F494697

General Info

Members Datasets Scaffolds Average Seq Length
1547 507 3094 251

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0002201|Ga0495610_0002201_4570_5493
Length 307
Sequence MIERTSERADRQASRNARRVCITRDTRDASRAANVTHPNELPLSPLSALQFYATAPYPCSYLDGRIARSQVATPSHLINSDVYTDLVKAGFRRSGVFTYRPYCDGCRACVPVRVPVERFEPNRTQRRVWKKHGEMIATVAPLHYDEEHYALYMRYQSARHAGGGMDRDSRDQYEQFLLQSRINSRLVEFREPLPDRPDSPGLLRMISMIDILGDGLSSVYTFFEPGLPHTSFGTYNIYWQIEQARSLKLPYVYLGYWIRESPKMAYKANFRPLEGLIDGTWRVLDPAGVDLAPTGTGMQGRRGPLRP

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
106 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
176 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
202 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
203 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
305 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
306 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
307 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
334 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
346 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
347 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
348 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
355 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
356 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
359 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
360 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
361 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
362 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
391 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
392 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
393 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
394 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
395 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
396 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
397 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
398 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
399 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
400 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
401 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
402 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
403 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
404 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
405 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
406 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
407 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
408 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
409 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
410 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
411 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
412 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
413 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
414 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
415 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
416 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
417 2643221556 Massilia sp. Root1485 Isolate Unclassified
418 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
419 2643221638 Duganella sp. Root336D2 Isolate Unclassified
420 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
421 2643221645 Massilia sp. Root351 Isolate Unclassified
422 2643221664 Massilia sp. Root418 Isolate Unclassified
423 2643221684 Massilia sp. Root133 Isolate Unclassified
424 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
425 2738541280 Massilia sp. GV090 Isolate Unclassified
426 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
427 2738541297 Duganella sp. GV083 Isolate Unclassified
428 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
429 2738541300 Massilia sp. GV016 Isolate Unclassified
430 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
431 2738541357 Duganella sp. GV053 Isolate Unclassified
432 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
433 2738543003 Duganella sp. GV066 Isolate Unclassified
434 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
435 2738543018 Massilia sp. GV045 Isolate Unclassified
436 2738543026 Duganella sp. GV089 Isolate Unclassified
437 2738543029 Duganella sp. GV039 Isolate Unclassified
438 2738543030 Massilia sp. GV097 Isolate Unclassified
439 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
440 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
441 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
442 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
443 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
444 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
445 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
446 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
447 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
448 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
449 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
450 2818991436 Collimonas arenae 515 Isolate Unclassified
451 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
452 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
453 2818991450 Burkholderia sp. 604 Isolate Unclassified
454 2821131069 Duganella sp. 1224 Isolate Unclassified
455 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
456 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
457 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
458 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
459 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
460 2842711865 Duganella sp. R-73148 Isolate Unclassified
461 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
462 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
463 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
464 2857553236 Duganella sp. R-74557 Isolate Unclassified
465 2857558681 Duganella sp. R-74565 Isolate Unclassified
466 2857564685 Duganella sp. R-74599 Isolate Unclassified
467 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
468 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
469 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
470 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
471 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
472 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
473 2885266251 Ralstonia sp. SET104 Isolate Nodule
474 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
475 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
476 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
477 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
478 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
479 2904424332 Duganella sp. 1411 Isolate Rhizosphere
480 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
481 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
482 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
483 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
484 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
485 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
486 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
487 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
488 2919476304 Duganella sp. 3397 Isolate Unclassified
489 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
490 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
491 2928058823 Ralstonia sp. 1138 Isolate Unclassified
492 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
493 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
494 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
495 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
496 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
497 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
498 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
499 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
500 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
501 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
502 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
503 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
504 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
505 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
506 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
507 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.91
Metatranscriptomes 4.52
Isolates 7.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.67
Nodule 2.07
Rhizoplane 3.75
Rhizosphere 70.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0002201 3300046512 Bacteria 16506
2 JGI24741J21665_1000156 3300001915 Bacteria 19419
3 JGI24740J21852_10002175 3300001979 Bacteria 8963
4 JGI24740J21852_10003164 3300001979 Bacteria 7264
5 JGI24740J21852_10019148 3300001979 Bacteria 2416
6 JGI24739J22299_10028602 3300001989 Bacteria 1943
7 JGI24735J21928_10003035 3300002067 Bacteria 5760
8 JGI25155J39150_1000774 3300002704 Bacteria 5234
9 JGI25156J39149_1000426 3300002705 Bacteria 26196
10 JGI25156J39149_1001100 3300002705 Bacteria 12340
11 JGI25156J39149_1001378 3300002705 Bacteria 10399
12 JGI25156J39149_1002013 3300002705 Bacteria 7769
13 JGI25156J39149_1003563 3300002705 Bacteria 5048
14 JGI25162J39368_1000664 3300002737 Bacteria 24298
15 JGI25154J39366_1000581 3300002738 Bacteria 17734
16 JGI25154J39366_1001073 3300002738 Bacteria 10769
17 JGI25154J39366_1001965 3300002738 Bacteria 6060
18 JGI25154J39366_1002270 3300002738 Bacteria 5209
19 JGI25157J39369_1000450 3300002741 Bacteria 26192
20 JGI25152J39213_1000082 3300002773 Bacteria 65365
21 JGI25150J39212_1002994 3300002774 Bacteria 4068
22 JGI25159J45721_1002028 3300002987 Bacteria 8010
23 JGI25159J45721_1002859 3300002987 Bacteria 6336
24 JGI25159J45721_1006376 3300002987 Bacteria 3540
25 JGI25151J46595_10002737 3300003187 Bacteria 10278
26 JGI25151J46595_10064361 3300003187 Bacteria 1148
27 JGI25165J46597_1000776 3300003214 Bacteria 24298
28 JGI25165J46597_1001470 3300003214 Bacteria 12267
29 JGI25153J46596_10007670 3300003215 Bacteria 5262
30 rootH2_10081186 3300003320 Bacteria 9917
31 rootH1_10047789 3300003323 Bacteria 1569
32 JGI26128J50194_1000689 3300003347 Bacteria 1965
33 JGI25160J50197_1003402 3300003354 Bacteria 7125
34 JGI25161J50226_1000609 3300003374 Bacteria 14747
35 JGI25161J50226_1001244 3300003374 Bacteria 8233
36 Ga0007417J51691_1060715 3300003544 Bacteria 1109
37 Ga0007410J51695_1074447 3300003574 Bacteria 2027
38 Ga0007409J51694_1026520 3300003575 Bacteria 921
39 Ga0007409J51694_1057268 3300003575 Bacteria 1744
40 Ga0007416J51690_1033224 3300003577 Bacteria 2533
41 Ga0007416J51690_1043106 3300003577 Bacteria 1568
42 Ga0032354_1065010 3300003693 Bacteria 2077
43 Ga0055538_1000030 3300003751 Bacteria 200831
44 Ga0055538_1000305 3300003751 Bacteria 24298
45 Ga0055539_1000040 3300003752 Bacteria 200831
46 Ga0055539_1000062 3300003752 Bacteria 141171
47 Ga0055539_1000324 3300003752 Bacteria 24298
48 Ga0055533_1000050 3300003756 Bacteria 200831
49 Ga0055533_1000218 3300003756 Bacteria 41729
50 Ga0055533_1000305 3300003756 Bacteria 24298
51 Ga0055533_1000522 3300003756 Bacteria 13873
52 Ga0055533_1001757 3300003756 Bacteria 5509
53 Ga0055532_1000001 3300003758 Bacteria 1119836
54 Ga0055532_1000019 3300003758 Bacteria 286358
55 Ga0055532_1000101 3300003758 Bacteria 92881
56 Ga0055525_1000060 3300003759 Bacteria 200831
57 Ga0055525_1000133 3300003759 Bacteria 109627
58 Ga0055525_1000439 3300003759 Bacteria 24298
59 Ga0055525_1000592 3300003759 Bacteria 15701
60 Ga0055525_1002445 3300003759 Bacteria 1900
61 Ga0055527_1000002 3300003760 Bacteria 830488
62 Ga0055527_1000558 3300003760 Bacteria 12374
63 Ga0055535_1000001 3300003761 Bacteria 1119836
64 Ga0055535_1000014 3300003761 Bacteria 286358
65 Ga0055535_1007396 3300003761 Bacteria 2103
66 Ga0055542_1000001 3300003762 Bacteria 1119836
67 Ga0055529_1000026 3300003763 Bacteria 293254
68 Ga0055529_1000086 3300003763 Bacteria 140681
69 Ga0055529_1000154 3300003763 Bacteria 94292
70 Ga0055526_1000237 3300003771 Bacteria 46547
71 Ga0055526_1000523 3300003771 Bacteria 30490
72 Ga0055526_1000525 3300003771 Bacteria 30396
73 Ga0055526_1002040 3300003771 Bacteria 13903
74 Ga0055526_1003137 3300003771 Bacteria 10705
75 Ga0055526_1007272 3300003771 Bacteria 5799
76 Ga0055526_1008504 3300003771 Bacteria 5111
77 Ga0055526_1012536 3300003771 Bacteria 3686
78 Ga0055537_1000111 3300003773 Bacteria 61884
79 Ga0055537_1004903 3300003773 Bacteria 3703
80 Ga0055524_1000015 3300003775 Bacteria 246493
81 Ga0055524_1000970 3300003775 Bacteria 18003
82 Ga0055524_1001551 3300003775 Bacteria 12948
83 Ga0055524_1001982 3300003775 Bacteria 10975
84 Ga0055524_1002372 3300003775 Bacteria 9777
85 Ga0055536_1000034 3300003781 Bacteria 148178
86 Ga0055534_1000509 3300003784 Bacteria 21144
87 Ga0055534_1002215 3300003784 Bacteria 6898
88 Ga0055534_1005959 3300003784 Bacteria 3157
89 Ga0055528_1010241 3300003790 Bacteria 3834
90 Ga0055528_1011563 3300003790 Bacteria 3493
91 Ga0055531_10003700 3300003794 Bacteria 9623
92 Ga0055541_1000027 3300003841 Bacteria 200831
93 Ga0055541_1000213 3300003841 Bacteria 24298
94 Ga0055541_1001407 3300003841 Bacteria 5220
95 Ga0055543_1000588 3300004625 Bacteria 20014
96 Ga0055543_1001327 3300004625 Bacteria 10120
97 Ga0065165_1000286 3300005262 Bacteria 85993
98 Ga0065165_1000465 3300005262 Bacteria 63558
99 Ga0065165_1001962 3300005262 Bacteria 19498
100 Ga0065165_1044858 3300005262 Bacteria 1291
101 Ga0070658_10000863 3300005327 Bacteria 25893
102 Ga0070658_10066647 3300005327 Bacteria 2941
103 Ga0070658_10152102 3300005327 Bacteria 1938
104 Ga0070660_100000895 3300005339 Bacteria 19956
105 Ga0070660_100006100 3300005339 Bacteria 8333
106 Ga0070660_100019090 3300005339 Bacteria 5018
107 Ga0070661_100000088 3300005344 Bacteria 73636
108 Ga0070661_100023005 3300005344 Bacteria 4464
109 Ga0070659_100005584 3300005366 Bacteria 9037
110 Ga0070659_100038991 3300005366 Bacteria 3707
111 Ga0070659_100069361 3300005366 Bacteria 2798
112 Ga0070667_100168707 3300005367 Bacteria 1931
113 Ga0070667_100300751 3300005367 Bacteria 1445
114 Ga0070663_100000010 3300005455 Bacteria 158193
115 Ga0070678_100199329 3300005456 Bacteria 1651
116 Ga0070662_100093538 3300005457 Bacteria 2262
117 Ga0068853_100165324 3300005539 Bacteria 1999
118 Ga0068855_100000137 3300005563 Bacteria 93126
119 Ga0068855_100003932 3300005563 Bacteria 18138
120 Ga0068855_100067541 3300005563 Bacteria 4164
121 Ga0068855_100207320 3300005563 Bacteria 2205
122 Ga0068855_100263049 3300005563 Bacteria 1921
123 Ga0068855_100479311 3300005563 Bacteria 1354
124 Ga0068855_100698765 3300005563 Bacteria 1085
125 Ga0070664_100000005 3300005564 Bacteria 222746
126 Ga0068857_100005050 3300005577 Bacteria 11209
127 Ga0068854_100000104 3300005578 Bacteria 58909
128 Ga0068856_100000054 3300005614 Bacteria 104246
129 Ga0068856_100602431 3300005614 Bacteria 1120
130 Ga0068856_100688596 3300005614 Bacteria 1043
131 Ga0068852_100144017 3300005616 Bacteria 2208
132 Ga0068851_10027919 3300005834 Bacteria 2785
133 Ga0068851_10219316 3300005834 Bacteria 1068
134 Ga0068863_100298389 3300005841 Bacteria 1563
135 Ga0068858_100043574 3300005842 Bacteria 4161
136 Ga0068860_100915436 3300005843 Bacteria 893
137 Ga0070716_100147440 3300006173 Bacteria 1509
138 Ga0075362_10017642 3300006177 Bacteria 2944
139 Ga0075366_10001663 3300006195 Bacteria 11165
140 Ga0075366_10127923 3300006195 Bacteria 1532
141 Ga0079104_1000333 3300006946 Bacteria 57718
142 Ga0079104_1010533 3300006946 Bacteria 3041
143 Ga0079104_1015769 3300006946 Bacteria 2229
144 Ga0099826_10000003 3300006948 Bacteria 1067817
145 Ga0099826_10000004 3300006948 Bacteria 802669
146 Ga0105251_10000043 3300009011 Bacteria 113848
147 Ga0105251_10001385 3300009011 Bacteria 20970
148 Ga0105244_10001962 3300009036 Bacteria 15940
149 Ga0105244_10003735 3300009036 Bacteria 10745
150 Ga0105244_10048799 3300009036 Bacteria 2166
151 Ga0105240_10000569 3300009093 Bacteria 68389
152 Ga0105240_10005998 3300009093 Bacteria 17965
153 Ga0105240_10006748 3300009093 Bacteria 16805
154 Ga0105240_10027922 3300009093 Bacteria 7382
155 Ga0105240_10038201 3300009093 Bacteria 6160
156 Ga0105240_10092814 3300009093 Bacteria 3685
157 Ga0105240_10278890 3300009093 Bacteria 1921
158 Ga0105243_10062725 3300009148 Bacteria 2976
159 Ga0105241_10113920 3300009174 Bacteria 2168
160 Ga0105248_10011496 3300009177 Bacteria 9755
161 Ga0105237_10085456 3300009545 Bacteria 3145
162 Ga0105237_10422321 3300009545 Bacteria 1339
163 Ga0105237_10657194 3300009545 Bacteria 1055
164 Ga0105238_10000547 3300009551 Bacteria 39292
165 Ga0105238_10023411 3300009551 Bacteria 6295
166 Ga0105239_10042299 3300010375 Bacteria 4993
167 Ga0105246_10175762 3300011119 Bacteria 1644
168 Ga0157373_10002542 3300013100 Bacteria 13898
169 Ga0157373_10029907 3300013100 Bacteria 3922
170 Ga0157371_10000001 3300013102 Bacteria 1162285
