F494699

General Info

Members Datasets Scaffolds Average Seq Length
1547 860 3094 261

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2585427594|2585847286
Length 306
Sequence ARYTFIVWRKPHRVSISPLVGEMSGRTEGGATPTNIHEEKQMPNLKVKPTGTHGRVTHVTPESAGWTYVGFDMHRLKAGETVSGETGEREVCLVWVSGKGKASAGTRDFGTLGERMSPFDGAPHALYIPMESAWSVTAETDLELAVCSAPGGGAYEAKAIPPGTHPALTRGKGTNVRYVNNIMPEDDASAYSLLVVEVITPGGHTSSYPPHKHDQDNLPNESFLEETYYHRLNPPQGFGFQRVYTDDRSLDEAMVLEDGDVTLVPRGYHPCAATHGYDLYYLNVMAGPKRVWKFYNAPEHEWLLKA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
23 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
120 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
127 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
144 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
148 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
149 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
161 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
162 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
163 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
166 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
232 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
242 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
250 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
268 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
269 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
272 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
273 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
284 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
285 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
286 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
287 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
288 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
291 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
292 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
293 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
294 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
297 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
311 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
314 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
318 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
319 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
320 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
321 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
322 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
323 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
324 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
327 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
328 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
331 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
332 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
336 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
337 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
338 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
339 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
340 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
351 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
360 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
363 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
364 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
365 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
366 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
367 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
368 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
369 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
370 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
371 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
372 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
373 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
374 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
375 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
376 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
377 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
378 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
379 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
380 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
381 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
382 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
383 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
384 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
385 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
386 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
387 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
388 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
389 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
390 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
391 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
392 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
393 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
394 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
395 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
396 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
400 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
401 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
402 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
403 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
406 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
407 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
408 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
424 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
428 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
431 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
432 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
436 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
437 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
438 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
439 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
440 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
441 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
442 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
445 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
446 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
447 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
448 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
449 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
450 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
451 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
452 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
453 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
454 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
455 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
456 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
457 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
458 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
459 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
460 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
463 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
464 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
465 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
466 2509276019 Ensifer aridi TW10 Isolate Nodule
467 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
468 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
469 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
470 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
471 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
472 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
473 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
474 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
475 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
476 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
477 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
478 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
479 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
480 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
481 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
482 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
483 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
484 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
485 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
486 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
487 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
488 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
489 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
490 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
491 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
492 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
493 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
494 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
495 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
496 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
497 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
498 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
499 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
500 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
501 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
502 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
503 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
504 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
505 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
506 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
507 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
508 2519899620 Rhizobium sp. Pop5 Isolate Nodule
509 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
510 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
511 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
512 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
513 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
514 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
515 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
516 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
517 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
