055529_1008865 3300003763 Bacteria 1331
52 Ga0055530_10000333 3300003791 Bacteria 42485
53 Ga0055530_10025529 3300003791 Bacteria 1648
54 Ga0055540_1000138 3300003792 Bacteria 73170
55 Ga0055540_1000279 3300003792 Bacteria 45880
56 Ga0055540_1000586 3300003792 Bacteria 26511
57 Ga0055531_10000321 3300003794 Bacteria 47157
58 Ga0055541_1000035 3300003841 Bacteria 190238
59 Ga0065165_1000157 3300005262 Bacteria 118005
60 Ga0065714_10002325 3300005288 Bacteria 36328
61 Ga0065714_10004288 3300005288 Bacteria 13113
62 Ga0065714_10013604 3300005288 Bacteria 1920
63 Ga0065714_10065492 3300005288 Bacteria 9763
64 Ga0065714_10066275 3300005288 Bacteria 7218
65 Ga0065714_10073214 3300005288 Bacteria 3225
66 Ga0065714_10086600 3300005288 Bacteria 2091
67 Ga0065714_10153303 3300005288 Bacteria 1082
68 Ga0065714_10155007 3300005288 Bacteria 1081
69 Ga0065714_10176174 3300005288 Bacteria 970
70 Ga0065714_10202228 3300005288 Bacteria 892
71 Ga0065704_10029484 3300005289 Bacteria 1893
72 Ga0065704_10030688 3300005289 Bacteria 984
73 Ga0065704_10050307 3300005289 Bacteria 704
74 Ga0065704_10052046 3300005289 Bacteria 644
75 Ga0065704_10078436 3300005289 Bacteria 4426
76 Ga0065704_10307763 3300005289 Bacteria 849
77 Ga0065712_10005782 3300005290 Bacteria 3810
78 Ga0065715_10114987 3300005293 Bacteria 2431
79 Ga0070658_10318215 3300005327 Bacteria 1328
80 Ga0070670_100002353 3300005331 Bacteria 15579
81 Ga0070670_100002909 3300005331 Bacteria 14174
82 Ga0070666_10000003 3300005335 Bacteria 463666
83 Ga0070682_100005436 3300005337 Bacteria 7100
84 Ga0070689_101347086 3300005340 Unclassified 644
85 Ga0070661_100000078 3300005344 Bacteria 77449
86 Ga0070661_100017685 3300005344 Bacteria 5059
87 Ga0070668_100208188 3300005347 Bacteria 1608
88 Ga0070669_100000221 3300005353 Bacteria 47408
89 Ga0070669_100000827 3300005353 Bacteria 22538
90 Ga0070669_100972425 3300005353 Bacteria 727
91 Ga0070659_100823034 3300005366 Bacteria 808
92 Ga0070714_100435085 3300005435 Bacteria 1244
93 Ga0070714_100518782 3300005435 Bacteria 1138
94 Ga0070663_100113348 3300005455 Bacteria 2040
95 Ga0070663_100727496 3300005455 Bacteria 845
96 Ga0070678_100397620 3300005456 Bacteria 1196
97 Ga0070662_100000095 3300005457 Bacteria 48526
98 Ga0070662_100160604 3300005457 Bacteria 1758
99 Ga0068853_100000089 3300005539 Bacteria 62291
100 Ga0070696_100088846 3300005546 Bacteria 2197
101 Ga0070693_100039762 3300005547 Bacteria 2636
102 Ga0070665_100044877 3300005548 Bacteria 4437
103 Ga0070665_100333708 3300005548 Bacteria 1521
104 Ga0070665_100434018 3300005548 Bacteria 1323
105 Ga0070665_100459354 3300005548 Bacteria 1283
106 Ga0070665_100699696 3300005548 Bacteria 1026
107 Ga0068855_100030341 3300005563 Bacteria 6467
108 Ga0070664_100000391 3300005564 Bacteria 32645
109 Ga0070664_100042072 3300005564 Bacteria 3858
110 Ga0070664_100621367 3300005564 Bacteria 1003
111 Ga0068857_100560401 3300005577 Bacteria 1077
112 Ga0068854_100001775 3300005578 Bacteria 13130
113 Ga0068856_100000053 3300005614 Bacteria 106241
114 Ga0068856_100001666 3300005614 Bacteria 23262
115 Ga0068851_10000024 3300005834 Bacteria 125917
116 Ga0068858_100063314 3300005842 Bacteria 3422
117 Ga0068858_101256440 3300005842 Bacteria 728
118 Ga0068860_100032236 3300005843 Bacteria 5037
119 Ga0075364_10096390 3300006051 Bacteria 1967
120 Ga0075364_10389759 3300006051 Bacteria 950
121 Ga0075364_10483272 3300006051 Bacteria 847
122 Ga0075364_10596925 3300006051 Bacteria 754
123 Ga0075364_10776200 3300006051 Bacteria 653
124 Ga0075364_11002870 3300006051 Bacteria 568
125 Ga0075432_10021407 3300006058 Bacteria 2210
126 Ga0075432_10026953 3300006058 Bacteria 1976
127 Ga0075432_10027473 3300006058 Bacteria 1959
128 Ga0075432_10071471 3300006058 Bacteria 1247
129 Ga0075432_10190618 3300006058 Bacteria 806
130 Ga0075432_10520918 3300006058 Bacteria 533
131 Ga0075369_10026032 3300006186 Bacteria 2436
132 Ga0075369_10049054 3300006186 Bacteria 1823
133 Ga0075369_10129538 3300006186 Bacteria 1146
134 Ga0075369_10227839 3300006186 Bacteria 863
135 Ga0097621_100338195 3300006237 Bacteria 1336
136 Ga0075436_100036047 3300006914 Bacteria 3413
137 Ga0075436_100060442 3300006914 Bacteria 2617
138 Ga0075436_100130000 3300006914 Bacteria 1765
139 Ga0075436_100347450 3300006914 Bacteria 1068
140 Ga0075436_100548220 3300006914 Bacteria 849
141 Ga0097620_100361471 3300006931 Bacteria 1547
142 Ga0079104_1000296 3300006946 Bacteria 63123
143 Ga0079104_1008919 3300006946 Bacteria 3446
144 Ga0099826_10016883 3300006948 Bacteria 5516
145 Ga0105251_10000303 3300009011 Bacteria 49448
146 Ga0105251_10000361 3300009011 Bacteria 44718
147 Ga0105251_10001365 3300009011 Bacteria 21115
148 Ga0105251_10001591 3300009011 Bacteria 19391
149 Ga0105251_10002600 3300009011 Bacteria 13964
150 Ga0105251_10005307 3300009011 Bacteria 8476
151 Ga0105251_10020898 3300009011 Bacteria 3430
152 Ga0105251_10114451 3300009011 Bacteria 1227
153 Ga0105251_10178983 3300009011 Bacteria 955
154 Ga0105251_10201537 3300009011 Bacteria 897
155 Ga0105251_10226189 3300009011 Bacteria 842
156 Ga0105251_10423788 3300009011 Bacteria 614
157 Ga0105244_10002380 3300009036 Bacteria 14257
158 Ga0105244_10019815 3300009036 Bacteria 3746
159 Ga0105244_10020489 3300009036 Bacteria 3673
160 Ga0105244_10032540 3300009036 Bacteria 2759
161 Ga0105244_10047696 3300009036 Bacteria 2195
162 Ga0105244_10068478 3300009036 Bacteria 1773
163 Ga0105250_10000189 3300009092 Bacteria 52791
164 Ga0105250_10000211 3300009092 Bacteria 48658
165 Ga0105250_10007144 3300009092 Bacteria 4820
166 Ga0105250_10007155 3300009092 Bacteria 4817
167 Ga0105250_10037371 3300009092 Bacteria 1949
168 Ga0105250_10067830 3300009092 Bacteria 1439
169 Ga0105240_10001417 3300009093 Bacteria 41135
170 Ga0105240_10006890 3300009093 Bacteria 16608
171 Ga0105240_10202071 3300009093 Bacteria 2328
172 Ga0105247_10001296 3300009101 Bacteria 18449
173 Ga0105247_10157755 3300009101 Bacteria 1500
174 Ga0105243_10000370 3300009148 Bacteria 48223
175 Ga0105243_10000595 3300009148 Bacteria 36195
176 Ga0105243_10008730 3300009148 Bacteria 7767
177 Ga0105243_10009526 3300009148 Bacteria 7394
178 Ga0105243_10017221 3300009148 Bacteria 5465
179 Ga0105243_10292792 3300009148 Bacteria 1472
180 Ga0105243_10956529 3300009148 Bacteria 856
181 Ga0105243_11131835 3300009148 Bacteria 793
182 Ga0105241_10298325 3300009174 Bacteria 1382
183 Ga0105242_10000136 3300009176 Bacteria 53348
184 Ga0105242_10229120 3300009176 Bacteria 1664
185 Ga0105242_10739324 3300009176 Bacteria 967
186 Ga0105242_11148283 3300009176 Bacteria 793
187 Ga0105248_10004445 3300009177 Bacteria 15525
188 Ga0105237_10000007 3300009545 Bacteria 367690
189 Ga0105237_10000939 3300009545 Bacteria 39181
190 Ga0105237_12710579 3300009545 Bacteria 507
191 Ga0105238_10000702 3300009551 Bacteria 35000
192 Ga0105238_10039803 3300009551 Bacteria 4765
193 Ga0105238_10857489 3300009551 Bacteria 926
194 Ga0105238_11438607 3300009551 Bacteria 717
195 Ga0105249_10115553 3300009553 Bacteria 2543
196 Ga0105239_10000030 3300010375 Bacteria 233669
197 Ga0105239_10046362 3300010375 Bacteria 4763
198 Ga0105239_10902901 3300010375 Bacteria 1014
199 Ga0105239_10960731 3300010375 Bacteria 982
200 Ga0105246_10008404 3300011119 Bacteria 6345
201 Ga0105246_10018246 3300011119 Bacteria 4470
202 Ga0105246_10023658 3300011119 Bacteria 3978
203 Ga0157336_1005077 3300012477 Bacteria 856
204 Ga0157345_1000068 3300012498 Bacteria 21372
205 Ga0157345_1012891 3300012498 Bacteria 762
206 Ga0157347_1023128 3300012502 Bacteria 739
207 Ga0157373_10001463 3300013100 Bacteria 18045
208 Ga0157373_10006037 3300013100 Bacteria 9056
209 Ga0157373_10021634 3300013100 Bacteria 4668
210 Ga0157373_10026974 3300013100 Bacteria 4146
211 Ga0157373_10060876 3300013100 Bacteria 2674
212 Ga0157373_10096863 3300013100 Bacteria 2077
213 Ga0157373_10260028 3300013100 Bacteria 1228
214 Ga0157373_10480719 3300013100 Bacteria 896
215 Ga0157373_10767109 3300013100 Bacteria 709
216 Ga0157371_10000811 3300013102 Bacteria 35895
217 Ga0157371_10002984 3300013102 Bacteria 15714
218 Ga0157371_10044761 3300013102 Bacteria 3151
219 Ga0157371_10121924 3300013102 Bacteria 1854
220 Ga0157370_10000150 3300013104 Bacteria 85732
221 Ga0157370_10002327 3300013104 Bacteria 22976
222 Ga0157370_10003150 3300013104 Bacteria 19544
223 Ga0157370_10011272 3300013104 Bacteria 9372
224 Ga0157370_10012220 3300013104 Bacteria 8921
225 Ga0157370_10016312 3300013104 Bacteria 7525
226 Ga0157370_10049234 3300013104 Bacteria 4034
227 Ga0157370_10056674 3300013104 Bacteria 3729
228 Ga0157370_10087218 3300013104 Bacteria 2931
229 Ga0157370_10102736 3300013104 Bacteria 2676
230 Ga0157370_10165398 3300013104 Bacteria 2057
231 Ga0157370_10191974 3300013104 Bacteria 1896
232 Ga0157370_10314736 3300013104 Bacteria 1444
233 Ga0157370_10592768 3300013104 Bacteria 1015
234 Ga0157369_10000080 3300013105 Bacteria 133011
235 Ga0157369_10001555 3300013105 Bacteria 28080
236 Ga0157369_10009964 3300013105 Bacteria 10856
237 Ga0157369_10015276 3300013105 Bacteria 8658
238 Ga0157369_10053218 3300013105 Bacteria 4377
239 Ga0157369_10120603 3300013105 Bacteria 2783
240 Ga0157369_10295993 3300013105 Bacteria 1684
241 Ga0157369_11324219 3300013105 Bacteria 734
242 Ga0163162_10000737 3300013306 Bacteria 30385
243 Ga0163162_10003525 3300013306 Bacteria 14970
244 Ga0163162_10334923 3300013306 Bacteria 1646
245 Ga0163162_10493418 3300013306 Bacteria 1355
246 Ga0163162_10555135 3300013306 Bacteria 1276
247 Ga0163162_10619308 3300013306 Bacteria 1208
248 Ga0163162_11036777 3300013306 Bacteria 928
249 Ga0157372_10097256 3300013307 Bacteria 3357
250 Ga0157372_10318988 3300013307 Bacteria 1809
251 Ga0157372_10364041 3300013307 Bacteria 1685
252 Ga0157375_10001875 3300013308 Bacteria 18102
253 Ga0157375_10008094 3300013308 Bacteria 9196
254 Ga0157375_10095216 3300013308 Bacteria 3048
255 Ga0182008_10001166 3300014497 Bacteria 18127
256 Ga0182008_10002124 3300014497 Bacteria 12636
257 Ga0182008_10002921 3300014497 Bacteria 10559
258 Ga0182008_10003447 3300014497 Bacteria 9547
259 Ga0182008_10013504 3300014497 Bacteria 4294
260 Ga0182008_10019151 3300014497 Bacteria 3536
261 Ga0182008_10032207 3300014497 Bacteria 2635
262 Ga0182008_10042257 3300014497 Bacteria 2272
263 Ga0182008_10058596 3300014497 Bacteria 1901
264 Ga0182008_10285747 3300014497 Bacteria 859
265 Ga0157377_10181198 3300014745 Bacteria 1325
266 Ga0182006_1000786 3300015261 Bacteria 21399
267 Ga0182006_1001000 3300015261 Bacteria 18502
268 Ga0182006_1004709 3300015261 Bacteria 6673
269 Ga0182006_1039761 3300015261 Bacteria 1854
270 Ga0182006_1048554 3300015261 Bacteria 1641
271 Ga0182006_1055500 3300015261 Bacteria 1512
272 Ga0182006_1066143 3300015261 Bacteria 1351
273 Ga0182006_1167303 3300015261 Bacteria 738
274 Ga0182007_10000194 3300015262 Bacteria 40895
275 Ga0182007_10018594 3300015262 Bacteria 2515
276 Ga0182005_1000028 3300015265 Bacteria 221889
277 Ga0182005_1000459 3300015265 Bacteria 21396
278 Ga0182005_1000718 3300015265 Bacteria 15278
279 Ga0182005_1006391 3300015265 Bacteria 3607
280 Ga0182005_1006642 3300015265 Bacteria 3515
281 Ga0182005_1030209 3300015265 Bacteria 1477
282 Ga0182005_1038877 3300015265 Bacteria 1294
283 Ga0182005_1040761 3300015265 Bacteria 1263
284 Ga0182005_1051947 3300015265 Bacteria 1115
285 Ga0182005_1085256 3300015265 Bacteria 875
286 Ga0182005_1101706 3300015265 Bacteria 806
287 Ga0183369_1006 3300015685 Bacteria 449058
288 Ga0183368_1002 3300015687 Bacteria 1865598
289 Ga0163161_10000719 3300017792 Bacteria 26142
290 Ga0163161_10001156 3300017792 Bacteria 19877
291 Ga0163161_10001514 3300017792 Bacteria 17199
292 Ga0163161_10006052 3300017792 Bacteria 8387
293 Ga0163161_10009292 3300017792 Bacteria 6802
294 Ga0163161_10023882 3300017792 Bacteria 4315
295 Ga0163161_10062490 3300017792 Bacteria 2713
296 Ga0163161_10269024 3300017792 Bacteria 1333
297 Ga0163161_10574017 3300017792 Bacteria 927
298 Ga0163161_10694211 3300017792 Bacteria 847
299 Ga0163161_10731030 3300017792 Bacteria 826
300 Ga0163161_10827596 3300017792 Bacteria 780
301 Ga0163161_10923875 3300017792 Bacteria 741
302 Ga0206356_10138341 3300020070 Bacteria 1394
303 Ga0206353_11377469 3300020082 Bacteria 1653
304 Ga0209435_108296 3300025206 Bacteria 1144
305 Ga0209760_100037 3300025207 Bacteria 129761
306 Ga0209760_100128 3300025207 Bacteria 50562
307 Ga0209784_100028 3300025224 Bacteria 357464
308 Ga0209566_100028 3300025225 Bacteria 357464
309 Ga0209674_100047 3300025226 Bacteria 357464
310 Ga0209674_100086 3300025226 Bacteria 187776
311 Ga0209672_100005 3300025228 Bacteria 1069303
312 Ga0209672_100029 3300025228 Bacteria 339298
313 Ga0209672_100142 3300025228 Bacteria 67156
314 Ga0209672_101479 3300025228 Bacteria 8284
315 Ga0209147_100031 3300025229 Bacteria 357464
316 Ga0209563_100023 3300025230 Bacteria 636844
317 Ga0209563_100050 3300025230 Bacteria 357464
318 Ga0209563_100868 3300025230 Bacteria 8979
319 Ga0207427_100014 3300025231 Bacteria 561361
320 Ga0207427_100016 3300025231 Bacteria 538697
321 Ga0207427_100055 3300025231 Bacteria 209093
322 Ga0209437_100011 3300025233 Bacteria 818520
323 Ga0209437_100016 3300025233 Bacteria 710118
324 Ga0209437_100161 3300025233 Bacteria 148264
325 Ga0209437_101703 3300025233 Bacteria 4890
326 Ga0209437_103800 3300025233 Bacteria 2695
327 Ga0209258_100006 3300025242 Bacteria 1069303
328 Ga0209258_100053 3300025242 Bacteria 339233
329 Ga0209258_100064 3300025242 Bacteria 293837
330 Ga0209258_100150 3300025242 Bacteria 161813
331 Ga0209258_100177 3300025242 Bacteria 140714
332 Ga0209258_100186 3300025242 Bacteria 132381
333 Ga0209646_1000183 3300025246 Bacteria 79021