171 Ga0157371_10000103 3300013102 Bacteria 128611
172 Ga0157371_10042772 3300013102 Bacteria 3228
173 Ga0157370_10000578 3300013104 Bacteria 45683
174 Ga0157370_10000966 3300013104 Bacteria 36379
175 Ga0157370_10005241 3300013104 Bacteria 14582
176 Ga0157369_10000113 3300013105 Bacteria 113723
177 Ga0157369_10000205 3300013105 Bacteria 81963
178 Ga0157369_10003450 3300013105 Bacteria 18742
179 Ga0157369_10003969 3300013105 Bacteria 17540
180 Ga0157369_10995614 3300013105 Bacteria 858
181 Ga0157374_10000044 3300013296 Bacteria 144848
182 Ga0157374_10414900 3300013296 Bacteria 1344
183 Ga0157378_10140112 3300013297 Bacteria 2245
184 Ga0163162_10425109 3300013306 Bacteria 1461
185 Ga0157372_10000461 3300013307 Bacteria 44748
186 Ga0157372_10001872 3300013307 Bacteria 22853
187 Ga0163163_10189086 3300014325 Bacteria 2107
188 Ga0182008_10001692 3300014497 Bacteria 14492
189 Ga0182008_10060980 3300014497 Bacteria 1859
190 Ga0182008_10090292 3300014497 Bacteria 1510
191 Ga0182006_1000014 3300015261 Bacteria 340159
192 Ga0182006_1000369 3300015261 Bacteria 37352
193 Ga0182006_1000468 3300015261 Bacteria 31596
194 Ga0182006_1001075 3300015261 Bacteria 17538
195 Ga0182006_1005546 3300015261 Bacteria 5995
196 Ga0182006_1036364 3300015261 Bacteria 1958
197 Ga0182006_1127465 3300015261 Bacteria 878
198 Ga0182007_10000096 3300015262 Bacteria 62363
199 Ga0182007_10000453 3300015262 Bacteria 24829
200 Ga0182007_10013928 3300015262 Bacteria 3048
201 Ga0182007_10017680 3300015262 Bacteria 2598
202 Ga0182005_1000014 3300015265 Bacteria 389763
203 Ga0182005_1000018 3300015265 Bacteria 324307
204 Ga0182005_1000500 3300015265 Bacteria 20026
205 Ga0163161_10165138 3300017792 Bacteria 1690
206 Ga0197907_11038722 3300020069 Bacteria 2812
207 Ga0206356_11069915 3300020070 Bacteria 1621
208 Ga0206356_11078314 3300020070 Bacteria 4954
209 Ga0206349_1235210 3300020075 Bacteria 2244
210 Ga0206355_1479823 3300020076 Bacteria 3847
211 Ga0206351_10121833 3300020077 Bacteria 6469
212 Ga0206350_11084827 3300020080 Bacteria 2842
213 Ga0206354_10003151 3300020081 Bacteria 1855
214 Ga0206354_10947371 3300020081 Bacteria 2208
215 Ga0206353_11402448 3300020082 Bacteria 4283
216 Ga0154015_1286480 3300020610 Bacteria 42278
217 Ga0213872_10000002 3300021361 Bacteria 554092
218 Ga0213872_10000427 3300021361 Bacteria 34434
219 Ga0213872_10006826 3300021361 Bacteria 5682
220 Ga0213872_10009842 3300021361 Bacteria 4565
221 Ga0213872_10041949 3300021361 Bacteria 2087
222 Ga0224712_10000205 3300022467 Bacteria 10658
223 Ga0224712_10012271 3300022467 Bacteria 2689
224 Ga0209435_100016 3300025206 Bacteria 305566
225 Ga0209435_100038 3300025206 Bacteria 120273
226 Ga0209435_101065 3300025206 Bacteria 3836
227 Ga0209436_100185 3300025208 Bacteria 28976
228 Ga0209436_100244 3300025208 Bacteria 25067
229 Ga0209784_100003 3300025224 Bacteria 1379451
230 Ga0209784_100005 3300025224 Bacteria 1040422
231 Ga0209784_100323 3300025224 Bacteria 24350
232 Ga0209784_100328 3300025224 Bacteria 24020
233 Ga0209566_100002 3300025225 Bacteria 2614868
234 Ga0209566_100005 3300025225 Bacteria 1040422
235 Ga0209566_100562 3300025225 Bacteria 24350
236 Ga0209566_100621 3300025225 Bacteria 21899
237 Ga0209566_100782 3300025225 Bacteria 16940
238 Ga0209674_100005 3300025226 Bacteria 1708125
239 Ga0209674_100008 3300025226 Bacteria 1076909
240 Ga0209674_100009 3300025226 Bacteria 1040422
241 Ga0209674_100113 3300025226 Bacteria 139708
242 Ga0209674_100239 3300025226 Bacteria 46704
243 Ga0209674_100374 3300025226 Bacteria 24350
244 Ga0209672_100001 3300025228 Bacteria 2828210
245 Ga0209672_100246 3300025228 Bacteria 40789
246 Ga0209672_100444 3300025228 Bacteria 23389
247 Ga0209147_100001 3300025229 Bacteria 2384371
248 Ga0209147_100002 3300025229 Bacteria 2158988
249 Ga0209147_100023 3300025229 Bacteria 437803
250 Ga0209563_100004 3300025230 Bacteria 1814108
251 Ga0209563_100012 3300025230 Bacteria 1040422
252 Ga0209563_100015 3300025230 Bacteria 879901
253 Ga0209563_100258 3300025230 Bacteria 24350
254 Ga0209563_101134 3300025230 Bacteria 7516
255 Ga0209563_103216 3300025230 Bacteria 3438
256 Ga0207427_100932 3300025231 Bacteria 12475
257 Ga0207427_102317 3300025231 Bacteria 5260
258 Ga0209437_100166 3300025233 Bacteria 144787
259 Ga0209437_100565 3300025233 Bacteria 24350
260 Ga0209437_109505 3300025233 Bacteria 1515
261 Ga0209258_100001 3300025242 Bacteria 2384269
262 Ga0209258_100002 3300025242 Bacteria 2158988
263 Ga0209258_100345 3300025242 Bacteria 67870
264 Ga0207425_1000001 3300025245 Bacteria 2525432
265 Ga0207425_1000194 3300025245 Bacteria 48678
266 Ga0207425_1000551 3300025245 Bacteria 22377
267 Ga0209646_1000019 3300025246 Bacteria 475248
268 Ga0209646_1000028 3300025246 Bacteria 387986
269 Ga0209646_1000033 3300025246 Bacteria 369507
270 Ga0209646_1000093 3300025246 Bacteria 183840
271 Ga0209026_1000031 3300025250 Bacteria 325747
272 Ga0209026_1001896 3300025250 Bacteria 8498
273 Ga0209026_1004752 3300025250 Bacteria 3907
274 Ga0209677_100006 3300025253 Bacteria 1040422
275 Ga0209677_100009 3300025253 Bacteria 749530
276 Ga0209677_100438 3300025253 Bacteria 24350
277 Ga0209677_106364 3300025253 Bacteria 2809
278 Ga0209677_113219 3300025253 Bacteria 1184
279 Ga0209148_1000003 3300025254 Bacteria 2384288
280 Ga0209148_1000471 3300025254 Bacteria 42915
281 Ga0209148_1000656 3300025254 Bacteria 29811
282 Ga0209148_1004089 3300025254 Bacteria 3695
283 Ga0209759_1000029 3300025256 Bacteria 286968
284 Ga0209759_1000232 3300025256 Bacteria 83288
285 Ga0209759_1000322 3300025256 Bacteria 63168
286 Ga0209759_1000346 3300025256 Bacteria 60977
287 Ga0209759_1001190 3300025256 Bacteria 16317
288 Ga0209759_1003612 3300025256 Bacteria 6097
289 Ga0209759_1006480 3300025256 Bacteria 3923
290 Ga0209129_1000001 3300025258 Bacteria 1452436
291 Ga0209233_1000043 3300025261 Bacteria 509723
292 Ga0209233_1000483 3300025261 Bacteria 24350
293 Ga0209565_1000009 3300025263 Bacteria 751701
294 Ga0209565_1000191 3300025263 Bacteria 75148
295 Ga0209565_1000321 3300025263 Bacteria 43257
296 Ga0209565_1004466 3300025263 Bacteria 4244
297 Ga0209565_1009953 3300025263 Bacteria 2380
298 Ga0209455_1000001 3300025272 Bacteria 2384278
299 Ga0209455_1000049 3300025272 Bacteria 374414
300 Ga0209455_1000076 3300025272 Bacteria 284092
301 Ga0209455_1009263 3300025272 Bacteria 2599
302 Ga0209673_1000036 3300025273 Bacteria 323162
303 Ga0209673_1016259 3300025273 Bacteria 2790
304 Ga0209673_1036095 3300025273 Bacteria 1471
305 Ga0209130_1000044 3300025284 Bacteria 241110
306 Ga0209130_1000391 3300025284 Bacteria 48004
307 Ga0209130_1002746 3300025284 Bacteria 8323
308 Ga0209130_1004442 3300025284 Bacteria 5317
309 Ga0209675_1000013 3300025291 Bacteria 448220
310 Ga0209675_1000084 3300025291 Bacteria 152066
311 Ga0209675_1000496 3300025291 Bacteria 29513
312 Ga0209675_1001550 3300025291 Bacteria 13072
313 Ga0209675_1002122 3300025291 Bacteria 10486
314 Ga0209675_1008884 3300025291 Bacteria 3619
315 Ga0209675_1013587 3300025291 Bacteria 2534
316 Ga0209676_1000014 3300025292 Bacteria 793514
317 Ga0209025_1000323 3300025294 Bacteria 106442
318 Ga0209025_1000363 3300025294 Bacteria 96763
319 Ga0209025_1002228 3300025294 Bacteria 21355
320 Ga0209025_1009587 3300025294 Bacteria 6718
321 Ga0209025_1031950 3300025294 Bacteria 2474
322 Ga0209025_1039251 3300025294 Bacteria 2068
323 Ga0209564_1000006 3300025295 Bacteria 1100927
324 Ga0209564_1000038 3300025295 Bacteria 414357
325 Ga0209564_1000122 3300025295 Bacteria 203709
326 Ga0209564_1000813 3300025295 Bacteria 42574
327 Ga0209564_1000953 3300025295 Bacteria 36860
328 Ga0209564_1001000 3300025295 Bacteria 35296
329 Ga0209564_1002158 3300025295 Bacteria 16591
330 Ga0209564_1003280 3300025295 Bacteria 11282
331 Ga0209564_1025521 3300025295 Bacteria 1983
332 Ga0209758_1000055 3300025297 Bacteria 336183
333 Ga0209758_1000149 3300025297 Bacteria 163504
334 Ga0209050_1000334 3300025298 Bacteria 93637
335 Ga0209050_1000743 3300025298 Bacteria 46935
336 Ga0209256_1000005 3300025299 Bacteria 1315082
337 Ga0209256_1000024 3300025299 Bacteria 448909
338 Ga0209256_1000106 3300025299 Bacteria 187258
339 Ga0209256_1000269 3300025299 Bacteria 91493
340 Ga0209256_1000466 3300025299 Bacteria 61247
341 Ga0209256_1000780 3300025299 Bacteria 41123
342 Ga0209256_1000867 3300025299 Bacteria 37536
343 Ga0209256_1003509 3300025299 Bacteria 10925
344 Ga0207426_1005062 3300025302 Bacteria 6164
345 Ga0207426_1007837 3300025302 Bacteria 4414
346 Ga0209051_1016793 3300025303 Bacteria 3292
347 Ga0209051_1045368 3300025303 Bacteria 1522
348 Ga0209257_1000010 3300025304 Bacteria 1158682
349 Ga0209257_1001145 3300025304 Bacteria 33847
350 Ga0207655_1018450 3300025728 Bacteria 3697
351 Ga0207655_1023331 3300025728 Bacteria 3072
352 Ga0207713_1000287 3300025735 Bacteria 58430
353 Ga0207713_1002387 3300025735 Bacteria 13721
354 Ga0207647_10081675 3300025904 Bacteria 1937
355 Ga0207705_10000681 3300025909 Bacteria 28117
356 Ga0207705_10002956 3300025909 Bacteria 12995
357 Ga0207705_10165502 3300025909 Bacteria 1663
358 Ga0207654_10002514 3300025911 Bacteria 9322
359 Ga0207695_10002002 3300025913 Bacteria 31431
360 Ga0207695_10002789 3300025913 Bacteria 25429
361 Ga0207695_10006826 3300025913 Bacteria 14701
362 Ga0207695_10033764 3300025913 Bacteria 5575
363 Ga0207695_10041008 3300025913 Bacteria 4956
364 Ga0207695_10134650 3300025913 Bacteria 2425
365 Ga0207695_10197741 3300025913 Bacteria 1926
366 Ga0207671_10012778 3300025914 Bacteria 6732
367 Ga0207671_10544272 3300025914 Bacteria 925
368 Ga0207657_10000842 3300025919 Bacteria 32462
369 Ga0207657_10008034 3300025919 Bacteria 10761
370 Ga0207657_10065346 3300025919 Bacteria 3101
371 Ga0207657_10139229 3300025919 Bacteria 1984
372 Ga0207649_10000098 3300025920 Bacteria 71539
373 Ga0207649_10041314 3300025920 Bacteria 2807
374 Ga0207694_10001422 3300025924 Bacteria 20510
375 Ga0207690_10019643 3300025932 Bacteria 4164
376 Ga0207690_10039304 3300025932 Bacteria 3086
377 Ga0207706_10357761 3300025933 Bacteria 1268
378 Ga0207686_10014723 3300025934 Bacteria 4362
379 Ga0207709_10108356 3300025935 Bacteria 1852
380 Ga0207691_10168723 3300025940 Bacteria 1917
381 Ga0207711_10128462 3300025941 Bacteria 2269
382 Ga0207689_10065783 3300025942 Bacteria 2981
383 Ga0207679_10000020 3300025945 Bacteria 225727
384 Ga0207679_10001045 3300025945 Bacteria 17630
385 Ga0207667_10000112 3300025949 Bacteria 131462
386 Ga0207667_10000350 3300025949 Bacteria 62831
387 Ga0207667_10001547 3300025949 Bacteria 28940
388 Ga0207667_10037931 3300025949 Bacteria 5150
389 Ga0207667_10064906 3300025949 Bacteria 3809
390 Ga0207667_10720845 3300025949 Bacteria 998
391 Ga0207640_10000092 3300025981 Bacteria 71354
392 Ga0207658_10137657 3300025986 Bacteria 1971
393 Ga0207703_10050504 3300026035 Bacteria 3366
394 Ga0207678_10000181 3300026067 Bacteria 53999
395 Ga0207702_10000017 3300026078 Bacteria 222964
396 Ga0207702_10621659 3300026078 Bacteria 1061
397 Ga0207641_10329455 3300026088 Bacteria 1450
398 Ga0207648_10603642 3300026089 Bacteria 1012
399 Ga0207674_10009965 3300026116 Bacteria 10813
400 Ga0207683_10162344 3300026121 Bacteria 2021
401 Ga0207698_10133720 3300026142 Bacteria 2124
402 Ga0207698_10851139 3300026142 Bacteria 917
403 Ga0209281_1000322 3300027111 Bacteria 84374
404 Ga0209281_1017789 3300027111 Bacteria 1435
405 Ga0209995_1009558 3300027471 Bacteria 1569
406 Ga0209968_1000652 3300027526 Bacteria 5356
407 Ga0209282_1000002 3300027666 Bacteria 1067825
408 Ga0209282_1000184 3300027666 Bacteria 33500
409 Ga0209966_1000005 3300027695 Bacteria 103734
410 Ga0307515_10120528 3300028794 Bacteria 2975
411 Ga0265338_10000022 3300028800 Bacteria 308414
412 Ga0265338_10000281 3300028800 Bacteria 91847
413 Ga0307511_10000574 3300030521 Bacteria 39348
414 Ga0316181_1200678 3300030744 Bacteria 3779
415 Ga0316182_1144804 3300030745 Bacteria 2254
416 Ga0265328_10012598 3300031239 Bacteria 3363
417 Ga0265331_10004696 3300031250 Bacteria 8458
418 Ga0265327_10006308 3300031251 Bacteria 9534
419 Ga0265316_10002426 3300031344 Bacteria 19371
420 Ga0265316_10097591 3300031344 Bacteria 2236
421 Ga0307408_100001629 3300031548 Bacteria 16615
422 Ga0307408_100002195 3300031548 Bacteria 13956
423 Ga0307408_100002582 3300031548 Bacteria 12625
424 Ga0307408_100006036 3300031548 Bacteria 8058
425 Ga0265314_10056079 3300031711 Bacteria 2715
426 Ga0265314_10069748 3300031711 Bacteria 2358
427 Ga0307405_10391520 3300031731 Bacteria 1085
428 Ga0307518_10206037 3300031838 Bacteria 1300
429 Ga0307410_10336858 3300031852 Bacteria 1201
430 Ga0307412_10000024 3300031911 Bacteria 235467
431 Ga0307414_10102350 3300032004 Bacteria 2158
432 Ga0373956_0071706 3300035119 Bacteria 1581
433 Ga0373925_0707088 3300037068 Bacteria 831
434 Ga0395899_0000035 3300037312 Bacteria 295584
435 Ga0395899_0000206 3300037312 Bacteria 86263
436 Ga0395899_0001114 3300037312 Bacteria 24057
437 Ga0395899_0012621 3300037312 Bacteria 6475
438 Ga0395899_0026634 3300037312 Bacteria 4362
439 Ga0395899_0069703 3300037312 Bacteria 2574
440 Ga0395900_0000050 3300037418 Bacteria 224616
441 Ga0395900_0000113 3300037418 Bacteria 139979
442 Ga0395900_0000298 3300037418 Bacteria 74295
443 Ga0395900_0002068 3300037418 Bacteria 22520
444 Ga0395900_0003955 3300037418 Bacteria 15819
445 Ga0395900_0005739 3300037418 Bacteria 12975
446 Ga0395900_0008520 3300037418 Bacteria 10540
447 Ga0395900_0008874 3300037418 Bacteria 10324
448 Ga0395900_0027896 3300037418 Bacteria 5783
449 Ga0395900_0034374 3300037418 Bacteria 5219
450 Ga0395900_0081796 3300037418 Bacteria 3317
451 Ga0395900_0151316 3300037418 Bacteria 2370
452 Ga0395900_0272782 3300037418 Bacteria 1686
453 Ga0395900_0317671 3300037418 Bacteria 1538
454 Ga0395900_0341843 3300037418 Bacteria 1472
455 Ga0395900_0367645 3300037418 Bacteria 1408
456 Ga0395898_0000437 3300037466 Bacteria 87616
457 Ga0395898_0000813 3300037466 Bacteria 52382
458 Ga0395898_0000817 3300037466 Bacteria 52136
459 Ga0395898_0026404 3300037466 Bacteria 5843
460 Ga0395898_0036477 3300037466 Bacteria 4882
461 Ga0395898_0060324 3300037466 Bacteria 3686
462 Ga0395898_0118102 3300037466 Bacteria 2541
463 Ga0395898_0208759 3300037466 Bacteria 1863
464 Ga0395898_0405036 3300037466 Bacteria 1300
465 Ga0395905_0004574 3300037471 Bacteria 14314
466 Ga0395905_0005007 3300037471 Bacteria 13647
467 Ga0395905_0025625 3300037471 Bacteria 5561
468 Ga0395905_0049731 3300037471 Bacteria 3929
469 Ga0395905_0178169 3300037471 Bacteria 1995
470 Ga0395905_0583418 3300037471 Bacteria 1019
471 Ga0436364_0382499 3300037853 Bacteria 1758
472 Ga0395901_0000062 3300038443 Bacteria 150171
473 Ga0395901_0000416 3300038443 Bacteria 50194
474 Ga0395901_0000508 3300038443 Bacteria 45081
475 Ga0395901_0001200 3300038443 Bacteria 27580
476 Ga0395901_0124335 3300038443 Bacteria 2710
477 Ga0395901_0182649 3300038443 Bacteria 2200
478 Ga0395901_0219648 3300038443 Bacteria 1987
479 Ga0395901_0474839 3300038443 Bacteria 1276
480 Ga0395901_0547995 3300038443 Bacteria 1172
481 Ga0395901_0860041 3300038443 Bacteria 891
482 Ga0436361_0125110 3300039447 Bacteria 71341
483 Ga0436361_0153681 3300039447 Bacteria 2233
484 Ga0436361_0185139 3300039447 Bacteria 11803
485 Ga0436361_0376382 3300039447 Bacteria 68820
486 Ga0436361_0556100 3300039447 Bacteria 1285
487 Ga0436361_0615231 3300039447 Bacteria 15420
488 Ga0436361_0684212 3300039447 Bacteria 74853
489 Ga0436361_0759601 3300039447 Bacteria 3704
490 Ga0436361_1021214 3300039447 Bacteria 3498
491 Ga0439448_0000302 3300042005 Bacteria 10910
492 Ga0439448_0026282 3300042005 Bacteria 1829
493 Ga0439449_0018309 3300042007 Bacteria 2629
494 Ga0439450_030943 3300042008 Bacteria 1203
495 Ga0439455_0000411 3300042012 Bacteria 5714
496 Ga0439455_0015815 3300042012 Bacteria 1738
497 Ga0450923_002748 3300042125 Bacteria 2567
498 Ga0450904_000172 3300042139 Bacteria 14135
499 Ga0439458_0027625 3300042157 Bacteria 1339
500 Ga0466969_0002755 3300044656 Bacteria 9402
501 Ga0466969_0012522 3300044656 Bacteria 4471
502 Ga0466969_0017996 3300044656 Bacteria 3686
503 Ga0466972_0000034 3300044658 Bacteria 152086
504 Ga0466972_0010189 3300044658 Bacteria 4722
505 Ga0466972_0012579 3300044658 Bacteria 4252
506 Ga0466972_0033620 3300044658 Bacteria 2514
507 Ga0466972_0049636 3300044658 Bacteria 2027
508 Ga0466973_0035357 3300044659 Bacteria 4748
509 Ga0466965_0012573 3300044683 Bacteria 3984
510 Ga0466965_0017057 3300044683 Bacteria 3466
511 Ga0466965_0029040 3300044683 Bacteria 2689
512 Ga0466965_0030291 3300044683 Bacteria 2636
513 Ga0466965_0066016 3300044683 Bacteria 1813
514 Ga0466966_0000106 3300044684 Bacteria 51109
515 Ga0466966_0002872 3300044684 Bacteria 11341
516 Ga0466966_0002959 3300044684 Bacteria 11181
517 Ga0466966_0004420 3300044684 Bacteria 9274
518 Ga0466966_0005785 3300044684 Bacteria 8148