518 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
519 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
520 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
521 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
522 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
523 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
524 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
525 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
526 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
527 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
528 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
529 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
530 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
531 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
532 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
533 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
534 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
535 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
536 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
537 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
538 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
539 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
540 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
541 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
542 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
543 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
544 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
545 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
546 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
547 2643221557 Ensifer sp. Root558 Isolate Unclassified
548 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
549 2643221580 Devosia sp. Root635 Isolate Unclassified
550 2643221591 Devosia sp. Root685 Isolate Unclassified
551 2643221599 Rhizobium sp. Root708 Isolate Unclassified
552 2643221607 Rhizobium sp. Root73 Isolate Unclassified
553 2643221610 Ensifer sp. Root74 Isolate Unclassified
554 2643221626 Ensifer sp. Root31 Isolate Unclassified
555 2643221629 Devosia sp. Root105 Isolate Unclassified
556 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
557 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
558 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
559 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
560 2643221655 Ensifer sp. Root1252 Isolate Unclassified
561 2643221659 Ensifer sp. Root127 Isolate Unclassified
562 2643221662 Devosia sp. Root413D1 Isolate Unclassified
563 2643221668 Ensifer sp. Root423 Isolate Unclassified
564 2643221675 Ensifer sp. Root1298 Isolate Unclassified
565 2643221680 Ensifer sp. Root1312 Isolate Unclassified
566 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
567 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
568 2643221698 Ensifer sp. Root142 Isolate Unclassified
569 2643221712 Ensifer sp. Root258 Isolate Unclassified
570 2643221718 Rhizobium sp. Root268 Isolate Unclassified
571 2643221723 Ensifer sp. Root278 Isolate Unclassified
572 2643221726 Ensifer sp. Root954 Isolate Unclassified
573 2643221733 Bosea sp. Root381 Isolate Unclassified
574 2643221734 Bosea sp. Root670 Isolate Unclassified
575 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
576 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
577 2671180694 Paenibacillus sp. A3 Isolate Unclassified
578 2718217882 Rhizobium sp. N741 Isolate Nodule
579 2718217927 Rhizobium sp. N324 Isolate Nodule
580 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
581 2718218009 Rhizobium sp. N561 Isolate Nodule
582 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
583 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
584 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
585 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
586 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
587 2718218363 Rhizobium sp. N113 Isolate Nodule
588 2718218365 Rhizobium sp. N731 Isolate Nodule
589 2718218366 Rhizobium sp. N621 Isolate Nodule
590 2718218423 Rhizobium sp. N941 Isolate Nodule
591 2721755514 Rhizobium sp. N6212 Isolate Nodule
592 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
593 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
594 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
595 2721755809 Rhizobium sp. N541 Isolate Nodule
596 2721755810 Rhizobium sp. N871 Isolate Nodule
597 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
598 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
599 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
600 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
601 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
602 2728369365 Rhizobium sp. N1341 Isolate Nodule
603 2728369397 Rhizobium sp. N1314 Isolate Nodule
604 2738541293 Rhizobium sp. GV031 Isolate Unclassified
605 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
606 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
607 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
608 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
609 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
610 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
611 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
612 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
613 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
614 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
615 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
616 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
617 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
618 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
619 2791355256 Rhizobium sp. M10 Isolate Nodule
620 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
621 2791355260 Rhizobium sp. L9 Isolate Nodule
622 2791355261 Rhizobium sp. J15 Isolate Nodule
623 2791355262 Rhizobium sp. M1 Isolate Nodule
624 2791355263 Rhizobium chutanense C5 Isolate Nodule
625 2791355264 Rhizobium sp. S9 Isolate Nodule
626 2791355265 Rhizobium sp. H4 Isolate Nodule
627 2791355266 Rhizobium sp. L43 Isolate Nodule
628 2791355267 Rhizobium sp. L18 Isolate Nodule
629 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
630 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
631 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
632 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
633 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
634 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
635 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
636 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
637 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
638 2802429633 Rhizobium anhuiense J3 Isolate Nodule
639 2802429634 Rhizobium anhuiense S10 Isolate Nodule
640 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
641 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
642 2802429637 Rhizobium anhuiense C15 Isolate Nodule
643 2818991436 Collimonas arenae 515 Isolate Unclassified
644 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
645 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
646 2818991467 Bosea vestrisii 3192 Isolate Unclassified
647 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
648 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
649 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
650 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
651 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
652 2838048938 Rhizobium pisi 27/80 Isolate Nodule
653 2838061910 Rhizobium phaseoli L15 Isolate Nodule
654 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
655 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
656 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
657 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
658 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
659 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
660 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
661 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
662 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
663 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
664 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
665 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
666 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
667 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
668 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
669 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
670 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
671 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
672 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
673 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
674 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
675 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
676 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
677 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
678 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
679 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
680 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
681 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
682 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
683 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
684 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
685 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
686 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
687 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
688 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
689 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
690 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
691 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
692 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
693 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
694 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
695 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
696 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
697 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
698 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
699 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
700 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
701 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