334 Ga0209646_1000470 3300025246 Bacteria 20301
335 Ga0209646_1001464 3300025246 Bacteria 6300
336 Ga0209026_1000074 3300025250 Bacteria 203820
337 Ga0209026_1000205 3300025250 Bacteria 81843
338 Ga0209026_1000449 3300025250 Bacteria 32850
339 Ga0209677_100029 3300025253 Bacteria 357464
340 Ga0209677_113300 3300025253 Bacteria 1176
341 Ga0209148_1000009 3300025254 Bacteria 1395625
342 Ga0209148_1000012 3300025254 Bacteria 1069303
343 Ga0209148_1000073 3300025254 Bacteria 320851
344 Ga0209148_1000142 3300025254 Bacteria 163404
345 Ga0209148_1010000 3300025254 Bacteria 1820
346 Ga0209759_1000103 3300025256 Bacteria 153195
347 Ga0209759_1000922 3300025256 Bacteria 21502
348 Ga0209759_1006464 3300025256 Bacteria 3933
349 Ga0209759_1007045 3300025256 Bacteria 3680
350 Ga0209759_1009951 3300025256 Bacteria 2832
351 Ga0209129_1000553 3300025258 Bacteria 25955
352 Ga0209233_1000019 3300025261 Bacteria 818520
353 Ga0209233_1000036 3300025261 Bacteria 561361
354 Ga0209233_1000063 3300025261 Bacteria 395810
355 Ga0209565_1042725 3300025263 Bacteria 839
356 Ga0209455_1000008 3300025272 Bacteria 1069303
357 Ga0209455_1000060 3300025272 Bacteria 339298
358 Ga0209455_1000108 3300025272 Bacteria 193021
359 Ga0209455_1000177 3300025272 Bacteria 106026
360 Ga0209455_1001503 3300025272 Bacteria 10460
361 Ga0209455_1026840 3300025272 Bacteria 1027
362 Ga0209130_1049001 3300025284 Bacteria 777
363 Ga0209675_1002949 3300025291 Bacteria 8393
364 Ga0209676_1000025 3300025292 Bacteria 577569
365 Ga0209676_1000032 3300025292 Bacteria 469558
366 Ga0209676_1000318 3300025292 Bacteria 94045
367 Ga0209676_1005098 3300025292 Bacteria 7010
368 Ga0209676_1008035 3300025292 Bacteria 4800
369 Ga0209758_1014983 3300025297 Bacteria 4056
370 Ga0209050_1000025 3300025298 Bacteria 528225
371 Ga0209050_1000028 3300025298 Bacteria 477133
372 Ga0209050_1000520 3300025298 Bacteria 64262
373 Ga0209050_1001196 3300025298 Bacteria 30513
374 Ga0209050_1002297 3300025298 Bacteria 16884
375 Ga0209256_1010728 3300025299 Bacteria 3784
376 Ga0209051_1000026 3300025303 Bacteria 413311
377 Ga0209051_1000080 3300025303 Bacteria 199694
378 Ga0209051_1000334 3300025303 Bacteria 70713
379 Ga0209051_1015086 3300025303 Bacteria 3571
380 Ga0209257_1000034 3300025304 Bacteria 662719
381 Ga0209257_1009422 3300025304 Bacteria 5234
382 Ga0207656_10000007 3300025321 Bacteria 289154
383 Ga0207696_1000020 3300025711 Bacteria 434998
384 Ga0207696_1000057 3300025711 Bacteria 249404
385 Ga0207696_1000084 3300025711 Bacteria 196086
386 Ga0207696_1001201 3300025711 Bacteria 14759
387 Ga0207696_1001573 3300025711 Bacteria 12105
388 Ga0207696_1002868 3300025711 Bacteria 8139
389 Ga0207696_1003512 3300025711 Bacteria 7091
390 Ga0207696_1032191 3300025711 Bacteria 1581
391 Ga0207696_1053864 3300025711 Bacteria 1144
392 Ga0207696_1063672 3300025711 Bacteria 1033
393 Ga0207655_1000014 3300025728 Bacteria 607124
394 Ga0207655_1000326 3300025728 Bacteria 70089
395 Ga0207655_1000405 3300025728 Bacteria 59516
396 Ga0207655_1000935 3300025728 Bacteria 30300
397 Ga0207655_1001697 3300025728 Bacteria 19386
398 Ga0207655_1002391 3300025728 Bacteria 15301
399 Ga0207655_1002603 3300025728 Bacteria 14351
400 Ga0207655_1002944 3300025728 Bacteria 13087
401 Ga0207655_1005374 3300025728 Bacteria 8723
402 Ga0207655_1018024 3300025728 Bacteria 3774
403 Ga0207655_1040203 3300025728 Bacteria 2022
404 Ga0207655_1046056 3300025728 Bacteria 1815
405 Ga0207655_1052294 3300025728 Bacteria 1644
406 Ga0207655_1065786 3300025728 Bacteria 1374
407 Ga0207713_1000031 3300025735 Bacteria 283971
408 Ga0207713_1000114 3300025735 Bacteria 132170
409 Ga0207713_1000331 3300025735 Bacteria 53100
410 Ga0207713_1000434 3300025735 Bacteria 44039
411 Ga0207713_1000632 3300025735 Bacteria 34264
412 Ga0207713_1002064 3300025735 Bacteria 15016
413 Ga0207713_1002107 3300025735 Bacteria 14839
414 Ga0207713_1007038 3300025735 Bacteria 6739
415 Ga0207713_1010115 3300025735 Bacteria 5247
416 Ga0207713_1010313 3300025735 Bacteria 5185
417 Ga0207713_1016105 3300025735 Bacteria 3807
418 Ga0207713_1029590 3300025735 Bacteria 2451
419 Ga0207713_1040802 3300025735 Bacteria 1944
420 Ga0207713_1046192 3300025735 Bacteria 1772
421 Ga0207713_1060289 3300025735 Bacteria 1451
422 Ga0207713_1066672 3300025735 Bacteria 1346
423 Ga0207680_10000006 3300025903 Bacteria 635950
424 Ga0207647_10000342 3300025904 Bacteria 37701
425 Ga0207647_10029688 3300025904 Bacteria 3534
426 Ga0207705_10010198 3300025909 Bacteria 6835
427 Ga0207705_10150555 3300025909 Bacteria 1743
428 Ga0207695_10001438 3300025913 Bacteria 39963
429 Ga0207695_10002840 3300025913 Bacteria 25162
430 Ga0207695_10003444 3300025913 Bacteria 22313
431 Ga0207671_10000015 3300025914 Bacteria 439607
432 Ga0207671_10000763 3300025914 Bacteria 40900
433 Ga0207671_11377404 3300025914 Bacteria 547
434 Ga0207649_10000001 3300025920 Bacteria 537851
435 Ga0207649_10023541 3300025920 Bacteria 3568
436 Ga0207681_10000236 3300025923 Bacteria 42706
437 Ga0207681_10001050 3300025923 Bacteria 17915
438 Ga0207681_10792483 3300025923 Bacteria 791
439 Ga0207694_10000309 3300025924 Bacteria 45949
440 Ga0207650_10000273 3300025925 Bacteria 54321
441 Ga0207650_10000449 3300025925 Bacteria 35040
442 Ga0207650_10153801 3300025925 Bacteria 1817
443 Ga0207664_10410948 3300025929 Bacteria 1205
444 Ga0207690_10883096 3300025932 Bacteria 741
445 Ga0207706_10000069 3300025933 Bacteria 105541
446 Ga0207706_10000936 3300025933 Bacteria 29850
447 Ga0207686_10008722 3300025934 Bacteria 5477
448 Ga0207709_10000022 3300025935 Bacteria 383573
449 Ga0207709_10000164 3300025935 Bacteria 91154
450 Ga0207709_10029589 3300025935 Bacteria 3178
451 Ga0207709_10039160 3300025935 Bacteria 2830
452 Ga0207709_10073272 3300025935 Bacteria 2182
453 Ga0207709_10149675 3300025935 Bacteria 1615
454 Ga0207709_10506220 3300025935 Bacteria 943
455 Ga0207709_10752314 3300025935 Bacteria 783
456 Ga0207679_10000011 3300025945 Bacteria 346112
457 Ga0207679_10101171 3300025945 Bacteria 2254
458 Ga0207679_11813488 3300025945 Bacteria 557
459 Ga0207667_10046089 3300025949 Bacteria 4616
460 Ga0207712_10808570 3300025961 Bacteria 824
461 Ga0207668_10419000 3300025972 Bacteria 1136
462 Ga0207668_11874115 3300025972 Bacteria 541
463 Ga0207640_10039712 3300025981 Bacteria 2981
464 Ga0207658_11518238 3300025986 Bacteria 613
465 Ga0207703_10722924 3300026035 Bacteria 948
466 Ga0207639_10001824 3300026041 Bacteria 14346
467 Ga0207678_10002481 3300026067 Bacteria 16771
468 Ga0207678_10140962 3300026067 Bacteria 2057
469 Ga0207678_11003817 3300026067 Bacteria 739
470 Ga0207702_10000032 3300026078 Bacteria 168047
471 Ga0207702_10001392 3300026078 Bacteria 24120
472 Ga0207674_10537140 3300026116 Bacteria 1130
473 Ga0207674_11022937 3300026116 Bacteria 795
474 Ga0209281_1000026 3300027111 Bacteria 465877
475 Ga0209281_1000033 3300027111 Bacteria 383539
476 Ga0209281_1004128 3300027111 Bacteria 4452
477 Ga0209371_1017338 3300027312 Bacteria 1868
478 Ga0209969_1007503 3300027360 Bacteria 1541
479 Ga0209999_1017956 3300027543 Bacteria 1292
480 Ga0209282_1020582 3300027666 Bacteria 4178
481 Ga0207428_10029384 3300027907 Bacteria 4557
482 Ga0207428_10040814 3300027907 Bacteria 3760
483 Ga0207428_10182592 3300027907 Bacteria 1584
484 Ga0207428_10347525 3300027907 Bacteria 1092
485 Ga0207428_10397380 3300027907 Bacteria 1010
486 Ga0207428_10535991 3300027907 Bacteria 848
487 Ga0207428_10546990 3300027907 Bacteria 838
488 Ga0207428_11115148 3300027907 Bacteria 551
489 Ga0268266_10000021 3300028379 Bacteria 522453
490 Ga0268266_10014704 3300028379 Bacteria 6723
491 Ga0268266_10145699 3300028379 Bacteria 2129
492 Ga0268266_10187693 3300028379 Bacteria 1886
493 Ga0268266_10276065 3300028379 Bacteria 1561
494 Ga0268266_10493826 3300028379 Bacteria 1168
495 Ga0268264_10070759 3300028381 Bacteria 2954
496 Ga0265336_10000061 3300028666 Bacteria 102829
497 Ga0307515_10814054 3300028794 Bacteria 558
498 Ga0265324_10000178 3300029957 Bacteria 48490
499 Ga0268256_1023187 3300030500 Bacteria 1616
500 Ga0307511_10014728 3300030521 Bacteria 7603
501 Ga0316177_1074952 3300030731 Bacteria 773
502 Ga0316177_1133603 3300030731 Bacteria 1824
503 Ga0316179_1120809 3300030734 Bacteria 1020
504 Ga0316178_1016305 3300030735 Bacteria 9333
505 Ga0316181_1264489 3300030744 Bacteria 1637
506 Ga0316182_1089372 3300030745 Bacteria 964
507 Ga0307509_10133750 3300031507 Bacteria 2429
508 Ga0307408_100005176 3300031548 Bacteria 8751
509 Ga0307408_100125719 3300031548 Bacteria 1993
510 Ga0307408_100495386 3300031548 Bacteria 1068
511 Ga0307408_101173464 3300031548 Bacteria 715
512 Ga0307508_10615707 3300031616 Bacteria 688
513 Ga0307516_10178739 3300031730 Bacteria 1857
514 Ga0307516_10320110 3300031730 Bacteria 1222
515 Ga0307516_10452019 3300031730 Bacteria 941
516 Ga0307405_10001583 3300031731 Bacteria 9659
517 Ga0307405_10004526 3300031731 Bacteria 6581
518 Ga0307405_10010182 3300031731 Bacteria 4857
519 Ga0307405_10534882 3300031731 Bacteria 945
520 Ga0307405_10823189 3300031731 Bacteria 779
521 Ga0307413_10041666 3300031824 Bacteria 2690
522 Ga0307413_10448356 3300031824 Bacteria 1024
523 Ga0307413_10734671 3300031824 Bacteria 823
524 Ga0307406_10002125 3300031901 Bacteria 10783
525 Ga0307406_10245979 3300031901 Bacteria 1344
526 Ga0307406_10681661 3300031901 Bacteria 856
527 Ga0307407_10042777 3300031903 Bacteria 2542
528 Ga0307407_10248057 3300031903 Bacteria 1218
529 Ga0307412_10002814 3300031911 Bacteria 9659
530 Ga0307412_10003974 3300031911 Bacteria 8240
531 Ga0307412_10008615 3300031911 Bacteria 5830
532 Ga0307412_10012536 3300031911 Bacteria 4946
533 Ga0307412_10043865 3300031911 Bacteria 2915
534 Ga0307412_10654982 3300031911 Bacteria 896
535 Ga0307412_11936430 3300031911 Bacteria 544
536 Ga0307409_100064318 3300031995 Bacteria 2881
537 Ga0307409_100259242 3300031995 Bacteria 1594
538 Ga0307416_100046739 3300032002 Bacteria 3419
539 Ga0307416_100363414 3300032002 Bacteria 1470
540 Ga0307416_102222426 3300032002 Bacteria 650
541 Ga0307416_102727092 3300032002 Bacteria 590
542 Ga0307416_103427636 3300032002 Bacteria 530
543 Ga0307414_10130758 3300032004 Bacteria 1948
544 Ga0307414_10294082 3300032004 Bacteria 1370
545 Ga0307414_10403913 3300032004 Bacteria 1187
546 Ga0307411_10042187 3300032005 Bacteria 2908
547 Ga0307411_10147121 3300032005 Bacteria 1745
548 Ga0307411_10344313 3300032005 Bacteria 1212
549 Ga0307411_10770464 3300032005 Bacteria 844
550 Ga0307510_10001604 3300033180 Bacteria 25008
551 Ga0307510_10611486 3300033180 Bacteria 543
552 Ga0373931_0010218 3300035691 Bacteria 4508
553 Ga0395899_0027036 3300037312 Bacteria 4327
554 Ga0395900_0000755 3300037418 Bacteria 42995
555 Ga0395898_0000018 3300037466 Bacteria 418600
556 Ga0395898_0000049 3300037466 Bacteria 284792
557 Ga0395901_0002064 3300038443 Bacteria 20607
558 Ga0395901_0008508 3300038443 Bacteria 10369
559 Ga0395901_0237235 3300038443 Bacteria 1903
560 Ga0237819_03760 3300038705 Bacteria 2617
561 Ga0439436_0000011 3300041404 Bacteria 100668
562 Ga0439438_001501 3300041405 Bacteria 10291
563 Ga0439438_002275 3300041405 Bacteria 8231
564 Ga0439438_003017 3300041405 Bacteria 6947
565 Ga0439438_005281 3300041405 Bacteria 4782
566 Ga0439438_005369 3300041405 Bacteria 4728
567 Ga0439438_006547 3300041405 Bacteria 4091
568 Ga0439438_036780 3300041405 Bacteria 1282
569 Ga0439438_049350 3300041405 Bacteria 1074
570 Ga0439438_073359 3300041405 Bacteria 845
571 Ga0439438_124426 3300041405 Bacteria 619
572 Ga0439438_124748 3300041405 Bacteria 618
573 Ga0439447_000222 3300041407 Bacteria 20061
574 Ga0439447_001689 3300041407 Bacteria 8105
575 Ga0439447_002346 3300041407 Bacteria 6920
576 Ga0439447_049515 3300041407 Bacteria 1006
577 Ga0439466_0000766 3300041411 Bacteria 12159
578 Ga0439466_0010791 3300041411 Bacteria 3391
579 Ga0439466_0028437 3300041411 Bacteria 1930
580 Ga0439466_0044905 3300041411 Bacteria 1462
581 Ga0439466_0046469 3300041411 Bacteria 1434
582 Ga0439466_0180499 3300041411 Bacteria 643
583 Ga0439465_0000862 3300041413 Bacteria 9570
584 Ga0439465_0014309 3300041413 Bacteria 2473
585 Ga0451793_0565898 3300041452 Bacteria 5242
586 Ga0451795_0504092 3300041456 Bacteria 2071
587 Ga0451800_1116172 3300041459 Bacteria 706
588 Ga0451807_2313429 3300041486 Bacteria 536
589 Ga0439441_139710 3300042001 Unclassified 565
590 Ga0439432_000366 3300042006 Bacteria 16615
591 Ga0439432_000409 3300042006 Bacteria 15952
592 Ga0439432_004983 3300042006 Bacteria 4806
593 Ga0439432_009141 3300042006 Bacteria 3462
594 Ga0439432_012621 3300042006 Bacteria 2887
595 Ga0439432_022381 3300042006 Bacteria 2087
596 Ga0439432_038310 3300042006 Bacteria 1527
597 Ga0439432_070925 3300042006 Bacteria 1062
598 Ga0439432_085518 3300042006 Bacteria 952
599 Ga0439451_033600 3300042009 Bacteria 1031
600 Ga0439452_000231 3300042010 Bacteria 38808
601 Ga0439452_000245 3300042010 Bacteria 37540
602 Ga0439452_006230 3300042010 Bacteria 3753
603 Ga0439452_015949 3300042010 Bacteria 2049
604 Ga0439452_018150 3300042010 Bacteria 1878
605 Ga0439452_026430 3300042010 Bacteria 1464
606 Ga0439452_048802 3300042010 Bacteria 975
607 Ga0439452_106705 3300042010 Bacteria 599
608 Ga0439456_000187 3300042013 Bacteria 17986
609 Ga0439456_000508 3300042013 Bacteria 8359
610 Ga0439456_001536 3300042013 Bacteria 4654
611 Ga0439456_011441 3300042013 Bacteria 1836
612 Ga0439456_015485 3300042013 Bacteria 1592
613 Ga0439462_0160311 3300042015 Bacteria 634
614 Ga0439463_002080 3300042016 Bacteria 5181
615 Ga0439463_008043 3300042016 Bacteria 2602
616 Ga0439463_010879 3300042016 Bacteria 2235
617 Ga0450911_000158 3300042115 Bacteria 27057
618 Ga0450911_000764 3300042115 Bacteria 9167