519 Ga0466966_0022302 3300044684 Bacteria 4155
520 Ga0466966_0284382 3300044684 Bacteria 994
521 Ga0466961_0000032 3300044693 Bacteria 85497
522 Ga0466961_0000202 3300044693 Bacteria 40048
523 Ga0466961_0000417 3300044693 Bacteria 27119
524 Ga0466961_0005980 3300044693 Bacteria 7713
525 Ga0466963_0000050 3300044694 Bacteria 39352
526 Ga0466963_0043394 3300044694 Bacteria 2956
527 Ga0466963_0147042 3300044694 Bacteria 1635
528 Ga0466963_0385917 3300044694 Bacteria 987
529 Ga0466964_0000380 3300044706 Bacteria 13506
530 Ga0466964_0006313 3300044706 Bacteria 4413
531 Ga0466964_0026695 3300044706 Bacteria 2262
532 Ga0453684_0080313 3300044712 Bacteria 4073
533 Ga0466971_0003444 3300044719 Bacteria 6756
534 Ga0466971_0005199 3300044719 Bacteria 5632
535 Ga0466971_0009300 3300044719 Bacteria 4292
536 Ga0466971_0055154 3300044719 Bacteria 1791
537 Ga0466968_0009810 3300044735 Bacteria 3695
538 Ga0466968_0015479 3300044735 Bacteria 3023
539 Ga0466968_0031325 3300044735 Bacteria 2206
540 Ga0466970_0000877 3300044765 Bacteria 14498
541 Ga0466970_0004900 3300044765 Bacteria 6610
542 Ga0466970_0063239 3300044765 Bacteria 1984
543 Ga0466970_0078473 3300044765 Bacteria 1781
544 Ga0466970_0094274 3300044765 Bacteria 1626
545 Ga0466957_0001750 3300044842 Bacteria 11417
546 Ga0466957_0003510 3300044842 Bacteria 8620
547 Ga0466957_0026350 3300044842 Bacteria 3448
548 Ga0466957_0032839 3300044842 Bacteria 3110
549 Ga0466957_0065864 3300044842 Bacteria 2232
550 Ga0466957_0068235 3300044842 Bacteria 2195
551 Ga0466957_0086903 3300044842 Bacteria 1954
552 Ga0466957_0106911 3300044842 Bacteria 1770
553 Ga0466957_0191561 3300044842 Bacteria 1340
554 Ga0466960_0100865 3300044901 Bacteria 1486
555 Ga0466960_0269286 3300044901 Bacteria 951
556 Ga0466959_0003501 3300045049 Bacteria 10289
557 Ga0466959_0014950 3300045049 Bacteria 5656
558 Ga0466959_0031138 3300045049 Bacteria 3948
559 Ga0466959_0068217 3300045049 Bacteria 2577
560 Ga0466959_0088120 3300045049 Bacteria 2231
561 Ga0466959_0109471 3300045049 Bacteria 1972
562 Ga0466959_0125624 3300045049 Bacteria 1821
563 Ga0466959_0128096 3300045049 Bacteria 1800
564 Ga0466959_0249755 3300045049 Bacteria 1223
565 Ga0451576_0024224 3300045051 Bacteria 6557
566 Ga0451576_0369256 3300045051 Bacteria 1503
567 Ga0466958_0001226 3300045836 Bacteria 12002
568 Ga0466958_0002253 3300045836 Bacteria 9606
569 Ga0466958_0004564 3300045836 Bacteria 7328
570 Ga0466958_0005384 3300045836 Bacteria 6878
571 Ga0466958_0062728 3300045836 Bacteria 2266
572 Ga0466967_0004230 3300045976 Bacteria 9632
573 Ga0466967_0127300 3300045976 Bacteria 2360
574 Ga0466967_0144891 3300045976 Bacteria 2215
575 Ga0466967_0226341 3300045976 Bacteria 1779
576 Ga0466967_0805287 3300045976 Bacteria 933
577 Ga0495617_000002 3300046452 Bacteria 710121
578 Ga0495617_000006 3300046452 Bacteria 398279
579 Ga0495617_000574 3300046452 Bacteria 18841
580 Ga0495617_001877 3300046452 Bacteria 8873
581 Ga0495617_006621 3300046452 Bacteria 4052
582 Ga0495627_000005 3300046453 Bacteria 630805
583 Ga0495627_000350 3300046453 Bacteria 43486
584 Ga0495627_004964 3300046453 Bacteria 5462
585 Ga0495627_060882 3300046453 Bacteria 1117
586 Ga0495592_0007616 3300046454 Bacteria 8112
587 Ga0495592_0023221 3300046454 Bacteria 4717
588 Ga0495592_0361613 3300046454 Bacteria 928
589 Ga0495603_0016533 3300046455 Bacteria 4463
590 Ga0495603_0125381 3300046455 Bacteria 1496
591 Ga0495603_0194874 3300046455 Bacteria 1171
592 Ga0495603_0246283 3300046455 Bacteria 1029
593 Ga0495590_0000025 3300046457 Bacteria 165221
594 Ga0495590_0000052 3300046457 Bacteria 103480
595 Ga0495590_0000510 3300046457 Bacteria 19058
596 Ga0495590_0026139 3300046457 Bacteria 2050
597 Ga0495590_0026746 3300046457 Bacteria 2024
598 Ga0495590_0041915 3300046457 Bacteria 1596
599 Ga0495590_0061272 3300046457 Bacteria 1317
600 Ga0495591_000290 3300046458 Bacteria 46499
601 Ga0495591_002346 3300046458 Bacteria 10646
602 Ga0495629_0000098 3300046459 Bacteria 75959
603 Ga0495629_0000480 3300046459 Bacteria 33539
604 Ga0495629_0001062 3300046459 Bacteria 21966
605 Ga0495629_0003444 3300046459 Bacteria 11960
606 Ga0495629_0219824 3300046459 Bacteria 1310
607 Ga0495638_0000066 3300046460 Bacteria 168673
608 Ga0495638_0020487 3300046460 Bacteria 4369
609 Ga0495638_0021868 3300046460 Bacteria 4204
610 Ga0495638_0074214 3300046460 Bacteria 2075
611 Ga0495638_0108151 3300046460 Bacteria 1654
612 Ga0495638_0109790 3300046460 Bacteria 1640
613 Ga0495651_0002927 3300046462 Bacteria 13210
614 Ga0495651_0004151 3300046462 Bacteria 11095
615 Ga0495651_0258391 3300046462 Bacteria 1186
616 Ga0495651_0278278 3300046462 Bacteria 1131
617 Ga0495653_0000011 3300046463 Bacteria 272314
618 Ga0495653_0004216 3300046463 Bacteria 11641
619 Ga0495653_0024870 3300046463 Bacteria 4819
620 Ga0495653_0026196 3300046463 Bacteria 4678
621 Ga0495653_0042336 3300046463 Bacteria 3547
622 Ga0495653_0149072 3300046463 Bacteria 1636
623 Ga0495650_0000015 3300046471 Bacteria 557595
624 Ga0495650_0000352 3300046471 Bacteria 81351
625 Ga0495650_0000506 3300046471 Bacteria 58187
626 Ga0495650_0000567 3300046471 Bacteria 51961
627 Ga0495650_0000694 3300046471 Bacteria 43425
628 Ga0495650_0000716 3300046471 Bacteria 42283
629 Ga0495650_0001942 3300046471 Bacteria 18281
630 Ga0495650_0002453 3300046471 Bacteria 14961
631 Ga0495650_0012550 3300046471 Bacteria 4550
632 Ga0495650_0014139 3300046471 Bacteria 4174
633 Ga0495650_0025130 3300046471 Bacteria 2798
634 Ga0495580_0000453 3300046472 Bacteria 34001
635 Ga0495580_0000490 3300046472 Bacteria 33087
636 Ga0495580_0007251 3300046472 Bacteria 8916
637 Ga0495580_0011469 3300046472 Bacteria 6857
638 Ga0495582_0004426 3300046473 Bacteria 7903
639 Ga0495582_0031926 3300046473 Bacteria 2896
640 Ga0495582_0049879 3300046473 Bacteria 2305
641 Ga0495582_0207568 3300046473 Bacteria 1119
642 Ga0495605_0000003 3300046474 Bacteria 491502
643 Ga0495605_0000034 3300046474 Bacteria 208277
644 Ga0495605_0000474 3300046474 Bacteria 35493
645 Ga0495605_0000775 3300046474 Bacteria 22945
646 Ga0495605_0001336 3300046474 Bacteria 16318
647 Ga0495605_0001357 3300046474 Bacteria 16161
648 Ga0495605_0002584 3300046474 Bacteria 11136
649 Ga0495605_0002767 3300046474 Bacteria 10698
650 Ga0495605_0004977 3300046474 Bacteria 7763
651 Ga0495605_0005138 3300046474 Bacteria 7630
652 Ga0495605_0014177 3300046474 Bacteria 4372
653 Ga0495605_0057551 3300046474 Bacteria 1870
654 Ga0495662_0048656 3300046476 Bacteria 2047
655 Ga0495664_0001796 3300046477 Bacteria 11396
656 Ga0495664_0007851 3300046477 Bacteria 5938
657 Ga0495584_0000017 3300046491 Bacteria 149686
658 Ga0495584_0000718 3300046491 Bacteria 21824
659 Ga0495584_0001121 3300046491 Bacteria 16621
660 Ga0495584_0002718 3300046491 Bacteria 9920
661 Ga0495584_0004213 3300046491 Bacteria 7756
662 Ga0495584_0004606 3300046491 Bacteria 7392
663 Ga0495584_0007731 3300046491 Bacteria 5595
664 Ga0495584_0008014 3300046491 Bacteria 5490
665 Ga0495584_0036280 3300046491 Bacteria 2490
666 Ga0495584_0089253 3300046491 Bacteria 1554
667 Ga0495585_0000064 3300046492 Bacteria 109302
668 Ga0495585_0000719 3300046492 Bacteria 29700
669 Ga0495585_0003608 3300046492 Bacteria 10376
670 Ga0495585_0005194 3300046492 Bacteria 8256
671 Ga0495585_0006205 3300046492 Bacteria 7449
672 Ga0495585_0010728 3300046492 Bacteria 5441
673 Ga0495585_0011801 3300046492 Bacteria 5161
674 Ga0495585_0017413 3300046492 Bacteria 4150
675 Ga0495585_0019284 3300046492 Bacteria 3933
676 Ga0495585_0034711 3300046492 Bacteria 2851
677 Ga0495585_0043580 3300046492 Bacteria 2508
678 Ga0495585_0050675 3300046492 Bacteria 2302
679 Ga0495585_0053991 3300046492 Bacteria 2222
680 Ga0495585_0056736 3300046492 Bacteria 2162
681 Ga0495585_0058974 3300046492 Bacteria 2116
682 Ga0495585_0072425 3300046492 Bacteria 1877
683 Ga0495585_0083776 3300046492 Bacteria 1725
684 Ga0495585_0124025 3300046492 Bacteria 1364
685 Ga0495594_0007765 3300046499 Bacteria 5516
686 Ga0495594_0025706 3300046499 Bacteria 3165
687 Ga0495594_0039392 3300046499 Bacteria 2584
688 Ga0495594_0072968 3300046499 Bacteria 1909
689 Ga0495594_0184631 3300046499 Bacteria 1187
690 Ga0495596_0000205 3300046500 Bacteria 40540
691 Ga0495596_0002342 3300046500 Bacteria 10266
692 Ga0495596_0002444 3300046500 Bacteria 9996
693 Ga0495596_0003397 3300046500 Bacteria 8077
694 Ga0495596_0006211 3300046500 Bacteria 5529
695 Ga0495596_0012140 3300046500 Bacteria 3694
696 Ga0495596_0017735 3300046500 Bacteria 2943
697 Ga0495596_0036508 3300046500 Bacteria 1946
698 Ga0495596_0037389 3300046500 Bacteria 1919
699 Ga0495596_0069014 3300046500 Bacteria 1373
700 Ga0495596_0103072 3300046500 Bacteria 1108
701 Ga0495607_0002968 3300046501 Bacteria 13304
702 Ga0495607_0003100 3300046501 Bacteria 12902
703 Ga0495607_0004837 3300046501 Bacteria 9824
704 Ga0495607_0005693 3300046501 Bacteria 8878
705 Ga0495607_0012044 3300046501 Bacteria 5724
706 Ga0495607_0014345 3300046501 Bacteria 5163
707 Ga0495607_0021624 3300046501 Bacteria 4045
708 Ga0495607_0022753 3300046501 Bacteria 3932
709 Ga0495607_0025829 3300046501 Bacteria 3649
710 Ga0495607_0031908 3300046501 Bacteria 3221
711 Ga0495607_0033328 3300046501 Bacteria 3134
712 Ga0495607_0040118 3300046501 Bacteria 2790
713 Ga0495607_0080102 3300046501 Bacteria 1797
714 Ga0495607_0128169 3300046501 Bacteria 1324
715 Ga0495607_0198859 3300046501 Bacteria 993
716 Ga0495583_0000056 3300046506 Bacteria 200858
717 Ga0495583_0000320 3300046506 Bacteria 76050
718 Ga0495583_0000344 3300046506 Bacteria 73346
719 Ga0495583_0000864 3300046506 Bacteria 36820
720 Ga0495583_0001309 3300046506 Bacteria 25885
721 Ga0495583_0001863 3300046506 Bacteria 19634
722 Ga0495583_0003698 3300046506 Bacteria 11378
723 Ga0495583_0004990 3300046506 Bacteria 9203
724 Ga0495583_0035874 3300046506 Bacteria 2362
725 Ga0495606_0000024 3300046507 Bacteria 262080
726 Ga0495606_0000043 3300046507 Bacteria 214367
727 Ga0495606_0000920 3300046507 Bacteria 43445
728 Ga0495606_0002355 3300046507 Bacteria 22181
729 Ga0495606_0002651 3300046507 Bacteria 20411
730 Ga0495606_0002848 3300046507 Bacteria 19155
731 Ga0495606_0003368 3300046507 Bacteria 17035
732 Ga0495606_0003606 3300046507 Bacteria 16281
733 Ga0495606_0004448 3300046507 Bacteria 14001
734 Ga0495606_0005867 3300046507 Bacteria 11564
735 Ga0495606_0014463 3300046507 Bacteria 6155
736 Ga0495606_0020534 3300046507 Bacteria 4866
737 Ga0495606_0026407 3300046507 Bacteria 4140
738 Ga0495606_0028021 3300046507 Bacteria 3981
739 Ga0495606_0033961 3300046507 Bacteria 3509
740 Ga0495606_0050194 3300046507 Bacteria 2730
741 Ga0495606_0056514 3300046507 Bacteria 2532
742 Ga0495606_0132797 3300046507 Bacteria 1478
743 Ga0495606_0308253 3300046507 Bacteria 855
744 Ga0495608_0000558 3300046511 Bacteria 25667
745 Ga0495608_0027302 3300046511 Bacteria 3884
746 Ga0495608_0031265 3300046511 Bacteria 3601
747 Ga0495608_0039105 3300046511 Bacteria 3181
748 Ga0495610_0000004 3300046512 Bacteria 1006135
749 Ga0495610_0000613 3300046512 Bacteria 35266
750 Ga0495610_0000866 3300046512 Bacteria 28294
751 Ga0495610_0046369 3300046512 Bacteria 2144
752 Ga0495610_0117421 3300046512 Bacteria 1170
753 Ga0495616_0000057 3300046513 Bacteria 100806
754 Ga0495616_0000727 3300046513 Bacteria 24274
755 Ga0495616_0000765 3300046513 Bacteria 23498
756 Ga0495616_0001281 3300046513 Bacteria 17669
757 Ga0495616_0005523 3300046513 Bacteria 7771
758 Ga0495616_0008223 3300046513 Bacteria 6193
759 Ga0495616_0012740 3300046513 Bacteria 4762
760 Ga0495616_0014843 3300046513 Bacteria 4347
761 Ga0495616_0016856 3300046513 Bacteria 4036
762 Ga0495616_0019205 3300046513 Bacteria 3733
763 Ga0495616_0020183 3300046513 Bacteria 3629
764 Ga0495616_0037178 3300046513 Bacteria 2506
765 Ga0495616_0085897 3300046513 Bacteria 1497
766 Ga0495618_0002641 3300046514 Bacteria 11469
767 Ga0495618_0134275 3300046514 Bacteria 1583
768 Ga0495620_0010534 3300046515 Bacteria 4873
769 Ga0495628_0004435 3300046516 Bacteria 12449
770 Ga0495628_0010088 3300046516 Bacteria 8034
771 Ga0495628_0012308 3300046516 Bacteria 7211
772 Ga0495628_0014449 3300046516 Bacteria 6619
773 Ga0495628_0046726 3300046516 Bacteria 3437
774 Ga0495628_0128462 3300046516 Bacteria 1940
775 Ga0495630_0001998 3300046517 Bacteria 14196
776 Ga0495630_0031771 3300046517 Bacteria 3932
777 Ga0495630_0054910 3300046517 Bacteria 2984
778 Ga0495631_0000942 3300046518 Bacteria 18163
779 Ga0495631_0003085 3300046518 Bacteria 9184
780 Ga0495631_0004674 3300046518 Bacteria 7242
781 Ga0495631_0008186 3300046518 Bacteria 5275
782 Ga0495631_0020467 3300046518 Bacteria 3091
783 Ga0495631_0022459 3300046518 Bacteria 2933
784 Ga0495631_0026976 3300046518 Bacteria 2632
785 Ga0495631_0035697 3300046518 Bacteria 2222
786 Ga0495631_0103327 3300046518 Bacteria 1226
787 Ga0495631_0139355 3300046518 Bacteria 1041
788 Ga0495632_0000077 3300046519 Bacteria 100834
789 Ga0495632_0001144 3300046519 Bacteria 22654
790 Ga0495632_0001998 3300046519 Bacteria 16119
791 Ga0495632_0002332 3300046519 Bacteria 14575
792 Ga0495632_0004741 3300046519 Bacteria 9170
793 Ga0495632_0012804 3300046519 Bacteria 4815
794 Ga0495637_0000126 3300046520 Bacteria 57018
795 Ga0495637_0000327 3300046520 Bacteria 36965
796 Ga0495637_0001842 3300046520 Bacteria 12128
797 Ga0495637_0008157 3300046520 Bacteria 5154
798 Ga0495637_0072634 3300046520 Bacteria 1385
799 Ga0495643_0000224 3300046522 Bacteria 86728
800 Ga0495643_0000747 3300046522 Bacteria 36826
801 Ga0495643_0002070 3300046522 Bacteria 16605
802 Ga0495643_0003157 3300046522 Bacteria 12258
803 Ga0495643_0007721 3300046522 Bacteria 6892
804 Ga0495643_0008341 3300046522 Bacteria 6572
805 Ga0495643_0027344 3300046522 Bacteria 3207
806 Ga0495643_0027805 3300046522 Bacteria 3174
807 Ga0495643_0033876 3300046522 Bacteria 2821
808 Ga0495643_0040432 3300046522 Bacteria 2547
809 Ga0495643_0148990 3300046522 Bacteria 1160
810 Ga0495644_0001226 3300046523 Bacteria 10502
811 Ga0495644_0001682 3300046523 Bacteria 8981
812 Ga0495644_0002719 3300046523 Bacteria 7014
813 Ga0495644_0005980 3300046523 Bacteria 4740
814 Ga0495644_0009943 3300046523 Bacteria 3664
815 Ga0495644_0023269 3300046523 Bacteria 2359
816 Ga0495644_0033604 3300046523 Bacteria 1937
817 Ga0495644_0040602 3300046523 Bacteria 1753
818 Ga0495648_0000007 3300046524 Bacteria 347305
819 Ga0495648_0000045 3300046524 Bacteria 172587
820 Ga0495648_0000534 3300046524 Bacteria 40983
821 Ga0495648_0000708 3300046524 Bacteria 35539
822 Ga0495648_0004006 3300046524 Bacteria 12729
823 Ga0495648_0004011 3300046524 Bacteria 12716
824 Ga0495648_0005917 3300046524 Bacteria 10065
825 Ga0495648_0006818 3300046524 Bacteria 9230
826 Ga0495648_0042479 3300046524 Bacteria 2859
827 Ga0495648_0047112 3300046524 Bacteria 2667
828 Ga0495648_0056113 3300046524 Bacteria 2371
829 Ga0495648_0123177 3300046524 Bacteria 1390
830 Ga0495648_0140254 3300046524 Bacteria 1273
831 Ga0495648_0151933 3300046524 Bacteria 1207
832 Ga0495648_0157687 3300046524 Bacteria 1176
833 Ga0495663_0005099 3300046525 Bacteria 3666
834 Ga0495666_0001316 3300046526 Bacteria 12005
835 Ga0495666_0001527 3300046526 Bacteria 11345
836 Ga0495666_0003147 3300046526 Bacteria 8301
837 Ga0495666_0009724 3300046526 Bacteria 4805
838 Ga0495666_0019865 3300046526 Bacteria 3331
839 Ga0495666_0028196 3300046526 Bacteria 2763
840 Ga0495642_0000422 3300046528 Bacteria 22466
841 Ga0495642_0000749 3300046528 Bacteria 16028
842 Ga0495642_0008472 3300046528 Bacteria 3935
843 Ga0495642_0010038 3300046528 Bacteria 3626
844 Ga0495642_0019964 3300046528 Bacteria 2628
845 Ga0495642_0026351 3300046528 Bacteria 2308
846 Ga0495642_0032469 3300046528 Bacteria 2094
847 Ga0495642_0033276 3300046528 Bacteria 2072
848 Ga0495642_0034691 3300046528 Bacteria 2033
849 Ga0495642_0054057 3300046528 Bacteria 1655
850 Ga0495642_0060759 3300046528 Bacteria 1567
851 Ga0495642_0161505 3300046528 Bacteria 971
852 Ga0495652_0004631 3300046529 Bacteria 13113
853 Ga0495652_0005074 3300046529 Bacteria 12464
854 Ga0495652_0093493 3300046529 Bacteria 2454
855 Ga0495652_0240807 3300046529 Bacteria 1346
856 Ga0495654_0000004 3300046530 Bacteria 515304
857 Ga0495654_0002376 3300046530 Bacteria 12143
858 Ga0495654_0014863 3300046530 Bacteria 4136
859 Ga0495654_0083824 3300046530 Bacteria 1490
860 Ga0495665_0008513 3300046531 Bacteria 5568
861 Ga0495665_0015880 3300046531 Bacteria 4056
862 Ga0495665_0017372 3300046531 Bacteria 3870
863 Ga0495665_0027505 3300046531 Bacteria 3052
864 Ga0495665_0039390 3300046531 Bacteria 2517
865 Ga0495665_0040146 3300046531 Bacteria 2492
866 Ga0495640_0001438 3300046533 Bacteria 18758
867 Ga0495640_0010125 3300046533 Bacteria 7307
868 Ga0495586_0009518 3300046535 Bacteria 5173
869 Ga0495586_0012553 3300046535 Bacteria 4494
870 Ga0495586_0017328 3300046535 Bacteria 3830
871 Ga0495586_0019855 3300046535 Bacteria 3579
872 Ga0495586_0026061 3300046535 Bacteria 3128