702 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
703 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
704 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
705 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
706 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
707 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
708 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
709 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
710 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
711 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
712 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
713 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
714 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
715 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
716 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
717 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
718 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
719 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
720 2844163670 Ensifer sp. 1H6 Isolate Unclassified
721 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
722 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
723 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
724 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
725 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
726 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
727 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
728 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
729 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
730 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
731 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
732 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
733 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
734 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
735 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
736 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
737 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
738 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
739 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
740 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
741 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
742 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
743 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
744 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
745 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
746 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
747 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
748 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
749 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
750 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
751 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
752 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
753 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
754 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
755 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
756 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
757 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
758 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
759 2933599457 Rhizobium phaseoli M3 Isolate Nodule
760 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
761 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
762 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
763 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
764 2936381700 Rhizobium chutanense C16 Isolate Unclassified
765 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
766 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
767 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
768 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
769 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
770 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
771 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
772 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
773 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
774 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
775 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
776 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
777 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
778 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
779 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
780 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
781 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
782 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
783 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
784 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
785 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
786 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
787 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
788 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
789 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
790 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
791 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
792 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
793 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
794 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
795 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
796 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
797 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
798 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
799 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
800 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
801 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
802 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
803 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
804 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
805 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
806 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
807 2996887358 Rhizobium sp. R711 Isolate Nodule
808 2996893221 Rhizobium sp. R635 Isolate Nodule
809 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
810 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
811 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
812 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
813 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
814 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
815 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
816 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
817 8005258706 Rhizobium sp. R693 Isolate Nodule
818 8005275841 Rhizobium sp. N4311 Isolate Nodule
819 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
820 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
821 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
822 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
823 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
824 8005321885 Rhizobium sp. R72 Isolate Nodule
825 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
826 8005382845 Rhizobium sp. R634 Isolate Nodule
827 8005395548 Rhizobium sp. R339 Isolate Nodule
828 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
829 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
830 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
831 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
832 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
833 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
834 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
835 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
836 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
837 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
838 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
839 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
840 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
841 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
842 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
843 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
844 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
845 8018176218 Rhizobium sp. N122 Isolate Nodule
846 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
847 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
848 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
849 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
850 8024501048 Rhizobium sp. H4 Isolate Nodule
851 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
852 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
853 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
854 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
855 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
856 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
857 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
858 8056382006 Rhizobium croatiense 13T Isolate Nodule
859 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
860 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.95
Metatranscriptomes 0.39
Isolates 25.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.84
Nodule 17.84
Rhizoplane 3.04
Rhizosphere 51.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000928 3300001979 Bacteria 13025
2 JGI24739J22299_10016037 3300001989 Bacteria 2717
3 JGI24739J22299_10057113 3300001989 Bacteria 1243
4 JGI24735J21928_10000173 3300002067 Bacteria 23138
5 JGI24735J21928_10036629 3300002067 Bacteria 1439
6 JGI25155J39150_1000072 3300002704 Bacteria 64012
7 JGI25156J39149_1000086 3300002705 Bacteria 69106
8 JGI25156J39149_1000831 3300002705 Bacteria 15594
9 JGI25156J39149_1001033 3300002705 Bacteria 12987
10 JGI25156J39149_1003343 3300002705 Bacteria 5289
11 JGI25162J39368_1000015 3300002737 Bacteria 316381
12 JGI25162J39368_1000458 3300002737 Bacteria 31923
13 JGI25162J39368_1000463 3300002737 Bacteria 31575
14 JGI25154J39366_1000449 3300002738 Bacteria 21682
15 JGI25158J39367_1000141 3300002739 Bacteria 16827
16 JGI25157J39369_1000113 3300002741 Bacteria 69106
17 JGI25152J39213_1001001 3300002773 Bacteria 13676
18 JGI25152J39213_1001038 3300002773 Bacteria 13224
19 JGI25152J39213_1003216 3300002773 Bacteria 5680
20 JGI25152J39213_1012723 3300002773 Bacteria 1788
21 JGI25150J39212_1000031 3300002774 Bacteria 100456