619 Ga0450911_013395 3300042115 Bacteria 1097
620 Ga0450912_000194 3300042116 Bacteria 2517
621 Ga0450919_000888 3300042121 Bacteria 3863
622 Ga0450919_007856 3300042121 Bacteria 1241
623 Ga0450920_001094 3300042122 Bacteria 4430
624 Ga0450921_019250 3300042123 Bacteria 639
625 Ga0450922_000039 3300042124 Bacteria 11543
626 Ga0450922_001856 3300042124 Bacteria 2040
627 Ga0450923_000046 3300042125 Bacteria 9249
628 Ga0450892_012053 3300042130 Bacteria 774
629 Ga0450902_004154 3300042137 Bacteria 2147
630 Ga0450902_028478 3300042137 Bacteria 937
631 Ga0450902_046074 3300042137 Bacteria 745
632 Ga0450902_051106 3300042137 Bacteria 709
633 Ga0450903_000959 3300042138 Bacteria 5535
634 Ga0450903_004799 3300042138 Bacteria 2285
635 Ga0450903_005798 3300042138 Bacteria 2061
636 Ga0450904_026017 3300042139 Bacteria 603
637 Ga0450905_000094 3300042142 Bacteria 8594
638 Ga0450905_000892 3300042142 Bacteria 3736
639 Ga0450905_003932 3300042142 Bacteria 1958
640 Ga0450906_001941 3300042145 Bacteria 4522
641 Ga0450906_017346 3300042145 Bacteria 1299
642 Ga0450906_030317 3300042145 Bacteria 956
643 Ga0450907_000510 3300042146 Bacteria 10666
644 Ga0450907_001218 3300042146 Bacteria 5817
645 Ga0450910_000234 3300042147 Bacteria 6325
646 Ga0450910_000454 3300042147 Bacteria 4848
647 Ga0439446_0000915 3300042156 Bacteria 6364
648 Ga0439446_0082838 3300042156 Bacteria 995
649 Ga0450908_000023 3300042184 Bacteria 36671
650 Ga0450908_000250 3300042184 Bacteria 10609
651 Ga0450908_025554 3300042184 Bacteria 1031
652 Ga0450908_035408 3300042184 Bacteria 865
653 Ga0450908_056222 3300042184 Bacteria 688
654 Ga0450909_000593 3300042185 Bacteria 4761
655 Ga0439459_0000300 3300042438 Bacteria 5946
656 Ga0439459_0170212 3300042438 Bacteria 580
657 Ga0439464_0116837 3300042439 Bacteria 819
658 Ga0439460_0000192 3300042461 Bacteria 11893
659 Ga0439460_0000452 3300042461 Bacteria 8827
660 Ga0439460_0003104 3300042461 Bacteria 4015
661 Ga0450893_0012179 3300042532 Bacteria 1427
662 Ga0450901_000434 3300042533 Bacteria 4967
663 Ga0439440_0015227 3300042993 Bacteria 1670
664 Ga0466972_0168109 3300044658 Bacteria 1029
665 Ga0466975_0079261 3300044661 Bacteria 2343
666 Ga0466982_0000004 3300044672 Bacteria 386724
667 Ga0466982_0000035 3300044672 Bacteria 43571
668 Ga0466965_0069159 3300044683 Bacteria 1774
669 Ga0466965_0179458 3300044683 Bacteria 1116
670 Ga0466966_0001558 3300044684 Bacteria 14715
671 Ga0466966_0089705 3300044684 Bacteria 1909
672 Ga0466966_0115240 3300044684 Bacteria 1654
673 Ga0466961_0001256 3300044693 Bacteria 15640
674 Ga0466961_0014456 3300044693 Bacteria 5068
675 Ga0466961_0255863 3300044693 Bacteria 1074
676 Ga0466963_0092245 3300044694 Bacteria 2064
677 Ga0466971_0005242 3300044719 Bacteria 5615
678 Ga0466971_0038048 3300044719 Bacteria 2158
679 Ga0466971_0087007 3300044719 Bacteria 1428
680 Ga0466968_0000856 3300044735 Bacteria 10649
681 Ga0466970_0016610 3300044765 Bacteria 3797
682 Ga0466970_0046228 3300044765 Bacteria 2318
683 Ga0466970_0087570 3300044765 Bacteria 1689
684 Ga0466970_0473429 3300044765 Bacteria 719
685 Ga0466957_0011109 3300044842 Bacteria 5183
686 Ga0466957_0025615 3300044842 Bacteria 3496
687 Ga0466957_0397249 3300044842 Bacteria 942
688 Ga0466957_0467039 3300044842 Bacteria 871
689 Ga0466960_0003213 3300044901 Bacteria 6264
690 Ga0466959_0000347 3300045049 Bacteria 27371
691 Ga0466958_0001295 3300045836 Bacteria 11767
692 Ga0466958_0472660 3300045836 Bacteria 813
693 Ga0495617_000311 3300046452 Bacteria 27369
694 Ga0495617_000414 3300046452 Bacteria 23341
695 Ga0495617_000760 3300046452 Bacteria 15772
696 Ga0495617_001619 3300046452 Bacteria 9685
697 Ga0495617_004043 3300046452 Bacteria 5390
698 Ga0495617_007673 3300046452 Bacteria 3734
699 Ga0495617_009589 3300046452 Bacteria 3322
700 Ga0495617_010323 3300046452 Bacteria 3197
701 Ga0495617_039850 3300046452 Bacteria 1571
702 Ga0495617_048422 3300046452 Bacteria 1414
703 Ga0495617_071612 3300046452 Bacteria 1140
704 Ga0495617_142415 3300046452 Bacteria 765
705 Ga0495627_000535 3300046453 Bacteria 31404
706 Ga0495627_000700 3300046453 Bacteria 25589
707 Ga0495627_001188 3300046453 Bacteria 16475
708 Ga0495627_001933 3300046453 Bacteria 10797
709 Ga0495627_006456 3300046453 Bacteria 4595
710 Ga0495627_038932 3300046453 Bacteria 1468
711 Ga0495627_045750 3300046453 Bacteria 1332
712 Ga0495627_064932 3300046453 Bacteria 1073
713 Ga0495627_079309 3300046453 Bacteria 953
714 Ga0495627_124489 3300046453 Bacteria 727
715 Ga0495603_0002971 3300046455 Bacteria 10026
716 Ga0495603_0258235 3300046455 Bacteria 1003
717 Ga0495603_0538762 3300046455 Bacteria 668
718 Ga0495590_0001094 3300046457 Bacteria 11932
719 Ga0495590_0001147 3300046457 Bacteria 11586
720 Ga0495590_0015363 3300046457 Bacteria 2780
721 Ga0495590_0072748 3300046457 Bacteria 1207
722 Ga0495590_0271253 3300046457 Bacteria 634
723 Ga0495591_000025 3300046458 Bacteria 189897
724 Ga0495591_000244 3300046458 Bacteria 52389
725 Ga0495591_001000 3300046458 Bacteria 19227
726 Ga0495591_001158 3300046458 Bacteria 17285
727 Ga0495591_001492 3300046458 Bacteria 14436
728 Ga0495591_003990 3300046458 Bacteria 7394
729 Ga0495591_011170 3300046458 Bacteria 3418
730 Ga0495591_072768 3300046458 Bacteria 889
731 Ga0495629_0604816 3300046459 Bacteria 733
732 Ga0495638_0000038 3300046460 Bacteria 249534
733 Ga0495638_0000383 3300046460 Bacteria 54789
734 Ga0495638_0001218 3300046460 Bacteria 24478
735 Ga0495638_0003177 3300046460 Bacteria 12989
736 Ga0495638_0005538 3300046460 Bacteria 9364
737 Ga0495638_0010408 3300046460 Bacteria 6463
738 Ga0495638_0050766 3300046460 Bacteria 2589
739 Ga0495638_0052070 3300046460 Bacteria 2551
740 Ga0495638_0076752 3300046460 Bacteria 2035
741 Ga0495638_0078101 3300046460 Bacteria 2014
742 Ga0495638_0078633 3300046460 Bacteria 2006
743 Ga0495638_0083725 3300046460 Bacteria 1931
744 Ga0495638_0099325 3300046460 Bacteria 1742
745 Ga0495638_0102661 3300046460 Bacteria 1708
746 Ga0495653_0000549 3300046463 Bacteria 28717
747 Ga0495653_0004448 3300046463 Bacteria 11318
748 Ga0495653_0007642 3300046463 Bacteria 8842
749 Ga0495653_0015276 3300046463 Bacteria 6257
750 Ga0495653_0283428 3300046463 Bacteria 1086
751 Ga0495650_0000686 3300046471 Bacteria 43752
752 Ga0495650_0002476 3300046471 Bacteria 14863
753 Ga0495650_0003286 3300046471 Bacteria 11955
754 Ga0495650_0010087 3300046471 Bacteria 5305
755 Ga0495650_0013860 3300046471 Bacteria 4236
756 Ga0495650_0015184 3300046471 Bacteria 3962
757 Ga0495650_0056658 3300046471 Bacteria 1589
758 Ga0495650_0067227 3300046471 Bacteria 1416
759 Ga0495650_0073592 3300046471 Bacteria 1334
760 Ga0495650_0089122 3300046471 Bacteria 1176
761 Ga0495582_0005410 3300046473 Bacteria 7126
762 Ga0495605_0000095 3300046474 Bacteria 112622
763 Ga0495605_0000246 3300046474 Bacteria 64351
764 Ga0495605_0000311 3300046474 Bacteria 50989
765 Ga0495605_0000328 3300046474 Bacteria 48074
766 Ga0495605_0000673 3300046474 Bacteria 25763
767 Ga0495605_0000878 3300046474 Bacteria 20810
768 Ga0495605_0008900 3300046474 Bacteria 5659
769 Ga0495605_0037055 3300046474 Bacteria 2455
770 Ga0495605_0083911 3300046474 Bacteria 1486
771 Ga0495605_0129796 3300046474 Bacteria 1137
772 Ga0495605_0195466 3300046474 Bacteria 883
773 Ga0495605_0201722 3300046474 Bacteria 866
774 Ga0495605_0441933 3300046474 Bacteria 536
775 Ga0495639_0000238 3300046475 Bacteria 27395
776 Ga0495639_0045140 3300046475 Bacteria 1993
777 Ga0495639_0048517 3300046475 Bacteria 1925
778 Ga0495584_0000695 3300046491 Bacteria 22284
779 Ga0495584_0000768 3300046491 Bacteria 21254
780 Ga0495584_0001738 3300046491 Bacteria 12732
781 Ga0495584_0001963 3300046491 Bacteria 11831
782 Ga0495584_0004252 3300046491 Bacteria 7721
783 Ga0495584_0006560 3300046491 Bacteria 6081
784 Ga0495584_0006745 3300046491 Bacteria 6001
785 Ga0495584_0010414 3300046491 Bacteria 4777
786 Ga0495584_0017308 3300046491 Bacteria 3671
787 Ga0495584_0027204 3300046491 Bacteria 2898
788 Ga0495584_0035369 3300046491 Bacteria 2525
789 Ga0495584_0084591 3300046491 Bacteria 1598
790 Ga0495585_0000080 3300046492 Bacteria 99617
791 Ga0495585_0000279 3300046492 Bacteria 51082
792 Ga0495585_0000772 3300046492 Bacteria 28287
793 Ga0495585_0000790 3300046492 Bacteria 27867
794 Ga0495585_0002554 3300046492 Bacteria 12902
795 Ga0495585_0005311 3300046492 Bacteria 8134
796 Ga0495585_0006753 3300046492 Bacteria 7082
797 Ga0495585_0017325 3300046492 Bacteria 4163
798 Ga0495585_0025198 3300046492 Bacteria 3410
799 Ga0495585_0045224 3300046492 Bacteria 2458
800 Ga0495585_0053486 3300046492 Bacteria 2234
801 Ga0495585_0071741 3300046492 Bacteria 1887
802 Ga0495585_0217565 3300046492 Bacteria 965
803 Ga0495594_0001648 3300046499 Bacteria 11609
804 Ga0495594_0041606 3300046499 Bacteria 2515
805 Ga0495594_0131398 3300046499 Bacteria 1418
806 Ga0495596_0000273 3300046500 Bacteria 34263
807 Ga0495596_0001654 3300046500 Bacteria 12664
808 Ga0495596_0005230 3300046500 Bacteria 6166
809 Ga0495607_0000181 3300046501 Bacteria 67120
810 Ga0495607_0000347 3300046501 Bacteria 47969
811 Ga0495607_0000600 3300046501 Bacteria 35044
812 Ga0495607_0000776 3300046501 Bacteria 30570
813 Ga0495607_0000926 3300046501 Bacteria 27382
814 Ga0495607_0001128 3300046501 Bacteria 24218
815 Ga0495607_0001492 3300046501 Bacteria 20779
816 Ga0495607_0002014 3300046501 Bacteria 17053
817 Ga0495607_0003262 3300046501 Bacteria 12479
818 Ga0495607_0003337 3300046501 Bacteria 12321
819 Ga0495607_0010764 3300046501 Bacteria 6125
820 Ga0495607_0014147 3300046501 Bacteria 5206
821 Ga0495607_0016362 3300046501 Bacteria 4786
822 Ga0495607_0018201 3300046501 Bacteria 4484
823 Ga0495607_0026053 3300046501 Bacteria 3630
824 Ga0495607_0028340 3300046501 Bacteria 3457
825 Ga0495607_0050501 3300046501 Bacteria 2420
826 Ga0495607_0077775 3300046501 Bacteria 1832
827 Ga0495607_0094367 3300046501 Bacteria 1614
828 Ga0495607_0142741 3300046501 Bacteria 1233
829 Ga0495607_0181946 3300046501 Bacteria 1053
830 Ga0495583_0000015 3300046506 Bacteria 316392
831 Ga0495583_0001231 3300046506 Bacteria 27233
832 Ga0495583_0001852 3300046506 Bacteria 19708
833 Ga0495583_0001865 3300046506 Bacteria 19601
834 Ga0495583_0003070 3300046506 Bacteria 13227
835 Ga0495583_0003641 3300046506 Bacteria 11503
836 Ga0495583_0005013 3300046506 Bacteria 9170
837 Ga0495583_0007128 3300046506 Bacteria 7121
838 Ga0495583_0073032 3300046506 Bacteria 1504
839 Ga0495583_0138305 3300046506 Bacteria 1015
840 Ga0495606_0000214 3300046507 Bacteria 103149
841 Ga0495606_0000227 3300046507 Bacteria 99782
842 Ga0495606_0000340 3300046507 Bacteria 80328
843 Ga0495606_0001468 3300046507 Bacteria 31498
844 Ga0495606_0003165 3300046507 Bacteria 17806
845 Ga0495606_0004043 3300046507 Bacteria 14953
846 Ga0495606_0006528 3300046507 Bacteria 10728
847 Ga0495606_0008626 3300046507 Bacteria 8810
848 Ga0495606_0018121 3300046507 Bacteria 5292
849 Ga0495606_0058817 3300046507 Bacteria 2468
850 Ga0495606_0071855 3300046507 Bacteria 2177
851 Ga0495606_0081404 3300046507 Bacteria 2013
852 Ga0495606_0092554 3300046507 Bacteria 1856
853 Ga0495606_0129840 3300046507 Bacteria 1499
854 Ga0495606_0142984 3300046507 Bacteria 1411
855 Ga0495606_0146401 3300046507 Bacteria 1390
856 Ga0495606_0228196 3300046507 Bacteria 1045
857 Ga0495610_0001424 3300046512 Bacteria 21157
858 Ga0495610_0001476 3300046512 Bacteria 20720
859 Ga0495610_0001656 3300046512 Bacteria 19581
860 Ga0495610_0002687 3300046512 Bacteria 14660
861 Ga0495610_0002713 3300046512 Bacteria 14573
862 Ga0495610_0004601 3300046512 Bacteria 10116
863 Ga0495610_0006119 3300046512 Bacteria 8390
864 Ga0495610_0007982 3300046512 Bacteria 6941
865 Ga0495610_0008825 3300046512 Bacteria 6464
866 Ga0495610_0011088 3300046512 Bacteria 5535
867 Ga0495610_0021573 3300046512 Bacteria 3538
868 Ga0495610_0030016 3300046512 Bacteria 2854
869 Ga0495610_0048188 3300046512 Bacteria 2092
870 Ga0495610_0050791 3300046512 Bacteria 2022
871 Ga0495610_0088558 3300046512 Bacteria 1407
872 Ga0495610_0136008 3300046512 Bacteria 1062
873 Ga0495616_0000036 3300046513 Bacteria 128264
874 Ga0495616_0001441 3300046513 Bacteria 16553
875 Ga0495616_0002739 3300046513 Bacteria 11534
876 Ga0495616_0002792 3300046513 Bacteria 11404
877 Ga0495616_0006024 3300046513 Bacteria 7387
878 Ga0495616_0009922 3300046513 Bacteria 5535
879 Ga0495616_0021418 3300046513 Bacteria 3501
880 Ga0495616_0021751 3300046513 Bacteria 3468
881 Ga0495616_0029516 3300046513 Bacteria 2894
882 Ga0495616_0038295 3300046513 Bacteria 2462
883 Ga0495616_0052588 3300046513 Bacteria 2028
884 Ga0495616_0157608 3300046513 Bacteria 1023
885 Ga0495616_0158310 3300046513 Bacteria 1020
886 Ga0495616_0187041 3300046513 Bacteria 917
887 Ga0495616_0197949 3300046513 Bacteria 884
888 Ga0495620_0000042 3300046515 Bacteria 112107
889 Ga0495620_0000456 3300046515 Bacteria 26967
890 Ga0495620_0001598 3300046515 Bacteria 13417
891 Ga0495620_0004504 3300046515 Bacteria 7842
892 Ga0495620_0005261 3300046515 Bacteria 7240
893 Ga0495620_0005379 3300046515 Bacteria 7154
894 Ga0495620_0009865 3300046515 Bacteria 5058
895 Ga0495620_0019326 3300046515 Bacteria 3352
896 Ga0495620_0022826 3300046515 Bacteria 3004
897 Ga0495620_0027664 3300046515 Bacteria 2650
898 Ga0495620_0046424 3300046515 Bacteria 1875
899 Ga0495630_0078440 3300046517 Bacteria 2490
900 Ga0495630_0267724 3300046517 Bacteria 1305
901 Ga0495631_0000017 3300046518 Bacteria 98047
902 Ga0495631_0000722 3300046518 Bacteria 21214
903 Ga0495631_0002014 3300046518 Bacteria 11831
904 Ga0495631_0002456 3300046518 Bacteria 10450
905 Ga0495631_0002529 3300046518 Bacteria 10279
906 Ga0495631_0039447 3300046518 Bacteria 2095