873 Ga0495587_0006766 3300046536 Bacteria 7464
874 Ga0495587_0008698 3300046536 Bacteria 6520
875 Ga0495587_0021741 3300046536 Bacteria 3958
876 Ga0495609_0000002 3300046538 Bacteria 739816
877 Ga0495609_0000433 3300046538 Bacteria 34767
878 Ga0495609_0000918 3300046538 Bacteria 21365
879 Ga0495609_0001390 3300046538 Bacteria 16251
880 Ga0495609_0007649 3300046538 Bacteria 5368
881 Ga0495609_0008064 3300046538 Bacteria 5190
882 Ga0495609_0016089 3300046538 Bacteria 3490
883 Ga0495609_0016658 3300046538 Bacteria 3422
884 Ga0495609_0016949 3300046538 Bacteria 3389
885 Ga0495609_0028418 3300046538 Bacteria 2551
886 Ga0495609_0034795 3300046538 Bacteria 2281
887 Ga0495597_0000031 3300046542 Bacteria 133296
888 Ga0495597_0000523 3300046542 Bacteria 31819
889 Ga0495597_0000943 3300046542 Bacteria 22465
890 Ga0495597_0000990 3300046542 Bacteria 21862
891 Ga0495597_0002157 3300046542 Bacteria 12934
892 Ga0495597_0003690 3300046542 Bacteria 8781
893 Ga0495597_0006269 3300046542 Bacteria 6164
894 Ga0495597_0024977 3300046542 Bacteria 2754
895 Ga0495597_0054672 3300046542 Bacteria 1752
896 Ga0495645_0009654 3300046543 Bacteria 6749
897 Ga0495645_0038143 3300046543 Bacteria 3504
898 Ga0495645_0113923 3300046543 Bacteria 1911
899 Ga0495622_0000064 3300046557 Bacteria 93789
900 Ga0495622_0000161 3300046557 Bacteria 56444
901 Ga0495622_0016364 3300046557 Bacteria 3453
902 Ga0495622_0021079 3300046557 Bacteria 3036
903 Ga0495622_0042110 3300046557 Bacteria 2123
904 Ga0495622_0110252 3300046557 Bacteria 1260
905 Ga0495622_0166327 3300046557 Bacteria 993
906 Ga0495633_0000504 3300046558 Bacteria 39318
907 Ga0495633_0000812 3300046558 Bacteria 27646
908 Ga0495633_0001019 3300046558 Bacteria 22954
909 Ga0495633_0001449 3300046558 Bacteria 18433
910 Ga0495633_0002066 3300046558 Bacteria 14450
911 Ga0495633_0002613 3300046558 Bacteria 12604
912 Ga0495633_0009193 3300046558 Bacteria 5481
913 Ga0495633_0013731 3300046558 Bacteria 4256
914 Ga0495633_0016324 3300046558 Bacteria 3831
915 Ga0495633_0017316 3300046558 Bacteria 3688
916 Ga0495633_0023576 3300046558 Bacteria 3047
917 Ga0495633_0027732 3300046558 Bacteria 2766
918 Ga0495633_0058138 3300046558 Bacteria 1815
919 Ga0495633_0062415 3300046558 Bacteria 1744
920 Ga0495667_0053002 3300046559 Bacteria 2672
921 Ga0495656_0006814 3300046615 Bacteria 4016
922 Ga0495656_0010802 3300046615 Bacteria 3332
923 Ga0495668_0000025 3300046616 Bacteria 304546
924 Ga0495668_0000126 3300046616 Bacteria 114185
925 Ga0495668_0000810 3300046616 Bacteria 35815
926 Ga0495668_0001707 3300046616 Bacteria 20270
927 Ga0495668_0001771 3300046616 Bacteria 19723
928 Ga0495668_0001853 3300046616 Bacteria 19009
929 Ga0495668_0003631 3300046616 Bacteria 11425
930 Ga0495668_0004249 3300046616 Bacteria 10288
931 Ga0495668_0007249 3300046616 Bacteria 7115
932 Ga0495668_0007326 3300046616 Bacteria 7073
933 Ga0495668_0007725 3300046616 Bacteria 6829
934 Ga0495668_0013407 3300046616 Bacteria 4835
935 Ga0495668_0016514 3300046616 Bacteria 4291
936 Ga0495668_0023330 3300046616 Bacteria 3530
937 Ga0495668_0180468 3300046616 Bacteria 1156
938 Ga0495634_0004151 3300046642 Bacteria 11444
939 Ga0495634_0006050 3300046642 Bacteria 9231
940 Ga0495634_0032590 3300046642 Bacteria 3583
941 Ga0495634_0078814 3300046642 Bacteria 2158
942 Ga0495634_0333032 3300046642 Bacteria 912
943 Ga0495611_0001533 3300046648 Bacteria 11371
944 Ga0495611_0002226 3300046648 Bacteria 9017
945 Ga0495611_0006665 3300046648 Bacteria 4913
946 Ga0495611_0015651 3300046648 Bacteria 3242
947 Ga0495611_0022289 3300046648 Bacteria 2740
948 Ga0495611_0035625 3300046648 Bacteria 2205
949 Ga0495611_0047589 3300046648 Bacteria 1925
950 Ga0495611_0058755 3300046648 Bacteria 1744
951 Ga0495611_0061076 3300046648 Bacteria 1712
952 Ga0495625_0001407 3300046660 Bacteria 29458
953 Ga0495625_0002112 3300046660 Bacteria 22181
954 Ga0495625_0004938 3300046660 Bacteria 12397
955 Ga0495625_0008140 3300046660 Bacteria 8982
956 Ga0495625_0010929 3300046660 Bacteria 7454
957 Ga0495625_0019091 3300046660 Bacteria 5333
958 Ga0495625_0031267 3300046660 Bacteria 3961
959 Ga0495625_0078683 3300046660 Bacteria 2301
960 Ga0495625_0082972 3300046660 Bacteria 2228
961 Ga0495625_0107326 3300046660 Bacteria 1911
962 Ga0495625_0254092 3300046660 Bacteria 1140
963 Ga0495635_0032625 3300046663 Bacteria 3612
964 Ga0495659_0000032 3300046664 Bacteria 65104
965 Ga0495659_0002511 3300046664 Bacteria 5921
966 Ga0495659_0008848 3300046664 Bacteria 3206
967 Ga0495659_0056894 3300046664 Bacteria 1436
968 Ga0495659_0084371 3300046664 Bacteria 1210
969 Ga0495661_0000859 3300046665 Bacteria 28295
970 Ga0495661_0001558 3300046665 Bacteria 18895
971 Ga0495661_0003524 3300046665 Bacteria 11535
972 Ga0495661_0004711 3300046665 Bacteria 9796
973 Ga0495661_0006045 3300046665 Bacteria 8529
974 Ga0495661_0024773 3300046665 Bacteria 3883
975 Ga0495661_0032618 3300046665 Bacteria 3291
976 Ga0495661_0037121 3300046665 Bacteria 3044
977 Ga0495661_0044154 3300046665 Bacteria 2734
978 Ga0495661_0045459 3300046665 Bacteria 2685
979 Ga0495661_0045945 3300046665 Bacteria 2668
980 Ga0495661_0047817 3300046665 Bacteria 2602
981 Ga0495661_0053183 3300046665 Bacteria 2436
982 Ga0495661_0054464 3300046665 Bacteria 2401
983 Ga0495661_0055380 3300046665 Bacteria 2377
984 Ga0495661_0080705 3300046665 Bacteria 1876
985 Ga0495661_0160693 3300046665 Bacteria 1206
986 Ga0495588_0000067 3300046674 Bacteria 238958
987 Ga0495588_0014282 3300046674 Bacteria 3799
988 Ga0495588_0017593 3300046674 Bacteria 3475
989 Ga0495588_0091668 3300046674 Bacteria 1592
990 Ga0495588_0118176 3300046674 Bacteria 1397
991 Ga0495657_0022952 3300046675 Bacteria 4465
992 Ga0495657_0055230 3300046675 Bacteria 2650
993 Ga0495599_0029630 3300046678 Bacteria 3431
994 Ga0495599_0208931 3300046678 Bacteria 1197
995 Ga0495623_0003701 3300046679 Bacteria 10085
996 Ga0495623_0005752 3300046679 Bacteria 8093
997 Ga0495623_0048983 3300046679 Bacteria 2678
998 Ga0495623_0092414 3300046679 Bacteria 1855
999 Ga0495623_0112606 3300046679 Bacteria 1647
1000 Ga0495646_0002140 3300046680 Bacteria 11995
1001 Ga0495646_0005975 3300046680 Bacteria 7713
1002 Ga0495646_0006570 3300046680 Bacteria 7380
1003 Ga0495646_0014853 3300046680 Bacteria 4946
1004 Ga0495646_0019398 3300046680 Bacteria 4306
1005 Ga0495646_0098175 3300046680 Bacteria 1682
1006 Ga0495646_0221442 3300046680 Bacteria 1023
1007 Ga0495669_0000298 3300046684 Bacteria 27587
1008 Ga0495669_0000712 3300046684 Bacteria 14461
1009 Ga0495669_0012540 3300046684 Bacteria 3609
1010 Ga0495669_0055200 3300046684 Bacteria 1789
1011 Ga0495669_0139072 3300046684 Bacteria 1146
1012 Ga0495613_0009023 3300046689 Bacteria 7396
1013 Ga0495613_0010221 3300046689 Bacteria 6972
1014 Ga0495613_0013143 3300046689 Bacteria 6152
1015 Ga0495613_0209768 3300046689 Bacteria 1370
1016 Ga0495613_0333870 3300046689 Bacteria 1044
1017 Ga0495624_0000423 3300046690 Bacteria 33576
1018 Ga0495624_0005681 3300046690 Bacteria 8953
1019 Ga0495624_0022216 3300046690 Bacteria 4197
1020 Ga0495624_0022577 3300046690 Bacteria 4155
1021 Ga0495624_0035592 3300046690 Bacteria 3214
1022 Ga0495624_0053917 3300046690 Bacteria 2537
1023 Ga0495624_0072060 3300046690 Bacteria 2149
1024 Ga0495670_0001517 3300046691 Bacteria 11336
1025 Ga0495670_0005496 3300046691 Bacteria 6219
1026 Ga0495670_0007043 3300046691 Bacteria 5535
1027 Ga0495670_0011986 3300046691 Bacteria 4266
1028 Ga0495670_0013839 3300046691 Bacteria 3967
1029 Ga0495670_0055489 3300046691 Bacteria 1986
1030 Ga0495670_0076325 3300046691 Bacteria 1702
1031 Ga0495670_0096811 3300046691 Bacteria 1516
1032 Ga0495670_0230451 3300046691 Bacteria 985
1033 Ga0495671_0000001 3300046692 Bacteria 1169494
1034 Ga0495671_0000717 3300046692 Bacteria 23940
1035 Ga0495671_0000758 3300046692 Bacteria 23177
1036 Ga0495671_0001181 3300046692 Bacteria 17884
1037 Ga0495671_0001620 3300046692 Bacteria 14773
1038 Ga0495671_0273441 3300046692 Bacteria 814
1039 Ga0495649_0000321 3300046694 Bacteria 41688
1040 Ga0495649_0001148 3300046694 Bacteria 20618
1041 Ga0495649_0001798 3300046694 Bacteria 15768
1042 Ga0495649_0003100 3300046694 Bacteria 11374
1043 Ga0495649_0005392 3300046694 Bacteria 8141
1044 Ga0495649_0005907 3300046694 Bacteria 7675
1045 Ga0495649_0049644 3300046694 Bacteria 2279
1046 Ga0495649_0068894 3300046694 Bacteria 1898
1047 Ga0495649_0119489 3300046694 Bacteria 1394
1048 Ga0495649_0127574 3300046694 Bacteria 1343
1049 Ga0495649_0148815 3300046694 Bacteria 1230
1050 Ga0495589_0000324 3300046794 Bacteria 37487
1051 Ga0495589_0000701 3300046794 Bacteria 21813
1052 Ga0495589_0001143 3300046794 Bacteria 15786
1053 Ga0495589_0001662 3300046794 Bacteria 12744
1054 Ga0495589_0004539 3300046794 Bacteria 7378
1055 Ga0495589_0006006 3300046794 Bacteria 6413
1056 Ga0495589_0006673 3300046794 Bacteria 6080
1057 Ga0495589_0017258 3300046794 Bacteria 3706
1058 Ga0495589_0028561 3300046794 Bacteria 2814
1059 Ga0495589_0034842 3300046794 Bacteria 2525
1060 Ga0495600_0000436 3300046809 Bacteria 21410
1061 Ga0495600_0005178 3300046809 Bacteria 7841
1062 Ga0495600_0052042 3300046809 Bacteria 2673
1063 Ga0495660_0000026 3300046810 Bacteria 256223
1064 Ga0495660_0000449 3300046810 Bacteria 34312
1065 Ga0495660_0000947 3300046810 Bacteria 21222
1066 Ga0495660_0001734 3300046810 Bacteria 14570
1067 Ga0495660_0003330 3300046810 Bacteria 9966
1068 Ga0495660_0016493 3300046810 Bacteria 4259
1069 Ga0495660_0028972 3300046810 Bacteria 3126
1070 Ga0495660_0043086 3300046810 Bacteria 2490
1071 Ga0495660_0140680 3300046810 Bacteria 1201
1072 Ga0495581_0004134 3300047315 Bacteria 8361
1073 Ga0495581_0040296 3300047315 Bacteria 2703
1074 Ga0495581_0073848 3300047315 Bacteria 1973
1075 Ga0495581_0090796 3300047315 Bacteria 1772
1076 Ga0495604_0011054 3300047317 Bacteria 7164
1077 Ga0495604_0031143 3300047317 Bacteria 4232
1078 Ga0495604_0037004 3300047317 Bacteria 3845
1079 Ga0495604_0050470 3300047317 Bacteria 3230
1080 Ga0495604_0051280 3300047317 Bacteria 3199
1081 Ga0495604_0059919 3300047317 Bacteria 2916
1082 Ga0495604_0100182 3300047317 Bacteria 2130
1083 Ga0495604_0158902 3300047317 Bacteria 1598
1084 Ga0495604_0209666 3300047317 Bacteria 1347
1085 Ga0495604_0337743 3300047317 Bacteria 1003
1086 Ga0495604_0362930 3300047317 Bacteria 960
1087 Ga0495636_0002332 3300047318 Bacteria 7296
1088 Ga0495636_0003310 3300047318 Bacteria 6246
1089 Ga0495636_0011579 3300047318 Bacteria 3492
1090 Ga0495636_0053613 3300047318 Bacteria 1693
1091 Ga0495636_0068745 3300047318 Bacteria 1508
1092 Ga0495636_0069552 3300047318 Bacteria 1500
1093 Ga0495636_0135948 3300047318 Bacteria 1095
1094 Ga0495674_0004218 3300047319 Bacteria 13839
1095 Ga0495674_0005464 3300047319 Bacteria 12208
1096 Ga0495674_0015269 3300047319 Bacteria 7184
1097 Ga0495674_0016821 3300047319 Bacteria 6821
1098 Ga0495674_0097449 3300047319 Bacteria 2505
1099 Ga0495674_0464624 3300047319 Bacteria 1015
1100 Ga0495672_0000041 3300047320 Bacteria 267545
1101 Ga0495672_0000045 3300047320 Bacteria 255145
1102 Ga0495672_0000050 3300047320 Bacteria 240336
1103 Ga0495672_0000454 3300047320 Bacteria 48596
1104 Ga0495672_0000811 3300047320 Bacteria 33662
1105 Ga0495672_0001250 3300047320 Bacteria 25523
1106 Ga0495672_0001396 3300047320 Bacteria 23770
1107 Ga0495672_0001789 3300047320 Bacteria 20634
1108 Ga0495672_0008445 3300047320 Bacteria 7600
1109 Ga0495672_0025558 3300047320 Bacteria 3777
1110 Ga0495672_0087189 3300047320 Bacteria 1724
1111 Ga0495676_0000235 3300047321 Bacteria 44374
1112 Ga0495676_0003028 3300047321 Bacteria 15199
1113 Ga0495676_0013951 3300047321 Bacteria 7202
1114 Ga0495676_0030625 3300047321 Bacteria 4562
1115 Ga0495676_0040134 3300047321 Bacteria 3866
1116 Ga0495676_0040446 3300047321 Bacteria 3848
1117 Ga0495676_0063173 3300047321 Bacteria 2888
1118 Ga0495676_0080040 3300047321 Bacteria 2482
1119 Ga0495676_0168174 3300047321 Bacteria 1545
1120 Ga0495680_0001011 3300047322 Bacteria 31241
1121 Ga0495680_0037858 3300047322 Bacteria 3861
1122 Ga0495680_0230607 3300047322 Bacteria 1318
1123 Ga0495683_0000203 3300047323 Bacteria 56418
1124 Ga0495683_0000434 3300047323 Bacteria 33166
1125 Ga0495683_0001204 3300047323 Bacteria 17670
1126 Ga0495683_0002952 3300047323 Bacteria 10061
1127 Ga0495683_0004558 3300047323 Bacteria 7834
1128 Ga0495683_0005418 3300047323 Bacteria 7083
1129 Ga0495683_0005959 3300047323 Bacteria 6695
1130 Ga0495683_0010339 3300047323 Bacteria 4935
1131 Ga0495683_0011166 3300047323 Bacteria 4733
1132 Ga0495683_0022223 3300047323 Bacteria 3262
1133 Ga0495683_0022821 3300047323 Bacteria 3217
1134 Ga0495683_0035286 3300047323 Bacteria 2542
1135 Ga0495683_0116433 3300047323 Bacteria 1271
1136 Ga0495687_000013 3300047443 Bacteria 371058
1137 Ga0495687_000127 3300047443 Bacteria 117520
1138 Ga0495687_000143 3300047443 Bacteria 108306
1139 Ga0495687_000871 3300047443 Bacteria 32002
1140 Ga0495687_002404 3300047443 Bacteria 15091
1141 Ga0495687_002441 3300047443 Bacteria 14948
1142 Ga0495687_009000 3300047443 Bacteria 5640
1143 Ga0495687_010408 3300047443 Bacteria 5102
1144 Ga0495687_018731 3300047443 Bacteria 3413
1145 Ga0495687_020010 3300047443 Bacteria 3270
1146 Ga0495687_042439 3300047443 Bacteria 1987
1147 Ga0495675_0003234 3300047444 Bacteria 9794
1148 Ga0495675_0003315 3300047444 Bacteria 9682
1149 Ga0495675_0004776 3300047444 Bacteria 8233
1150 Ga0495675_0017249 3300047444 Bacteria 4574
1151 Ga0495677_0000098 3300047445 Bacteria 44329
1152 Ga0495677_0001274 3300047445 Bacteria 10088
1153 Ga0495677_0001303 3300047445 Bacteria 9966
1154 Ga0495677_0001675 3300047445 Bacteria 8921
1155 Ga0495677_0006417 3300047445 Bacteria 4444
1156 Ga0495677_0014272 3300047445 Bacteria 2893
1157 Ga0495677_0029761 3300047445 Bacteria 1986
1158 Ga0495677_0091810 3300047445 Bacteria 1144
1159 Ga0495677_0104271 3300047445 Bacteria 1075
1160 Ga0495677_0134160 3300047445 Bacteria 948
1161 Ga0495679_000025 3300047446 Bacteria 198386
1162 Ga0495679_000933 3300047446 Bacteria 18193
1163 Ga0495679_001000 3300047446 Bacteria 17403
1164 Ga0495679_001499 3300047446 Bacteria 13187
1165 Ga0495679_026881 3300047446 Bacteria 1905
1166 Ga0495685_000023 3300047447 Bacteria 68601
1167 Ga0495685_009105 3300047447 Bacteria 3311
1168 Ga0495685_023128 3300047447 Bacteria 2138
1169 Ga0495685_084782 3300047447 Bacteria 1053
1170 Ga0495673_0000006 3300047469 Bacteria 908691
1171 Ga0495673_0000014 3300047469 Bacteria 599202
1172 Ga0495673_0000430 3300047469 Bacteria 47639
1173 Ga0495673_0005979 3300047469 Bacteria 7243
1174 Ga0495673_0046411 3300047469 Bacteria 1925
1175 Ga0495681_0000647 3300047470 Bacteria 26531
1176 Ga0495681_0002407 3300047470 Bacteria 13392
1177 Ga0495681_0009526 3300047470 Bacteria 5969
1178 Ga0495681_0011512 3300047470 Bacteria 5262
1179 Ga0495681_0012964 3300047470 Bacteria 4867
1180 Ga0495681_0013882 3300047470 Bacteria 4653
1181 Ga0495681_0031460 3300047470 Bacteria 2685
1182 Ga0495684_0069263 3300047471 Bacteria 2683
1183 Ga0495686_0000288 3300047472 Bacteria 88523
1184 Ga0495686_0001006 3300047472 Bacteria 34250
1185 Ga0495686_0009590 3300047472 Bacteria 6958
1186 Ga0495686_0014755 3300047472 Bacteria 5368
1187 Ga0495686_0054022 3300047472 Bacteria 2516
1188 Ga0495686_0059954 3300047472 Bacteria 2367
1189 Ga0495686_0066606 3300047472 Bacteria 2225
1190 Ga0495686_0093141 3300047472 Bacteria 1827
1191 Ga0495593_0002218 3300047673 Bacteria 11644
1192 Ga0495593_0007331 3300047673 Bacteria 6461
1193 Ga0495593_0007699 3300047673 Bacteria 6286
1194 Ga0495593_0047822 3300047673 Bacteria 2274
1195 Ga0495593_0104991 3300047673 Bacteria 1446
1196 Ga0495602_0008398 3300048088 Bacteria 10790
1197 Ga0495602_0025256 3300048088 Bacteria 5750
1198 Ga0495602_0027756 3300048088 Bacteria 5433
1199 Ga0495602_0069429 3300048088 Bacteria 3020
1200 Ga0495602_0077689 3300048088 Bacteria 2807
1201 Ga0495602_0147863 3300048088 Bacteria 1851
1202 Ga0495602_0332509 3300048088 Bacteria 1101
1203 Ga0495614_0003062 3300048089 Bacteria 7454
1204 Ga0495614_0007673 3300048089 Bacteria 4795
1205 Ga0495614_0008050 3300048089 Bacteria 4684
1206 Ga0495614_0023083 3300048089 Bacteria 2683
1207 Ga0495626_0000003 3300048091 Bacteria 427774
1208 Ga0495626_0000096 3300048091 Bacteria 114087
1209 Ga0495626_0001123 3300048091 Bacteria 22492
1210 Ga0495626_0004243 3300048091 Bacteria 8858
1211 Ga0495626_0006046 3300048091 Bacteria 6955
1212 Ga0495626_0006705 3300048091 Bacteria 6522
1213 Ga0495626_0008280 3300048091 Bacteria 5720
1214 Ga0495626_0009019 3300048091 Bacteria 5408
1215 Ga0495626_0009836 3300048091 Bacteria 5142
1216 Ga0495626_0028456 3300048091 Bacteria 2709
1217 Ga0495626_0031684 3300048091 Bacteria 2542
1218 Ga0496100_0005002 3300048903 Bacteria 7093
1219 Ga0496100_0114370 3300048903 Bacteria 1879
1220 Ga0496100_0296993 3300048903 Bacteria 1208
1221 Ga0496101_0012730 3300048904 Bacteria 5623