22 JGI25159J45721_1000064 3300002987 Bacteria 51766
23 JGI25159J45721_1027232 3300002987 Bacteria 973
24 JGI25151J46595_10000039 3300003187 Bacteria 180051
25 JGI25151J46595_10000062 3300003187 Bacteria 146687
26 JGI25151J46595_10000350 3300003187 Bacteria 49262
27 JGI25151J46595_10003129 3300003187 Bacteria 9299
28 JGI25151J46595_10020812 3300003187 Bacteria 2758
29 JGI25151J46595_10050012 3300003187 Bacteria 1428
30 JGI25406J46586_10064268 3300003203 Bacteria 1173
31 JGI25165J46597_1000001 3300003214 Bacteria 1111887
32 JGI25165J46597_1000582 3300003214 Bacteria 31988
33 JGI25165J46597_1001083 3300003214 Bacteria 17416
34 JGI25165J46597_1001530 3300003214 Bacteria 11556
35 JGI25165J46597_1002700 3300003214 Bacteria 5276
36 JGI25165J46597_1005990 3300003214 Bacteria 2231
37 JGI25153J46596_10001838 3300003215 Bacteria 12594
38 JGI25153J46596_10006876 3300003215 Bacteria 5680
39 rootH1_10035975 3300003316 Bacteria 2458
40 rootH2_10019592 3300003320 Bacteria 5075
41 rootL2_10037632 3300003322 Bacteria 2165
42 rootH1_10082257 3300003323 Bacteria 3426
43 JGI25160J50197_1000003 3300003354 Bacteria 482719
44 JGI25160J50197_1000052 3300003354 Bacteria 127795
45 JGI25161J50226_1000073 3300003374 Bacteria 86555
46 JGI25161J50226_1000153 3300003374 Bacteria 47896
47 JGI25161J50226_1002554 3300003374 Bacteria 4602
48 Ga0006562J51391_1135276 3300003578 Bacteria 1404
49 Ga0055538_1000001 3300003751 Bacteria 1111887
50 Ga0055538_1000057 3300003751 Bacteria 112934
51 Ga0055539_1000001 3300003752 Bacteria 1111887
52 Ga0055539_1000088 3300003752 Bacteria 112934
53 Ga0055533_1000003 3300003756 Bacteria 1111887
54 Ga0055533_1000093 3300003756 Bacteria 116829
55 Ga0055533_1000096 3300003756 Bacteria 112934
56 Ga0055533_1000767 3300003756 Bacteria 10214
57 Ga0055532_1000039 3300003758 Bacteria 198049
58 Ga0055532_1001175 3300003758 Bacteria 7900
59 Ga0055532_1001955 3300003758 Bacteria 4851
60 Ga0055525_1000087 3300003759 Bacteria 149803
61 Ga0055525_1000129 3300003759 Bacteria 112934
62 Ga0055527_1000024 3300003760 Bacteria 198049
63 Ga0055535_1000028 3300003761 Bacteria 198049
64 Ga0055542_1000047 3300003762 Bacteria 198049
65 Ga0055529_1000054 3300003763 Bacteria 198049
66 Ga0055526_1000799 3300003771 Bacteria 23444
67 Ga0055526_1001895 3300003771 Bacteria 14505
68 Ga0055526_1002211 3300003771 Bacteria 13335
69 Ga0055526_1002843 3300003771 Bacteria 11433
70 Ga0055526_1005878 3300003771 Bacteria 6873
71 Ga0055526_1018334 3300003771 Bacteria 2616
72 Ga0055524_1000061 3300003775 Bacteria 135241
73 Ga0055524_1000104 3300003775 Bacteria 104549
74 Ga0055524_1003002 3300003775 Bacteria 8365
75 Ga0055524_1009869 3300003775 Bacteria 3844
76 Ga0055524_1028264 3300003775 Bacteria 1684
77 Ga0055536_1000985 3300003781 Bacteria 18054
78 Ga0055536_1003268 3300003781 Bacteria 8786
79 Ga0055528_1000097 3300003790 Bacteria 70021
80 Ga0055528_1000443 3300003790 Bacteria 33228
81 Ga0055528_1003367 3300003790 Bacteria 8066
82 Ga0055528_1006401 3300003790 Bacteria 5343
83 Ga0055528_1022523 3300003790 Bacteria 1960
84 Ga0055528_1025399 3300003790 Bacteria 1740
85 Ga0055528_1026904 3300003790 Bacteria 1636
86 Ga0055530_10031312 3300003791 Bacteria 1397
87 Ga0055540_1000914 3300003792 Bacteria 19278
88 Ga0055540_1010936 3300003792 Bacteria 2977
89 Ga0055540_1019357 3300003792 Bacteria 1835
90 Ga0055540_1026966 3300003792 Bacteria 1381
91 Ga0055540_1027399 3300003792 Bacteria 1364
92 Ga0055531_10002899 3300003794 Bacteria 11168
93 Ga0055541_1000001 3300003841 Bacteria 1111887
94 Ga0055541_1000059 3300003841 Bacteria 112934
95 Ga0055543_1000035 3300004625 Bacteria 127833
96 Ga0055543_1000048 3300004625 Bacteria 109807
97 Ga0055543_1000223 3300004625 Bacteria 45570
98 Ga0055543_1000656 3300004625 Bacteria 18294
99 Ga0065165_1000025 3300005262 Bacteria 246909
100 Ga0065165_1000253 3300005262 Bacteria 92969
101 Ga0065165_1015178 3300005262 Bacteria 2950
102 Ga0065165_1036906 3300005262 Bacteria 1486
103 Ga0065165_1038777 3300005262 Bacteria 1433
104 Ga0070658_10036537 3300005327 Bacteria 3959
105 Ga0070658_10060723 3300005327 Bacteria 3079
106 Ga0070658_10216633 3300005327 Bacteria 1618
107 Ga0070658_10338925 3300005327 Bacteria 1286
108 Ga0070658_10453788 3300005327 Bacteria 1105
109 Ga0070676_10001679 3300005328 Bacteria 11254
110 Ga0070676_10192414 3300005328 Bacteria 1333
111 Ga0070683_100178043 3300005329 Bacteria 2018
112 Ga0070670_100001192 3300005331 Bacteria 20626
113 Ga0070670_100003745 3300005331 Bacteria 12658
114 Ga0070670_100057022 3300005331 Bacteria 3353
115 Ga0070677_10000284 3300005333 Bacteria 17761
116 Ga0068869_100115170 3300005334 Bacteria 2050
117 Ga0068869_100393467 3300005334 Bacteria 1138
118 Ga0070666_10022585 3300005335 Bacteria 4087
119 Ga0070660_100005906 3300005339 Bacteria 8468
120 Ga0070660_100021197 3300005339 Bacteria 4788
121 Ga0070660_100180996 3300005339 Bacteria 1705
122 Ga0070660_100231945 3300005339 Bacteria 1502
123 Ga0070689_100115054 3300005340 Bacteria 2143
124 Ga0070661_100002923 3300005344 Bacteria 11779
125 Ga0070661_100058287 3300005344 Bacteria 2830
126 Ga0070661_100431540 3300005344 Bacteria 1046
127 Ga0070692_10008165 3300005345 Bacteria 4655
128 Ga0070668_100000600 3300005347 Bacteria 24135
129 Ga0070668_100025707 3300005347 Bacteria 4466
130 Ga0070668_100109681 3300005347 Bacteria 2196
131 Ga0070668_100162422 3300005347 Bacteria 1813
132 Ga0070668_100341717 3300005347 Bacteria 1265
133 Ga0070668_100446881 3300005347 Bacteria 1111
134 Ga0070669_100148124 3300005353 Bacteria 1815
135 Ga0070669_100299976 3300005353 Bacteria 1292
136 Ga0070675_100002372 3300005354 Bacteria 14027
137 Ga0070675_100034354 3300005354 Bacteria 4114
138 Ga0070675_100107731 3300005354 Bacteria 2353
139 Ga0070671_100001633 3300005355 Bacteria 16922
140 Ga0070671_100142156 3300005355 Bacteria 2025
141 Ga0070671_100475872 3300005355 Bacteria 1073
142 Ga0070673_100000043 3300005364 Bacteria 52415
143 Ga0070673_100074646 3300005364 Bacteria 2733
144 Ga0070667_100058849 3300005367 Bacteria 3249
145 Ga0070667_100078167 3300005367 Bacteria 2826
146 Ga0070701_10185635 3300005438 Bacteria 1220
147 Ga0070708_100125001 3300005445 Bacteria 2376
148 Ga0070663_100066979 3300005455 Bacteria 2603
149 Ga0070678_100019749 3300005456 Bacteria 4403
150 Ga0070662_100000595 3300005457 Bacteria 22020
151 Ga0070662_100048049 3300005457 Bacteria 3073
152 Ga0068867_100001617 3300005459 Bacteria 15658
153 Ga0070706_100016889 3300005467 Bacteria 6742
154 Ga0070706_100081551 3300005467 Bacteria 2995
155 Ga0070706_100115512 3300005467 Bacteria 2499
156 Ga0070707_100004732 3300005468 Bacteria 12759
157 Ga0070707_100141523 3300005468 Bacteria 2341
158 Ga0070707_100456213 3300005468 Bacteria 1239
159 Ga0070699_100044905 3300005518 Bacteria 3825
160 Ga0070679_100062946 3300005530 Bacteria 3698
161 Ga0070684_100071484 3300005535 Bacteria 3053
162 Ga0070697_100164846 3300005536 Bacteria 1873
163 Ga0068853_100064851 3300005539 Bacteria 3168
164 Ga0068853_100110235 3300005539 Bacteria 2444
165 Ga0068853_100158742 3300005539 Bacteria 2039
166 Ga0068853_100160419 3300005539 Bacteria 2029
167 Ga0068853_100383734 3300005539 Bacteria 1312
168 Ga0070672_100064224 3300005543 Bacteria 2900
169 Ga0070695_100066305 3300005545 Bacteria 2353
170 Ga0070695_100329856 3300005545 Bacteria 1137
171 Ga0070696_100074468 3300005546 Bacteria 2394
172 Ga0070665_100015106 3300005548 Bacteria 7752
173 Ga0070665_100092333 3300005548 Bacteria 3032
174 Ga0070665_100149969 3300005548 Bacteria 2334
175 Ga0070665_100156932 3300005548 Bacteria 2277
176 Ga0070665_100207892 3300005548 Bacteria 1958
177 Ga0070704_100003833 3300005549 Bacteria 8651
178 Ga0068855_100000112 3300005563 Bacteria 100923
179 Ga0068855_100015721 3300005563 Bacteria 9103
180 Ga0068855_100074547 3300005563 Bacteria 3941
181 Ga0068855_100319434 3300005563 Bacteria 1717
182 Ga0068855_100419693 3300005563 Bacteria 1463
183 Ga0070664_100323440 3300005564 Bacteria 1398
184 Ga0070664_100397442 3300005564 Bacteria 1260
185 Ga0068857_100024609 3300005577 Bacteria 5302
186 Ga0068857_100219721 3300005577 Bacteria 1735
187 Ga0068854_100025684 3300005578 Bacteria 4042
188 Ga0068856_100006424 3300005614 Bacteria 11534
189 Ga0068856_100031300 3300005614 Bacteria 5205
190 Ga0068856_100082339 3300005614 Bacteria 3194
191 Ga0068856_100226625 3300005614 Bacteria 1885
192 Ga0068856_100400672 3300005614 Bacteria 1392
193 Ga0068852_100004716 3300005616 Bacteria 9672
194 Ga0068852_100189595 3300005616 Bacteria 1939
195 Ga0068852_100279307 3300005616 Bacteria 1609
196 Ga0068864_100019540 3300005618 Bacteria 5666
197 Ga0068866_10309396 3300005718 Bacteria 990
198 Ga0068861_100191729 3300005719 Bacteria 1709
199 Ga0068870_10019746 3300005840 Bacteria 3273
200 Ga0068870_10036685 3300005840 Bacteria 2523
201 Ga0068863_100004844 3300005841 Bacteria 13254
202 Ga0068863_100035979 3300005841 Bacteria 4716
203 Ga0068863_100527127 3300005841 Bacteria 1165
204 Ga0068858_100124490 3300005842 Bacteria 2413
205 Ga0068860_100063158 3300005843 Bacteria 3518
206 Ga0068860_100142447 3300005843 Bacteria 2305
207 Ga0068860_100259739 3300005843 Bacteria 1693
208 Ga0068862_100006394 3300005844 Bacteria 9796
209 Ga0068862_100143321 3300005844 Bacteria 2122
210 Ga0068862_100326284 3300005844 Bacteria 1418
211 Ga0081455_10271262 3300005937 Bacteria 1230
212 Ga0081455_10417943 3300005937 Bacteria 925
213 Ga0081540_1001564 3300005983 Bacteria 19568
214 Ga0081540_1009283 3300005983 Bacteria 6784
215 Ga0081539_10002371 3300005985 Bacteria 26979
216 Ga0075365_10147251 3300006038 Bacteria 1637
217 Ga0075365_10401157 3300006038 Bacteria 968
218 Ga0075368_10035926 3300006042 Bacteria 1935
219 Ga0075363_100259492 3300006048 Bacteria 1002
220 Ga0075362_10171136 3300006177 Bacteria 1049
221 Ga0075367_10013064 3300006178 Bacteria 4451
222 Ga0075367_10162178 3300006178 Bacteria 1390
223 Ga0075367_10317937 3300006178 Bacteria 981
224 Ga0075369_10002189 3300006186 Bacteria 6906
225 Ga0075369_10107811 3300006186 Bacteria 1254
226 Ga0075366_10004184 3300006195 Bacteria 7737
227 Ga0097621_100038145 3300006237 Bacteria 3855
228 Ga0075370_10022947 3300006353 Bacteria 3433
229 Ga0075370_10092723 3300006353 Bacteria 1743
230 Ga0075370_10101670 3300006353 Bacteria 1664
231 Ga0075370_10229329 3300006353 Bacteria 1099
232 Ga0075428_100251624 3300006844 Bacteria 1904
233 Ga0075428_100292380 3300006844 Bacteria 1752
234 Ga0075430_100058566 3300006846 Bacteria 3238
235 Ga0075430_100143631 3300006846 Bacteria 1987