907 Ga0495631_0051173 3300046518 Bacteria 1805
908 Ga0495631_0066137 3300046518 Bacteria 1564
909 Ga0495632_0000004 3300046519 Bacteria 381372
910 Ga0495632_0000573 3300046519 Bacteria 34214
911 Ga0495632_0000786 3300046519 Bacteria 28264
912 Ga0495632_0001250 3300046519 Bacteria 21567
913 Ga0495632_0001298 3300046519 Bacteria 21142
914 Ga0495632_0001313 3300046519 Bacteria 21015
915 Ga0495632_0004750 3300046519 Bacteria 9160
916 Ga0495632_0006386 3300046519 Bacteria 7594
917 Ga0495632_0011439 3300046519 Bacteria 5177
918 Ga0495632_0012740 3300046519 Bacteria 4831
919 Ga0495632_0020288 3300046519 Bacteria 3600
920 Ga0495632_0041126 3300046519 Bacteria 2323
921 Ga0495632_0041622 3300046519 Bacteria 2307
922 Ga0495632_0053753 3300046519 Bacteria 1976
923 Ga0495632_0081451 3300046519 Bacteria 1543
924 Ga0495632_0108921 3300046519 Bacteria 1301
925 Ga0495632_0110269 3300046519 Bacteria 1292
926 Ga0495632_0115967 3300046519 Bacteria 1254
927 Ga0495632_0169219 3300046519 Bacteria 1004
928 Ga0495637_0000020 3300046520 Bacteria 181611
929 Ga0495637_0000260 3300046520 Bacteria 41743
930 Ga0495637_0000848 3300046520 Bacteria 20166
931 Ga0495637_0001597 3300046520 Bacteria 13157
932 Ga0495637_0002194 3300046520 Bacteria 10915
933 Ga0495637_0002265 3300046520 Bacteria 10678
934 Ga0495637_0002757 3300046520 Bacteria 9543
935 Ga0495637_0003062 3300046520 Bacteria 8932
936 Ga0495637_0003107 3300046520 Bacteria 8864
937 Ga0495637_0006806 3300046520 Bacteria 5719
938 Ga0495637_0007488 3300046520 Bacteria 5405
939 Ga0495637_0021420 3300046520 Bacteria 2964
940 Ga0495637_0029337 3300046520 Bacteria 2449
941 Ga0495637_0031159 3300046520 Bacteria 2360
942 Ga0495637_0035236 3300046520 Bacteria 2187
943 Ga0495637_0037209 3300046520 Bacteria 2114
944 Ga0495637_0047707 3300046520 Bacteria 1806
945 Ga0495637_0055611 3300046520 Bacteria 1640
946 Ga0495637_0104353 3300046520 Bacteria 1104
947 Ga0495637_0203494 3300046520 Bacteria 726
948 Ga0495643_0004420 3300046522 Bacteria 9838
949 Ga0495643_0040933 3300046522 Bacteria 2528
950 Ga0495643_0049272 3300046522 Bacteria 2272
951 Ga0495643_0071231 3300046522 Bacteria 1825
952 Ga0495643_0134806 3300046522 Bacteria 1236
953 Ga0495643_0189037 3300046522 Bacteria 995
954 Ga0495643_0244198 3300046522 Bacteria 841
955 Ga0495644_0000218 3300046523 Bacteria 27012
956 Ga0495644_0000952 3300046523 Bacteria 11967
957 Ga0495644_0002488 3300046523 Bacteria 7348
958 Ga0495644_0020499 3300046523 Bacteria 2522
959 Ga0495644_0159556 3300046523 Bacteria 864
960 Ga0495644_0340575 3300046523 Bacteria 590
961 Ga0495648_0000797 3300046524 Bacteria 33330
962 Ga0495648_0001064 3300046524 Bacteria 27859
963 Ga0495648_0001468 3300046524 Bacteria 23050
964 Ga0495648_0002580 3300046524 Bacteria 16591
965 Ga0495648_0003045 3300046524 Bacteria 15001
966 Ga0495648_0005330 3300046524 Bacteria 10719
967 Ga0495648_0006491 3300046524 Bacteria 9538
968 Ga0495648_0013003 3300046524 Bacteria 6178
969 Ga0495648_0015550 3300046524 Bacteria 5522
970 Ga0495648_0025784 3300046524 Bacteria 3971
971 Ga0495648_0029576 3300046524 Bacteria 3634
972 Ga0495648_0032117 3300046524 Bacteria 3449
973 Ga0495648_0041353 3300046524 Bacteria 2912
974 Ga0495648_0060225 3300046524 Bacteria 2260
975 Ga0495648_0083454 3300046524 Bacteria 1810
976 Ga0495648_0085581 3300046524 Bacteria 1780
977 Ga0495648_0167350 3300046524 Bacteria 1130
978 Ga0495648_0419171 3300046524 Bacteria 593
979 Ga0495666_0028302 3300046526 Bacteria 2756
980 Ga0495666_0140201 3300046526 Bacteria 1127
981 Ga0495642_0000088 3300046528 Bacteria 53831
982 Ga0495642_0000463 3300046528 Bacteria 21321
983 Ga0495652_0360294 3300046529 Bacteria 1039
984 Ga0495654_0000891 3300046530 Bacteria 22358
985 Ga0495654_0000985 3300046530 Bacteria 20933
986 Ga0495654_0000992 3300046530 Bacteria 20889
987 Ga0495654_0001624 3300046530 Bacteria 15239
988 Ga0495654_0001635 3300046530 Bacteria 15181
989 Ga0495654_0002244 3300046530 Bacteria 12516
990 Ga0495654_0003637 3300046530 Bacteria 9367
991 Ga0495654_0008032 3300046530 Bacteria 5856
992 Ga0495654_0009609 3300046530 Bacteria 5296
993 Ga0495654_0017101 3300046530 Bacteria 3818
994 Ga0495654_0018737 3300046530 Bacteria 3624
995 Ga0495654_0020237 3300046530 Bacteria 3470
996 Ga0495654_0029476 3300046530 Bacteria 2798
997 Ga0495654_0046940 3300046530 Bacteria 2125
998 Ga0495654_0064846 3300046530 Bacteria 1745
999 Ga0495654_0073811 3300046530 Bacteria 1612
1000 Ga0495654_0120257 3300046530 Bacteria 1189
1001 Ga0495654_0253819 3300046530 Bacteria 731
1002 Ga0495654_0274252 3300046530 Bacteria 695
1003 Ga0495654_0307059 3300046530 Bacteria 646
1004 Ga0495654_0366970 3300046530 Bacteria 576
1005 Ga0495587_0005901 3300046536 Bacteria 7982
1006 Ga0495587_0009517 3300046536 Bacteria 6223
1007 Ga0495609_0000053 3300046538 Bacteria 149126
1008 Ga0495609_0000102 3300046538 Bacteria 100762
1009 Ga0495609_0000685 3300046538 Bacteria 26127
1010 Ga0495609_0001189 3300046538 Bacteria 17916
1011 Ga0495609_0002004 3300046538 Bacteria 12870
1012 Ga0495609_0003388 3300046538 Bacteria 9158
1013 Ga0495609_0010186 3300046538 Bacteria 4517
1014 Ga0495609_0011152 3300046538 Bacteria 4289
1015 Ga0495609_0089343 3300046538 Bacteria 1340
1016 Ga0495597_0000186 3300046542 Bacteria 55973
1017 Ga0495597_0002630 3300046542 Bacteria 11171
1018 Ga0495597_0005301 3300046542 Bacteria 6842
1019 Ga0495597_0005351 3300046542 Bacteria 6804
1020 Ga0495597_0005468 3300046542 Bacteria 6720
1021 Ga0495597_0005589 3300046542 Bacteria 6634
1022 Ga0495597_0018249 3300046542 Bacteria 3294
1023 Ga0495597_0040530 3300046542 Bacteria 2081
1024 Ga0495597_0046954 3300046542 Bacteria 1912
1025 Ga0495597_0083251 3300046542 Bacteria 1366
1026 Ga0495597_0177324 3300046542 Bacteria 862
1027 Ga0495597_0195255 3300046542 Bacteria 812
1028 Ga0495597_0223297 3300046542 Bacteria 747
1029 Ga0495597_0284426 3300046542 Bacteria 644
1030 Ga0495645_0043198 3300046543 Bacteria 3288
1031 Ga0495622_0000584 3300046557 Bacteria 21528
1032 Ga0495622_0000824 3300046557 Bacteria 17176
1033 Ga0495622_0011452 3300046557 Bacteria 4098
1034 Ga0495622_0056236 3300046557 Bacteria 1824
1035 Ga0495622_0143545 3300046557 Bacteria 1083
1036 Ga0495633_0000366 3300046558 Bacteria 48617
1037 Ga0495633_0005493 3300046558 Bacteria 7716
1038 Ga0495633_0087354 3300046558 Bacteria 1450
1039 Ga0495668_0000866 3300046616 Bacteria 34104
1040 Ga0495668_0007559 3300046616 Bacteria 6935
1041 Ga0495668_0016456 3300046616 Bacteria 4298
1042 Ga0495668_0027362 3300046616 Bacteria 3231
1043 Ga0495668_0033371 3300046616 Bacteria 2892
1044 Ga0495668_0257906 3300046616 Bacteria 954
1045 Ga0495668_0296928 3300046616 Bacteria 885
1046 Ga0495634_0001452 3300046642 Bacteria 21049
1047 Ga0495634_0111353 3300046642 Bacteria 1760
1048 Ga0495611_0000001 3300046648 Bacteria 2628469
1049 Ga0495611_0000022 3300046648 Bacteria 122452
1050 Ga0495611_0000193 3300046648 Bacteria 43575
1051 Ga0495611_0000386 3300046648 Bacteria 28151
1052 Ga0495611_0051797 3300046648 Bacteria 1851
1053 Ga0495611_0068705 3300046648 Bacteria 1617
1054 Ga0495611_0069065 3300046648 Bacteria 1613
1055 Ga0495611_0083237 3300046648 Bacteria 1473
1056 Ga0495625_0000022 3300046660 Bacteria 278823
1057 Ga0495625_0000086 3300046660 Bacteria 151735
1058 Ga0495625_0003090 3300046660 Bacteria 17005
1059 Ga0495625_0004188 3300046660 Bacteria 13740
1060 Ga0495625_0004759 3300046660 Bacteria 12699
1061 Ga0495625_0005594 3300046660 Bacteria 11395
1062 Ga0495625_0012798 3300046660 Bacteria 6783
1063 Ga0495625_0018709 3300046660 Bacteria 5396
1064 Ga0495625_0079061 3300046660 Bacteria 2294
1065 Ga0495625_0097166 3300046660 Bacteria 2027
1066 Ga0495625_0162671 3300046660 Bacteria 1494
1067 Ga0495625_0171083 3300046660 Bacteria 1450
1068 Ga0495625_0185348 3300046660 Bacteria 1381
1069 Ga0495625_0190369 3300046660 Bacteria 1359
1070 Ga0495625_0197838 3300046660 Bacteria 1328
1071 Ga0495625_0757330 3300046660 Bacteria 569
1072 Ga0495625_0802119 3300046660 Bacteria 547
1073 Ga0495635_0001499 3300046663 Bacteria 15653
1074 Ga0495635_0011073 3300046663 Bacteria 6324
1075 Ga0495659_0000084 3300046664 Bacteria 40750
1076 Ga0495659_0007648 3300046664 Bacteria 3424
1077 Ga0495659_0090659 3300046664 Bacteria 1173
1078 Ga0495661_0000048 3300046665 Bacteria 144678
1079 Ga0495661_0000131 3300046665 Bacteria 90795
1080 Ga0495661_0000171 3300046665 Bacteria 76610
1081 Ga0495661_0002376 3300046665 Bacteria 14528
1082 Ga0495661_0003777 3300046665 Bacteria 11084
1083 Ga0495661_0005763 3300046665 Bacteria 8767
1084 Ga0495661_0009381 3300046665 Bacteria 6717
1085 Ga0495661_0010290 3300046665 Bacteria 6387
1086 Ga0495661_0100205 3300046665 Bacteria 1632
1087 Ga0495661_0183899 3300046665 Bacteria 1105
1088 Ga0495661_0189569 3300046665 Bacteria 1084
1089 Ga0495661_0189689 3300046665 Bacteria 1083
1090 Ga0495661_0232365 3300046665 Bacteria 950
1091 Ga0495661_0269382 3300046665 Bacteria 862
1092 Ga0495588_0027114 3300046674 Bacteria 2862
1093 Ga0495588_0389683 3300046674 Bacteria 731
1094 Ga0495599_0423570 3300046678 Bacteria 791
1095 Ga0495623_0394048 3300046679 Bacteria 746
1096 Ga0495646_0147187 3300046680 Bacteria 1312
1097 Ga0495669_0120057 3300046684 Bacteria 1231
1098 Ga0495613_0079347 3300046689 Bacteria 2387
1099 Ga0495613_0184936 3300046689 Bacteria 1474
1100 Ga0495624_0001848 3300046690 Bacteria 16142
1101 Ga0495670_0000302 3300046691 Bacteria 23271
1102 Ga0495670_0000993 3300046691 Bacteria 13783
1103 Ga0495670_0001543 3300046691 Bacteria 11267
1104 Ga0495670_0001591 3300046691 Bacteria 11094
1105 Ga0495670_0001868 3300046691 Bacteria 10365
1106 Ga0495670_0004320 3300046691 Bacteria 6965
1107 Ga0495670_0005561 3300046691 Bacteria 6183
1108 Ga0495670_0015111 3300046691 Bacteria 3797
1109 Ga0495670_0107645 3300046691 Bacteria 1440
1110 Ga0495670_0120138 3300046691 Bacteria 1364
1111 Ga0495670_0145087 3300046691 Bacteria 1243
1112 Ga0495670_0406012 3300046691 Bacteria 736
1113 Ga0495671_0000157 3300046692 Bacteria 59803
1114 Ga0495671_0001635 3300046692 Bacteria 14701
1115 Ga0495671_0002821 3300046692 Bacteria 10872
1116 Ga0495671_0003219 3300046692 Bacteria 10142
1117 Ga0495671_0010307 3300046692 Bacteria 5187
1118 Ga0495671_0016468 3300046692 Bacteria 3947
1119 Ga0495671_0024838 3300046692 Bacteria 3117
1120 Ga0495671_0026153 3300046692 Bacteria 3027
1121 Ga0495671_0028399 3300046692 Bacteria 2882
1122 Ga0495671_0099200 3300046692 Bacteria 1424
1123 Ga0495671_0115513 3300046692 Bacteria 1310
1124 Ga0495671_0162731 3300046692 Bacteria 1085
1125 Ga0495671_0210795 3300046692 Bacteria 941
1126 Ga0495671_0250546 3300046692 Bacteria 854
1127 Ga0495649_0000782 3300046694 Bacteria 25561
1128 Ga0495649_0003461 3300046694 Bacteria 10639
1129 Ga0495649_0004128 3300046694 Bacteria 9538
1130 Ga0495649_0006803 3300046694 Bacteria 7080
1131 Ga0495649_0006929 3300046694 Bacteria 7002
1132 Ga0495649_0015660 3300046694 Bacteria 4311
1133 Ga0495649_0015913 3300046694 Bacteria 4272
1134 Ga0495649_0016636 3300046694 Bacteria 4166
1135 Ga0495649_0060081 3300046694 Bacteria 2045
1136 Ga0495649_0092925 3300046694 Bacteria 1606
1137 Ga0495649_0093328 3300046694 Bacteria 1602
1138 Ga0495649_0129881 3300046694 Bacteria 1329
1139 Ga0495649_0131929 3300046694 Bacteria 1318
1140 Ga0495649_0160849 3300046694 Bacteria 1177
1141 Ga0495649_0168677 3300046694 Bacteria 1146
1142 Ga0495649_0174019 3300046694 Bacteria 1125
1143 Ga0495589_0000053 3300046794 Bacteria 111458
1144 Ga0495589_0000445 3300046794 Bacteria 30407
1145 Ga0495589_0000647 3300046794 Bacteria 22840
1146 Ga0495589_0000866 3300046794 Bacteria 18894
1147 Ga0495589_0001416 3300046794 Bacteria 13904
1148 Ga0495589_0007951 3300046794 Bacteria 5552
1149 Ga0495589_0020471 3300046794 Bacteria 3383
1150 Ga0495589_0028217 3300046794 Bacteria 2833
1151 Ga0495589_0068621 3300046794 Bacteria 1734
1152 Ga0495589_0197792 3300046794 Bacteria 949
1153 Ga0495600_0012548 3300046809 Bacteria 5301
1154 Ga0495600_0259323 3300046809 Bacteria 1104
1155 Ga0495660_0000094 3300046810 Bacteria 94870
1156 Ga0495660_0000233 3300046810 Bacteria 54493
1157 Ga0495660_0000608 3300046810 Bacteria 28251
1158 Ga0495660_0008534 3300046810 Bacteria 5998
1159 Ga0495660_0009505 3300046810 Bacteria 5668
1160 Ga0495660_0012856 3300046810 Bacteria 4855
1161 Ga0495660_0013774 3300046810 Bacteria 4686
1162 Ga0495660_0014381 3300046810 Bacteria 4580
1163 Ga0495660_0025264 3300046810 Bacteria 3374
1164 Ga0495660_0034475 3300046810 Bacteria 2832
1165 Ga0495660_0050274 3300046810 Bacteria 2271
1166 Ga0495660_0067768 3300046810 Bacteria 1900
1167 Ga0495660_0137850 3300046810 Bacteria 1217
1168 Ga0495660_0154890 3300046810 Bacteria 1128
1169 Ga0495660_0202288 3300046810 Bacteria 947
1170 Ga0495660_0257421 3300046810 Bacteria 807
1171 Ga0495660_0334971 3300046810 Bacteria 676
1172 Ga0495581_0017951 3300047315 Bacteria 4111
1173 Ga0495581_0341247 3300047315 Bacteria 874
1174 Ga0495604_0002392 3300047317 Bacteria 15037
1175 Ga0495604_0004861 3300047317 Bacteria 10645
1176 Ga0495604_0145910 3300047317 Bacteria 1686
1177 Ga0495604_0200070 3300047317 Bacteria 1386
1178 Ga0495636_0014587 3300047318 Bacteria 3125
1179 Ga0495674_0002066 3300047319 Bacteria 19692
1180 Ga0495672_0001137 3300047320 Bacteria 26897
1181 Ga0495672_0001472 3300047320 Bacteria 23111
1182 Ga0495672_0001678 3300047320 Bacteria 21460
1183 Ga0495672_0002315 3300047320 Bacteria 17677
1184 Ga0495672_0002439 3300047320 Bacteria 17116
1185 Ga0495672_0007157 3300047320 Bacteria 8440
1186 Ga0495672_0009451 3300047320 Bacteria 7063
1187 Ga0495672_0017082 3300047320 Bacteria 4861
1188 Ga0495672_0021482 3300047320 Bacteria 4210
1189 Ga0495672_0039195 3300047320 Bacteria 2882