1222 Ga0496101_0209828 3300048904 Bacteria 1508
1223 Ga0496101_0239263 3300048904 Bacteria 1412
1224 Ga0496102_0000194 3300048905 Bacteria 83095
1225 Ga0496102_0001533 3300048905 Bacteria 20384
1226 Ga0496102_0023734 3300048905 Bacteria 5450
1227 Ga0496102_0033340 3300048905 Bacteria 4627
1228 Ga0496102_0142210 3300048905 Bacteria 2250
1229 Ga0496103_0005046 3300048906 Bacteria 7963
1230 Ga0496103_0018291 3300048906 Bacteria 4203
1231 Ga0496103_0020123 3300048906 Bacteria 4007
1232 Ga0496103_0039130 3300048906 Bacteria 2913
1233 Ga0496103_0119048 3300048906 Bacteria 1681
1234 Ga0496104_0123829 3300048907 Bacteria 2482
1235 Ga0496104_0198519 3300048907 Bacteria 1918
1236 Ga0496104_0211765 3300048907 Bacteria 1850
1237 Ga0496104_0263911 3300048907 Bacteria 1634
1238 Ga0496105_0210786 3300048908 Bacteria 1584
1239 Ga0496105_0466540 3300048908 Bacteria 995
1240 Ga0496106_0000029 3300048909 Bacteria 141097
1241 Ga0496106_0004373 3300048909 Bacteria 10498
1242 Ga0496106_0009286 3300048909 Bacteria 7269
1243 Ga0496106_0589613 3300048909 Bacteria 891
1244 Ga0496107_0015835 3300048910 Bacteria 5289
1245 Ga0496107_0098698 3300048910 Bacteria 2139
1246 Ga0496108_0209836 3300048911 Bacteria 1690
1247 Ga0496109_0023422 3300048912 Bacteria 5482
1248 Ga0496109_0052532 3300048912 Bacteria 3715
1249 Ga0496109_0142211 3300048912 Bacteria 2244
1250 Ga0496109_0182179 3300048912 Bacteria 1973
1251 Ga0496110_0000146 3300048913 Bacteria 41791
1252 Ga0496110_0008873 3300048913 Bacteria 8104
1253 Ga0496110_0050203 3300048913 Bacteria 3662
1254 Ga0496110_0101238 3300048913 Bacteria 2583
1255 Ga0496110_0264572 3300048913 Bacteria 1565
1256 Ga0496111_0050158 3300048914 Bacteria 3009
1257 Ga0496111_0053070 3300048914 Bacteria 2928
1258 Ga0496111_0091545 3300048914 Bacteria 2228
1259 Ga0496111_0114549 3300048914 Bacteria 1988
1260 Ga0496111_0133655 3300048914 Bacteria 1837
1261 Ga0496113_0006016 3300048916 Bacteria 7639
1262 Ga0496113_0066819 3300048916 Bacteria 2724
1263 Ga0496113_0203703 3300048916 Bacteria 1573
1264 Ga0496114_0002351 3300048917 Bacteria 14395
1265 Ga0496114_0023215 3300048917 Bacteria 5060
1266 Ga0496114_0092696 3300048917 Bacteria 2567
1267 Ga0496114_0474903 3300048917 Bacteria 1106
1268 Ga0496115_0004356 3300048918 Bacteria 10244
1269 Ga0496115_0053693 3300048918 Bacteria 3234
1270 Ga0496115_0060554 3300048918 Bacteria 3051
1271 Ga0496115_0115306 3300048918 Bacteria 2209
1272 Ga0496115_0137782 3300048918 Bacteria 2013
1273 Ga0496116_0005854 3300048919 Bacteria 11295
1274 Ga0496116_0006608 3300048919 Bacteria 10492
1275 Ga0496116_0025634 3300048919 Bacteria 4331
1276 Ga0496116_0029456 3300048919 Bacteria 3957
1277 Ga0496116_0041014 3300048919 Bacteria 3180
1278 Ga0496116_0108680 3300048919 Bacteria 1637
1279 Ga0496117_0000001 3300048920 Bacteria 2526244
1280 Ga0496117_0001537 3300048920 Bacteria 32791
1281 Ga0496117_0012221 3300048920 Bacteria 7592
1282 Ga0496117_0025988 3300048920 Bacteria 4590
1283 Ga0496117_0148183 3300048920 Bacteria 1393
1284 Ga0496117_0170820 3300048920 Bacteria 1262
1285 Ga0496118_0000008 3300048921 Bacteria 644537
1286 Ga0496118_0001933 3300048921 Bacteria 29376
1287 Ga0496118_0003947 3300048921 Bacteria 18133
1288 Ga0496118_0005785 3300048921 Bacteria 13877
1289 Ga0496118_0056141 3300048921 Bacteria 2963
1290 Ga0496118_0063721 3300048921 Bacteria 2710
1291 Ga0496118_0077451 3300048921 Bacteria 2358
1292 Ga0496119_0071815 3300048922 Bacteria 2025
1293 Ga0496120_0021798 3300048923 Bacteria 4040
1294 Ga0496121_0000800 3300048924 Bacteria 57387
1295 Ga0496121_0001199 3300048924 Bacteria 45399
1296 Ga0496121_0011117 3300048924 Bacteria 10043
1297 Ga0496121_0014177 3300048924 Bacteria 8487
1298 Ga0496121_0072962 3300048924 Bacteria 2753
1299 Ga0496121_0075566 3300048924 Bacteria 2691
1300 Ga0496121_0100606 3300048924 Bacteria 2231
1301 Ga0496121_0236917 3300048924 Bacteria 1274
1302 Ga0496121_0256273 3300048924 Bacteria 1210
1303 Ga0496122_0000445 3300048925 Bacteria 86566
1304 Ga0496122_0000457 3300048925 Bacteria 84895
1305 Ga0496122_0006540 3300048925 Bacteria 13330
1306 Ga0496122_0007790 3300048925 Bacteria 11777
1307 Ga0496122_0014503 3300048925 Bacteria 7608
1308 Ga0496122_0047972 3300048925 Bacteria 3290
1309 Ga0496122_0069887 3300048925 Bacteria 2512
1310 Ga0496123_0000321 3300048926 Bacteria 91682
1311 Ga0496123_0001956 3300048926 Bacteria 26767
1312 Ga0496123_0003306 3300048926 Bacteria 18274
1313 Ga0496123_0003551 3300048926 Bacteria 17303
1314 Ga0496123_0005710 3300048926 Bacteria 12404
1315 Ga0496123_0073786 3300048926 Bacteria 2115
1316 Ga0496124_0009346 3300048927 Bacteria 10101
1317 Ga0496124_0011253 3300048927 Bacteria 8963
1318 Ga0496124_0016799 3300048927 Bacteria 6937
1319 Ga0496124_0028528 3300048927 Bacteria 4991
1320 Ga0496124_0073172 3300048927 Bacteria 2836
1321 Ga0496124_0151487 3300048927 Bacteria 1818
1322 Ga0496124_0380958 3300048927 Bacteria 986
1323 Ga0496125_0000642 3300048928 Bacteria 58307
1324 Ga0496125_0003245 3300048928 Bacteria 20034
1325 Ga0496125_0005554 3300048928 Bacteria 13954
1326 Ga0496125_0020567 3300048928 Bacteria 6192
1327 Ga0496125_0035240 3300048928 Bacteria 4395
1328 Ga0496125_0051880 3300048928 Bacteria 3378
1329 Ga0496125_0073102 3300048928 Bacteria 2668
1330 Ga0496126_0000192 3300048929 Bacteria 136536
1331 Ga0496126_0000278 3300048929 Bacteria 107983
1332 Ga0496126_0000374 3300048929 Bacteria 92435
1333 Ga0496126_0003722 3300048929 Bacteria 19017
1334 Ga0496126_0004761 3300048929 Bacteria 15979
1335 Ga0496126_0024456 3300048929 Bacteria 5832
1336 Ga0496126_0410429 3300048929 Bacteria 1097
1337 Ga0495678_000016 3300049459 Bacteria 303426
1338 Ga0495678_000408 3300049459 Bacteria 43359
1339 Ga0495678_000967 3300049459 Bacteria 24794
1340 Ga0495678_001068 3300049459 Bacteria 23200
1341 Ga0495678_001706 3300049459 Bacteria 16499
1342 Ga0495678_006463 3300049459 Bacteria 6234
1343 Ga0495678_026933 3300049459 Bacteria 2446
1344 Ga0495678_037773 3300049459 Bacteria 1959
1345 Ga0495678_043054 3300049459 Bacteria 1795
1346 Ga0495678_062706 3300049459 Bacteria 1391
1347 Ga0495682_0000351 3300049460 Bacteria 33719
1348 Ga0495682_0001002 3300049460 Bacteria 16842
1349 Ga0495682_0002269 3300049460 Bacteria 9225
1350 Ga0495682_0003255 3300049460 Bacteria 7277
1351 Ga0501034_0000761 3300049571 Bacteria 48401
1352 Ga0501034_0153020 3300049571 Bacteria 2282
1353 Ga0501048_0299588 3300049582 Bacteria 1144
1354 Ga0501207_024120 3300049654 Bacteria 991
1355 Ga0501222_007670 3300049662 Bacteria 1440
1356 Ga0501269_000654 3300049766 Bacteria 5963
1357 Ga0501279_000432 3300049775 Bacteria 5560
1358 Ga0501279_001026 3300049775 Bacteria 3691
1359 Ga0501035_0036387 3300049822 Bacteria 4461
1360 nmdc:mga03683_107944_c1 3300050489 Bacteria 1228
1361 nmdc:mga0k408_310_c1 3300050493 Bacteria 26403
1362 Ga0495601_0066409 3300053077 Bacteria 2296
1363 Ga0495655_0069373 3300053083 Bacteria 982
1364 Ga0500646_0000697 3300053090 Bacteria 9611
1365 Ga0500583_0204039 3300053092 Bacteria 982
1366 Ga0500594_0001783 3300053118 Bacteria 4673
1367 Ga0500594_0084069 3300053118 Bacteria 956
1368 Ga0500618_003044 3300053125 Bacteria 5951
1369 Ga0500655_011340 3300053133 Bacteria 1614
1370 Ga0500586_000184 3300053145 Bacteria 11801
1371 Ga0500586_045193 3300053145 Bacteria 1506
1372 Ga0500604_0000643 3300053151 Bacteria 9590
1373 Ga0500622_0164616 3300053156 Bacteria 1037
1374 Ga0587084_006828 3300059477 Bacteria 1398
1375 Ga0587084_015411 3300059477 Bacteria 1079
1376 Ga0587093_005130 3300059478 Bacteria 1369
1377 Ga0587093_020275 3300059478 Bacteria 883
1378 Ga0587066_005723 3300059490 Bacteria 1605
1379 Ga0587066_035093 3300059490 Bacteria 916
1380 Ga0587070_007567 3300059491 Bacteria 1511
1381 Ga0587070_015365 3300059491 Bacteria 1211
1382 Ga0587070_024370 3300059491 Bacteria 1047
1383 Ga0587077_008329 3300059493 Bacteria 1541
1384 Ga0587077_008599 3300059493 Bacteria 1525
1385 Ga0587077_009603 3300059493 Bacteria 1473
1386 Ga0587082_009182 3300059504 Bacteria 1397
1387 Ga0587082_029610 3300059504 Bacteria 946
1388 Ga0587083_0003727 3300059505 Bacteria 2057
1389 Ga0587083_0040849 3300059505 Bacteria 971
1390 Ga0587085_007429 3300059506 Bacteria 1368
1391 Ga0587085_018438 3300059506 Bacteria 1034
1392 Ga0587086_009393 3300059507 Bacteria 1162
1393 Ga0587088_010421 3300059508 Bacteria 1361
1394 Ga0587088_017073 3300059508 Bacteria 1164
1395 Ga0587088_045083 3300059508 Bacteria 844
1396 Ga0587091_011531 3300059511 Bacteria 1381
1397 Ga0587092_013010 3300059512 Bacteria 1183
1398 Ga0587094_004986 3300059513 Bacteria 1533
1399 Ga0587098_001893 3300059604 Bacteria 1691
1400 Ga0587101_009564 3300059623 Bacteria 1200
1401 Ga0587101_017774 3300059623 Bacteria 989
1402 Ga0587101_020435 3300059623 Bacteria 948
1403 Ga0587109_009454 3300059624 Bacteria 1531
1404 Ga0587117_007501 3300059627 Bacteria 1252
1405 Ga0587128_020648 3300059630 Bacteria 1008
1406 Ga0587062_002963 3300059639 Bacteria 1673
1407 Ga0587067_000317 3300059640 Bacteria 3964
1408 Ga0587067_008507 3300059640 Bacteria 1502
1409 Ga0587068_003962 3300059641 Bacteria 1929
1410 Ga0587068_015607 3300059641 Bacteria 1197
1411 Ga0587068_020253 3300059641 Bacteria 1085
1412 Ga0587072_000189 3300059643 Bacteria 5370
1413 Ga0587072_005267 3300059643 Bacteria 1926
1414 Ga0587072_022524 3300059643 Bacteria 1126
1415 Ga0587075_009421 3300059644 Bacteria 1271
1416 Ga0587076_004234 3300059645 Bacteria 1777
1417 Ga0587078_011762 3300059646 Bacteria 1021
1418 Ga0587079_015127 3300059647 Bacteria 1306
1419 Ga0587079_016765 3300059647 Bacteria 1262
1420 Ga0587100_001777 3300059648 Bacteria 1309
1421 Ga0587111_0002370 3300060346 Bacteria 2499
1422 Ga0587111_0004264 3300060346 Bacteria 2113
1423 Ga0587111_0006128 3300060346 Bacteria 1892
1424 Ga0466962_0000528 3300061719 Bacteria 16721
1425 Ga0466962_0009971 3300061719 Bacteria 4556
1426 Ga0466962_0014844 3300061719 Bacteria 3753
1427 Ga0466962_0025774 3300061719 Bacteria 2822
1428 Ga0466962_0058010 3300061719 Bacteria 1848
1429 Ga0466962_0062622 3300061719 Bacteria 1776
1430 Ga0466962_0215830 3300061719 Bacteria 939
1431 2501071389 2501025501 Bacteria 7768574
1432 2501411097 2501025504 Bacteria 8008976
1433 2509129068 2508501125 Bacteria 7208311
1434 2510250814 2510065045 Bacteria 7761063
1435 2511096450 2510917014 Bacteria 8296963
1436 2511102852 2510917015 Bacteria 7950052
1437 2511251113 2511231003 Bacteria 5606035
1438 2511384642 2511231026 Bacteria 5225445
1439 2512346366 2512047030 Bacteria 9031815
1440 2513552157 2513237082 Bacteria 8640282
1441 2513560944 2513237083 Bacteria 8410967
1442 2513952766 2513237150 Bacteria 6553639
1443 2513960992 2513237151 Bacteria 6309801
1444 2514045113 2513237165 Bacteria 6771773
1445 2515679738 2515154122 Bacteria 8609520
1446 2515692120 2515154123 Bacteria 6387382
1447 2516020281 2515154189 Bacteria 9629850
1448 2521559140 2521172590 Bacteria 5047645
1449 2527075234 2526164713 Bacteria 6780608
1450 2550696296 2548876994 Bacteria 4904866
1451 2553003974 2551306416 Bacteria 6152985
1452 2597032151 2596583598 Bacteria 5251611
1453 2599444269 2599185178 Bacteria 5365746
1454 2600809930 2600255067 Bacteria 6795583
1455 2601670965 2600255292 Bacteria 6300551
1456 2643788322 2643221554 Bacteria 6603920
1457 2643798166 2643221556 Bacteria 7251154
1458 2644030306 2643221603 Bacteria 6147767
1459 2644213750 2643221638 Bacteria 6579467
1460 2644248967 2643221644 Bacteria 6865017
1461 2644253875 2643221645 Bacteria 7207331
1462 2644356648 2643221664 Bacteria 7272945
1463 2644475163 2643221684 Bacteria 7145183
1464 2719639952 2718217991 Bacteria 7829542
1465 2738742923 2738541280 Bacteria 6630198
1466 2738820696 2738541296 Bacteria 7285013
1467 2738825122 2738541297 Bacteria 6549566
1468 2738833176 2738541298 Bacteria 7286732
1469 2738844611 2738541300 Bacteria 6675882
1470 2738874704 2738541306 Bacteria 7284992
1471 2739148919 2738541357 Bacteria 6549408
1472 2739186333 2738543002 Bacteria 7284546
1473 2739190838 2738543003 Bacteria 6549560
1474 2739221302 2738543008 Bacteria 7282815
1475 2739276135 2738543018 Bacteria 6718814
1476 2739317315 2738543026 Bacteria 6549408
1477 2739335556 2738543029 Bacteria 6549249
1478 2739345341 2738543030 Bacteria 6719714
1479 2746089567 2744054900 Bacteria 8399525
1480 2746098426 2744054901 Bacteria 8397047
1481 2753566730 2751185846 Bacteria 7242164
1482 2765570322 2765235838 Bacteria 5445269
1483 2808971081 2808606384 Bacteria 8474373
1484 2808981399 2808606386 Bacteria 4471946
1485 2809006016 2808606390 Bacteria 8476311
1486 2809013048 2808606391 Bacteria 8308166
1487 2809128985 2808606415 Bacteria 4576710
1488 2809144615 2808606418 Bacteria 6724496
1489 2809148605 2808606419 Bacteria 4576925
1490 2819545339 2818991436 Bacteria 5376622
1491 2819591471 2818991445 Bacteria 4955017
1492 2819615656 2818991449 Bacteria 5518009
1493 2819620141 2818991450 Bacteria 6962147
1494 2821133720 2821131069 Bacteria 6108407
1495 2834641949 2834641062 Bacteria 5559922
1496 2839096727 2839094727 Bacteria 5534556
1497 2842327418 2842324504 Bacteria 9364110
1498 2842351975 2842348783 Bacteria 9002918
1499 2842458170 2842454564 Bacteria 8730687
1500 2842717217 2842711865 Bacteria 7155354
1501 2852621139 2852618963 Bacteria 4577824
1502 2857362358 2857357740 Bacteria 9937880
1503 2857547737 2857547612 Bacteria 6179999
1504 2857553825 2857553236 Bacteria 6166726
1505 2857560383 2857558681 Bacteria 6617694
1506 2857565512 2857564685 Bacteria 6290584
1507 2857580980 2857576091 Bacteria 5465855
1508 2883088827 2883087390 Bacteria 9532701
1509 2884816632 2884811622 Bacteria 5552861
1510 2884837279 2884836552 Bacteria 5219991
1511 2884853570 2884852848 Bacteria 5221161
1512 2885086187 2885080285 Bacteria 6355622
1513 2885268479 2885266251 Bacteria 4796748
1514 2885278858 2885270888 Bacteria 9831543
1515 2896155313 2896154374 Bacteria 5221518
1516 2900578812 2900577576 Bacteria 5438534
1517 2900635143 2900634093 Bacteria 10263517
1518 2902689613 2902682994 Bacteria 8951596
1519 2904430568 2904424332 Bacteria 7633521
1520 2904443461 2904439833 Bacteria 5931679
1521 2904484852 2904483920 Bacteria 7545285
1522 2904532443 2904530477 Bacteria 5876334
1523 2904584913 2904584206 Bacteria 6028872
1524 2904591435 2904589729 Bacteria 6113573
1525 2904605458 2904601388 Bacteria 5884906
1526 2919048298 2919046199 Bacteria 5567169
1527 2919081230 2919079590 Bacteria 5946433
1528 2919480449 2919476304 Bacteria 5888696
1529 2919530577 2919527303 Bacteria 7718827
1530 2923512840 2923510766 Bacteria 5926163
1531 2928063248 2928058823 Bacteria 5520022
1532 2928110300 2928108538 Bacteria 7360024
1533 2928132789 2928130867 Bacteria 5467269
1534 2928138566 2928135762 Bacteria 7259641
1535 2928505371 2928503688 Bacteria 7268108
1536 2932412342 2932410948 Bacteria 6312192
1537 2932419857 2932416698 Bacteria 6315112
1538 2945937020 2945934425 Bacteria 7444609
1539 2990706252 2990703756 Bacteria 7715990
1540 642423076 641736151 Bacteria 7477263
1541 642621292 642555113 Bacteria 8214658
1542 644747629 644736347 Bacteria 6476522
1543 8003404506 8003400568 Bacteria 5535898
1544 8003955512 8003955200 Bacteria 8601927
1545 8047678175 8047673197 Bacteria 7395230
1546 8055268344 8055266321 Bacteria 7999742
1547 8055302336 8055301274 Bacteria 8587385
1548 Ga0495610_0002201
1549 JGI24741J21665_1000156
1550 JGI24740J21852_10002175
1551 JGI24740J21852_10003164
1552 JGI24740J21852_10019148
1553 JGI24739J22299_10028602
1554 JGI24735J21928_10003035
1555 JGI25155J39150_1000774
1556 JGI25156J39149_1000426
1557 JGI25156J39149_1001100
1558 JGI25156J39149_1001378
1559 JGI25156J39149_1002013
1560 JGI25156J39149_1003563
1561 JGI25162J39368_1000664
1562 JGI25154J39366_1000581
1563 JGI25154J39366_1001073
1564 JGI25154J39366_1001965
1565 JGI25154J39366_1002270
1566 JGI25157J39369_1000450
1567 JGI25152J39213_1000082
1568 JGI25150J39212_1002994
1569 JGI25159J45721_1002028
1570 JGI25159J45721_1002859
1571 JGI25159J45721_1006376
1572 JGI25151J46595_10002737
1573 JGI25151J46595_10064361
1574 JGI25165J46597_1000776
1575 JGI25165J46597_1001470
1576 JGI25153J46596_10007670
1577 rootH2_10081186
1578 rootH1_10047789
1579 JGI26128J50194_1000689
1580 JGI25160J50197_1003402
1581 JGI25161J50226_1000609
1582 JGI25161J50226_1001244
1583 Ga0007417J51691_1060715
1584 Ga0007410J51695_1074447
1585 Ga0007409J51694_1026520
1586 Ga0007409J51694_1057268
1587 Ga0007416J51690_1033224
1588 Ga0007416J51690_1043106
1589 Ga0032354_1065010
1590 Ga0055538_1000030
1591 Ga0055538_1000305
1592 Ga0055539_1000040
1593 Ga0055539_1000062
1594 Ga0055539_1000324
1595 Ga0055533_1000050
1596 Ga0055533_1000218
1597 Ga0055533_1000305
1598 Ga0055533_1000522
1599 Ga0055533_1001757
1600 Ga0055532_1000001
1601 Ga0055532_1000019
1602 Ga0055532_1000101
1603 Ga0055525_1000060
1604 Ga0055525_1000133
1605 Ga0055525_1000439
1606 Ga0055525_1000592
1607 Ga0055525_1002445