236 Ga0075430_100185000 3300006846 Bacteria 1732
237 Ga0075430_100254970 3300006846 Bacteria 1453
238 Ga0075430_100344974 3300006846 Bacteria 1230
239 Ga0075434_100029314 3300006871 Bacteria 5412
240 Ga0075434_100484348 3300006871 Bacteria 1258
241 Ga0068865_100192877 3300006881 Bacteria 1577
242 Ga0068865_100372296 3300006881 Bacteria 1163
243 Ga0079104_1004107 3300006946 Bacteria 6396
244 Ga0075435_100030554 3300007076 Bacteria 4237
245 Ga0105251_10000186 3300009011 Bacteria 62845
246 Ga0105251_10006290 3300009011 Bacteria 7599
247 Ga0105240_10000027 3300009093 Bacteria 348486
248 Ga0105240_10017895 3300009093 Bacteria 9534
249 Ga0105240_10287812 3300009093 Bacteria 1885
250 Ga0105240_10298298 3300009093 Bacteria 1844
251 Ga0105240_10639168 3300009093 Bacteria 1168
252 Ga0111539_10173003 3300009094 Bacteria 2523
253 Ga0105245_10130450 3300009098 Bacteria 2357
254 Ga0114129_10185856 3300009147 Bacteria 2824
255 Ga0114129_10657355 3300009147 Bacteria 1352
256 Ga0114129_11175263 3300009147 Bacteria 957
257 Ga0105241_10069410 3300009174 Bacteria 2732
258 Ga0105241_10420023 3300009174 Bacteria 1177
259 Ga0105248_10014055 3300009177 Bacteria 8810
260 Ga0105248_10088824 3300009177 Bacteria 3479
261 Ga0105248_10140496 3300009177 Bacteria 2724
262 Ga0105237_10003459 3300009545 Bacteria 18738
263 Ga0105237_10003513 3300009545 Bacteria 18595
264 Ga0105237_10009004 3300009545 Bacteria 10737
265 Ga0105237_10308750 3300009545 Bacteria 1585
266 Ga0105238_10178777 3300009551 Bacteria 2098
267 Ga0105238_10331242 3300009551 Bacteria 1509
268 Ga0123341_1000048 3300009765 Bacteria 50946
269 Ga0123342_1012205 3300009766 Bacteria 9083
270 Ga0105239_10002416 3300010375 Bacteria 23787
271 Ga0105239_10034949 3300010375 Bacteria 5520
272 Ga0105239_10175230 3300010375 Bacteria 2399
273 Ga0105239_11020694 3300010375 Bacteria 951
274 Ga0105246_10074599 3300011119 Bacteria 2399
275 Ga0157371_10026978 3300013102 Bacteria 4169
276 Ga0157370_10000372 3300013104 Bacteria 56499
277 Ga0157370_10003889 3300013104 Bacteria 17400
278 Ga0157370_10040302 3300013104 Bacteria 4509
279 Ga0157370_10634856 3300013104 Bacteria 977
280 Ga0157369_10000044 3300013105 Bacteria 178695
281 Ga0157369_10021119 3300013105 Bacteria 7279
282 Ga0171463_1001 3300013249 Bacteria 1406070
283 Ga0171462_1008 3300013250 Bacteria 384318
284 Ga0157374_10063155 3300013296 Bacteria 3473
285 Ga0157374_10140441 3300013296 Bacteria 2344
286 Ga0163162_10023344 3300013306 Bacteria 6104
287 Ga0163162_10443893 3300013306 Bacteria 1430
288 Ga0163162_10608508 3300013306 Bacteria 1218
289 Ga0157372_10244644 3300013307 Bacteria 2082
290 Ga0157372_10456406 3300013307 Bacteria 1489
291 Ga0157375_10009041 3300013308 Bacteria 8722
292 Ga0157375_10290094 3300013308 Bacteria 1799
293 Ga0157380_10241916 3300014326 Bacteria 1628
294 Ga0182008_10004471 3300014497 Bacteria 8173
295 Ga0182008_10050647 3300014497 Bacteria 2061
296 Ga0182008_10058210 3300014497 Bacteria 1908
297 Ga0157376_10060111 3300014969 Bacteria 3190
298 Ga0157376_10085241 3300014969 Bacteria 2722
299 Ga0157376_10126778 3300014969 Bacteria 2272
300 Ga0182006_1004028 3300015261 Bacteria 7334
301 Ga0182006_1043889 3300015261 Bacteria 1746
302 Ga0182007_10001095 3300015262 Bacteria 14734
303 Ga0182007_10003604 3300015262 Bacteria 7264
304 Ga0182005_1001513 3300015265 Bacteria 9273
305 Ga0182005_1003388 3300015265 Bacteria 5425
306 Ga0182005_1042792 3300015265 Bacteria 1231
307 Ga0183363_1135 3300015690 Bacteria 18828
308 Ga0163161_10019638 3300017792 Bacteria 4740
309 Ga0163161_10353914 3300017792 Bacteria 1168
310 Ga0197907_11172017 3300020069 Bacteria 2424
311 Ga0206356_10374673 3300020070 Bacteria 2321
312 Ga0206356_10961327 3300020070 Bacteria 1751
313 Ga0206353_12038952 3300020082 Bacteria 4724
314 Ga0214542_1023210 3300021321 Bacteria 3775
315 Ga0214543_1000049 3300021327 Bacteria 149506
316 Ga0213872_10011654 3300021361 Bacteria 4158
317 Ga0224712_10000168 3300022467 Bacteria 11220
318 Ga0228710_1000008 3300022740 Bacteria 174306
319 Ga0209435_100036 3300025206 Bacteria 126970
320 Ga0209435_105444 3300025206 Bacteria 1426
321 Ga0209760_101367 3300025207 Bacteria 2618
322 Ga0209436_100047 3300025208 Bacteria 68393
323 Ga0209436_101464 3300025208 Bacteria 8205
324 Ga0209784_100004 3300025224 Bacteria 1378156
325 Ga0209784_100009 3300025224 Bacteria 688031
326 Ga0209566_100004 3300025225 Bacteria 1531866
327 Ga0209566_100007 3300025225 Bacteria 688031
328 Ga0209674_100006 3300025226 Bacteria 1531866
329 Ga0209674_100013 3300025226 Bacteria 813140
330 Ga0209674_100018 3300025226 Bacteria 688031
331 Ga0209674_100308 3300025226 Bacteria 32854
332 Ga0209672_100010 3300025228 Bacteria 873151
333 Ga0209147_100006 3300025229 Bacteria 873276
334 Ga0209563_100009 3300025230 Bacteria 1378156
335 Ga0209563_100020 3300025230 Bacteria 688031
336 Ga0209563_107410 3300025230 Bacteria 1804
337 Ga0207427_101102 3300025231 Bacteria 10948
338 Ga0207427_104561 3300025231 Bacteria 2274
339 Ga0209437_100004 3300025233 Bacteria 1378156
340 Ga0209437_100033 3300025233 Bacteria 512520
341 Ga0209437_100036 3300025233 Bacteria 469153
342 Ga0209258_100010 3300025242 Bacteria 873276
343 Ga0207425_1000031 3300025245 Bacteria 261181
344 Ga0207425_1001638 3300025245 Bacteria 9024
345 Ga0207425_1005328 3300025245 Bacteria 3682
346 Ga0209646_1000132 3300025246 Bacteria 126859
347 Ga0209026_1000236 3300025250 Bacteria 73740
348 Ga0209677_100005 3300025253 Bacteria 1378156
349 Ga0209677_100010 3300025253 Bacteria 688031
350 Ga0209677_101419 3300025253 Bacteria 10372
351 Ga0209148_1000018 3300025254 Bacteria 756247
352 Ga0209148_1001099 3300025254 Bacteria 16270
353 Ga0209759_1000148 3300025256 Bacteria 121104
354 Ga0209759_1000269 3300025256 Bacteria 73740
355 Ga0209759_1000307 3300025256 Bacteria 66493
356 Ga0209129_1000053 3300025258 Bacteria 262823
357 Ga0209129_1000125 3300025258 Bacteria 133506
358 Ga0209129_1000310 3300025258 Bacteria 44160
359 Ga0209129_1000585 3300025258 Bacteria 25039
360 Ga0209129_1000772 3300025258 Bacteria 20285
361 Ga0209129_1001648 3300025258 Bacteria 12106
362 Ga0209129_1002237 3300025258 Bacteria 9688
363 Ga0209233_1000005 3300025261 Bacteria 1531866
364 Ga0209233_1000056 3300025261 Bacteria 438104
365 Ga0209233_1000064 3300025261 Bacteria 392156
366 Ga0209233_1000135 3300025261 Bacteria 201057
367 Ga0209233_1000492 3300025261 Bacteria 23883
368 Ga0209233_1000519 3300025261 Bacteria 22325
369 Ga0209565_1024431 3300025263 Bacteria 1230
370 Ga0209565_1024863 3300025263 Bacteria 1215
371 Ga0209455_1000015 3300025272 Bacteria 756128
372 Ga0209455_1000542 3300025272 Bacteria 26113
373 Ga0209673_1000254 3300025273 Bacteria 101508
374 Ga0209673_1000420 3300025273 Bacteria 74545
375 Ga0209673_1000946 3300025273 Bacteria 36287
376 Ga0209673_1001299 3300025273 Bacteria 25473
377 Ga0209673_1001710 3300025273 Bacteria 18597
378 Ga0209673_1002387 3300025273 Bacteria 13187
379 Ga0209673_1005272 3300025273 Bacteria 6564
380 Ga0209673_1007188 3300025273 Bacteria 5194
381 Ga0209130_1000005 3300025284 Bacteria 599620
382 Ga0209130_1000006 3300025284 Bacteria 596528
383 Ga0209130_1000018 3300025284 Bacteria 388301
384 Ga0209675_1000452 3300025291 Bacteria 31792
385 Ga0209676_1000296 3300025292 Bacteria 100635
386 Ga0209676_1004393 3300025292 Bacteria 7872
387 Ga0209676_1006421 3300025292 Bacteria 5809
388 Ga0209025_1000008 3300025294 Bacteria 1130876
389 Ga0209025_1000087 3300025294 Bacteria 261181
390 Ga0209025_1000165 3300025294 Bacteria 164692
391 Ga0209025_1000284 3300025294 Bacteria 114754
392 Ga0209025_1000900 3300025294 Bacteria 46091
393 Ga0209025_1001720 3300025294 Bacteria 26508
394 Ga0209025_1005547 3300025294 Bacteria 10231
395 Ga0209025_1017626 3300025294 Bacteria 4106
396 Ga0209025_1028874 3300025294 Bacteria 2702
397 Ga0209025_1045059 3300025294 Bacteria 1834
398 Ga0209564_1000015 3300025295 Bacteria 615324
399 Ga0209564_1000031 3300025295 Bacteria 494703
400 Ga0209564_1000217 3300025295 Bacteria 131090
401 Ga0209564_1000233 3300025295 Bacteria 121692
402 Ga0209564_1000399 3300025295 Bacteria 77444
403 Ga0209564_1009805 3300025295 Bacteria 4499
404 Ga0209564_1010691 3300025295 Bacteria 4193
405 Ga0209758_1000081 3300025297 Bacteria 261181
406 Ga0209758_1000313 3300025297 Bacteria 93883
407 Ga0209758_1000420 3300025297 Bacteria 71919
408 Ga0209758_1003751 3300025297 Bacteria 13450
409 Ga0209758_1005053 3300025297 Bacteria 10474
410 Ga0209758_1010064 3300025297 Bacteria 5732
411 Ga0209758_1021831 3300025297 Bacteria 2964
412 Ga0209758_1062664 3300025297 Bacteria 1216
413 Ga0209050_1000773 3300025298 Bacteria 45942
414 Ga0209050_1004963 3300025298 Bacteria 8667
415 Ga0209050_1005751 3300025298 Bacteria 7648
416 Ga0209256_1000027 3300025299 Bacteria 423283
417 Ga0209256_1000030 3300025299 Bacteria 414828
418 Ga0209256_1000062 3300025299 Bacteria 253433
419 Ga0209256_1000762 3300025299 Bacteria 41835
420 Ga0209256_1000882 3300025299 Bacteria 37027
421 Ga0209256_1001301 3300025299 Bacteria 26880
422 Ga0209256_1002206 3300025299 Bacteria 16675
423 Ga0209256_1010006 3300025299 Bacteria 4056
424 Ga0209256_1049104 3300025299 Bacteria 1030
425 Ga0207426_1000015 3300025302 Bacteria 599316
426 Ga0207426_1000044 3300025302 Bacteria 428043
427 Ga0207426_1000106 3300025302 Bacteria 244368
428 Ga0207426_1000265 3300025302 Bacteria 110545
429 Ga0207426_1000417 3300025302 Bacteria 70223
430 Ga0207426_1003845 3300025302 Bacteria 7746
431 Ga0209051_1000339 3300025303 Bacteria 70136
432 Ga0209051_1008214 3300025303 Bacteria 5561
433 Ga0209051_1051500 3300025303 Bacteria 1368
434 Ga0207713_1000804 3300025735 Bacteria 29085
435 Ga0207713_1043867 3300025735 Bacteria 1843
436 Ga0207682_10000255 3300025893 Bacteria 23987
437 Ga0207642_10116105 3300025899 Bacteria 1372
438 Ga0207710_10136093 3300025900 Bacteria 1183
439 Ga0207680_10029569 3300025903 Bacteria 3080
440 Ga0207647_10052263 3300025904 Bacteria 2522
441 Ga0207645_10000696 3300025907 Bacteria 27955
442 Ga0207645_10130673 3300025907 Bacteria 1634
443 Ga0207645_10176646 3300025907 Bacteria 1400
444 Ga0207643_10027655 3300025908 Bacteria 3145
445 Ga0207643_10075194 3300025908 Bacteria 1949
446 Ga0207705_10097002 3300025909 Bacteria 2164
447 Ga0207705_10321491 3300025909 Bacteria 1189
448 Ga0207684_10170292 3300025910 Bacteria 1877
449 Ga0207684_10174289 3300025910 Bacteria 1854
450 Ga0207684_10427432 3300025910 Bacteria 1138
451 Ga0207707_10024271 3300025912 Bacteria 5306