1190 Ga0495672_0048591 3300047320 Bacteria 2515
1191 Ga0495672_0081659 3300047320 Bacteria 1799
1192 Ga0495672_0081853 3300047320 Bacteria 1796
1193 Ga0495672_0117948 3300047320 Bacteria 1415
1194 Ga0495672_0128188 3300047320 Bacteria 1338
1195 Ga0495672_0139179 3300047320 Bacteria 1269
1196 Ga0495672_0146246 3300047320 Bacteria 1229
1197 Ga0495672_0254428 3300047320 Bacteria 851
1198 Ga0495676_0000022 3300047321 Bacteria 163719
1199 Ga0495676_0092879 3300047321 Bacteria 2251
1200 Ga0495680_0001940 3300047322 Bacteria 21762
1201 Ga0495680_0013153 3300047322 Bacteria 7232
1202 Ga0495680_0054661 3300047322 Bacteria 3099
1203 Ga0495680_0167638 3300047322 Bacteria 1591
1204 Ga0495680_0188060 3300047322 Bacteria 1486
1205 Ga0495683_0000030 3300047323 Bacteria 150551
1206 Ga0495683_0000520 3300047323 Bacteria 29465
1207 Ga0495683_0000927 3300047323 Bacteria 20673
1208 Ga0495683_0003818 3300047323 Bacteria 8693
1209 Ga0495683_0024998 3300047323 Bacteria 3062
1210 Ga0495683_0086173 3300047323 Bacteria 1526
1211 Ga0495683_0105027 3300047323 Bacteria 1354
1212 Ga0495683_0147203 3300047323 Bacteria 1099
1213 Ga0495683_0172472 3300047323 Bacteria 993
1214 Ga0495683_0224200 3300047323 Bacteria 836
1215 Ga0495687_002395 3300047443 Bacteria 15125
1216 Ga0495687_002578 3300047443 Bacteria 14291
1217 Ga0495687_004360 3300047443 Bacteria 9626
1218 Ga0495675_0067346 3300047444 Bacteria 2262
1219 Ga0495677_0024167 3300047445 Bacteria 2204
1220 Ga0495679_000004 3300047446 Bacteria 748056
1221 Ga0495679_000218 3300047446 Bacteria 48725
1222 Ga0495679_001364 3300047446 Bacteria 14041
1223 Ga0495679_015125 3300047446 Bacteria 2832
1224 Ga0495679_018166 3300047446 Bacteria 2501
1225 Ga0495679_034564 3300047446 Bacteria 1607
1226 Ga0495679_090604 3300047446 Bacteria 858
1227 Ga0495685_002740 3300047447 Bacteria 5555
1228 Ga0495685_190825 3300047447 Bacteria 658
1229 Ga0495673_0000004 3300047469 Bacteria 1354526
1230 Ga0495673_0000048 3300047469 Bacteria 265950
1231 Ga0495673_0000544 3300047469 Bacteria 38535
1232 Ga0495673_0001080 3300047469 Bacteria 23910
1233 Ga0495673_0001326 3300047469 Bacteria 20085
1234 Ga0495673_0003184 3300047469 Bacteria 10968
1235 Ga0495673_0003448 3300047469 Bacteria 10409
1236 Ga0495673_0004063 3300047469 Bacteria 9316
1237 Ga0495673_0004141 3300047469 Bacteria 9175
1238 Ga0495673_0005947 3300047469 Bacteria 7269
1239 Ga0495673_0007317 3300047469 Bacteria 6369
1240 Ga0495673_0009064 3300047469 Bacteria 5529
1241 Ga0495673_0010372 3300047469 Bacteria 5073
1242 Ga0495673_0019014 3300047469 Bacteria 3449
1243 Ga0495673_0029698 3300047469 Bacteria 2577
1244 Ga0495673_0031615 3300047469 Bacteria 2477
1245 Ga0495673_0034968 3300047469 Bacteria 2319
1246 Ga0495673_0043010 3300047469 Bacteria 2024
1247 Ga0495673_0060366 3300047469 Bacteria 1626
1248 Ga0495673_0076239 3300047469 Bacteria 1398
1249 Ga0495673_0165323 3300047469 Bacteria 846
1250 Ga0495681_0000351 3300047470 Bacteria 36044
1251 Ga0495681_0000411 3300047470 Bacteria 33097
1252 Ga0495681_0000534 3300047470 Bacteria 29137
1253 Ga0495681_0001655 3300047470 Bacteria 16511
1254 Ga0495681_0003659 3300047470 Bacteria 10678
1255 Ga0495681_0004241 3300047470 Bacteria 9836
1256 Ga0495681_0009965 3300047470 Bacteria 5795
1257 Ga0495681_0013066 3300047470 Bacteria 4843
1258 Ga0495681_0018019 3300047470 Bacteria 3904
1259 Ga0495681_0028010 3300047470 Bacteria 2905
1260 Ga0495681_0033813 3300047470 Bacteria 2555
1261 Ga0495681_0041182 3300047470 Bacteria 2243
1262 Ga0495681_0045233 3300047470 Bacteria 2108
1263 Ga0495681_0073048 3300047470 Bacteria 1549
1264 Ga0495681_0086959 3300047470 Bacteria 1386
1265 Ga0495681_0101900 3300047470 Bacteria 1254
1266 Ga0495681_0144794 3300047470 Bacteria 1001
1267 Ga0495686_0000017 3300047472 Bacteria 435554
1268 Ga0495686_0000295 3300047472 Bacteria 86824
1269 Ga0495686_0003766 3300047472 Bacteria 12894
1270 Ga0495686_0007911 3300047472 Bacteria 7895
1271 Ga0495686_0016228 3300047472 Bacteria 5055
1272 Ga0495686_0036297 3300047472 Bacteria 3163
1273 Ga0495686_0047765 3300047472 Bacteria 2701
1274 Ga0495686_0063540 3300047472 Bacteria 2287
1275 Ga0495686_0189564 3300047472 Bacteria 1186
1276 Ga0495686_0215243 3300047472 Bacteria 1095
1277 Ga0495686_0306556 3300047472 Bacteria 874
1278 Ga0495686_0412862 3300047472 Bacteria 722
1279 Ga0495593_0010377 3300047673 Bacteria 5385
1280 Ga0495593_0031330 3300047673 Bacteria 2905
1281 Ga0495593_0114748 3300047673 Bacteria 1373
1282 Ga0495602_0213446 3300048088 Bacteria 1462
1283 Ga0495602_0274720 3300048088 Bacteria 1244
1284 Ga0495626_0000039 3300048091 Bacteria 175454
1285 Ga0495626_0000391 3300048091 Bacteria 45354
1286 Ga0495626_0000562 3300048091 Bacteria 36865
1287 Ga0495626_0000876 3300048091 Bacteria 26763
1288 Ga0495626_0001660 3300048091 Bacteria 17183
1289 Ga0495626_0001894 3300048091 Bacteria 15625
1290 Ga0495626_0002239 3300048091 Bacteria 13862
1291 Ga0495626_0003053 3300048091 Bacteria 10989
1292 Ga0495626_0069159 3300048091 Bacteria 1590
1293 Ga0495626_0193035 3300048091 Bacteria 838
1294 Ga0496100_0003016 3300048903 Bacteria 8684
1295 Ga0496100_0381983 3300048903 Bacteria 1070
1296 Ga0496101_0000778 3300048904 Bacteria 18879
1297 Ga0496101_0017392 3300048904 Bacteria 4877
1298 Ga0496101_0246912 3300048904 Bacteria 1390
1299 Ga0496102_0001161 3300048905 Bacteria 24071
1300 Ga0496102_0722108 3300048905 Bacteria 919
1301 Ga0496103_0004719 3300048906 Bacteria 8244
1302 Ga0496104_0825531 3300048907 Bacteria 833
1303 Ga0496104_1101903 3300048907 Bacteria 698
1304 Ga0496105_0001610 3300048908 Bacteria 16023
1305 Ga0496106_0000756 3300048909 Bacteria 23310
1306 Ga0496106_0037602 3300048909 Bacteria 3622
1307 Ga0496106_0546883 3300048909 Bacteria 929
1308 Ga0496107_0010840 3300048910 Bacteria 6343
1309 Ga0496107_0539039 3300048910 Bacteria 865
1310 Ga0496108_0198830 3300048911 Bacteria 1739
1311 Ga0496110_0346670 3300048913 Bacteria 1353
1312 Ga0496110_0450852 3300048913 Bacteria 1172
1313 Ga0496110_1266590 3300048913 Bacteria 646
1314 Ga0496111_0408059 3300048914 Bacteria 1004
1315 Ga0496115_0009762 3300048918 Bacteria 7149
1316 Ga0496116_0000376 3300048919 Bacteria 66696
1317 Ga0496116_0001403 3300048919 Bacteria 27112
1318 Ga0496116_0003933 3300048919 Bacteria 14459
1319 Ga0496116_0004841 3300048919 Bacteria 12698
1320 Ga0496116_0042188 3300048919 Bacteria 3122
1321 Ga0496116_0095797 3300048919 Bacteria 1790
1322 Ga0496116_0259356 3300048919 Bacteria 858
1323 Ga0496116_0311251 3300048919 Bacteria 743
1324 Ga0496117_0001205 3300048920 Bacteria 38844
1325 Ga0496117_0004904 3300048920 Bacteria 14392
1326 Ga0496117_0007835 3300048920 Bacteria 10274
1327 Ga0496117_0023385 3300048920 Bacteria 4928
1328 Ga0496117_0027620 3300048920 Bacteria 4415
1329 Ga0496117_0033404 3300048920 Bacteria 3890
1330 Ga0496117_0101582 3300048920 Bacteria 1817
1331 Ga0496117_0104615 3300048920 Bacteria 1781
1332 Ga0496117_0106088 3300048920 Bacteria 1764
1333 Ga0496117_0144723 3300048920 Bacteria 1417
1334 Ga0496117_0202189 3300048920 Bacteria 1121
1335 Ga0496117_0205345 3300048920 Bacteria 1110
1336 Ga0496118_0000805 3300048921 Bacteria 50087
1337 Ga0496118_0002349 3300048921 Bacteria 25650
1338 Ga0496118_0003474 3300048921 Bacteria 19772
1339 Ga0496118_0006876 3300048921 Bacteria 12321
1340 Ga0496118_0007533 3300048921 Bacteria 11495
1341 Ga0496118_0022512 3300048921 Bacteria 5504
1342 Ga0496118_0041443 3300048921 Bacteria 3645
1343 Ga0496118_0085648 3300048921 Bacteria 2193
1344 Ga0496118_0130432 3300048921 Bacteria 1615
1345 Ga0496118_0132719 3300048921 Bacteria 1595
1346 Ga0496118_0149310 3300048921 Bacteria 1466
1347 Ga0496118_0184328 3300048921 Bacteria 1257
1348 Ga0496118_0295986 3300048921 Bacteria 891
1349 Ga0496119_0000082 3300048922 Bacteria 138565
1350 Ga0496119_0002193 3300048922 Bacteria 21829
1351 Ga0496119_0004168 3300048922 Bacteria 14516
1352 Ga0496119_0136834 3300048922 Bacteria 1327
1353 Ga0496119_0151878 3300048922 Bacteria 1240
1354 Ga0496120_0000343 3300048923 Bacteria 76966
1355 Ga0496120_0000873 3300048923 Bacteria 42650
1356 Ga0496120_0003526 3300048923 Bacteria 14163
1357 Ga0496120_0108927 3300048923 Bacteria 1450
1358 Ga0496120_0138384 3300048923 Bacteria 1238
1359 Ga0496121_0000372 3300048924 Bacteria 92348
1360 Ga0496121_0001119 3300048924 Bacteria 47137
1361 Ga0496121_0001386 3300048924 Bacteria 41013
1362 Ga0496121_0003275 3300048924 Bacteria 23245
1363 Ga0496121_0005323 3300048924 Bacteria 16544
1364 Ga0496121_0008472 3300048924 Bacteria 12072
1365 Ga0496121_0022730 3300048924 Bacteria 6068
1366 Ga0496121_0032161 3300048924 Bacteria 4775
1367 Ga0496121_0045083 3300048924 Bacteria 3793
1368 Ga0496121_0051123 3300048924 Bacteria 3483
1369 Ga0496121_0160733 3300048924 Bacteria 1643
1370 Ga0496121_0171138 3300048924 Bacteria 1577
1371 Ga0496121_0539246 3300048924 Bacteria 732
1372 Ga0496122_0000165 3300048925 Bacteria 157612
1373 Ga0496122_0003673 3300048925 Bacteria 19907
1374 Ga0496122_0009835 3300048925 Bacteria 9979
1375 Ga0496122_0015506 3300048925 Bacteria 7280
1376 Ga0496122_0057237 3300048925 Bacteria 2897
1377 Ga0496122_0070589 3300048925 Bacteria 2494
1378 Ga0496122_0117649 3300048925 Bacteria 1724
1379 Ga0496122_0152606 3300048925 Bacteria 1423
1380 Ga0496122_0168433 3300048925 Bacteria 1324
1381 Ga0496122_0200033 3300048925 Bacteria 1169
1382 Ga0496122_0249687 3300048925 Bacteria 993
1383 Ga0496122_0530269 3300048925 Bacteria 565
1384 Ga0496123_0000471 3300048926 Bacteria 70580
1385 Ga0496123_0002626 3300048926 Bacteria 21790
1386 Ga0496123_0007256 3300048926 Bacteria 10518
1387 Ga0496123_0042340 3300048926 Bacteria 3143
1388 Ga0496123_0043490 3300048926 Bacteria 3084
1389 Ga0496123_0046993 3300048926 Bacteria 2921
1390 Ga0496123_0105333 3300048926 Bacteria 1628
1391 Ga0496123_0106824 3300048926 Bacteria 1612
1392 Ga0496123_0127995 3300048926 Bacteria 1413
1393 Ga0496123_0138143 3300048926 Bacteria 1337
1394 Ga0496123_0140877 3300048926 Bacteria 1319
1395 Ga0496123_0221954 3300048926 Bacteria 952
1396 Ga0496123_0233463 3300048926 Bacteria 918
1397 Ga0496124_0000120 3300048927 Bacteria 163899
1398 Ga0496124_0000289 3300048927 Bacteria 95056
1399 Ga0496124_0002123 3300048927 Bacteria 26679
1400 Ga0496124_0002586 3300048927 Bacteria 23427
1401 Ga0496124_0004161 3300048927 Bacteria 17075
1402 Ga0496124_0004499 3300048927 Bacteria 16259
1403 Ga0496124_0025597 3300048927 Bacteria 5343
1404 Ga0496124_0075776 3300048927 Bacteria 2778
1405 Ga0496124_0086590 3300048927 Bacteria 2563
1406 Ga0496124_0141700 3300048927 Bacteria 1896
1407 Ga0496124_0156103 3300048927 Bacteria 1784
1408 Ga0496124_0343411 3300048927 Bacteria 1059
1409 Ga0496124_0490661 3300048927 Bacteria 826
1410 Ga0496124_0615966 3300048927 Bacteria 703
1411 Ga0496125_0000799 3300048928 Bacteria 51395
1412 Ga0496125_0020266 3300048928 Bacteria 6244
1413 Ga0496125_0030336 3300048928 Bacteria 4839
1414 Ga0496125_0052151 3300048928 Bacteria 3366
1415 Ga0496125_0072625 3300048928 Bacteria 2679
1416 Ga0496125_0089198 3300048928 Bacteria 2320
1417 Ga0496125_0094313 3300048928 Bacteria 2230
1418 Ga0496125_0115288 3300048928 Bacteria 1932
1419 Ga0496125_0242708 3300048928 Bacteria 1142
1420 Ga0496125_0255021 3300048928 Bacteria 1104
1421 Ga0496126_0003436 3300048929 Bacteria 19988
1422 Ga0496126_0016008 3300048929 Bacteria 7519
1423 Ga0496126_0068686 3300048929 Bacteria 3163
1424 Ga0496126_0076337 3300048929 Bacteria 2972
1425 Ga0496126_0090247 3300048929 Bacteria 2696
1426 Ga0496126_0170609 3300048929 Bacteria 1853
1427 Ga0496126_0226319 3300048929 Bacteria 1569
1428 Ga0496126_0231886 3300048929 Bacteria 1546
1429 Ga0495678_000017 3300049459 Bacteria 282592
1430 Ga0495678_000276 3300049459 Bacteria 56670
1431 Ga0495678_000693 3300049459 Bacteria 30734
1432 Ga0495678_001927 3300049459 Bacteria 15036
1433 Ga0495678_002044 3300049459 Bacteria 14442
1434 Ga0495678_002423 3300049459 Bacteria 12682
1435 Ga0495678_017852 3300049459 Bacteria 3203
1436 Ga0495678_029628 3300049459 Bacteria 2296
1437 Ga0495678_039248 3300049459 Bacteria 1910
1438 Ga0495678_058917 3300049459 Bacteria 1449
1439 Ga0495678_172420 3300049459 Bacteria 683
1440 Ga0495678_180824 3300049459 Bacteria 661
1441 Ga0495678_221822 3300049459 Bacteria 573
1442 Ga0495682_0000182 3300049460 Bacteria 51816
1443 Ga0495682_0000659 3300049460 Bacteria 22954
1444 Ga0495682_0003288 3300049460 Bacteria 7227
1445 Ga0495682_0013672 3300049460 Bacteria 3086
1446 Ga0495682_0053109 3300049460 Bacteria 1471
1447 Ga0495682_0060253 3300049460 Bacteria 1370
1448 Ga0495682_0075283 3300049460 Bacteria 1214
1449 Ga0501031_0020724 3300049568 Bacteria 4285
1450 Ga0501032_0004573 3300049569 Bacteria 10410
1451 Ga0501032_0065381 3300049569 Bacteria 2432
1452 Ga0501032_0228544 3300049569 Bacteria 1210
1453 Ga0501032_0582283 3300049569 Bacteria 712
1454 Ga0501033_0000926 3300049570 Bacteria 26794
1455 Ga0501033_0002943 3300049570 Bacteria 14234
1456 Ga0501033_0006162 3300049570 Bacteria 9404
1457 Ga0501033_0311126 3300049570 Bacteria 1107
1458 Ga0501034_0120731 3300049571 Bacteria 2607
1459 Ga0501034_0728379 3300049571 Bacteria 888
1460 Ga0501037_0040652 3300049573 Bacteria 3421
1461 Ga0501037_0210961 3300049573 Bacteria 1369
1462 Ga0501037_0626147 3300049573 Bacteria 721
1463 Ga0501038_0034555 3300049574 Bacteria 4444
1464 Ga0501038_0046051 3300049574 Bacteria 3783
1465 Ga0501038_0444077 3300049574 Bacteria 998
1466 Ga0501038_0774396 3300049574 Bacteria 714
1467 Ga0501039_0014265 3300049575 Bacteria 6084
1468 Ga0501039_0083397 3300049575 Bacteria 2489
1469 Ga0501043_0034664 3300049579 Bacteria 3969
1470 Ga0501043_0117913 3300049579 Bacteria 2082
1471 Ga0501043_0216140 3300049579 Bacteria 1484