1608 Ga0055527_1000002
1609 Ga0055527_1000558
1610 Ga0055535_1000001
1611 Ga0055535_1000014
1612 Ga0055535_1007396
1613 Ga0055542_1000001
1614 Ga0055529_1000026
1615 Ga0055529_1000086
1616 Ga0055529_1000154
1617 Ga0055526_1000237
1618 Ga0055526_1000523
1619 Ga0055526_1000525
1620 Ga0055526_1002040
1621 Ga0055526_1003137
1622 Ga0055526_1007272
1623 Ga0055526_1008504
1624 Ga0055526_1012536
1625 Ga0055537_1000111
1626 Ga0055537_1004903
1627 Ga0055524_1000015
1628 Ga0055524_1000970
1629 Ga0055524_1001551
1630 Ga0055524_1001982
1631 Ga0055524_1002372
1632 Ga0055536_1000034
1633 Ga0055534_1000509
1634 Ga0055534_1002215
1635 Ga0055534_1005959
1636 Ga0055528_1010241
1637 Ga0055528_1011563
1638 Ga0055531_10003700
1639 Ga0055541_1000027
1640 Ga0055541_1000213
1641 Ga0055541_1001407
1642 Ga0055543_1000588
1643 Ga0055543_1001327
1644 Ga0065165_1000286
1645 Ga0065165_1000465
1646 Ga0065165_1001962
1647 Ga0065165_1044858
1648 Ga0070658_10000863
1649 Ga0070658_10066647
1650 Ga0070658_10152102
1651 Ga0070660_100000895
1652 Ga0070660_100006100
1653 Ga0070660_100019090
1654 Ga0070661_100000088
1655 Ga0070661_100023005
1656 Ga0070659_100005584
1657 Ga0070659_100038991
1658 Ga0070659_100069361
1659 Ga0070667_100168707
1660 Ga0070667_100300751
1661 Ga0070663_100000010
1662 Ga0070678_100199329
1663 Ga0070662_100093538
1664 Ga0068853_100165324
1665 Ga0068855_100000137
1666 Ga0068855_100003932
1667 Ga0068855_100067541
1668 Ga0068855_100207320
1669 Ga0068855_100263049
1670 Ga0068855_100479311
1671 Ga0068855_100698765
1672 Ga0070664_100000005
1673 Ga0068857_100005050
1674 Ga0068854_100000104
1675 Ga0068856_100000054
1676 Ga0068856_100602431
1677 Ga0068856_100688596
1678 Ga0068852_100144017
1679 Ga0068851_10027919
1680 Ga0068851_10219316
1681 Ga0068863_100298389
1682 Ga0068858_100043574
1683 Ga0068860_100915436
1684 Ga0070716_100147440
1685 Ga0075362_10017642
1686 Ga0075366_10001663
1687 Ga0075366_10127923
1688 Ga0079104_1000333
1689 Ga0079104_1010533
1690 Ga0079104_1015769
1691 Ga0099826_10000003
1692 Ga0099826_10000004
1693 Ga0105251_10000043
1694 Ga0105251_10001385
1695 Ga0105244_10001962
1696 Ga0105244_10003735
1697 Ga0105244_10048799
1698 Ga0105240_10000569
1699 Ga0105240_10005998
1700 Ga0105240_10006748
1701 Ga0105240_10027922
1702 Ga0105240_10038201
1703 Ga0105240_10092814
1704 Ga0105240_10278890
1705 Ga0105243_10062725
1706 Ga0105241_10113920
1707 Ga0105248_10011496
1708 Ga0105237_10085456
1709 Ga0105237_10422321
1710 Ga0105237_10657194
1711 Ga0105238_10000547
1712 Ga0105238_10023411
1713 Ga0105239_10042299
1714 Ga0105246_10175762
1715 Ga0157373_10002542
1716 Ga0157373_10029907
1717 Ga0157371_10000001
1718 Ga0157371_10000103
1719 Ga0157371_10042772
1720 Ga0157370_10000578
1721 Ga0157370_10000966
1722 Ga0157370_10005241
1723 Ga0157369_10000113
1724 Ga0157369_10000205
1725 Ga0157369_10003450
1726 Ga0157369_10003969
1727 Ga0157369_10995614
1728 Ga0157374_10000044
1729 Ga0157374_10414900
1730 Ga0157378_10140112
1731 Ga0163162_10425109
1732 Ga0157372_10000461
1733 Ga0157372_10001872
1734 Ga0163163_10189086
1735 Ga0182008_10001692
1736 Ga0182008_10060980
1737 Ga0182008_10090292
1738 Ga0182006_1000014
1739 Ga0182006_1000369
1740 Ga0182006_1000468
1741 Ga0182006_1001075
1742 Ga0182006_1005546
1743 Ga0182006_1036364
1744 Ga0182006_1127465
1745 Ga0182007_10000096
1746 Ga0182007_10000453
1747 Ga0182007_10013928
1748 Ga0182007_10017680
1749 Ga0182005_1000014
1750 Ga0182005_1000018
1751 Ga0182005_1000500
1752 Ga0163161_10165138
1753 Ga0197907_11038722
1754 Ga0206356_11069915
1755 Ga0206356_11078314
1756 Ga0206349_1235210
1757 Ga0206355_1479823
1758 Ga0206351_10121833
1759 Ga0206350_11084827
1760 Ga0206354_10003151
1761 Ga0206354_10947371
1762 Ga0206353_11402448
1763 Ga0154015_1286480
1764 Ga0213872_10000002
1765 Ga0213872_10000427
1766 Ga0213872_10006826
1767 Ga0213872_10009842
1768 Ga0213872_10041949
1769 Ga0224712_10000205
1770 Ga0224712_10012271
1771 Ga0209435_100016
1772 Ga0209435_100038
1773 Ga0209435_101065
1774 Ga0209436_100185
1775 Ga0209436_100244
1776 Ga0209784_100003
1777 Ga0209784_100005
1778 Ga0209784_100323
1779 Ga0209784_100328
1780 Ga0209566_100002
1781 Ga0209566_100005
1782 Ga0209566_100562
1783 Ga0209566_100621
1784 Ga0209566_100782
1785 Ga0209674_100005
1786 Ga0209674_100008
1787 Ga0209674_100009
1788 Ga0209674_100113
1789 Ga0209674_100239
1790 Ga0209674_100374
1791 Ga0209672_100001
1792 Ga0209672_100246
1793 Ga0209672_100444
1794 Ga0209147_100001
1795 Ga0209147_100002
1796 Ga0209147_100023
1797 Ga0209563_100004
1798 Ga0209563_100012
1799 Ga0209563_100015
1800 Ga0209563_100258
1801 Ga0209563_101134
1802 Ga0209563_103216
1803 Ga0207427_100932
1804 Ga0207427_102317
1805 Ga0209437_100166
1806 Ga0209437_100565
1807 Ga0209437_109505
1808 Ga0209258_100001
1809 Ga0209258_100002
1810 Ga0209258_100345
1811 Ga0207425_1000001
1812 Ga0207425_1000194
1813 Ga0207425_1000551
1814 Ga0209646_1000019
1815 Ga0209646_1000028
1816 Ga0209646_1000033
1817 Ga0209646_1000093
1818 Ga0209026_1000031
1819 Ga0209026_1001896
1820 Ga0209026_1004752
1821 Ga0209677_100006
1822 Ga0209677_100009
1823 Ga0209677_100438
1824 Ga0209677_106364
1825 Ga0209677_113219
1826 Ga0209148_1000003
1827 Ga0209148_1000471
1828 Ga0209148_1000656
1829 Ga0209148_1004089
1830 Ga0209759_1000029
1831 Ga0209759_1000232
1832 Ga0209759_1000322
1833 Ga0209759_1000346
1834 Ga0209759_1001190
1835 Ga0209759_1003612
1836 Ga0209759_1006480
1837 Ga0209129_1000001
1838 Ga0209233_1000043
1839 Ga0209233_1000483
1840 Ga0209565_1000009
1841 Ga0209565_1000191
1842 Ga0209565_1000321
1843 Ga0209565_1004466
1844 Ga0209565_1009953
1845 Ga0209455_1000001
1846 Ga0209455_1000049
1847 Ga0209455_1000076
1848 Ga0209455_1009263
1849 Ga0209673_1000036
1850 Ga0209673_1016259
1851 Ga0209673_1036095
1852 Ga0209130_1000044
1853 Ga0209130_1000391
1854 Ga0209130_1002746
1855 Ga0209130_1004442
1856 Ga0209675_1000013
1857 Ga0209675_1000084
1858 Ga0209675_1000496
1859 Ga0209675_1001550
1860 Ga0209675_1002122
1861 Ga0209675_1008884
1862 Ga0209675_1013587
1863 Ga0209676_1000014
1864 Ga0209025_1000323
1865 Ga0209025_1000363
1866 Ga0209025_1002228
1867 Ga0209025_1009587
1868 Ga0209025_1031950
1869 Ga0209025_1039251
1870 Ga0209564_1000006
1871 Ga0209564_1000038
1872 Ga0209564_1000122
1873 Ga0209564_1000813
1874 Ga0209564_1000953
1875 Ga0209564_1001000
1876 Ga0209564_1002158
1877 Ga0209564_1003280
1878 Ga0209564_1025521
1879 Ga0209758_1000055
1880 Ga0209758_1000149
1881 Ga0209050_1000334
1882 Ga0209050_1000743
1883 Ga0209256_1000005
1884 Ga0209256_1000024
1885 Ga0209256_1000106
1886 Ga0209256_1000269
1887 Ga0209256_1000466
1888 Ga0209256_1000780
1889 Ga0209256_1000867
1890 Ga0209256_1003509
1891 Ga0207426_1005062
1892 Ga0207426_1007837
1893 Ga0209051_1016793
1894 Ga0209051_1045368
1895 Ga0209257_1000010
1896 Ga0209257_1001145
1897 Ga0207655_1018450
1898 Ga0207655_1023331
1899 Ga0207713_1000287
1900 Ga0207713_1002387
1901 Ga0207647_10081675
1902 Ga0207705_10000681
1903 Ga0207705_10002956
1904 Ga0207705_10165502
1905 Ga0207654_10002514
1906 Ga0207695_10002002
1907 Ga0207695_10002789
1908 Ga0207695_10006826
1909 Ga0207695_10033764
1910 Ga0207695_10041008
1911 Ga0207695_10134650
1912 Ga0207695_10197741
1913 Ga0207671_10012778
1914 Ga0207671_10544272
1915 Ga0207657_10000842
1916 Ga0207657_10008034
1917 Ga0207657_10065346
1918 Ga0207657_10139229
1919 Ga0207649_10000098
1920 Ga0207649_10041314
1921 Ga0207694_10001422
1922 Ga0207690_10019643
1923 Ga0207690_10039304
1924 Ga0207706_10357761
1925 Ga0207686_10014723
1926 Ga0207709_10108356
1927 Ga0207691_10168723
1928 Ga0207711_10128462
1929 Ga0207689_10065783
1930 Ga0207679_10000020
1931 Ga0207679_10001045
1932 Ga0207667_10000112
1933 Ga0207667_10000350
1934 Ga0207667_10001547
1935 Ga0207667_10037931
1936 Ga0207667_10064906
1937 Ga0207667_10720845
1938 Ga0207640_10000092
1939 Ga0207658_10137657
1940 Ga0207703_10050504
1941 Ga0207678_10000181
1942 Ga0207702_10000017
1943 Ga0207702_10621659
1944 Ga0207641_10329455
1945 Ga0207648_10603642
1946 Ga0207674_10009965
1947 Ga0207683_10162344
1948 Ga0207698_10133720
1949 Ga0207698_10851139
1950 Ga0209281_1000322
1951 Ga0209281_1017789
1952 Ga0209995_1009558
1953 Ga0209968_1000652
1954 Ga0209282_1000002
1955 Ga0209282_1000184
1956 Ga0209966_1000005
1957 Ga0307515_10120528
1958 Ga0265338_10000022
1959 Ga0265338_10000281
1960 Ga0307511_10000574
1961 Ga0316181_1200678
1962 Ga0316182_1144804
1963 Ga0265328_10012598
1964 Ga0265331_10004696
1965 Ga0265327_10006308
1966 Ga0265316_10002426
1967 Ga0265316_10097591
1968 Ga0307408_100001629
1969 Ga0307408_100002195
1970 Ga0307408_100002582
1971 Ga0307408_100006036
1972 Ga0265314_10056079
1973 Ga0265314_10069748
1974 Ga0307405_10391520
1975 Ga0307518_10206037
1976 Ga0307410_10336858
1977 Ga0307412_10000024
1978 Ga0307414_10102350
1979 Ga0373956_0071706
1980 Ga0373925_0707088
1981 Ga0395899_0000035
1982 Ga0395899_0000206
1983 Ga0395899_0001114
1984 Ga0395899_0012621
1985 Ga0395899_0026634
1986 Ga0395899_0069703
1987 Ga0395900_0000050
1988 Ga0395900_0000113
1989 Ga0395900_0000298
1990 Ga0395900_0002068
1991 Ga0395900_0003955
1992 Ga0395900_0005739
1993 Ga0395900_0008520
1994 Ga0395900_0008874
1995 Ga0395900_0027896
1996 Ga0395900_0034374
1997 Ga0395900_0081796
1998 Ga0395900_0151316
1999 Ga0395900_0272782
2000 Ga0395900_0317671
2001 Ga0395900_0341843
2002 Ga0395900_0367645
2003 Ga0395898_0000437
2004 Ga0395898_0000813
2005 Ga0395898_0000817
2006 Ga0395898_0026404
2007 Ga0395898_0036477
2008 Ga0395898_0060324
2009 Ga0395898_0118102
2010 Ga0395898_0208759
2011 Ga0395898_0405036
2012 Ga0395905_0004574
2013 Ga0395905_0005007
2014 Ga0395905_0025625
2015 Ga0395905_0049731
2016 Ga0395905_0178169
2017 Ga0395905_0583418
2018 Ga0436364_0382499
2019 Ga0395901_0000062
2020 Ga0395901_0000416
2021 Ga0395901_0000508
2022 Ga0395901_0001200
2023 Ga0395901_0124335
2024 Ga0395901_0182649
2025 Ga0395901_0219648
2026 Ga0395901_0474839
2027 Ga0395901_0547995
2028 Ga0395901_0860041
2029 Ga0436361_0125110
2030 Ga0436361_0153681
2031 Ga0436361_0185139
2032 Ga0436361_0376382
2033 Ga0436361_0556100
2034 Ga0436361_0615231
2035 Ga0436361_0684212
2036 Ga0436361_0759601
2037 Ga0436361_1021214
2038 Ga0439448_0000302
2039 Ga0439448_0026282
2040 Ga0439449_0018309
2041 Ga0439450_030943
2042 Ga0439455_0000411
2043 Ga0439455_0015815
2044 Ga0450923_002748
2045 Ga0450904_000172
2046 Ga0439458_0027625
2047 Ga0466969_0002755
2048 Ga0466969_0012522
2049 Ga0466969_0017996
2050 Ga0466972_0000034
2051 Ga0466972_0010189
2052 Ga0466972_0012579
2053 Ga0466972_0033620
2054 Ga0466972_0049636
2055 Ga0466973_0035357
2056 Ga0466965_0012573
2057 Ga0466965_0017057
2058 Ga0466965_0029040
2059 Ga0466965_0030291
2060 Ga0466965_0066016
2061 Ga0466966_0000106
2062 Ga0466966_0002872
2063 Ga0466966_0002959
2064 Ga0466966_0004420
2065 Ga0466966_0005785
2066 Ga0466966_0022302
2067 Ga0466966_0284382
2068 Ga0466961_0000032
2069 Ga0466961_0000202
2070 Ga0466961_0000417
2071 Ga0466961_0005980
2072 Ga0466963_0000050
2073 Ga0466963_0043394
2074 Ga0466963_0147042
2075 Ga0466963_0385917
2076 Ga0466964_0000380
2077 Ga0466964_0006313
2078 Ga0466964_0026695
2079 Ga0453684_0080313
2080 Ga0466971_0003444
2081 Ga0466971_0005199
2082 Ga0466971_0009300
2083 Ga0466971_0055154
2084 Ga0466968_0009810
2085 Ga0466968_0015479
2086 Ga0466968_0031325
2087 Ga0466970_0000877
2088 Ga0466970_0004900
2089 Ga0466970_0063239
2090 Ga0466970_0078473
2091 Ga0466970_0094274
2092 Ga0466957_0001750
2093 Ga0466957_0003510
2094 Ga0466957_0026350
2095 Ga0466957_0032839
2096 Ga0466957_0065864
2097 Ga0466957_0068235
2098 Ga0466957_0086903
2099 Ga0466957_0106911
2100 Ga0466957_0191561
2101 Ga0466960_0100865
2102 Ga0466960_0269286
2103 Ga0466959_0003501
2104 Ga0466959_0014950
2105 Ga0466959_0031138
2106 Ga0466959_0068217
2107 Ga0466959_0088120
2108 Ga0466959_0109471
2109 Ga0466959_0125624
2110 Ga0466959_0128096
2111 Ga0466959_0249755
2112 Ga0451576_0024224
2113 Ga0451576_0369256
2114 Ga0466958_0001226
2115 Ga0466958_0002253
2116 Ga0466958_0004564
2117 Ga0466958_0005384
2118 Ga0466958_0062728
2119 Ga0466967_0004230
2120 Ga0466967_0127300
2121 Ga0466967_0144891
2122 Ga0466967_0226341
2123 Ga0466967_0805287
2124 Ga0495617_000002
2125 Ga0495617_000006
2126 Ga0495617_000574
2127 Ga0495617_001877
2128 Ga0495617_006621
2129 Ga0495627_000005
2130 Ga0495627_000350
2131 Ga0495627_004964
2132 Ga0495627_060882
2133 Ga0495592_0007616
2134 Ga0495592_0023221
2135 Ga0495592_0361613
2136 Ga0495603_0016533
2137 Ga0495603_0125381
2138 Ga0495603_0194874
2139 Ga0495603_0246283
2140 Ga0495590_0000025
2141 Ga0495590_0000052
2142 Ga0495590_0000510
2143 Ga0495590_0026139
2144 Ga0495590_0026746
2145 Ga0495590_0041915
2146 Ga0495590_0061272
2147 Ga0495591_000290
2148 Ga0495591_002346
2149 Ga0495629_0000098
2150 Ga0495629_0000480
2151 Ga0495629_0001062
2152 Ga0495629_0003444
2153 Ga0495629_0219824
2154 Ga0495638_0000066
2155 Ga0495638_0020487
2156 Ga0495638_0021868
2157 Ga0495638_0074214
2158 Ga0495638_0108151
2159 Ga0495638_0109790
2160 Ga0495651_0002927
2161 Ga0495651_0004151
2162 Ga0495651_0258391
2163 Ga0495651_0278278
2164 Ga0495653_0000011
2165 Ga0495653_0004216
2166 Ga0495653_0024870
2167 Ga0495653_0026196
2168 Ga0495653_0042336
2169 Ga0495653_0149072
2170 Ga0495650_0000015
2171 Ga0495650_0000352
2172 Ga0495650_0000506
2173 Ga0495650_0000567
2174 Ga0495650_0000694
2175 Ga0495650_0000716
2176 Ga0495650_0001942
2177 Ga0495650_0002453
2178 Ga0495650_0012550
2179 Ga0495650_0014139
2180 Ga0495650_0025130
2181 Ga0495580_0000453
2182 Ga0495580_0000490
2183 Ga0495580_0007251
2184 Ga0495580_0011469
2185 Ga0495582_0004426
2186 Ga0495582_0031926
2187 Ga0495582_0049879
2188 Ga0495582_0207568
2189 Ga0495605_0000003
2190 Ga0495605_0000034
2191 Ga0495605_0000474
2192 Ga0495605_0000775
2193 Ga0495605_0001336
2194 Ga0495605_0001357
2195 Ga0495605_0002584
2196 Ga0495605_0002767
2197 Ga0495605_0004977
2198 Ga0495605_0005138
2199 Ga0495605_0014177
2200 Ga0495605_0057551
2201 Ga0495662_0048656
2202 Ga0495664_0001796
2203 Ga0495664_0007851
2204 Ga0495584_0000017
2205 Ga0495584_0000718
2206 Ga0495584_0001121
2207 Ga0495584_0002718
2208 Ga0495584_0004213
2209 Ga0495584_0004606
2210 Ga0495584_0007731
2211 Ga0495584_0008014
2212 Ga0495584_0036280
2213 Ga0495584_0089253
2214 Ga0495585_0000064
2215 Ga0495585_0000719
2216 Ga0495585_0003608
2217 Ga0495585_0005194
2218 Ga0495585_0006205
2219 Ga0495585_0010728
2220 Ga0495585_0011801
2221 Ga0495585_0017413
2222 Ga0495585_0019284
2223 Ga0495585_0034711
2224 Ga0495585_0043580
2225 Ga0495585_0050675
2226 Ga0495585_0053991
2227 Ga0495585_0056736
2228 Ga0495585_0058974
2229 Ga0495585_0072425
2230 Ga0495585_0083776
2231 Ga0495585_0124025
2232 Ga0495594_0007765
2233 Ga0495594_0025706
2234 Ga0495594_0039392
2235 Ga0495594_0072968
2236 Ga0495594_0184631
2237 Ga0495596_0000205
2238 Ga0495596_0002342
2239 Ga0495596_0002444
2240 Ga0495596_0003397
2241 Ga0495596_0006211
2242 Ga0495596_0012140
2243 Ga0495596_0017735
2244 Ga0495596_0036508
2245 Ga0495596_0037389
2246 Ga0495596_0069014
2247 Ga0495596_0103072
2248 Ga0495607_0002968
2249 Ga0495607_0003100
2250 Ga0495607_0004837
2251 Ga0495607_0005693
2252 Ga0495607_0012044
2253 Ga0495607_0014345
2254 Ga0495607_0021624
2255 Ga0495607_0022753
2256 Ga0495607_0025829
2257 Ga0495607_0031908
2258 Ga0495607_0033328
2259 Ga0495607_0040118
2260 Ga0495607_0080102
2261 Ga0495607_0128169
2262 Ga0495607_0198859
2263 Ga0495583_0000056
2264 Ga0495583_0000320
2265 Ga0495583_0000344
2266 Ga0495583_0000864
2267 Ga0495583_0001309
2268 Ga0495583_0001863
2269 Ga0495583_0003698
2270 Ga0495583_0004990
2271 Ga0495583_0035874
2272 Ga0495606_0000024
2273 Ga0495606_0000043
2274 Ga0495606_0000920
2275 Ga0495606_0002355
2276 Ga0495606_0002651
2277 Ga0495606_0002848
2278 Ga0495606_0003368
2279 Ga0495606_0003606
2280 Ga0495606_0004448
2281 Ga0495606_0005867
2282 Ga0495606_0014463
2283 Ga0495606_0020534
2284 Ga0495606_0026407
2285 Ga0495606_0028021
2286 Ga0495606_0033961
2287 Ga0495606_0050194
2288 Ga0495606_0056514
2289 Ga0495606_0132797
2290 Ga0495606_0308253
2291 Ga0495608_0000558
2292 Ga0495608_0027302
2293 Ga0495608_0031265
2294 Ga0495608_0039105
2295 Ga0495610_0000004
2296 Ga0495610_0000613
2297 Ga0495610_0000866
2298 Ga0495610_0046369
2299 Ga0495610_0117421
2300 Ga0495616_0000057
2301 Ga0495616_0000727
2302 Ga0495616_0000765
2303 Ga0495616_0001281
2304 Ga0495616_0005523
2305 Ga0495616_0008223
2306 Ga0495616_0012740
2307 Ga0495616_0014843
2308 Ga0495616_0016856
2309 Ga0495616_0019205
2310 Ga0495616_0020183
2311 Ga0495616_0037178
2312 Ga0495616_0085897
2313 Ga0495618_0002641
2314 Ga0495618_0134275
2315 Ga0495620_0010534
2316 Ga0495628_0004435
2317 Ga0495628_0010088
2318 Ga0495628_0012308
2319 Ga0495628_0014449
2320 Ga0495628_0046726
2321 Ga0495628_0128462
2322 Ga0495630_0001998
2323 Ga0495630_0031771
2324 Ga0495630_0054910
2325 Ga0495631_0000942
2326 Ga0495631_0003085
2327 Ga0495631_0004674
2328 Ga0495631_0008186