452 Ga0207695_10000024 3300025913 Bacteria 632311
453 Ga0207695_10070854 3300025913 Bacteria 3562
454 Ga0207695_10124846 3300025913 Bacteria 2538
455 Ga0207695_10178269 3300025913 Bacteria 2047
456 Ga0207695_10196802 3300025913 Bacteria 1931
457 Ga0207671_10000504 3300025914 Bacteria 53102
458 Ga0207671_10020765 3300025914 Bacteria 4995
459 Ga0207671_10201687 3300025914 Bacteria 1554
460 Ga0207671_10289010 3300025914 Bacteria 1294
461 Ga0207663_10096245 3300025916 Bacteria 1977
462 Ga0207660_10054495 3300025917 Bacteria 2854
463 Ga0207660_10058661 3300025917 Bacteria 2761
464 Ga0207657_10002628 3300025919 Bacteria 19416
465 Ga0207657_10019972 3300025919 Bacteria 6346
466 Ga0207657_10029830 3300025919 Bacteria 4959
467 Ga0207657_10192848 3300025919 Bacteria 1643
468 Ga0207649_10062944 3300025920 Bacteria 2340
469 Ga0207649_10069688 3300025920 Bacteria 2240
470 Ga0207649_10198305 3300025920 Bacteria 1416
471 Ga0207652_10061952 3300025921 Bacteria 3232
472 Ga0207646_10010934 3300025922 Bacteria 8814
473 Ga0207646_10522183 3300025922 Bacteria 1069
474 Ga0207681_10066969 3300025923 Bacteria 2488
475 Ga0207681_10225049 3300025923 Bacteria 1453
476 Ga0207694_10066506 3300025924 Bacteria 2812
477 Ga0207650_10002047 3300025925 Bacteria 14109
478 Ga0207650_10114414 3300025925 Bacteria 2093
479 Ga0207650_10147814 3300025925 Bacteria 1852
480 Ga0207650_10171275 3300025925 Bacteria 1726
481 Ga0207650_10501588 3300025925 Bacteria 1014
482 Ga0207659_10063962 3300025926 Bacteria 2661
483 Ga0207644_10100442 3300025931 Bacteria 2172
484 Ga0207644_10119456 3300025931 Bacteria 2005
485 Ga0207644_10186405 3300025931 Bacteria 1629
486 Ga0207706_10030908 3300025933 Bacteria 4775
487 Ga0207706_10256326 3300025933 Bacteria 1527
488 Ga0207670_10284360 3300025936 Bacteria 1290
489 Ga0207669_10058807 3300025937 Bacteria 2347
490 Ga0207704_10129306 3300025938 Bacteria 1745
491 Ga0207665_10119488 3300025939 Bacteria 1860
492 Ga0207691_10000029 3300025940 Bacteria 120814
493 Ga0207691_10000111 3300025940 Bacteria 72961
494 Ga0207691_10178528 3300025940 Bacteria 1856
495 Ga0207691_10448631 3300025940 Bacteria 1098
496 Ga0207711_10066509 3300025941 Bacteria 3117
497 Ga0207711_10097229 3300025941 Bacteria 2600
498 Ga0207689_10035410 3300025942 Bacteria 4148
499 Ga0207689_10126643 3300025942 Bacteria 2101
500 Ga0207679_10323687 3300025945 Bacteria 1336
501 Ga0207667_10000032 3300025949 Bacteria 322253
502 Ga0207667_10012150 3300025949 Bacteria 9945
503 Ga0207667_10156498 3300025949 Bacteria 2344
504 Ga0207667_10471585 3300025949 Bacteria 1275
505 Ga0207667_10652535 3300025949 Bacteria 1058
506 Ga0207651_10017619 3300025960 Bacteria 4224
507 Ga0207668_10020700 3300025972 Bacteria 4185
508 Ga0207668_10033890 3300025972 Bacteria 3386
509 Ga0207668_10132835 3300025972 Bacteria 1903
510 Ga0207668_10222677 3300025972 Bacteria 1516
511 Ga0207640_10071336 3300025981 Bacteria 2339
512 Ga0207658_10076986 3300025986 Bacteria 2543
513 Ga0207703_10239102 3300026035 Bacteria 1632
514 Ga0207639_10006241 3300026041 Bacteria 8098
515 Ga0207639_10154897 3300026041 Bacteria 1924
516 Ga0207639_10252998 3300026041 Bacteria 1537
517 Ga0207678_10079742 3300026067 Bacteria 2803
518 Ga0207678_10135000 3300026067 Bacteria 2105
519 Ga0207708_10014634 3300026075 Bacteria 5871
520 Ga0207702_10033194 3300026078 Bacteria 4310
521 Ga0207702_10169535 3300026078 Bacteria 2000
522 Ga0207702_10187226 3300026078 Bacteria 1910
523 Ga0207641_10092852 3300026088 Bacteria 2644
524 Ga0207641_10128584 3300026088 Bacteria 2271
525 Ga0207648_10001008 3300026089 Bacteria 31704
526 Ga0207676_10066093 3300026095 Bacteria 2882
527 Ga0207674_10059902 3300026116 Bacteria 3851
528 Ga0207674_10123109 3300026116 Bacteria 2559
529 Ga0207674_10193307 3300026116 Bacteria 1985
530 Ga0207675_100051114 3300026118 Bacteria 3856
531 Ga0207675_100213524 3300026118 Bacteria 1857
532 Ga0207675_100514325 3300026118 Bacteria 1193
533 Ga0207683_10000164 3300026121 Bacteria 56430
534 Ga0207698_10009652 3300026142 Bacteria 6163
535 Ga0207698_10123156 3300026142 Bacteria 2199
536 Ga0207698_10406051 3300026142 Bacteria 1303
537 Ga0209281_1000134 3300027111 Bacteria 185406
538 Ga0209281_1000319 3300027111 Bacteria 84764
539 Ga0209371_1002406 3300027312 Bacteria 10517
540 Ga0209969_1009777 3300027360 Bacteria 1368
541 Ga0209999_1009256 3300027543 Bacteria 1778
542 Ga0209970_1024307 3300027614 Bacteria 1034
543 Ga0209282_1000029 3300027666 Bacteria 157883
544 Ga0209813_10007265 3300027866 Bacteria 2755
545 Ga0207428_10124091 3300027907 Bacteria 1978
546 Ga0268266_10000002 3300028379 Bacteria 3059047
547 Ga0268266_10002704 3300028379 Bacteria 18601
548 Ga0268266_10022595 3300028379 Bacteria 5357
549 Ga0268266_10024678 3300028379 Bacteria 5115
550 Ga0268266_10081449 3300028379 Bacteria 2822
551 Ga0268266_10129895 3300028379 Bacteria 2252
552 Ga0268266_10303159 3300028379 Bacteria 1491
553 Ga0268265_10283677 3300028380 Bacteria 1483
554 Ga0265318_10018442 3300028577 Bacteria 2847
555 Ga0307515_10004491 3300028794 Bacteria 28864
556 Ga0307515_10044853 3300028794 Bacteria 6814
557 Ga0265338_10014553 3300028800 Bacteria 8741
558 Ga0268256_1001914 3300030500 Bacteria 11447
559 Ga0265330_10018309 3300031235 Bacteria 3218
560 Ga0265332_10137458 3300031238 Bacteria 1024
561 Ga0265328_10030250 3300031239 Bacteria 2018
562 Ga0265325_10006250 3300031241 Bacteria 7259
563 Ga0265325_10019300 3300031241 Bacteria 3772
564 Ga0265325_10066323 3300031241 Bacteria 1820
565 Ga0265340_10013579 3300031247 Bacteria 4275
566 Ga0265340_10022646 3300031247 Bacteria 3211
567 Ga0265340_10043305 3300031247 Bacteria 2207
568 Ga0265339_10002167 3300031249 Bacteria 14234
569 Ga0265339_10002978 3300031249 Bacteria 11969
570 Ga0265339_10017930 3300031249 Bacteria 4184
571 Ga0265331_10096775 3300031250 Bacteria 1361
572 Ga0265327_10062208 3300031251 Bacteria 1901
573 Ga0265316_10013087 3300031344 Bacteria 7399
574 Ga0265316_10088953 3300031344 Bacteria 2357
575 Ga0265316_10187826 3300031344 Bacteria 1536
576 Ga0265316_10286349 3300031344 Bacteria 1203
577 Ga0265316_10311642 3300031344 Bacteria 1145
578 Ga0307513_10004452 3300031456 Bacteria 18712
579 Ga0307513_10122586 3300031456 Bacteria 2563
580 Ga0307513_10397807 3300031456 Bacteria 1113
581 Ga0307408_100008435 3300031548 Bacteria 6801
582 Ga0307408_100240572 3300031548 Bacteria 1487
583 Ga0307408_100317073 3300031548 Bacteria 1312
584 Ga0265313_10000044 3300031595 Bacteria 117063
585 Ga0265313_10000481 3300031595 Bacteria 41874
586 Ga0265313_10011274 3300031595 Bacteria 5569
587 Ga0265313_10040457 3300031595 Bacteria 2304
588 Ga0265313_10107878 3300031595 Bacteria 1228
589 Ga0265313_10148949 3300031595 Bacteria 1001
590 Ga0316575_10125039 3300031665 Bacteria 1053
591 Ga0265314_10010039 3300031711 Bacteria 7937
592 Ga0265314_10040857 3300031711 Bacteria 3325
593 Ga0265314_10052311 3300031711 Bacteria 2840
594 Ga0265342_10000926 3300031712 Bacteria 29144
595 Ga0265342_10018725 3300031712 Bacteria 4476
596 Ga0265342_10036960 3300031712 Bacteria 2980
597 Ga0307405_10000891 3300031731 Bacteria 11843
598 Ga0307413_10459871 3300031824 Bacteria 1012
599 Ga0307406_10008115 3300031901 Bacteria 5849
600 Ga0307406_10282757 3300031901 Bacteria 1266
601 Ga0307406_10497205 3300031901 Bacteria 988
602 Ga0307412_10003099 3300031911 Bacteria 9229
603 Ga0315914_1000021 3300031967 Bacteria 119592
604 Ga0307409_100427434 3300031995 Bacteria 1272
605 Ga0307416_100134577 3300032002 Bacteria 2233
606 Ga0307416_100330957 3300032002 Bacteria 1531
607 Ga0307414_10006260 3300032004 Bacteria 6624
608 Ga0307414_10350310 3300032004 Bacteria 1267
609 Ga0307411_10116431 3300032005 Bacteria 1924
610 Ga0307415_100277707 3300032126 Bacteria 1376
611 Ga0307510_10000006 3300033180 Bacteria 566474
612 Ga0315913_1000014 3300033430 Bacteria 120114
613 Ga0315915_1000003 3300033464 Bacteria 407996
614 Ga0373940_0138878 3300035088 Bacteria 767
615 Ga0373931_0069030 3300035691 Bacteria 1925
616 Ga0373925_0337993 3300037068 Bacteria 1221
617 Ga0395899_0191350 3300037312 Bacteria 1432
618 Ga0395900_0102955 3300037418 Bacteria 2933
619 Ga0395898_0000734 3300037466 Bacteria 57441
620 Ga0395898_0396096 3300037466 Bacteria 1317
621 Ga0395905_0001622 3300037471 Bacteria 26738
622 Ga0395905_0005671 3300037471 Bacteria 12700
623 Ga0395905_0014502 3300037471 Bacteria 7521
624 Ga0395905_0146917 3300037471 Bacteria 2218
625 Ga0395901_0003838 3300038443 Bacteria 15147
626 Ga0436361_0202578 3300039447 Bacteria 4834
627 Ga0436361_0442404 3300039447 Bacteria 1523
628 Ga0436361_0837169 3300039447 Bacteria 1284
629 Ga0436361_0896770 3300039447 Bacteria 3405
630 Ga0439465_0006444 3300041413 Bacteria 3730
631 Ga0439465_0012770 3300041413 Bacteria 2626
632 Ga0439465_0014683 3300041413 Bacteria 2442
633 Ga0439465_0024073 3300041413 Bacteria 1918
634 Ga0439465_0025832 3300041413 Bacteria 1855
635 Ga0451787_404703 3300041441 Bacteria 1588
636 Ga0451795_0556880 3300041456 Bacteria 1914
637 Ga0451841_0396807 3300041498 Bacteria 1246
638 Ga0451841_0417501 3300041498 Bacteria 1968
639 Ga0451849_0336373 3300041505 Bacteria 1690
640 Ga0451843_1415636 3300041509 Bacteria 1020
641 Ga0451853_0588015 3300041512 Bacteria 1906
642 Ga0451853_2057460 3300041512 Bacteria 946
643 Ga0439449_0019354 3300042007 Bacteria 2552
644 Ga0439462_0053106 3300042015 Bacteria 1091
645 Ga0450911_000165 3300042115 Bacteria 26141
646 Ga0439435_0012453 3300042436 Bacteria 2062
647 Ga0439435_0067682 3300042436 Bacteria 1052
648 Ga0439460_0005081 3300042461 Bacteria 3218
649 Ga0466969_0000465 3300044656 Bacteria 22352
650 Ga0466972_0000754 3300044658 Bacteria 15432
651 Ga0453683_0340108 3300044673 Bacteria 963
652 Ga0466965_0000062 3300044683 Bacteria 34136
653 Ga0466966_0006620 3300044684 Bacteria 7670
654 Ga0466961_0001589 3300044693 Bacteria 14081
655 Ga0466961_0206928 3300044693 Bacteria 1212
656 Ga0466963_0000730 3300044694 Bacteria 16148
657 Ga0466971_0001288 3300044719 Bacteria 10466
658 Ga0466957_0003439 3300044842 Bacteria 8690
659 Ga0451576_0613565 3300045051 Bacteria 1143
660 Ga0466958_0000130 3300045836 Bacteria 24959
661 Ga0466967_0265249 3300045976 Bacteria 1644
662 Ga0495592_0000829 3300046454 Bacteria 21475
663 Ga0495592_0011881 3300046454 Bacteria 6599
664 Ga0495592_0054299 3300046454 Bacteria 2969
665 Ga0495592_0332200 3300046454 Bacteria 979
666 Ga0495603_0001794 3300046455 Bacteria 12674
667 Ga0495603_0025778 3300046455 Bacteria 3554
668 Ga0495590_0006612 3300046457 Bacteria 4518