1472 Ga0501043_0459604 3300049579 Bacteria 955
1473 Ga0501046_0016380 3300049580 Bacteria 6211
1474 Ga0501046_0115923 3300049580 Bacteria 2042
1475 Ga0501046_0323977 3300049580 Bacteria 1122
1476 Ga0501047_0016071 3300049581 Bacteria 7138
1477 Ga0501047_0034249 3300049581 Bacteria 4904
1478 Ga0501047_0179527 3300049581 Bacteria 1983
1479 Ga0501047_0454179 3300049581 Bacteria 1110
1480 Ga0501047_0484959 3300049581 Bacteria 1064
1481 Ga0501048_0113790 3300049582 Bacteria 1911
1482 Ga0501048_0285161 3300049582 Bacteria 1174
1483 Ga0501048_0946905 3300049582 Bacteria 619
1484 Ga0501070_1341477 3300049586 Bacteria 545
1485 Ga0501073_0794223 3300049589 Bacteria 652
1486 Ga0501241_002564 3300049758 Bacteria 3499
1487 Ga0501035_0053659 3300049822 Bacteria 3603
1488 Ga0501035_0095809 3300049822 Bacteria 2608
1489 Ga0501035_0172051 3300049822 Bacteria 1870
1490 Ga0501035_0206754 3300049822 Bacteria 1681
1491 Ga0501035_0216841 3300049822 Bacteria 1635
1492 Ga0501044_0158151 3300049823 Bacteria 2244
1493 Ga0501044_0231386 3300049823 Bacteria 1795
1494 Ga0501044_0235167 3300049823 Bacteria 1778
1495 Ga0501044_0340032 3300049823 Bacteria 1422
1496 Ga0501044_0585418 3300049823 Bacteria 1010
1497 Ga0501044_0602716 3300049823 Bacteria 991
1498 Ga0501045_0253138 3300049824 Bacteria 1311
1499 nmdc:mga03683_319579_c1 3300050489 Bacteria 731
1500 nmdc:mga00v17_112287_c1 3300050491 Bacteria 1729
1501 nmdc:mga00v17_182295_c1 3300050491 Bacteria 1355
1502 nmdc:mga00v17_716846_c1 3300050491 Bacteria 641
1503 nmdc:mga08x19_146385_c1 3300050514 Bacteria 1598
1504 nmdc:mga08x19_164243_c1 3300050514 Bacteria 1509
1505 nmdc:mga0sz30_55912_c1 3300050516 Bacteria 1680
1506 Ga0500635_0000026 3300053080 Bacteria 104983
1507 Ga0500643_000020 3300053087 Bacteria 290328
1508 Ga0500646_0025092 3300053090 Bacteria 1608
1509 Ga0500651_0762605 3300053093 Bacteria 513
1510 Ga0500555_000196 3300053103 Bacteria 27957
1511 Ga0500573_0171730 3300053140 Bacteria 1172
1512 Ga0500633_0005982 3300053160 Bacteria 2945
1513 Ga0500645_000391 3300053730 Bacteria 30650
1514 Ga0466962_0040925 3300061719 Bacteria 2217
1515 Ga0466962_0046742 3300061719 Bacteria 2068
1516 Ga0466962_0275202 3300061719 Bacteria 830
1517 2510284318 2510065053 Bacteria 5005518
1518 2510292993 2510065055 Bacteria 5037935
1519 2510312499 2510065058 Bacteria 5005894
1520 2595449632 2593339239 Bacteria 4124669
1521 2599327424 2599185155 Bacteria 5827168
1522 2599906830 2599185292 Bacteria 6290804
1523 2643862920 2643221569 Bacteria 6064337
1524 2643894864 2643221577 Bacteria 3710843
1525 2644477023 2643221685 Bacteria 3673288
1526 2687583651 2687453130 Bacteria 4227172
1527 2721026443 2718218334 Bacteria 4765486
1528 2735833556 2734482264 Unclassified 5014763
1529 2739229686 2738543009 Bacteria 4944499
1530 2774131498 2773857672 Bacteria 4993178
1531 2809031348 2808606395 Bacteria 6020352
1532 2819564024 2818991440 Bacteria 4774720
1533 2842917577 2842914999 Bacteria 4419378
1534 2842919944 2842918807 Bacteria 4289178
1535 2884341554 2884338543 Bacteria 4610696
1536 2904464660 2904463128 Bacteria 4775606
1537 2917836382 2917832318 Bacteria 5346010
1538 2919088255 2919085039 Bacteria 4532964
1539 2919127485 2919125081 Bacteria 5385106
1540 2919406158 2919404418 Bacteria 4232372
1541 2941472997 2941471342 Bacteria 5018624
1542 2953995239 2953994433 Bacteria 4303959
1543 2974301738 2974298342 Bacteria 4840922
1544 2984500693 2984499530 Bacteria 5020881
1545 2984507216 2984504281 Bacteria 5262371
1546 8016730686 8016728285 Bacteria 5263933
1547 Ga0500616_0000092
1548 MRS2a_Contig_1649
1549 MRS2a_Contig_66
1550 SwRhRL2b_contig_3620071
1551 JGI24741J21665_1006921
1552 JGI24737J22298_10049378
1553 JGI24735J21928_10002867
1554 JGI25156J39149_1010331
1555 JGI25162J39368_1000140
1556 JGI25162J39368_1001133
1557 JGI25154J39366_1005869
1558 JGI25154J39366_1011104
1559 JGI25157J39369_1000532
1560 JGI25157J39369_1001373
1561 JGI25163J39215_1000195
1562 JGI25163J39215_1000288
1563 JGI25164J39214_1000045
1564 JGI25164J39214_1000110
1565 JGI25164J39214_1000146
1566 JGI25165J46597_1000072
1567 JGI25165J46597_1000228
1568 JGI25165J46597_1000267
1569 rootH1_10143501
1570 rootH1_10144092
1571 rootH2_10006901
1572 rootH2_10102811
1573 rootL2_10072169
1574 rootH1_10194158
1575 Ga0055538_1000037
1576 Ga0055539_1000048
1577 Ga0055533_1000059
1578 Ga0055532_1000105
1579 Ga0055525_1000027
1580 Ga0055525_1000128
1581 Ga0055527_1000199
1582 Ga0055527_1003841
1583 Ga0055535_1000096
1584 Ga0055535_1000527
1585 Ga0055535_1000585
1586 Ga0055535_1000854
1587 Ga0055535_1001004
1588 Ga0055535_1003385
1589 Ga0055542_1000242
1590 Ga0055542_1000647
1591 Ga0055542_1000687
1592 Ga0055542_1000693
1593 Ga0055529_1000091
1594 Ga0055529_1000204
1595 Ga0055529_1000590
1596 Ga0055529_1001016
1597 Ga0055529_1008865
1598 Ga0055530_10000333
1599 Ga0055530_10025529
1600 Ga0055540_1000138
1601 Ga0055540_1000279
1602 Ga0055540_1000586
1603 Ga0055531_10000321
1604 Ga0055541_1000035
1605 Ga0065165_1000157
1606 Ga0065714_10002325
1607 Ga0065714_10004288
1608 Ga0065714_10013604
1609 Ga0065714_10065492
1610 Ga0065714_10066275
1611 Ga0065714_10073214
1612 Ga0065714_10086600
1613 Ga0065714_10153303
1614 Ga0065714_10155007
1615 Ga0065714_10176174
1616 Ga0065714_10202228
1617 Ga0065704_10029484
1618 Ga0065704_10030688
1619 Ga0065704_10050307
1620 Ga0065704_10052046
1621 Ga0065704_10078436
1622 Ga0065704_10307763
1623 Ga0065712_10005782
1624 Ga0065715_10114987
1625 Ga0070658_10318215
1626 Ga0070670_100002353
1627 Ga0070670_100002909
1628 Ga0070666_10000003
1629 Ga0070682_100005436
1630 Ga0070689_101347086
1631 Ga0070661_100000078
1632 Ga0070661_100017685
1633 Ga0070668_100208188
1634 Ga0070669_100000221
1635 Ga0070669_100000827
1636 Ga0070669_100972425
1637 Ga0070659_100823034
1638 Ga0070714_100435085
1639 Ga0070714_100518782
1640 Ga0070663_100113348
1641 Ga0070663_100727496
1642 Ga0070678_100397620
1643 Ga0070662_100000095
1644 Ga0070662_100160604
1645 Ga0068853_100000089
1646 Ga0070696_100088846
1647 Ga0070693_100039762
1648 Ga0070665_100044877
1649 Ga0070665_100333708
1650 Ga0070665_100434018
1651 Ga0070665_100459354
1652 Ga0070665_100699696
1653 Ga0068855_100030341
1654 Ga0070664_100000391
1655 Ga0070664_100042072
1656 Ga0070664_100621367
1657 Ga0068857_100560401
1658 Ga0068854_100001775
1659 Ga0068856_100000053
1660 Ga0068856_100001666
1661 Ga0068851_10000024
1662 Ga0068858_100063314
1663 Ga0068858_101256440
1664 Ga0068860_100032236
1665 Ga0075364_10096390
1666 Ga0075364_10389759
1667 Ga0075364_10483272
1668 Ga0075364_10596925
1669 Ga0075364_10776200
1670 Ga0075364_11002870
1671 Ga0075432_10021407
1672 Ga0075432_10026953
1673 Ga0075432_10027473
1674 Ga0075432_10071471
1675 Ga0075432_10190618
1676 Ga0075432_10520918
1677 Ga0075369_10026032
1678 Ga0075369_10049054
1679 Ga0075369_10129538
1680 Ga0075369_10227839
1681 Ga0097621_100338195
1682 Ga0075436_100036047
1683 Ga0075436_100060442
1684 Ga0075436_100130000
1685 Ga0075436_100347450
1686 Ga0075436_100548220
1687 Ga0097620_100361471
1688 Ga0079104_1000296
1689 Ga0079104_1008919
1690 Ga0099826_10016883
1691 Ga0105251_10000303
1692 Ga0105251_10000361
1693 Ga0105251_10001365
1694 Ga0105251_10001591
1695 Ga0105251_10002600
1696 Ga0105251_10005307
1697 Ga0105251_10020898
1698 Ga0105251_10114451
1699 Ga0105251_10178983
1700 Ga0105251_10201537
1701 Ga0105251_10226189
1702 Ga0105251_10423788
1703 Ga0105244_10002380
1704 Ga0105244_10019815
1705 Ga0105244_10020489
1706 Ga0105244_10032540
1707 Ga0105244_10047696
1708 Ga0105244_10068478
1709 Ga0105250_10000189
1710 Ga0105250_10000211
1711 Ga0105250_10007144
1712 Ga0105250_10007155
1713 Ga0105250_10037371
1714 Ga0105250_10067830
1715 Ga0105240_10001417
1716 Ga0105240_10006890
1717 Ga0105240_10202071
1718 Ga0105247_10001296
1719 Ga0105247_10157755
1720 Ga0105243_10000370
1721 Ga0105243_10000595
1722 Ga0105243_10008730
1723 Ga0105243_10009526
1724 Ga0105243_10017221
1725 Ga0105243_10292792
1726 Ga0105243_10956529
1727 Ga0105243_11131835
1728 Ga0105241_10298325
1729 Ga0105242_10000136
1730 Ga0105242_10229120
1731 Ga0105242_10739324
1732 Ga0105242_11148283
1733 Ga0105248_10004445
1734 Ga0105237_10000007
1735 Ga0105237_10000939
1736 Ga0105237_12710579
1737 Ga0105238_10000702
1738 Ga0105238_10039803
1739 Ga0105238_10857489
1740 Ga0105238_11438607
1741 Ga0105249_10115553
1742 Ga0105239_10000030
1743 Ga0105239_10046362
1744 Ga0105239_10902901
1745 Ga0105239_10960731
1746 Ga0105246_10008404
1747 Ga0105246_10018246
1748 Ga0105246_10023658
1749 Ga0157336_1005077
1750 Ga0157345_1000068
1751 Ga0157345_1012891
1752 Ga0157347_1023128
1753 Ga0157373_10001463
1754 Ga0157373_10006037
1755 Ga0157373_10021634
1756 Ga0157373_10026974
1757 Ga0157373_10060876
1758 Ga0157373_10096863
1759 Ga0157373_10260028
1760 Ga0157373_10480719
1761 Ga0157373_10767109
1762 Ga0157371_10000811
1763 Ga0157371_10002984
1764 Ga0157371_10044761
1765 Ga0157371_10121924
1766 Ga0157370_10000150
1767 Ga0157370_10002327
1768 Ga0157370_10003150
1769 Ga0157370_10011272
1770 Ga0157370_10012220
1771 Ga0157370_10016312
1772 Ga0157370_10049234
1773 Ga0157370_10056674
1774 Ga0157370_10087218
1775 Ga0157370_10102736
1776 Ga0157370_10165398
1777 Ga0157370_10191974
1778 Ga0157370_10314736
1779 Ga0157370_10592768
1780 Ga0157369_10000080
1781 Ga0157369_10001555
1782 Ga0157369_10009964
1783 Ga0157369_10015276
1784 Ga0157369_10053218
1785 Ga0157369_10120603
1786 Ga0157369_10295993
1787 Ga0157369_11324219
1788 Ga0163162_10000737
1789 Ga0163162_10003525
1790 Ga0163162_10334923
1791 Ga0163162_10493418
1792 Ga0163162_10555135
1793 Ga0163162_10619308
1794 Ga0163162_11036777
1795 Ga0157372_10097256
1796 Ga0157372_10318988
1797 Ga0157372_10364041
1798 Ga0157375_10001875
1799 Ga0157375_10008094
1800 Ga0157375_10095216
1801 Ga0182008_10001166
1802 Ga0182008_10002124
1803 Ga0182008_10002921
1804 Ga0182008_10003447
1805 Ga0182008_10013504
1806 Ga0182008_10019151
1807 Ga0182008_10032207
1808 Ga0182008_10042257
1809 Ga0182008_10058596
1810 Ga0182008_10285747
1811 Ga0157377_10181198
1812 Ga0182006_1000786
1813 Ga0182006_1001000
1814 Ga0182006_1004709
1815 Ga0182006_1039761
1816 Ga0182006_1048554
1817 Ga0182006_1055500
1818 Ga0182006_1066143
1819 Ga0182006_1167303
1820 Ga0182007_10000194
1821 Ga0182007_10018594
1822 Ga0182005_1000028
1823 Ga0182005_1000459
1824 Ga0182005_1000718
1825 Ga0182005_1006391
1826 Ga0182005_1006642
1827 Ga0182005_1030209
1828 Ga0182005_1038877
1829 Ga0182005_1040761
1830 Ga0182005_1051947
1831 Ga0182005_1085256
1832 Ga0182005_1101706
1833 Ga0183369_1006
1834 Ga0183368_1002
1835 Ga0163161_10000719
1836 Ga0163161_10001156
1837 Ga0163161_10001514
1838 Ga0163161_10006052
1839 Ga0163161_10009292
1840 Ga0163161_10023882
1841 Ga0163161_10062490
1842 Ga0163161_10269024
1843 Ga0163161_10574017
1844 Ga0163161_10694211
1845 Ga0163161_10731030
1846 Ga0163161_10827596
1847 Ga0163161_10923875
1848 Ga0206356_10138341
1849 Ga0206353_11377469
1850 Ga0209435_108296
1851 Ga0209760_100037
1852 Ga0209760_100128
1853 Ga0209784_100028
1854 Ga0209566_100028
1855 Ga0209674_100047
1856 Ga0209674_100086
1857 Ga0209672_100005
1858 Ga0209672_100029
1859 Ga0209672_100142
1860 Ga0209672_101479
1861 Ga0209147_100031
1862 Ga0209563_100023
1863 Ga0209563_100050
1864 Ga0209563_100868
1865 Ga0207427_100014
1866 Ga0207427_100016
1867 Ga0207427_100055
1868 Ga0209437_100011
1869 Ga0209437_100016
1870 Ga0209437_100161
1871 Ga0209437_101703
1872 Ga0209437_103800
1873 Ga0209258_100006
1874 Ga0209258_100053
1875 Ga0209258_100064
1876 Ga0209258_100150
1877 Ga0209258_100177
1878 Ga0209258_100186
1879 Ga0209646_1000183
1880 Ga0209646_1000470
1881 Ga0209646_1001464
1882 Ga0209026_1000074
1883 Ga0209026_1000205
1884 Ga0209026_1000449
1885 Ga0209677_100029
1886 Ga0209677_113300
1887 Ga0209148_1000009
1888 Ga0209148_1000012
1889 Ga0209148_1000073
1890 Ga0209148_1000142
1891 Ga0209148_1010000
1892 Ga0209759_1000103
1893 Ga0209759_1000922
1894 Ga0209759_1006464
1895 Ga0209759_1007045
1896 Ga0209759_1009951
1897 Ga0209129_1000553
1898 Ga0209233_1000019
1899 Ga0209233_1000036
1900 Ga0209233_1000063
1901 Ga0209565_1042725
1902 Ga0209455_1000008
1903 Ga0209455_1000060
1904 Ga0209455_1000108
1905 Ga0209455_1000177
1906 Ga0209455_1001503
1907 Ga0209455_1026840
1908 Ga0209130_1049001
1909 Ga0209675_1002949
1910 Ga0209676_1000025
1911 Ga0209676_1000032
1912 Ga0209676_1000318
1913 Ga0209676_1005098
1914 Ga0209676_1008035
1915 Ga0209758_1014983
1916 Ga0209050_1000025
1917 Ga0209050_1000028
1918 Ga0209050_1000520
1919 Ga0209050_1001196
1920 Ga0209050_1002297
1921 Ga0209256_1010728
1922 Ga0209051_1000026
1923 Ga0209051_1000080
1924 Ga0209051_1000334
1925 Ga0209051_1015086
1926 Ga0209257_1000034
1927 Ga0209257_1009422
1928 Ga0207656_10000007
1929 Ga0207696_1000020
1930 Ga0207696_1000057
1931 Ga0207696_1000084
1932 Ga0207696_1001201
1933 Ga0207696_1001573
1934 Ga0207696_1002868
1935 Ga0207696_1003512
1936 Ga0207696_1032191
1937 Ga0207696_1053864
1938 Ga0207696_1063672
1939 Ga0207655_1000014
1940 Ga0207655_1000326
1941 Ga0207655_1000405
1942 Ga0207655_1000935
1943 Ga0207655_1001697
1944 Ga0207655_1002391
1945 Ga0207655_1002603
1946 Ga0207655_1002944
1947 Ga0207655_1005374
1948 Ga0207655_1018024
1949 Ga0207655_1040203
1950 Ga0207655_1046056
1951 Ga0207655_1052294
1952 Ga0207655_1065786
1953 Ga0207713_1000031
1954 Ga0207713_1000114
1955 Ga0207713_1000331
1956 Ga0207713_1000434
1957 Ga0207713_1000632
1958 Ga0207713_1002064
1959 Ga0207713_1002107
1960 Ga0207713_1007038
1961 Ga0207713_1010115
1962 Ga0207713_1010313
1963 Ga0207713_1016105
1964 Ga0207713_1029590
1965 Ga0207713_1040802
1966 Ga0207713_1046192
1967 Ga0207713_1060289
1968 Ga0207713_1066672
1969 Ga0207680_10000006