2329 Ga0495631_0020467
2330 Ga0495631_0022459
2331 Ga0495631_0026976
2332 Ga0495631_0035697
2333 Ga0495631_0103327
2334 Ga0495631_0139355
2335 Ga0495632_0000077
2336 Ga0495632_0001144
2337 Ga0495632_0001998
2338 Ga0495632_0002332
2339 Ga0495632_0004741
2340 Ga0495632_0012804
2341 Ga0495637_0000126
2342 Ga0495637_0000327
2343 Ga0495637_0001842
2344 Ga0495637_0008157
2345 Ga0495637_0072634
2346 Ga0495643_0000224
2347 Ga0495643_0000747
2348 Ga0495643_0002070
2349 Ga0495643_0003157
2350 Ga0495643_0007721
2351 Ga0495643_0008341
2352 Ga0495643_0027344
2353 Ga0495643_0027805
2354 Ga0495643_0033876
2355 Ga0495643_0040432
2356 Ga0495643_0148990
2357 Ga0495644_0001226
2358 Ga0495644_0001682
2359 Ga0495644_0002719
2360 Ga0495644_0005980
2361 Ga0495644_0009943
2362 Ga0495644_0023269
2363 Ga0495644_0033604
2364 Ga0495644_0040602
2365 Ga0495648_0000007
2366 Ga0495648_0000045
2367 Ga0495648_0000534
2368 Ga0495648_0000708
2369 Ga0495648_0004006
2370 Ga0495648_0004011
2371 Ga0495648_0005917
2372 Ga0495648_0006818
2373 Ga0495648_0042479
2374 Ga0495648_0047112
2375 Ga0495648_0056113
2376 Ga0495648_0123177
2377 Ga0495648_0140254
2378 Ga0495648_0151933
2379 Ga0495648_0157687
2380 Ga0495663_0005099
2381 Ga0495666_0001316
2382 Ga0495666_0001527
2383 Ga0495666_0003147
2384 Ga0495666_0009724
2385 Ga0495666_0019865
2386 Ga0495666_0028196
2387 Ga0495642_0000422
2388 Ga0495642_0000749
2389 Ga0495642_0008472
2390 Ga0495642_0010038
2391 Ga0495642_0019964
2392 Ga0495642_0026351
2393 Ga0495642_0032469
2394 Ga0495642_0033276
2395 Ga0495642_0034691
2396 Ga0495642_0054057
2397 Ga0495642_0060759
2398 Ga0495642_0161505
2399 Ga0495652_0004631
2400 Ga0495652_0005074
2401 Ga0495652_0093493
2402 Ga0495652_0240807
2403 Ga0495654_0000004
2404 Ga0495654_0002376
2405 Ga0495654_0014863
2406 Ga0495654_0083824
2407 Ga0495665_0008513
2408 Ga0495665_0015880
2409 Ga0495665_0017372
2410 Ga0495665_0027505
2411 Ga0495665_0039390
2412 Ga0495665_0040146
2413 Ga0495640_0001438
2414 Ga0495640_0010125
2415 Ga0495586_0009518
2416 Ga0495586_0012553
2417 Ga0495586_0017328
2418 Ga0495586_0019855
2419 Ga0495586_0026061
2420 Ga0495587_0006766
2421 Ga0495587_0008698
2422 Ga0495587_0021741
2423 Ga0495609_0000002
2424 Ga0495609_0000433
2425 Ga0495609_0000918
2426 Ga0495609_0001390
2427 Ga0495609_0007649
2428 Ga0495609_0008064
2429 Ga0495609_0016089
2430 Ga0495609_0016658
2431 Ga0495609_0016949
2432 Ga0495609_0028418
2433 Ga0495609_0034795
2434 Ga0495597_0000031
2435 Ga0495597_0000523
2436 Ga0495597_0000943
2437 Ga0495597_0000990
2438 Ga0495597_0002157
2439 Ga0495597_0003690
2440 Ga0495597_0006269
2441 Ga0495597_0024977
2442 Ga0495597_0054672
2443 Ga0495645_0009654
2444 Ga0495645_0038143
2445 Ga0495645_0113923
2446 Ga0495622_0000064
2447 Ga0495622_0000161
2448 Ga0495622_0016364
2449 Ga0495622_0021079
2450 Ga0495622_0042110
2451 Ga0495622_0110252
2452 Ga0495622_0166327
2453 Ga0495633_0000504
2454 Ga0495633_0000812
2455 Ga0495633_0001019
2456 Ga0495633_0001449
2457 Ga0495633_0002066
2458 Ga0495633_0002613
2459 Ga0495633_0009193
2460 Ga0495633_0013731
2461 Ga0495633_0016324
2462 Ga0495633_0017316
2463 Ga0495633_0023576
2464 Ga0495633_0027732
2465 Ga0495633_0058138
2466 Ga0495633_0062415
2467 Ga0495667_0053002
2468 Ga0495656_0006814
2469 Ga0495656_0010802
2470 Ga0495668_0000025
2471 Ga0495668_0000126
2472 Ga0495668_0000810
2473 Ga0495668_0001707
2474 Ga0495668_0001771
2475 Ga0495668_0001853
2476 Ga0495668_0003631
2477 Ga0495668_0004249
2478 Ga0495668_0007249
2479 Ga0495668_0007326
2480 Ga0495668_0007725
2481 Ga0495668_0013407
2482 Ga0495668_0016514
2483 Ga0495668_0023330
2484 Ga0495668_0180468
2485 Ga0495634_0004151
2486 Ga0495634_0006050
2487 Ga0495634_0032590
2488 Ga0495634_0078814
2489 Ga0495634_0333032
2490 Ga0495611_0001533
2491 Ga0495611_0002226
2492 Ga0495611_0006665
2493 Ga0495611_0015651
2494 Ga0495611_0022289
2495 Ga0495611_0035625
2496 Ga0495611_0047589
2497 Ga0495611_0058755
2498 Ga0495611_0061076
2499 Ga0495625_0001407
2500 Ga0495625_0002112
2501 Ga0495625_0004938
2502 Ga0495625_0008140
2503 Ga0495625_0010929
2504 Ga0495625_0019091
2505 Ga0495625_0031267
2506 Ga0495625_0078683
2507 Ga0495625_0082972
2508 Ga0495625_0107326
2509 Ga0495625_0254092
2510 Ga0495635_0032625
2511 Ga0495659_0000032
2512 Ga0495659_0002511
2513 Ga0495659_0008848
2514 Ga0495659_0056894
2515 Ga0495659_0084371
2516 Ga0495661_0000859
2517 Ga0495661_0001558
2518 Ga0495661_0003524
2519 Ga0495661_0004711
2520 Ga0495661_0006045
2521 Ga0495661_0024773
2522 Ga0495661_0032618
2523 Ga0495661_0037121
2524 Ga0495661_0044154
2525 Ga0495661_0045459
2526 Ga0495661_0045945
2527 Ga0495661_0047817
2528 Ga0495661_0053183
2529 Ga0495661_0054464
2530 Ga0495661_0055380
2531 Ga0495661_0080705
2532 Ga0495661_0160693
2533 Ga0495588_0000067
2534 Ga0495588_0014282
2535 Ga0495588_0017593
2536 Ga0495588_0091668
2537 Ga0495588_0118176
2538 Ga0495657_0022952
2539 Ga0495657_0055230
2540 Ga0495599_0029630
2541 Ga0495599_0208931
2542 Ga0495623_0003701
2543 Ga0495623_0005752
2544 Ga0495623_0048983
2545 Ga0495623_0092414
2546 Ga0495623_0112606
2547 Ga0495646_0002140
2548 Ga0495646_0005975
2549 Ga0495646_0006570
2550 Ga0495646_0014853
2551 Ga0495646_0019398
2552 Ga0495646_0098175
2553 Ga0495646_0221442
2554 Ga0495669_0000298
2555 Ga0495669_0000712
2556 Ga0495669_0012540
2557 Ga0495669_0055200
2558 Ga0495669_0139072
2559 Ga0495613_0009023
2560 Ga0495613_0010221
2561 Ga0495613_0013143
2562 Ga0495613_0209768
2563 Ga0495613_0333870
2564 Ga0495624_0000423
2565 Ga0495624_0005681
2566 Ga0495624_0022216
2567 Ga0495624_0022577
2568 Ga0495624_0035592
2569 Ga0495624_0053917
2570 Ga0495624_0072060
2571 Ga0495670_0001517
2572 Ga0495670_0005496
2573 Ga0495670_0007043
2574 Ga0495670_0011986
2575 Ga0495670_0013839
2576 Ga0495670_0055489
2577 Ga0495670_0076325
2578 Ga0495670_0096811
2579 Ga0495670_0230451
2580 Ga0495671_0000001
2581 Ga0495671_0000717
2582 Ga0495671_0000758
2583 Ga0495671_0001181
2584 Ga0495671_0001620
2585 Ga0495671_0273441
2586 Ga0495649_0000321
2587 Ga0495649_0001148
2588 Ga0495649_0001798
2589 Ga0495649_0003100
2590 Ga0495649_0005392
2591 Ga0495649_0005907
2592 Ga0495649_0049644
2593 Ga0495649_0068894
2594 Ga0495649_0119489
2595 Ga0495649_0127574
2596 Ga0495649_0148815
2597 Ga0495589_0000324
2598 Ga0495589_0000701
2599 Ga0495589_0001143
2600 Ga0495589_0001662
2601 Ga0495589_0004539
2602 Ga0495589_0006006
2603 Ga0495589_0006673
2604 Ga0495589_0017258
2605 Ga0495589_0028561
2606 Ga0495589_0034842
2607 Ga0495600_0000436
2608 Ga0495600_0005178
2609 Ga0495600_0052042
2610 Ga0495660_0000026
2611 Ga0495660_0000449
2612 Ga0495660_0000947
2613 Ga0495660_0001734
2614 Ga0495660_0003330
2615 Ga0495660_0016493
2616 Ga0495660_0028972
2617 Ga0495660_0043086
2618 Ga0495660_0140680
2619 Ga0495581_0004134
2620 Ga0495581_0040296
2621 Ga0495581_0073848
2622 Ga0495581_0090796
2623 Ga0495604_0011054
2624 Ga0495604_0031143
2625 Ga0495604_0037004
2626 Ga0495604_0050470
2627 Ga0495604_0051280
2628 Ga0495604_0059919
2629 Ga0495604_0100182
2630 Ga0495604_0158902
2631 Ga0495604_0209666
2632 Ga0495604_0337743
2633 Ga0495604_0362930
2634 Ga0495636_0002332
2635 Ga0495636_0003310
2636 Ga0495636_0011579
2637 Ga0495636_0053613
2638 Ga0495636_0068745
2639 Ga0495636_0069552
2640 Ga0495636_0135948
2641 Ga0495674_0004218
2642 Ga0495674_0005464
2643 Ga0495674_0015269
2644 Ga0495674_0016821
2645 Ga0495674_0097449
2646 Ga0495674_0464624
2647 Ga0495672_0000041
2648 Ga0495672_0000045
2649 Ga0495672_0000050
2650 Ga0495672_0000454
2651 Ga0495672_0000811
2652 Ga0495672_0001250
2653 Ga0495672_0001396
2654 Ga0495672_0001789
2655 Ga0495672_0008445
2656 Ga0495672_0025558
2657 Ga0495672_0087189
2658 Ga0495676_0000235
2659 Ga0495676_0003028
2660 Ga0495676_0013951
2661 Ga0495676_0030625
2662 Ga0495676_0040134
2663 Ga0495676_0040446
2664 Ga0495676_0063173
2665 Ga0495676_0080040
2666 Ga0495676_0168174
2667 Ga0495680_0001011
2668 Ga0495680_0037858
2669 Ga0495680_0230607
2670 Ga0495683_0000203
2671 Ga0495683_0000434
2672 Ga0495683_0001204
2673 Ga0495683_0002952
2674 Ga0495683_0004558
2675 Ga0495683_0005418
2676 Ga0495683_0005959
2677 Ga0495683_0010339
2678 Ga0495683_0011166
2679 Ga0495683_0022223
2680 Ga0495683_0022821
2681 Ga0495683_0035286
2682 Ga0495683_0116433
2683 Ga0495687_000013
2684 Ga0495687_000127
2685 Ga0495687_000143
2686 Ga0495687_000871
2687 Ga0495687_002404
2688 Ga0495687_002441
2689 Ga0495687_009000
2690 Ga0495687_010408
2691 Ga0495687_018731
2692 Ga0495687_020010
2693 Ga0495687_042439
2694 Ga0495675_0003234
2695 Ga0495675_0003315
2696 Ga0495675_0004776
2697 Ga0495675_0017249
2698 Ga0495677_0000098
2699 Ga0495677_0001274
2700 Ga0495677_0001303
2701 Ga0495677_0001675
2702 Ga0495677_0006417
2703 Ga0495677_0014272
2704 Ga0495677_0029761
2705 Ga0495677_0091810
2706 Ga0495677_0104271
2707 Ga0495677_0134160
2708 Ga0495679_000025
2709 Ga0495679_000933
2710 Ga0495679_001000
2711 Ga0495679_001499
2712 Ga0495679_026881
2713 Ga0495685_000023
2714 Ga0495685_009105
2715 Ga0495685_023128
2716 Ga0495685_084782
2717 Ga0495673_0000006
2718 Ga0495673_0000014
2719 Ga0495673_0000430
2720 Ga0495673_0005979
2721 Ga0495673_0046411
2722 Ga0495681_0000647
2723 Ga0495681_0002407
2724 Ga0495681_0009526
2725 Ga0495681_0011512
2726 Ga0495681_0012964
2727 Ga0495681_0013882
2728 Ga0495681_0031460
2729 Ga0495684_0069263
2730 Ga0495686_0000288
2731 Ga0495686_0001006
2732 Ga0495686_0009590
2733 Ga0495686_0014755
2734 Ga0495686_0054022
2735 Ga0495686_0059954
2736 Ga0495686_0066606
2737 Ga0495686_0093141
2738 Ga0495593_0002218
2739 Ga0495593_0007331
2740 Ga0495593_0007699
2741 Ga0495593_0047822
2742 Ga0495593_0104991
2743 Ga0495602_0008398
2744 Ga0495602_0025256
2745 Ga0495602_0027756
2746 Ga0495602_0069429
2747 Ga0495602_0077689
2748 Ga0495602_0147863
2749 Ga0495602_0332509
2750 Ga0495614_0003062
2751 Ga0495614_0007673
2752 Ga0495614_0008050
2753 Ga0495614_0023083
2754 Ga0495626_0000003
2755 Ga0495626_0000096
2756 Ga0495626_0001123
2757 Ga0495626_0004243
2758 Ga0495626_0006046
2759 Ga0495626_0006705
2760 Ga0495626_0008280
2761 Ga0495626_0009019
2762 Ga0495626_0009836
2763 Ga0495626_0028456
2764 Ga0495626_0031684
2765 Ga0496100_0005002
2766 Ga0496100_0114370
2767 Ga0496100_0296993
2768 Ga0496101_0012730
2769 Ga0496101_0209828
2770 Ga0496101_0239263
2771 Ga0496102_0000194
2772 Ga0496102_0001533
2773 Ga0496102_0023734
2774 Ga0496102_0033340
2775 Ga0496102_0142210
2776 Ga0496103_0005046
2777 Ga0496103_0018291
2778 Ga0496103_0020123
2779 Ga0496103_0039130
2780 Ga0496103_0119048
2781 Ga0496104_0123829
2782 Ga0496104_0198519
2783 Ga0496104_0211765
2784 Ga0496104_0263911
2785 Ga0496105_0210786
2786 Ga0496105_0466540
2787 Ga0496106_0000029
2788 Ga0496106_0004373
2789 Ga0496106_0009286
2790 Ga0496106_0589613
2791 Ga0496107_0015835
2792 Ga0496107_0098698
2793 Ga0496108_0209836
2794 Ga0496109_0023422
2795 Ga0496109_0052532
2796 Ga0496109_0142211
2797 Ga0496109_0182179
2798 Ga0496110_0000146
2799 Ga0496110_0008873
2800 Ga0496110_0050203
2801 Ga0496110_0101238
2802 Ga0496110_0264572
2803 Ga0496111_0050158
2804 Ga0496111_0053070
2805 Ga0496111_0091545
2806 Ga0496111_0114549
2807 Ga0496111_0133655
2808 Ga0496113_0006016
2809 Ga0496113_0066819
2810 Ga0496113_0203703
2811 Ga0496114_0002351
2812 Ga0496114_0023215
2813 Ga0496114_0092696
2814 Ga0496114_0474903
2815 Ga0496115_0004356
2816 Ga0496115_0053693
2817 Ga0496115_0060554
2818 Ga0496115_0115306
2819 Ga0496115_0137782
2820 Ga0496116_0005854
2821 Ga0496116_0006608
2822 Ga0496116_0025634
2823 Ga0496116_0029456
2824 Ga0496116_0041014
2825 Ga0496116_0108680
2826 Ga0496117_0000001
2827 Ga0496117_0001537
2828 Ga0496117_0012221
2829 Ga0496117_0025988
2830 Ga0496117_0148183
2831 Ga0496117_0170820
2832 Ga0496118_0000008
2833 Ga0496118_0001933
2834 Ga0496118_0003947
2835 Ga0496118_0005785
2836 Ga0496118_0056141
2837 Ga0496118_0063721
2838 Ga0496118_0077451
2839 Ga0496119_0071815
2840 Ga0496120_0021798
2841 Ga0496121_0000800
2842 Ga0496121_0001199
2843 Ga0496121_0011117
2844 Ga0496121_0014177
2845 Ga0496121_0072962
2846 Ga0496121_0075566
2847 Ga0496121_0100606
2848 Ga0496121_0236917
2849 Ga0496121_0256273
2850 Ga0496122_0000445
2851 Ga0496122_0000457
2852 Ga0496122_0006540
2853 Ga0496122_0007790
2854 Ga0496122_0014503
2855 Ga0496122_0047972
2856 Ga0496122_0069887
2857 Ga0496123_0000321
2858 Ga0496123_0001956
2859 Ga0496123_0003306
2860 Ga0496123_0003551
2861 Ga0496123_0005710
2862 Ga0496123_0073786
2863 Ga0496124_0009346
2864 Ga0496124_0011253
2865 Ga0496124_0016799
2866 Ga0496124_0028528
2867 Ga0496124_0073172
2868 Ga0496124_0151487
2869 Ga0496124_0380958
2870 Ga0496125_0000642
2871 Ga0496125_0003245
2872 Ga0496125_0005554
2873 Ga0496125_0020567
2874 Ga0496125_0035240
2875 Ga0496125_0051880
2876 Ga0496125_0073102
2877 Ga0496126_0000192
2878 Ga0496126_0000278
2879 Ga0496126_0000374
2880 Ga0496126_0003722
2881 Ga0496126_0004761
2882 Ga0496126_0024456
2883 Ga0496126_0410429
2884 Ga0495678_000016
2885 Ga0495678_000408
2886 Ga0495678_000967
2887 Ga0495678_001068
2888 Ga0495678_001706
2889 Ga0495678_006463
2890 Ga0495678_026933
2891 Ga0495678_037773
2892 Ga0495678_043054
2893 Ga0495678_062706
2894 Ga0495682_0000351
2895 Ga0495682_0001002
2896 Ga0495682_0002269
2897 Ga0495682_0003255
2898 Ga0501034_0000761
2899 Ga0501034_0153020
2900 Ga0501048_0299588
2901 Ga0501207_024120
2902 Ga0501222_007670
2903 Ga0501269_000654
2904 Ga0501279_000432
2905 Ga0501279_001026
2906 Ga0501035_0036387
2907 nmdc:mga03683_107944_c1
2908 nmdc:mga0k408_310_c1
2909 Ga0495601_0066409
2910 Ga0495655_0069373
2911 Ga0500646_0000697
2912 Ga0500583_0204039
2913 Ga0500594_0001783
2914 Ga0500594_0084069
2915 Ga0500618_003044
2916 Ga0500655_011340
2917 Ga0500586_000184
2918 Ga0500586_045193
2919 Ga0500604_0000643
2920 Ga0500622_0164616
2921 Ga0587084_006828
2922 Ga0587084_015411
2923 Ga0587093_005130
2924 Ga0587093_020275
2925 Ga0587066_005723
2926 Ga0587066_035093
2927 Ga0587070_007567
2928 Ga0587070_015365
2929 Ga0587070_024370
2930 Ga0587077_008329
2931 Ga0587077_008599
2932 Ga0587077_009603
2933 Ga0587082_009182
2934 Ga0587082_029610
2935 Ga0587083_0003727
2936 Ga0587083_0040849
2937 Ga0587085_007429
2938 Ga0587085_018438
2939 Ga0587086_009393
2940 Ga0587088_010421
2941 Ga0587088_017073
2942 Ga0587088_045083
2943 Ga0587091_011531
2944 Ga0587092_013010
2945 Ga0587094_004986
2946 Ga0587098_001893
2947 Ga0587101_009564
2948 Ga0587101_017774
2949 Ga0587101_020435
2950 Ga0587109_009454
2951 Ga0587117_007501
2952 Ga0587128_020648
2953 Ga0587062_002963
2954 Ga0587067_000317
2955 Ga0587067_008507
2956 Ga0587068_003962
2957 Ga0587068_015607
2958 Ga0587068_020253
2959 Ga0587072_000189
2960 Ga0587072_005267
2961 Ga0587072_022524
2962 Ga0587075_009421
2963 Ga0587076_004234
2964 Ga0587078_011762
2965 Ga0587079_015127
2966 Ga0587079_016765
2967 Ga0587100_001777
2968 Ga0587111_0002370
2969 Ga0587111_0004264
2970 Ga0587111_0006128
2971 Ga0466962_0000528
2972 Ga0466962_0009971
2973 Ga0466962_0014844
2974 Ga0466962_0025774
2975 Ga0466962_0058010
2976 Ga0466962_0062622
2977 Ga0466962_0215830
2978 2501071389
2979 2501411097
2980 2509129068
2981 2510250814
2982 2511096450
2983 2511102852
2984 2511251113
2985 2511384642
2986 2512346366
2987 2513552157
2988 2513560944
2989 2513952766
2990 2513960992
2991 2514045113
2992 2515679738
2993 2515692120
2994 2516020281
2995 2521559140
2996 2527075234
2997 2550696296
2998 2553003974
2999 2597032151
3000 2599444269
3001 2600809930
3002 2601670965
3003 2643788322
3004 2643798166
3005 2644030306
3006 2644213750
3007 2644248967
3008 2644253875
3009 2644356648
3010 2644475163
3011 2719639952
3012 2738742923
3013 2738820696
3014 2738825122
3015 2738833176
3016 2738844611
3017 2738874704
3018 2739148919
3019 2739186333
3020 2739190838
3021 2739221302
3022 2739276135
3023 2739317315
3024 2739335556
3025 2739345341
3026 2746089567
3027 2746098426
3028 2753566730
3029 2765570322
3030 2808971081
3031 2808981399
3032 2809006016
3033 2809013048
3034 2809128985
3035 2809144615
3036 2809148605
3037 2819545339
3038 2819591471
3039 2819615656
3040 2819620141
3041 2821133720
3042 2834641949
3043 2839096727
3044 2842327418
3045 2842351975
3046 2842458170
3047 2842717217
3048 2852621139
3049 2857362358
3050 2857547737
3051 2857553825
3052 2857560383
3053 2857565512
3054 2857580980
3055 2883088827
3056 2884816632
3057 2884837279
3058 2884853570
3059 2885086187
3060 2885268479
3061 2885278858
3062 2896155313
3063 2900578812
3064 2900635143
3065 2902689613
3066 2904430568
3067 2904443461
3068 2904484852
3069 2904532443
3070 2904584913
3071 2904591435
3072 2904605458
3073 2919048298
3074 2919081230
3075 2919480449
3076 2919530577
3077 2923512840
3078 2928063248
3079 2928110300
3080 2928132789
3081 2928138566
3082 2928505371
3083 2932412342
3084 2932419857
3085 2945937020
3086 2990706252
3087 642423076
3088 642621292
3089 644747629
3090 8003404506
3091 8003955512
3092 8047678175
3093 8055268344
3094 8055302336