669 Ga0495629_0000914 3300046459 Bacteria 23710
670 Ga0495629_0099308 3300046459 Bacteria 2031
671 Ga0495629_0159995 3300046459 Bacteria 1564
672 Ga0495638_0000909 3300046460 Bacteria 30235
673 Ga0495641_0019229 3300046461 Bacteria 3502
674 Ga0495641_0025194 3300046461 Bacteria 2922
675 Ga0495651_0028826 3300046462 Bacteria 4327
676 Ga0495651_0035189 3300046462 Bacteria 3901
677 Ga0495651_0073024 3300046462 Bacteria 2605
678 Ga0495651_0176149 3300046462 Bacteria 1518
679 Ga0495651_0218766 3300046462 Bacteria 1320
680 Ga0495651_0369145 3300046462 Bacteria 944
681 Ga0495653_0009203 3300046463 Bacteria 8078
682 Ga0495653_0029136 3300046463 Bacteria 4410
683 Ga0495653_0110376 3300046463 Bacteria 1977
684 Ga0495653_0185586 3300046463 Bacteria 1423
685 Ga0495653_0377172 3300046463 Bacteria 906
686 Ga0495650_0001446 3300046471 Bacteria 22866
687 Ga0495650_0017389 3300046471 Bacteria 3606
688 Ga0495650_0020552 3300046471 Bacteria 3215
689 Ga0495580_0001047 3300046472 Bacteria 24311
690 Ga0495580_0001253 3300046472 Bacteria 22415
691 Ga0495580_0003602 3300046472 Bacteria 13132
692 Ga0495580_0009008 3300046472 Bacteria 7879
693 Ga0495580_0263550 3300046472 Bacteria 1178
694 Ga0495582_0004389 3300046473 Bacteria 7932
695 Ga0495582_0004650 3300046473 Bacteria 7718
696 Ga0495605_0002885 3300046474 Bacteria 10439
697 Ga0495605_0038228 3300046474 Bacteria 2409
698 Ga0495662_0041724 3300046476 Bacteria 2215
699 Ga0495662_0050211 3300046476 Bacteria 2013
700 Ga0495664_0002924 3300046477 Bacteria 9220
701 Ga0495664_0005874 3300046477 Bacteria 6753
702 Ga0495664_0083059 3300046477 Bacteria 1922
703 Ga0495585_0005637 3300046492 Bacteria 7862
704 Ga0495585_0069050 3300046492 Bacteria 1929
705 Ga0495585_0108761 3300046492 Bacteria 1476
706 Ga0495596_0005869 3300046500 Bacteria 5738
707 Ga0495607_0167571 3300046501 Bacteria 1112
708 Ga0495583_0011359 3300046506 Bacteria 5118
709 Ga0495583_0051746 3300046506 Bacteria 1871
710 Ga0495583_0066627 3300046506 Bacteria 1593
711 Ga0495606_0001156 3300046507 Bacteria 37435
712 Ga0495606_0006718 3300046507 Bacteria 10538
713 Ga0495606_0041695 3300046507 Bacteria 3077
714 Ga0495606_0080461 3300046507 Bacteria 2027
715 Ga0495606_0100057 3300046507 Bacteria 1767
716 Ga0495608_0012173 3300046511 Bacteria 5978
717 Ga0495610_0003480 3300046512 Bacteria 12251
718 Ga0495610_0018326 3300046512 Bacteria 3959
719 Ga0495610_0018570 3300046512 Bacteria 3922
720 Ga0495618_0016257 3300046514 Bacteria 4549
721 Ga0495620_0018573 3300046515 Bacteria 3441
722 Ga0495628_0001001 3300046516 Bacteria 25857
723 Ga0495628_0004631 3300046516 Bacteria 12146
724 Ga0495628_0007758 3300046516 Bacteria 9252
725 Ga0495628_0058964 3300046516 Bacteria 3015
726 Ga0495628_0146980 3300046516 Bacteria 1796
727 Ga0495628_0318805 3300046516 Bacteria 1147
728 Ga0495630_0127841 3300046517 Bacteria 1929
729 Ga0495631_0000552 3300046518 Bacteria 25095
730 Ga0495632_0028804 3300046519 Bacteria 2897
731 Ga0495632_0080712 3300046519 Bacteria 1551
732 Ga0495643_0219742 3300046522 Bacteria 902
733 Ga0495648_0009668 3300046524 Bacteria 7435
734 Ga0495648_0085051 3300046524 Bacteria 1788
735 Ga0495648_0087345 3300046524 Bacteria 1756
736 Ga0495663_0090151 3300046525 Bacteria 999
737 Ga0495666_0010278 3300046526 Bacteria 4668
738 Ga0495666_0044960 3300046526 Bacteria 2131
739 Ga0495642_0030212 3300046528 Bacteria 2167
740 Ga0495652_0012335 3300046529 Bacteria 7714
741 Ga0495652_0026326 3300046529 Bacteria 5139
742 Ga0495652_0043479 3300046529 Bacteria 3868
743 Ga0495652_0128645 3300046529 Bacteria 2008
744 Ga0495652_0273874 3300046529 Bacteria 1239
745 Ga0495652_0287220 3300046529 Bacteria 1202
746 Ga0495654_0126313 3300046530 Bacteria 1152
747 Ga0495654_0147139 3300046530 Bacteria 1045
748 Ga0495665_0027389 3300046531 Bacteria 3058
749 Ga0495665_0146855 3300046531 Bacteria 1231
750 Ga0495665_0251171 3300046531 Bacteria 910
751 Ga0495586_0022263 3300046535 Bacteria 3380
752 Ga0495586_0105143 3300046535 Bacteria 1569
753 Ga0495586_0262906 3300046535 Bacteria 985
754 Ga0495587_0007517 3300046536 Bacteria 7057
755 Ga0495597_0017347 3300046542 Bacteria 3391
756 Ga0495597_0167452 3300046542 Bacteria 894
757 Ga0495645_0000268 3300046543 Bacteria 38595
758 Ga0495645_0036074 3300046543 Bacteria 3604
759 Ga0495622_0000160 3300046557 Bacteria 56611
760 Ga0495622_0007629 3300046557 Bacteria 5024
761 Ga0495622_0017577 3300046557 Bacteria 3330
762 Ga0495622_0109639 3300046557 Bacteria 1264
763 Ga0495633_0058097 3300046558 Bacteria 1816
764 Ga0495633_0069262 3300046558 Bacteria 1647
765 Ga0495667_0109801 3300046559 Bacteria 1782
766 Ga0495668_0049554 3300046616 Bacteria 2329
767 Ga0495668_0071996 3300046616 Bacteria 1899
768 Ga0495634_0068259 3300046642 Bacteria 2349
769 Ga0495634_0147543 3300046642 Bacteria 1489
770 Ga0495611_0038900 3300046648 Bacteria 2117
771 Ga0495625_0001787 3300046660 Bacteria 24703
772 Ga0495625_0006284 3300046660 Bacteria 10626
773 Ga0495625_0025409 3300046660 Bacteria 4493
774 Ga0495625_0068718 3300046660 Bacteria 2490
775 Ga0495625_0082331 3300046660 Bacteria 2238
776 Ga0495635_0207830 3300046663 Bacteria 1326
777 Ga0495661_0020669 3300046665 Bacteria 4295
778 Ga0495588_0007107 3300046674 Bacteria 5076
779 Ga0495657_0011098 3300046675 Bacteria 6753
780 Ga0495599_0002233 3300046678 Bacteria 11274
781 Ga0495599_0036699 3300046678 Bacteria 3078
782 Ga0495599_0125995 3300046678 Bacteria 1592
783 Ga0495623_0027830 3300046679 Bacteria 3639
784 Ga0495623_0178717 3300046679 Bacteria 1234
785 Ga0495646_0001211 3300046680 Bacteria 15107
786 Ga0495646_0003303 3300046680 Bacteria 10042
787 Ga0495646_0007299 3300046680 Bacteria 7022
788 Ga0495646_0032075 3300046680 Bacteria 3270
789 Ga0495646_0065350 3300046680 Bacteria 2154
790 Ga0495646_0170947 3300046680 Bacteria 1198
791 Ga0495646_0171724 3300046680 Bacteria 1194
792 Ga0495658_0041794 3300046683 Bacteria 2557
793 Ga0495669_0024288 3300046684 Bacteria 2640
794 Ga0495669_0024927 3300046684 Bacteria 2606
795 Ga0495669_0038291 3300046684 Bacteria 2123
796 Ga0495613_0256182 3300046689 Bacteria 1220
797 Ga0495624_0001055 3300046690 Bacteria 21739
798 Ga0495624_0069594 3300046690 Bacteria 2191
799 Ga0495624_0194905 3300046690 Bacteria 1231
800 Ga0495670_0011202 3300046691 Bacteria 4409
801 Ga0495649_0001938 3300046694 Bacteria 15065
802 Ga0495649_0081534 3300046694 Bacteria 1729
803 Ga0495649_0232439 3300046694 Bacteria 951
804 Ga0495589_0010589 3300046794 Bacteria 4796
805 Ga0495589_0021089 3300046794 Bacteria 3330
806 Ga0495600_0002896 3300046809 Bacteria 9996
807 Ga0495600_0007763 3300046809 Bacteria 6569
808 Ga0495600_0087224 3300046809 Bacteria 2036
809 Ga0495600_0120164 3300046809 Bacteria 1709
810 Ga0495660_0044719 3300046810 Bacteria 2434
811 Ga0495660_0083315 3300046810 Bacteria 1673
812 Ga0495581_0002646 3300047315 Bacteria 10183
813 Ga0495581_0005299 3300047315 Bacteria 7460
814 Ga0495581_0117571 3300047315 Bacteria 1546
815 Ga0495604_0002922 3300047317 Bacteria 13682
816 Ga0495604_0009191 3300047317 Bacteria 7823
817 Ga0495604_0043051 3300047317 Bacteria 3536
818 Ga0495636_0050053 3300047318 Bacteria 1748
819 Ga0495674_0016282 3300047319 Bacteria 6936
820 Ga0495674_0029960 3300047319 Bacteria 4951
821 Ga0495674_0050664 3300047319 Bacteria 3663
822 Ga0495674_0171596 3300047319 Bacteria 1809
823 Ga0495674_0175754 3300047319 Bacteria 1784
824 Ga0495674_0425790 3300047319 Bacteria 1069
825 Ga0495672_0002790 3300047320 Bacteria 15596
826 Ga0495672_0074266 3300047320 Bacteria 1915
827 Ga0495672_0186410 3300047320 Bacteria 1047
828 Ga0495676_0152252 3300047321 Bacteria 1644
829 Ga0495676_0327926 3300047321 Bacteria 1027
830 Ga0495680_0018718 3300047322 Bacteria 5869
831 Ga0495680_0278453 3300047322 Bacteria 1179
832 Ga0495680_0291187 3300047322 Bacteria 1148
833 Ga0495683_0002161 3300047323 Bacteria 12068
834 Ga0495683_0003724 3300047323 Bacteria 8823
835 Ga0495683_0053342 3300047323 Bacteria 2017
836 Ga0495683_0249605 3300047323 Bacteria 779
837 Ga0495687_006656 3300047443 Bacteria 7022
838 Ga0495687_073084 3300047443 Bacteria 1368
839 Ga0495675_0004153 3300047444 Bacteria 8766
840 Ga0495675_0024861 3300047444 Bacteria 3820
841 Ga0495675_0086462 3300047444 Bacteria 1971
842 Ga0495675_0234792 3300047444 Bacteria 1106
843 Ga0495679_001418 3300047446 Bacteria 13635
844 Ga0495679_070370 3300047446 Bacteria 1009
845 Ga0495686_0000032 3300047472 Bacteria 345132
846 Ga0495686_0001669 3300047472 Bacteria 23075
847 Ga0495686_0004735 3300047472 Bacteria 11018
848 Ga0495686_0045477 3300047472 Bacteria 2777
849 Ga0495686_0110324 3300047472 Bacteria 1650
850 Ga0495686_0280146 3300047472 Bacteria 927
851 Ga0495593_0018207 3300047673 Bacteria 3950
852 Ga0495593_0041468 3300047673 Bacteria 2474
853 Ga0495593_0076431 3300047673 Bacteria 1735
854 Ga0495593_0096987 3300047673 Bacteria 1514
855 Ga0495602_0014072 3300048088 Bacteria 8137
856 Ga0495602_0029701 3300048088 Bacteria 5197
857 Ga0495602_0045355 3300048088 Bacteria 3978
858 Ga0495602_0097981 3300048088 Bacteria 2414
859 Ga0495602_0304329 3300048088 Bacteria 1165
860 Ga0496100_0024570 3300048903 Bacteria 3676
861 Ga0496100_0053319 3300048903 Bacteria 2633
862 Ga0496100_0142950 3300048903 Bacteria 1698
863 Ga0496101_0010604 3300048904 Bacteria 6086
864 Ga0496101_0171604 3300048904 Bacteria 1667
865 Ga0496101_0428097 3300048904 Bacteria 1043
866 Ga0496101_0471118 3300048904 Bacteria 991
867 Ga0496102_0001378 3300048905 Bacteria 21651
868 Ga0496102_0006765 3300048905 Bacteria 9786
869 Ga0496102_0047107 3300048905 Bacteria 3916
870 Ga0496102_0072128 3300048905 Bacteria 3172
871 Ga0496102_0129990 3300048905 Bacteria 2356
872 Ga0496102_0133589 3300048905 Bacteria 2324
873 Ga0496103_0003884 3300048906 Bacteria 9092
874 Ga0496103_0012238 3300048906 Bacteria 5093
875 Ga0496103_0085632 3300048906 Bacteria 1986
876 Ga0496103_0148233 3300048906 Bacteria 1502
877 Ga0496104_0097819 3300048907 Bacteria 2809
878 Ga0496105_0086571 3300048908 Bacteria 2589
879 Ga0496105_0285139 3300048908 Bacteria 1331
880 Ga0496105_0457244 3300048908 Bacteria 1007
881 Ga0496106_0000053 3300048909 Bacteria 93929
882 Ga0496106_0000290 3300048909 Bacteria 35498
883 Ga0496106_0041981 3300048909 Bacteria 3429
884 Ga0496106_0142362 3300048909 Bacteria 1887
885 Ga0496106_0461213 3300048909 Bacteria 1021
886 Ga0496107_0074890 3300048910 Bacteria 2463
887 Ga0496107_0251450 3300048910 Bacteria 1315
888 Ga0496107_0299235 3300048910 Bacteria 1197
889 Ga0496108_0212210 3300048911 Bacteria 1681