1970 Ga0207647_10000342
1971 Ga0207647_10029688
1972 Ga0207705_10010198
1973 Ga0207705_10150555
1974 Ga0207695_10001438
1975 Ga0207695_10002840
1976 Ga0207695_10003444
1977 Ga0207671_10000015
1978 Ga0207671_10000763
1979 Ga0207671_11377404
1980 Ga0207649_10000001
1981 Ga0207649_10023541
1982 Ga0207681_10000236
1983 Ga0207681_10001050
1984 Ga0207681_10792483
1985 Ga0207694_10000309
1986 Ga0207650_10000273
1987 Ga0207650_10000449
1988 Ga0207650_10153801
1989 Ga0207664_10410948
1990 Ga0207690_10883096
1991 Ga0207706_10000069
1992 Ga0207706_10000936
1993 Ga0207686_10008722
1994 Ga0207709_10000022
1995 Ga0207709_10000164
1996 Ga0207709_10029589
1997 Ga0207709_10039160
1998 Ga0207709_10073272
1999 Ga0207709_10149675
2000 Ga0207709_10506220
2001 Ga0207709_10752314
2002 Ga0207679_10000011
2003 Ga0207679_10101171
2004 Ga0207679_11813488
2005 Ga0207667_10046089
2006 Ga0207712_10808570
2007 Ga0207668_10419000
2008 Ga0207668_11874115
2009 Ga0207640_10039712
2010 Ga0207658_11518238
2011 Ga0207703_10722924
2012 Ga0207639_10001824
2013 Ga0207678_10002481
2014 Ga0207678_10140962
2015 Ga0207678_11003817
2016 Ga0207702_10000032
2017 Ga0207702_10001392
2018 Ga0207674_10537140
2019 Ga0207674_11022937
2020 Ga0209281_1000026
2021 Ga0209281_1000033
2022 Ga0209281_1004128
2023 Ga0209371_1017338
2024 Ga0209969_1007503
2025 Ga0209999_1017956
2026 Ga0209282_1020582
2027 Ga0207428_10029384
2028 Ga0207428_10040814
2029 Ga0207428_10182592
2030 Ga0207428_10347525
2031 Ga0207428_10397380
2032 Ga0207428_10535991
2033 Ga0207428_10546990
2034 Ga0207428_11115148
2035 Ga0268266_10000021
2036 Ga0268266_10014704
2037 Ga0268266_10145699
2038 Ga0268266_10187693
2039 Ga0268266_10276065
2040 Ga0268266_10493826
2041 Ga0268264_10070759
2042 Ga0265336_10000061
2043 Ga0307515_10814054
2044 Ga0265324_10000178
2045 Ga0268256_1023187
2046 Ga0307511_10014728
2047 Ga0316177_1074952
2048 Ga0316177_1133603
2049 Ga0316179_1120809
2050 Ga0316178_1016305
2051 Ga0316181_1264489
2052 Ga0316182_1089372
2053 Ga0307509_10133750
2054 Ga0307408_100005176
2055 Ga0307408_100125719
2056 Ga0307408_100495386
2057 Ga0307408_101173464
2058 Ga0307508_10615707
2059 Ga0307516_10178739
2060 Ga0307516_10320110
2061 Ga0307516_10452019
2062 Ga0307405_10001583
2063 Ga0307405_10004526
2064 Ga0307405_10010182
2065 Ga0307405_10534882
2066 Ga0307405_10823189
2067 Ga0307413_10041666
2068 Ga0307413_10448356
2069 Ga0307413_10734671
2070 Ga0307406_10002125
2071 Ga0307406_10245979
2072 Ga0307406_10681661
2073 Ga0307407_10042777
2074 Ga0307407_10248057
2075 Ga0307412_10002814
2076 Ga0307412_10003974
2077 Ga0307412_10008615
2078 Ga0307412_10012536
2079 Ga0307412_10043865
2080 Ga0307412_10654982
2081 Ga0307412_11936430
2082 Ga0307409_100064318
2083 Ga0307409_100259242
2084 Ga0307416_100046739
2085 Ga0307416_100363414
2086 Ga0307416_102222426
2087 Ga0307416_102727092
2088 Ga0307416_103427636
2089 Ga0307414_10130758
2090 Ga0307414_10294082
2091 Ga0307414_10403913
2092 Ga0307411_10042187
2093 Ga0307411_10147121
2094 Ga0307411_10344313
2095 Ga0307411_10770464
2096 Ga0307510_10001604
2097 Ga0307510_10611486
2098 Ga0373931_0010218
2099 Ga0395899_0027036
2100 Ga0395900_0000755
2101 Ga0395898_0000018
2102 Ga0395898_0000049
2103 Ga0395901_0002064
2104 Ga0395901_0008508
2105 Ga0395901_0237235
2106 Ga0237819_03760
2107 Ga0439436_0000011
2108 Ga0439438_001501
2109 Ga0439438_002275
2110 Ga0439438_003017
2111 Ga0439438_005281
2112 Ga0439438_005369
2113 Ga0439438_006547
2114 Ga0439438_036780
2115 Ga0439438_049350
2116 Ga0439438_073359
2117 Ga0439438_124426
2118 Ga0439438_124748
2119 Ga0439447_000222
2120 Ga0439447_001689
2121 Ga0439447_002346
2122 Ga0439447_049515
2123 Ga0439466_0000766
2124 Ga0439466_0010791
2125 Ga0439466_0028437
2126 Ga0439466_0044905
2127 Ga0439466_0046469
2128 Ga0439466_0180499
2129 Ga0439465_0000862
2130 Ga0439465_0014309
2131 Ga0451793_0565898
2132 Ga0451795_0504092
2133 Ga0451800_1116172
2134 Ga0451807_2313429
2135 Ga0439441_139710
2136 Ga0439432_000366
2137 Ga0439432_000409
2138 Ga0439432_004983
2139 Ga0439432_009141
2140 Ga0439432_012621
2141 Ga0439432_022381
2142 Ga0439432_038310
2143 Ga0439432_070925
2144 Ga0439432_085518
2145 Ga0439451_033600
2146 Ga0439452_000231
2147 Ga0439452_000245
2148 Ga0439452_006230
2149 Ga0439452_015949
2150 Ga0439452_018150
2151 Ga0439452_026430
2152 Ga0439452_048802
2153 Ga0439452_106705
2154 Ga0439456_000187
2155 Ga0439456_000508
2156 Ga0439456_001536
2157 Ga0439456_011441
2158 Ga0439456_015485
2159 Ga0439462_0160311
2160 Ga0439463_002080
2161 Ga0439463_008043
2162 Ga0439463_010879
2163 Ga0450911_000158
2164 Ga0450911_000764
2165 Ga0450911_013395
2166 Ga0450912_000194
2167 Ga0450919_000888
2168 Ga0450919_007856
2169 Ga0450920_001094
2170 Ga0450921_019250
2171 Ga0450922_000039
2172 Ga0450922_001856
2173 Ga0450923_000046
2174 Ga0450892_012053
2175 Ga0450902_004154
2176 Ga0450902_028478
2177 Ga0450902_046074
2178 Ga0450902_051106
2179 Ga0450903_000959
2180 Ga0450903_004799
2181 Ga0450903_005798
2182 Ga0450904_026017
2183 Ga0450905_000094
2184 Ga0450905_000892
2185 Ga0450905_003932
2186 Ga0450906_001941
2187 Ga0450906_017346
2188 Ga0450906_030317
2189 Ga0450907_000510
2190 Ga0450907_001218
2191 Ga0450910_000234
2192 Ga0450910_000454
2193 Ga0439446_0000915
2194 Ga0439446_0082838
2195 Ga0450908_000023
2196 Ga0450908_000250
2197 Ga0450908_025554
2198 Ga0450908_035408
2199 Ga0450908_056222
2200 Ga0450909_000593
2201 Ga0439459_0000300
2202 Ga0439459_0170212
2203 Ga0439464_0116837
2204 Ga0439460_0000192
2205 Ga0439460_0000452
2206 Ga0439460_0003104
2207 Ga0450893_0012179
2208 Ga0450901_000434
2209 Ga0439440_0015227
2210 Ga0466972_0168109
2211 Ga0466975_0079261
2212 Ga0466982_0000004
2213 Ga0466982_0000035
2214 Ga0466965_0069159
2215 Ga0466965_0179458
2216 Ga0466966_0001558
2217 Ga0466966_0089705
2218 Ga0466966_0115240
2219 Ga0466961_0001256
2220 Ga0466961_0014456
2221 Ga0466961_0255863
2222 Ga0466963_0092245
2223 Ga0466971_0005242
2224 Ga0466971_0038048
2225 Ga0466971_0087007
2226 Ga0466968_0000856
2227 Ga0466970_0016610
2228 Ga0466970_0046228
2229 Ga0466970_0087570
2230 Ga0466970_0473429
2231 Ga0466957_0011109
2232 Ga0466957_0025615
2233 Ga0466957_0397249
2234 Ga0466957_0467039
2235 Ga0466960_0003213
2236 Ga0466959_0000347
2237 Ga0466958_0001295
2238 Ga0466958_0472660
2239 Ga0495617_000311
2240 Ga0495617_000414
2241 Ga0495617_000760
2242 Ga0495617_001619
2243 Ga0495617_004043
2244 Ga0495617_007673
2245 Ga0495617_009589
2246 Ga0495617_010323
2247 Ga0495617_039850
2248 Ga0495617_048422
2249 Ga0495617_071612
2250 Ga0495617_142415
2251 Ga0495627_000535
2252 Ga0495627_000700
2253 Ga0495627_001188
2254 Ga0495627_001933
2255 Ga0495627_006456
2256 Ga0495627_038932
2257 Ga0495627_045750
2258 Ga0495627_064932
2259 Ga0495627_079309
2260 Ga0495627_124489
2261 Ga0495603_0002971
2262 Ga0495603_0258235
2263 Ga0495603_0538762
2264 Ga0495590_0001094
2265 Ga0495590_0001147
2266 Ga0495590_0015363
2267 Ga0495590_0072748
2268 Ga0495590_0271253
2269 Ga0495591_000025
2270 Ga0495591_000244
2271 Ga0495591_001000
2272 Ga0495591_001158
2273 Ga0495591_001492
2274 Ga0495591_003990
2275 Ga0495591_011170
2276 Ga0495591_072768
2277 Ga0495629_0604816
2278 Ga0495638_0000038
2279 Ga0495638_0000383
2280 Ga0495638_0001218
2281 Ga0495638_0003177
2282 Ga0495638_0005538
2283 Ga0495638_0010408
2284 Ga0495638_0050766
2285 Ga0495638_0052070
2286 Ga0495638_0076752
2287 Ga0495638_0078101
2288 Ga0495638_0078633
2289 Ga0495638_0083725
2290 Ga0495638_0099325
2291 Ga0495638_0102661
2292 Ga0495653_0000549
2293 Ga0495653_0004448
2294 Ga0495653_0007642
2295 Ga0495653_0015276
2296 Ga0495653_0283428
2297 Ga0495650_0000686
2298 Ga0495650_0002476
2299 Ga0495650_0003286
2300 Ga0495650_0010087
2301 Ga0495650_0013860
2302 Ga0495650_0015184
2303 Ga0495650_0056658
2304 Ga0495650_0067227
2305 Ga0495650_0073592
2306 Ga0495650_0089122
2307 Ga0495582_0005410
2308 Ga0495605_0000095
2309 Ga0495605_0000246
2310 Ga0495605_0000311
2311 Ga0495605_0000328
2312 Ga0495605_0000673
2313 Ga0495605_0000878
2314 Ga0495605_0008900
2315 Ga0495605_0037055
2316 Ga0495605_0083911
2317 Ga0495605_0129796
2318 Ga0495605_0195466
2319 Ga0495605_0201722
2320 Ga0495605_0441933
2321 Ga0495639_0000238
2322 Ga0495639_0045140
2323 Ga0495639_0048517
2324 Ga0495584_0000695
2325 Ga0495584_0000768
2326 Ga0495584_0001738
2327 Ga0495584_0001963
2328 Ga0495584_0004252
2329 Ga0495584_0006560
2330 Ga0495584_0006745
2331 Ga0495584_0010414
2332 Ga0495584_0017308
2333 Ga0495584_0027204
2334 Ga0495584_0035369
2335 Ga0495584_0084591
2336 Ga0495585_0000080
2337 Ga0495585_0000279
2338 Ga0495585_0000772
2339 Ga0495585_0000790
2340 Ga0495585_0002554
2341 Ga0495585_0005311
2342 Ga0495585_0006753
2343 Ga0495585_0017325
2344 Ga0495585_0025198
2345 Ga0495585_0045224
2346 Ga0495585_0053486
2347 Ga0495585_0071741
2348 Ga0495585_0217565
2349 Ga0495594_0001648
2350 Ga0495594_0041606
2351 Ga0495594_0131398
2352 Ga0495596_0000273
2353 Ga0495596_0001654
2354 Ga0495596_0005230
2355 Ga0495607_0000181
2356 Ga0495607_0000347
2357 Ga0495607_0000600
2358 Ga0495607_0000776
2359 Ga0495607_0000926
2360 Ga0495607_0001128
2361 Ga0495607_0001492
2362 Ga0495607_0002014
2363 Ga0495607_0003262
2364 Ga0495607_0003337
2365 Ga0495607_0010764
2366 Ga0495607_0014147
2367 Ga0495607_0016362
2368 Ga0495607_0018201
2369 Ga0495607_0026053
2370 Ga0495607_0028340
2371 Ga0495607_0050501
2372 Ga0495607_0077775
2373 Ga0495607_0094367
2374 Ga0495607_0142741
2375 Ga0495607_0181946
2376 Ga0495583_0000015
2377 Ga0495583_0001231
2378 Ga0495583_0001852
2379 Ga0495583_0001865
2380 Ga0495583_0003070
2381 Ga0495583_0003641
2382 Ga0495583_0005013
2383 Ga0495583_0007128
2384 Ga0495583_0073032
2385 Ga0495583_0138305
2386 Ga0495606_0000214
2387 Ga0495606_0000227
2388 Ga0495606_0000340
2389 Ga0495606_0001468
2390 Ga0495606_0003165
2391 Ga0495606_0004043
2392 Ga0495606_0006528
2393 Ga0495606_0008626
2394 Ga0495606_0018121
2395 Ga0495606_0058817
2396 Ga0495606_0071855
2397 Ga0495606_0081404
2398 Ga0495606_0092554
2399 Ga0495606_0129840
2400 Ga0495606_0142984
2401 Ga0495606_0146401
2402 Ga0495606_0228196
2403 Ga0495610_0001424
2404 Ga0495610_0001476
2405 Ga0495610_0001656
2406 Ga0495610_0002687
2407 Ga0495610_0002713
2408 Ga0495610_0004601
2409 Ga0495610_0006119
2410 Ga0495610_0007982
2411 Ga0495610_0008825
2412 Ga0495610_0011088
2413 Ga0495610_0021573
2414 Ga0495610_0030016
2415 Ga0495610_0048188
2416 Ga0495610_0050791
2417 Ga0495610_0088558
2418 Ga0495610_0136008
2419 Ga0495616_0000036
2420 Ga0495616_0001441
2421 Ga0495616_0002739
2422 Ga0495616_0002792
2423 Ga0495616_0006024
2424 Ga0495616_0009922
2425 Ga0495616_0021418
2426 Ga0495616_0021751
2427 Ga0495616_0029516
2428 Ga0495616_0038295
2429 Ga0495616_0052588
2430 Ga0495616_0157608
2431 Ga0495616_0158310
2432 Ga0495616_0187041
2433 Ga0495616_0197949
2434 Ga0495620_0000042
2435 Ga0495620_0000456
2436 Ga0495620_0001598
2437 Ga0495620_0004504
2438 Ga0495620_0005261
2439 Ga0495620_0005379
2440 Ga0495620_0009865
2441 Ga0495620_0019326
2442 Ga0495620_0022826
2443 Ga0495620_0027664
2444 Ga0495620_0046424
2445 Ga0495630_0078440
2446 Ga0495630_0267724
2447 Ga0495631_0000017
2448 Ga0495631_0000722
2449 Ga0495631_0002014
2450 Ga0495631_0002456
2451 Ga0495631_0002529
2452 Ga0495631_0039447
2453 Ga0495631_0051173
2454 Ga0495631_0066137
2455 Ga0495632_0000004
2456 Ga0495632_0000573
2457 Ga0495632_0000786
2458 Ga0495632_0001250
2459 Ga0495632_0001298
2460 Ga0495632_0001313
2461 Ga0495632_0004750
2462 Ga0495632_0006386
2463 Ga0495632_0011439
2464 Ga0495632_0012740
2465 Ga0495632_0020288
2466 Ga0495632_0041126
2467 Ga0495632_0041622
2468 Ga0495632_0053753
2469 Ga0495632_0081451
2470 Ga0495632_0108921
2471 Ga0495632_0110269
2472 Ga0495632_0115967
2473 Ga0495632_0169219
2474 Ga0495637_0000020
2475 Ga0495637_0000260
2476 Ga0495637_0000848
2477 Ga0495637_0001597
2478 Ga0495637_0002194
2479 Ga0495637_0002265
2480 Ga0495637_0002757
2481 Ga0495637_0003062
2482 Ga0495637_0003107
2483 Ga0495637_0006806
2484 Ga0495637_0007488
2485 Ga0495637_0021420
2486 Ga0495637_0029337
2487 Ga0495637_0031159
2488 Ga0495637_0035236
2489 Ga0495637_0037209
2490 Ga0495637_0047707
2491 Ga0495637_0055611
2492 Ga0495637_0104353
2493 Ga0495637_0203494
2494 Ga0495643_0004420
2495 Ga0495643_0040933
2496 Ga0495643_0049272
2497 Ga0495643_0071231
2498 Ga0495643_0134806
2499 Ga0495643_0189037
2500 Ga0495643_0244198
2501 Ga0495644_0000218
2502 Ga0495644_0000952
2503 Ga0495644_0002488
2504 Ga0495644_0020499
2505 Ga0495644_0159556
2506 Ga0495644_0340575
2507 Ga0495648_0000797
2508 Ga0495648_0001064
2509 Ga0495648_0001468
2510 Ga0495648_0002580
2511 Ga0495648_0003045
2512 Ga0495648_0005330
2513 Ga0495648_0006491
2514 Ga0495648_0013003
2515 Ga0495648_0015550
2516 Ga0495648_0025784
2517 Ga0495648_0029576
2518 Ga0495648_0032117
2519 Ga0495648_0041353
2520 Ga0495648_0060225
2521 Ga0495648_0083454
2522 Ga0495648_0085581
2523 Ga0495648_0167350
2524 Ga0495648_0419171
2525 Ga0495666_0028302
2526 Ga0495666_0140201
2527 Ga0495642_0000088
2528 Ga0495642_0000463
2529 Ga0495652_0360294
2530 Ga0495654_0000891
2531 Ga0495654_0000985
2532 Ga0495654_0000992
2533 Ga0495654_0001624
2534 Ga0495654_0001635
2535 Ga0495654_0002244
2536 Ga0495654_0003637
2537 Ga0495654_0008032
2538 Ga0495654_0009609
2539 Ga0495654_0017101
2540 Ga0495654_0018737
2541 Ga0495654_0020237
2542 Ga0495654_0029476
2543 Ga0495654_0046940
2544 Ga0495654_0064846
2545 Ga0495654_0073811
2546 Ga0495654_0120257
2547 Ga0495654_0253819
2548 Ga0495654_0274252
2549 Ga0495654_0307059
2550 Ga0495654_0366970
2551 Ga0495587_0005901
2552 Ga0495587_0009517
2553 Ga0495609_0000053
2554 Ga0495609_0000102
2555 Ga0495609_0000685
2556 Ga0495609_0001189
2557 Ga0495609_0002004
2558 Ga0495609_0003388
2559 Ga0495609_0010186