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04376

ATE_N

Arginine-tRNA-protein transferase, N terminus

57

127

0.99

PF04377

ATE_C

Arginine-tRNA-protein transferase, C terminus

147

277

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wg4-assembly1.cif.gz_A dvaa-klate1 0.8562 28 248
7wg2-assembly1.cif.gz_A evaa-klate1 0.8554 28 248
7wfx-assembly1.cif.gz_A evaa-klate1 0.8352 28 248
7wg1-assembly1.cif.gz_A dvaa-klate1 0.8346 28 248
7wfx-assembly2.cif.gz_B evaa-klate1 0.833 28 248
ID Description Score Start End Superfamily
af_O14133_140_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.875 112 233 3.40.50.1820
af_O14133_140_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8484 112 233 3.40.50.1820
af_Q2FWC9_161_285_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7823 145 207 3.40.630.30
af_P90914_254_388_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7804 111 233 3.40.630.30
af_Q9C776_322_467_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7676 111 233 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W0X3R3-F1-model_v4 Arginyltransferase (EC 2.3.2.8) 0.9738 54 244 GO:0004057
GO:0005737
AF-A0A5C7JZX2-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.9719 10 246 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A7W0X3R3-F1-model_v4 Arginyltransferase (EC 2.3.2.8) 0.9636 54 244 GO:0004057
GO:0005737
AF-A0A2T5IVY5-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.9628 12 244 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A351A2K3-F1-model_v4 Arginyltransferase 0.9605 97 245 GO:0004057
GO:0005737

Map