2560 Ga0495609_0011152
2561 Ga0495609_0089343
2562 Ga0495597_0000186
2563 Ga0495597_0002630
2564 Ga0495597_0005301
2565 Ga0495597_0005351
2566 Ga0495597_0005468
2567 Ga0495597_0005589
2568 Ga0495597_0018249
2569 Ga0495597_0040530
2570 Ga0495597_0046954
2571 Ga0495597_0083251
2572 Ga0495597_0177324
2573 Ga0495597_0195255
2574 Ga0495597_0223297
2575 Ga0495597_0284426
2576 Ga0495645_0043198
2577 Ga0495622_0000584
2578 Ga0495622_0000824
2579 Ga0495622_0011452
2580 Ga0495622_0056236
2581 Ga0495622_0143545
2582 Ga0495633_0000366
2583 Ga0495633_0005493
2584 Ga0495633_0087354
2585 Ga0495668_0000866
2586 Ga0495668_0007559
2587 Ga0495668_0016456
2588 Ga0495668_0027362
2589 Ga0495668_0033371
2590 Ga0495668_0257906
2591 Ga0495668_0296928
2592 Ga0495634_0001452
2593 Ga0495634_0111353
2594 Ga0495611_0000001
2595 Ga0495611_0000022
2596 Ga0495611_0000193
2597 Ga0495611_0000386
2598 Ga0495611_0051797
2599 Ga0495611_0068705
2600 Ga0495611_0069065
2601 Ga0495611_0083237
2602 Ga0495625_0000022
2603 Ga0495625_0000086
2604 Ga0495625_0003090
2605 Ga0495625_0004188
2606 Ga0495625_0004759
2607 Ga0495625_0005594
2608 Ga0495625_0012798
2609 Ga0495625_0018709
2610 Ga0495625_0079061
2611 Ga0495625_0097166
2612 Ga0495625_0162671
2613 Ga0495625_0171083
2614 Ga0495625_0185348
2615 Ga0495625_0190369
2616 Ga0495625_0197838
2617 Ga0495625_0757330
2618 Ga0495625_0802119
2619 Ga0495635_0001499
2620 Ga0495635_0011073
2621 Ga0495659_0000084
2622 Ga0495659_0007648
2623 Ga0495659_0090659
2624 Ga0495661_0000048
2625 Ga0495661_0000131
2626 Ga0495661_0000171
2627 Ga0495661_0002376
2628 Ga0495661_0003777
2629 Ga0495661_0005763
2630 Ga0495661_0009381
2631 Ga0495661_0010290
2632 Ga0495661_0100205
2633 Ga0495661_0183899
2634 Ga0495661_0189569
2635 Ga0495661_0189689
2636 Ga0495661_0232365
2637 Ga0495661_0269382
2638 Ga0495588_0027114
2639 Ga0495588_0389683
2640 Ga0495599_0423570
2641 Ga0495623_0394048
2642 Ga0495646_0147187
2643 Ga0495669_0120057
2644 Ga0495613_0079347
2645 Ga0495613_0184936
2646 Ga0495624_0001848
2647 Ga0495670_0000302
2648 Ga0495670_0000993
2649 Ga0495670_0001543
2650 Ga0495670_0001591
2651 Ga0495670_0001868
2652 Ga0495670_0004320
2653 Ga0495670_0005561
2654 Ga0495670_0015111
2655 Ga0495670_0107645
2656 Ga0495670_0120138
2657 Ga0495670_0145087
2658 Ga0495670_0406012
2659 Ga0495671_0000157
2660 Ga0495671_0001635
2661 Ga0495671_0002821
2662 Ga0495671_0003219
2663 Ga0495671_0010307
2664 Ga0495671_0016468
2665 Ga0495671_0024838
2666 Ga0495671_0026153
2667 Ga0495671_0028399
2668 Ga0495671_0099200
2669 Ga0495671_0115513
2670 Ga0495671_0162731
2671 Ga0495671_0210795
2672 Ga0495671_0250546
2673 Ga0495649_0000782
2674 Ga0495649_0003461
2675 Ga0495649_0004128
2676 Ga0495649_0006803
2677 Ga0495649_0006929
2678 Ga0495649_0015660
2679 Ga0495649_0015913
2680 Ga0495649_0016636
2681 Ga0495649_0060081
2682 Ga0495649_0092925
2683 Ga0495649_0093328
2684 Ga0495649_0129881
2685 Ga0495649_0131929
2686 Ga0495649_0160849
2687 Ga0495649_0168677
2688 Ga0495649_0174019
2689 Ga0495589_0000053
2690 Ga0495589_0000445
2691 Ga0495589_0000647
2692 Ga0495589_0000866
2693 Ga0495589_0001416
2694 Ga0495589_0007951
2695 Ga0495589_0020471
2696 Ga0495589_0028217
2697 Ga0495589_0068621
2698 Ga0495589_0197792
2699 Ga0495600_0012548
2700 Ga0495600_0259323
2701 Ga0495660_0000094
2702 Ga0495660_0000233
2703 Ga0495660_0000608
2704 Ga0495660_0008534
2705 Ga0495660_0009505
2706 Ga0495660_0012856
2707 Ga0495660_0013774
2708 Ga0495660_0014381
2709 Ga0495660_0025264
2710 Ga0495660_0034475
2711 Ga0495660_0050274
2712 Ga0495660_0067768
2713 Ga0495660_0137850
2714 Ga0495660_0154890
2715 Ga0495660_0202288
2716 Ga0495660_0257421
2717 Ga0495660_0334971
2718 Ga0495581_0017951
2719 Ga0495581_0341247
2720 Ga0495604_0002392
2721 Ga0495604_0004861
2722 Ga0495604_0145910
2723 Ga0495604_0200070
2724 Ga0495636_0014587
2725 Ga0495674_0002066
2726 Ga0495672_0001137
2727 Ga0495672_0001472
2728 Ga0495672_0001678
2729 Ga0495672_0002315
2730 Ga0495672_0002439
2731 Ga0495672_0007157
2732 Ga0495672_0009451
2733 Ga0495672_0017082
2734 Ga0495672_0021482
2735 Ga0495672_0039195
2736 Ga0495672_0048591
2737 Ga0495672_0081659
2738 Ga0495672_0081853
2739 Ga0495672_0117948
2740 Ga0495672_0128188
2741 Ga0495672_0139179
2742 Ga0495672_0146246
2743 Ga0495672_0254428
2744 Ga0495676_0000022
2745 Ga0495676_0092879
2746 Ga0495680_0001940
2747 Ga0495680_0013153
2748 Ga0495680_0054661
2749 Ga0495680_0167638
2750 Ga0495680_0188060
2751 Ga0495683_0000030
2752 Ga0495683_0000520
2753 Ga0495683_0000927
2754 Ga0495683_0003818
2755 Ga0495683_0024998
2756 Ga0495683_0086173
2757 Ga0495683_0105027
2758 Ga0495683_0147203
2759 Ga0495683_0172472
2760 Ga0495683_0224200
2761 Ga0495687_002395
2762 Ga0495687_002578
2763 Ga0495687_004360
2764 Ga0495675_0067346
2765 Ga0495677_0024167
2766 Ga0495679_000004
2767 Ga0495679_000218
2768 Ga0495679_001364
2769 Ga0495679_015125
2770 Ga0495679_018166
2771 Ga0495679_034564
2772 Ga0495679_090604
2773 Ga0495685_002740
2774 Ga0495685_190825
2775 Ga0495673_0000004
2776 Ga0495673_0000048
2777 Ga0495673_0000544
2778 Ga0495673_0001080
2779 Ga0495673_0001326
2780 Ga0495673_0003184
2781 Ga0495673_0003448
2782 Ga0495673_0004063
2783 Ga0495673_0004141
2784 Ga0495673_0005947
2785 Ga0495673_0007317
2786 Ga0495673_0009064
2787 Ga0495673_0010372
2788 Ga0495673_0019014
2789 Ga0495673_0029698
2790 Ga0495673_0031615
2791 Ga0495673_0034968
2792 Ga0495673_0043010
2793 Ga0495673_0060366
2794 Ga0495673_0076239
2795 Ga0495673_0165323
2796 Ga0495681_0000351
2797 Ga0495681_0000411
2798 Ga0495681_0000534
2799 Ga0495681_0001655
2800 Ga0495681_0003659
2801 Ga0495681_0004241
2802 Ga0495681_0009965
2803 Ga0495681_0013066
2804 Ga0495681_0018019
2805 Ga0495681_0028010
2806 Ga0495681_0033813
2807 Ga0495681_0041182
2808 Ga0495681_0045233
2809 Ga0495681_0073048
2810 Ga0495681_0086959
2811 Ga0495681_0101900
2812 Ga0495681_0144794
2813 Ga0495686_0000017
2814 Ga0495686_0000295
2815 Ga0495686_0003766
2816 Ga0495686_0007911
2817 Ga0495686_0016228
2818 Ga0495686_0036297
2819 Ga0495686_0047765
2820 Ga0495686_0063540
2821 Ga0495686_0189564
2822 Ga0495686_0215243
2823 Ga0495686_0306556
2824 Ga0495686_0412862
2825 Ga0495593_0010377
2826 Ga0495593_0031330
2827 Ga0495593_0114748
2828 Ga0495602_0213446
2829 Ga0495602_0274720
2830 Ga0495626_0000039
2831 Ga0495626_0000391
2832 Ga0495626_0000562
2833 Ga0495626_0000876
2834 Ga0495626_0001660
2835 Ga0495626_0001894
2836 Ga0495626_0002239
2837 Ga0495626_0003053
2838 Ga0495626_0069159
2839 Ga0495626_0193035
2840 Ga0496100_0003016
2841 Ga0496100_0381983
2842 Ga0496101_0000778
2843 Ga0496101_0017392
2844 Ga0496101_0246912
2845 Ga0496102_0001161
2846 Ga0496102_0722108
2847 Ga0496103_0004719
2848 Ga0496104_0825531
2849 Ga0496104_1101903
2850 Ga0496105_0001610
2851 Ga0496106_0000756
2852 Ga0496106_0037602
2853 Ga0496106_0546883
2854 Ga0496107_0010840
2855 Ga0496107_0539039
2856 Ga0496108_0198830
2857 Ga0496110_0346670
2858 Ga0496110_0450852
2859 Ga0496110_1266590
2860 Ga0496111_0408059
2861 Ga0496115_0009762
2862 Ga0496116_0000376
2863 Ga0496116_0001403
2864 Ga0496116_0003933
2865 Ga0496116_0004841
2866 Ga0496116_0042188
2867 Ga0496116_0095797
2868 Ga0496116_0259356
2869 Ga0496116_0311251
2870 Ga0496117_0001205
2871 Ga0496117_0004904
2872 Ga0496117_0007835
2873 Ga0496117_0023385
2874 Ga0496117_0027620
2875 Ga0496117_0033404
2876 Ga0496117_0101582
2877 Ga0496117_0104615
2878 Ga0496117_0106088
2879 Ga0496117_0144723
2880 Ga0496117_0202189
2881 Ga0496117_0205345
2882 Ga0496118_0000805
2883 Ga0496118_0002349
2884 Ga0496118_0003474
2885 Ga0496118_0006876
2886 Ga0496118_0007533
2887 Ga0496118_0022512
2888 Ga0496118_0041443
2889 Ga0496118_0085648
2890 Ga0496118_0130432
2891 Ga0496118_0132719
2892 Ga0496118_0149310
2893 Ga0496118_0184328
2894 Ga0496118_0295986
2895 Ga0496119_0000082
2896 Ga0496119_0002193
2897 Ga0496119_0004168
2898 Ga0496119_0136834
2899 Ga0496119_0151878
2900 Ga0496120_0000343
2901 Ga0496120_0000873
2902 Ga0496120_0003526
2903 Ga0496120_0108927
2904 Ga0496120_0138384
2905 Ga0496121_0000372
2906 Ga0496121_0001119
2907 Ga0496121_0001386
2908 Ga0496121_0003275
2909 Ga0496121_0005323
2910 Ga0496121_0008472
2911 Ga0496121_0022730
2912 Ga0496121_0032161
2913 Ga0496121_0045083
2914 Ga0496121_0051123
2915 Ga0496121_0160733
2916 Ga0496121_0171138
2917 Ga0496121_0539246
2918 Ga0496122_0000165
2919 Ga0496122_0003673
2920 Ga0496122_0009835
2921 Ga0496122_0015506
2922 Ga0496122_0057237
2923 Ga0496122_0070589
2924 Ga0496122_0117649
2925 Ga0496122_0152606
2926 Ga0496122_0168433
2927 Ga0496122_0200033
2928 Ga0496122_0249687
2929 Ga0496122_0530269
2930 Ga0496123_0000471
2931 Ga0496123_0002626
2932 Ga0496123_0007256
2933 Ga0496123_0042340
2934 Ga0496123_0043490
2935 Ga0496123_0046993
2936 Ga0496123_0105333
2937 Ga0496123_0106824
2938 Ga0496123_0127995
2939 Ga0496123_0138143
2940 Ga0496123_0140877
2941 Ga0496123_0221954
2942 Ga0496123_0233463
2943 Ga0496124_0000120
2944 Ga0496124_0000289
2945 Ga0496124_0002123
2946 Ga0496124_0002586
2947 Ga0496124_0004161
2948 Ga0496124_0004499
2949 Ga0496124_0025597
2950 Ga0496124_0075776
2951 Ga0496124_0086590
2952 Ga0496124_0141700
2953 Ga0496124_0156103
2954 Ga0496124_0343411
2955 Ga0496124_0490661
2956 Ga0496124_0615966
2957 Ga0496125_0000799
2958 Ga0496125_0020266
2959 Ga0496125_0030336
2960 Ga0496125_0052151
2961 Ga0496125_0072625
2962 Ga0496125_0089198
2963 Ga0496125_0094313
2964 Ga0496125_0115288
2965 Ga0496125_0242708
2966 Ga0496125_0255021
2967 Ga0496126_0003436
2968 Ga0496126_0016008
2969 Ga0496126_0068686
2970 Ga0496126_0076337
2971 Ga0496126_0090247
2972 Ga0496126_0170609
2973 Ga0496126_0226319
2974 Ga0496126_0231886
2975 Ga0495678_000017
2976 Ga0495678_000276
2977 Ga0495678_000693
2978 Ga0495678_001927
2979 Ga0495678_002044
2980 Ga0495678_002423
2981 Ga0495678_017852
2982 Ga0495678_029628
2983 Ga0495678_039248
2984 Ga0495678_058917
2985 Ga0495678_172420
2986 Ga0495678_180824
2987 Ga0495678_221822
2988 Ga0495682_0000182
2989 Ga0495682_0000659
2990 Ga0495682_0003288
2991 Ga0495682_0013672
2992 Ga0495682_0053109
2993 Ga0495682_0060253
2994 Ga0495682_0075283
2995 Ga0501031_0020724
2996 Ga0501032_0004573
2997 Ga0501032_0065381
2998 Ga0501032_0228544
2999 Ga0501032_0582283
3000 Ga0501033_0000926
3001 Ga0501033_0002943
3002 Ga0501033_0006162
3003 Ga0501033_0311126
3004 Ga0501034_0120731
3005 Ga0501034_0728379
3006 Ga0501037_0040652
3007 Ga0501037_0210961
3008 Ga0501037_0626147
3009 Ga0501038_0034555
3010 Ga0501038_0046051
3011 Ga0501038_0444077
3012 Ga0501038_0774396
3013 Ga0501039_0014265
3014 Ga0501039_0083397
3015 Ga0501043_0034664
3016 Ga0501043_0117913
3017 Ga0501043_0216140
3018 Ga0501043_0459604
3019 Ga0501046_0016380
3020 Ga0501046_0115923
3021 Ga0501046_0323977
3022 Ga0501047_0016071
3023 Ga0501047_0034249
3024 Ga0501047_0179527
3025 Ga0501047_0454179
3026 Ga0501047_0484959
3027 Ga0501048_0113790
3028 Ga0501048_0285161
3029 Ga0501048_0946905
3030 Ga0501070_1341477
3031 Ga0501073_0794223
3032 Ga0501241_002564
3033 Ga0501035_0053659
3034 Ga0501035_0095809
3035 Ga0501035_0172051
3036 Ga0501035_0206754
3037 Ga0501035_0216841
3038 Ga0501044_0158151
3039 Ga0501044_0231386
3040 Ga0501044_0235167
3041 Ga0501044_0340032
3042 Ga0501044_0585418
3043 Ga0501044_0602716
3044 Ga0501045_0253138
3045 nmdc:mga03683_319579_c1
3046 nmdc:mga00v17_112287_c1
3047 nmdc:mga00v17_182295_c1
3048 nmdc:mga00v17_716846_c1
3049 nmdc:mga08x19_146385_c1
3050 nmdc:mga08x19_164243_c1
3051 nmdc:mga0sz30_55912_c1
3052 Ga0500635_0000026
3053 Ga0500643_000020
3054 Ga0500646_0025092
3055 Ga0500651_0762605
3056 Ga0500555_000196
3057 Ga0500573_0171730
3058 Ga0500633_0005982
3059 Ga0500645_000391
3060 Ga0466962_0040925
3061 Ga0466962_0046742
3062 Ga0466962_0275202
3063 2510284318
3064 2510292993
3065 2510312499
3066 2595449632
3067 2599327424
3068 2599906830
3069 2643862920
3070 2643894864
3071 2644477023
3072 2687583651
3073 2721026443
3074 2735833556
3075 2739229686
3076 2774131498
3077 2809031348
3078 2819564024
3079 2842917577
3080 2842919944
3081 2884341554
3082 2904464660
3083 2917836382
3084 2919088255
3085 2919127485
3086 2919406158
3087 2941472997
3088 2953995239
3089 2974301738
3090 2984500693
3091 2984507216
3092 8016730686

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

23

104

0.94

PF13279

4HBT_2

Thioesterase-like superfamily

15

138

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egi-assembly1.cif.gz_G crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9182 9 117
6fdg-assembly1.cif.gz_D novel crystal structure of dhna-coa thioesterase from staphylococcus aureus 0.9181 6 122
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9115 9 134
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9069 8 132
2ess-assembly1.cif.gz_A-2 crystal structure of an acyl-acp thioesterase (np_810988.1) from bacteroides thetaiotaomicron vpi-5482 at 1.90 a resolution 0.9066 8 124
ID Description Score Start End Superfamily
af_Q9W440_48_153_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9187 16 116 3.10.129.10
2egiG00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9182 9 117 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9115 9 134 3.10.129.10
af_A0A1D6ESQ3_80_359_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9029 7 134 3.10.129.10
af_A4I2C2_85_240_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9022 6 119 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A254RX03-F1-model_v4 Thioesterase 0.9928 7 138 GO:0047617
AF-A0A558HJL7-F1-model_v4 Acyl-CoA thioesterase 0.989 7 137 GO:0047617
AF-A0A509E3V7-F1-model_v4 deleted 0.9885 6 138
AF-A0A4R1CCB4-F1-model_v4 deleted 0.9875 8 138
AF-A0A011PH42-F1-model_v4 Acyl-CoA thioesterase YbgC 0.987 7 138 GO:0047617

Map