890 Ga0496110_0006578 3300048913 Bacteria 9230
891 Ga0496110_0082373 3300048913 Bacteria 2869
892 Ga0496111_0004953 3300048914 Bacteria 8463
893 Ga0496111_0173692 3300048914 Bacteria 1601
894 Ga0496112_0124154 3300048915 Bacteria 2552
895 Ga0496113_0004113 3300048916 Bacteria 8865
896 Ga0496113_0067500 3300048916 Bacteria 2712
897 Ga0496113_0240781 3300048916 Bacteria 1443
898 Ga0496114_0002052 3300048917 Bacteria 15343
899 Ga0496114_0009661 3300048917 Bacteria 7664
900 Ga0496116_0002110 3300048919 Bacteria 21206
901 Ga0496116_0006225 3300048919 Bacteria 10890
902 Ga0496116_0011824 3300048919 Bacteria 7185
903 Ga0496116_0015688 3300048919 Bacteria 5975
904 Ga0496116_0025729 3300048919 Bacteria 4320
905 Ga0496117_0000090 3300048920 Bacteria 206388
906 Ga0496117_0000537 3300048920 Bacteria 62312
907 Ga0496117_0001435 3300048920 Bacteria 34375
908 Ga0496117_0004435 3300048920 Bacteria 15487
909 Ga0496117_0011926 3300048920 Bacteria 7725
910 Ga0496117_0013560 3300048920 Bacteria 7102
911 Ga0496117_0021217 3300048920 Bacteria 5264
912 Ga0496117_0068914 3300048920 Bacteria 2385
913 Ga0496118_0000032 3300048921 Bacteria 330072
914 Ga0496118_0003531 3300048921 Bacteria 19584
915 Ga0496118_0004184 3300048921 Bacteria 17363
916 Ga0496118_0021868 3300048921 Bacteria 5611
917 Ga0496118_0048497 3300048921 Bacteria 3280
918 Ga0496118_0122525 3300048921 Bacteria 1691
919 Ga0496119_0043730 3300048922 Bacteria 2827
920 Ga0496119_0155536 3300048922 Bacteria 1221
921 Ga0496120_0005377 3300048923 Bacteria 10235
922 Ga0496121_0001496 3300048924 Bacteria 39339
923 Ga0496121_0001984 3300048924 Bacteria 32516
924 Ga0496121_0002741 3300048924 Bacteria 26192
925 Ga0496121_0009025 3300048924 Bacteria 11553
926 Ga0496121_0018227 3300048924 Bacteria 7097
927 Ga0496121_0021093 3300048924 Bacteria 6401
928 Ga0496121_0023889 3300048924 Bacteria 5865
929 Ga0496121_0054942 3300048924 Bacteria 3322
930 Ga0496121_0057992 3300048924 Bacteria 3205
931 Ga0496121_0084193 3300048924 Bacteria 2508
932 Ga0496121_0113677 3300048924 Bacteria 2059
933 Ga0496121_0216832 3300048924 Bacteria 1351
934 Ga0496121_0333886 3300048924 Bacteria 1016
935 Ga0496122_0000205 3300048925 Bacteria 131755
936 Ga0496122_0007852 3300048925 Bacteria 11721
937 Ga0496122_0008322 3300048925 Bacteria 11229
938 Ga0496122_0022648 3300048925 Bacteria 5576
939 Ga0496122_0028681 3300048925 Bacteria 4714
940 Ga0496122_0080317 3300048925 Bacteria 2275
941 Ga0496122_0099422 3300048925 Bacteria 1950
942 Ga0496123_0000103 3300048926 Bacteria 168232
943 Ga0496123_0004660 3300048926 Bacteria 14232
944 Ga0496123_0025121 3300048926 Bacteria 4501
945 Ga0496123_0026340 3300048926 Bacteria 4357
946 Ga0496123_0029459 3300048926 Bacteria 4041
947 Ga0496123_0050517 3300048926 Bacteria 2777
948 Ga0496123_0065239 3300048926 Bacteria 2316
949 Ga0496123_0091738 3300048926 Bacteria 1800
950 Ga0496124_0001267 3300048927 Bacteria 38458
951 Ga0496124_0008624 3300048927 Bacteria 10628
952 Ga0496124_0010914 3300048927 Bacteria 9139
953 Ga0496124_0011588 3300048927 Bacteria 8800
954 Ga0496124_0022738 3300048927 Bacteria 5741
955 Ga0496124_0033325 3300048927 Bacteria 4531
956 Ga0496124_0036438 3300048927 Bacteria 4290
957 Ga0496124_0067522 3300048927 Bacteria 2975
958 Ga0496124_0158505 3300048927 Bacteria 1767
959 Ga0496124_0189741 3300048927 Bacteria 1574
960 Ga0496124_0369134 3300048927 Bacteria 1008
961 Ga0496125_0000276 3300048928 Bacteria 103024
962 Ga0496125_0000385 3300048928 Bacteria 82113
963 Ga0496125_0002618 3300048928 Bacteria 23079
964 Ga0496125_0007498 3300048928 Bacteria 11600
965 Ga0496125_0011149 3300048928 Bacteria 9014
966 Ga0496125_0018320 3300048928 Bacteria 6653
967 Ga0496125_0284806 3300048928 Bacteria 1021
968 Ga0496126_0000034 3300048929 Bacteria 362440
969 Ga0496126_0000606 3300048929 Bacteria 67915
970 Ga0496126_0007343 3300048929 Bacteria 12104
971 Ga0496126_0042028 3300048929 Bacteria 4225
972 Ga0496126_0067656 3300048929 Bacteria 3191
973 Ga0496126_0117887 3300048929 Bacteria 2305
974 Ga0496126_0375367 3300048929 Bacteria 1159
975 Ga0496126_0606897 3300048929 Bacteria 861
976 Ga0495678_059160 3300049459 Bacteria 1445
977 Ga0501031_0098092 3300049568 Bacteria 1912
978 Ga0501031_0117085 3300049568 Bacteria 1741
979 Ga0501031_0191047 3300049568 Bacteria 1337
980 Ga0501032_0000774 3300049569 Bacteria 25923
981 Ga0501032_0047584 3300049569 Bacteria 2896
982 Ga0501032_0050805 3300049569 Bacteria 2796
983 Ga0501032_0057846 3300049569 Bacteria 2604
984 Ga0501032_0071161 3300049569 Bacteria 2318
985 Ga0501033_0001601 3300049570 Bacteria 19901
986 Ga0501033_0003501 3300049570 Bacteria 12871
987 Ga0501033_0006388 3300049570 Bacteria 9231
988 Ga0501033_0073616 3300049570 Bacteria 2508
989 Ga0501033_0093116 3300049570 Bacteria 2203
990 Ga0501033_0103083 3300049570 Bacteria 2081
991 Ga0501033_0166535 3300049570 Bacteria 1584
992 Ga0501033_0391143 3300049570 Bacteria 971
993 Ga0501034_0012190 3300049571 Bacteria 8890
994 Ga0501034_0014475 3300049571 Bacteria 8123
995 Ga0501034_0020135 3300049571 Bacteria 6811
996 Ga0501034_0031563 3300049571 Bacteria 5381
997 Ga0501034_0051951 3300049571 Bacteria 4132
998 Ga0501034_0063118 3300049571 Bacteria 3718
999 Ga0501034_0152315 3300049571 Bacteria 2288
1000 Ga0501034_0281137 3300049571 Bacteria 1603
1001 Ga0501034_0297671 3300049571 Bacteria 1551
1002 Ga0501034_0414610 3300049571 Bacteria 1268
1003 Ga0501034_0419508 3300049571 Bacteria 1259
1004 Ga0501034_0476612 3300049571 Bacteria 1163
1005 Ga0501034_0517134 3300049571 Bacteria 1106
1006 Ga0501034_0524320 3300049571 Bacteria 1096
1007 Ga0501034_0618248 3300049571 Bacteria 987
1008 Ga0501036_0122241 3300049572 Bacteria 2199
1009 Ga0501036_0145038 3300049572 Bacteria 2003
1010 Ga0501036_0161451 3300049572 Bacteria 1889
1011 Ga0501036_0174646 3300049572 Bacteria 1809
1012 Ga0501037_0000227 3300049573 Bacteria 49134
1013 Ga0501037_0016106 3300049573 Bacteria 5502
1014 Ga0501037_0048724 3300049573 Bacteria 3103
1015 Ga0501037_0064803 3300049573 Bacteria 2662
1016 Ga0501037_0071633 3300049573 Bacteria 2521
1017 Ga0501037_0073188 3300049573 Bacteria 2491
1018 Ga0501037_0204633 3300049573 Bacteria 1394
1019 Ga0501037_0362928 3300049573 Bacteria 998
1020 Ga0501038_0065759 3300049574 Bacteria 3089
1021 Ga0501038_0105670 3300049574 Bacteria 2338
1022 Ga0501038_0182160 3300049574 Bacteria 1694
1023 Ga0501039_0055607 3300049575 Bacteria 3066
1024 Ga0501039_0068139 3300049575 Bacteria 2763
1025 Ga0501040_0000012 3300049576 Bacteria 77936
1026 Ga0501040_0009689 3300049576 Bacteria 6290
1027 Ga0501041_0051454 3300049577 Bacteria 2511
1028 Ga0501041_0197943 3300049577 Bacteria 1259
1029 Ga0501042_0000134 3300049578 Bacteria 31992
1030 Ga0501042_0047679 3300049578 Bacteria 3055
1031 Ga0501042_0072604 3300049578 Bacteria 2462
1032 Ga0501042_0239977 3300049578 Bacteria 1308
1033 Ga0501043_0000396 3300049579 Bacteria 39180
1034 Ga0501043_0036737 3300049579 Bacteria 3854
1035 Ga0501043_0052747 3300049579 Bacteria 3194
1036 Ga0501043_0054136 3300049579 Bacteria 3151
1037 Ga0501043_0087647 3300049579 Bacteria 2446
1038 Ga0501043_0233637 3300049579 Bacteria 1419
1039 Ga0501043_0251112 3300049579 Bacteria 1362
1040 Ga0501043_0251426 3300049579 Bacteria 1361
1041 Ga0501046_0074485 3300049580 Bacteria 2634
1042 Ga0501046_0367274 3300049580 Bacteria 1043
1043 Ga0501047_0021369 3300049581 Bacteria 6212
1044 Ga0501047_0031284 3300049581 Bacteria 5132
1045 Ga0501047_0060566 3300049581 Bacteria 3653
1046 Ga0501047_0160155 3300049581 Bacteria 2122
1047 Ga0501047_0189708 3300049581 Bacteria 1919
1048 Ga0501047_0203411 3300049581 Bacteria 1840
1049 Ga0501048_0171267 3300049582 Bacteria 1538
1050 Ga0501048_0203490 3300049582 Bacteria 1404
1051 Ga0501067_0002803 3300049583 Bacteria 9591
1052 Ga0501067_0234549 3300049583 Bacteria 1021
1053 Ga0501067_0300599 3300049583 Bacteria 893
1054 Ga0501069_0000068 3300049585 Bacteria 54324
1055 Ga0501069_0040540 3300049585 Bacteria 2574
1056 Ga0501070_0000313 3300049586 Bacteria 44225
1057 Ga0501070_0001095 3300049586 Bacteria 24325
1058 Ga0501070_0005970 3300049586 Bacteria 10378
1059 Ga0501070_0011952 3300049586 Bacteria 7331
1060 Ga0501070_0127226 3300049586 Bacteria 2105
1061 Ga0501070_0160291 3300049586 Bacteria 1855
1062 Ga0501070_0166840 3300049586 Bacteria 1814
1063 Ga0501070_0201959 3300049586 Bacteria 1632
1064 Ga0501070_0386987 3300049586 Bacteria 1132
1065 Ga0501071_0571348 3300049587 Bacteria 869
1066 Ga0501073_0004250 3300049589 Bacteria 10740
1067 Ga0501073_0031768 3300049589 Bacteria 3767
1068 Ga0501073_0055592 3300049589 Bacteria 2769
1069 Ga0501073_0073155 3300049589 Bacteria 2387
1070 Ga0501073_0075503 3300049589 Bacteria 2346
1071 Ga0501073_0209024 3300049589 Bacteria 1349
1072 Ga0501074_0000239 3300049590 Bacteria 30690
1073 Ga0501074_0040882 3300049590 Bacteria 3357
1074 Ga0501074_0068869 3300049590 Bacteria 2544
1075 Ga0501079_0294782 3300049741 Bacteria 1269
1076 Ga0501080_0000128 3300049742 Bacteria 53662
1077 Ga0501080_0010598 3300049742 Bacteria 8437
1078 Ga0501080_0058923 3300049742 Bacteria 3574
1079 Ga0501080_0117747 3300049742 Bacteria 2462
1080 Ga0501080_0148783 3300049742 Bacteria 2165
1081 Ga0501080_0277460 3300049742 Bacteria 1524
1082 Ga0501083_0000065 3300049744 Bacteria 73075
1083 Ga0501083_0000105 3300049744 Bacteria 56997
1084 Ga0501083_0002746 3300049744 Bacteria 12167
1085 Ga0501083_0017184 3300049744 Bacteria 5045
1086 Ga0501035_0000185 3300049822 Bacteria 76291
1087 Ga0501035_0002315 3300049822 Bacteria 18781
1088 Ga0501035_0002609 3300049822 Bacteria 17588
1089 Ga0501035_0004471 3300049822 Bacteria 13271
1090 Ga0501035_0004845 3300049822 Bacteria 12760
1091 Ga0501035_0055678 3300049822 Bacteria 3530
1092 Ga0501035_0076538 3300049822 Bacteria 2959
1093 Ga0501044_0000003 3300049823 Bacteria 345647
1094 Ga0501044_0026482 3300049823 Bacteria 6136
1095 Ga0501044_0027102 3300049823 Bacteria 6061
1096 Ga0501044_0039557 3300049823 Bacteria 4919
1097 Ga0501044_0042927 3300049823 Bacteria 4700
1098 Ga0501044_0071681 3300049823 Bacteria 3523
1099 Ga0501044_0071965 3300049823 Bacteria 3515
1100 Ga0501044_0096345 3300049823 Bacteria 2980
1101 Ga0501044_0143485 3300049823 Bacteria 2375
1102 Ga0501044_0162000 3300049823 Bacteria 2213
1103 Ga0501044_0428967 3300049823 Bacteria 1231
1104 Ga0501044_0542254 3300049823 Bacteria 1061
1105 Ga0501044_0561123 3300049823 Bacteria 1038
1106 nmdc:mga00v17_162864_c1 3300050491 Bacteria 1436
1107 nmdc:mga0yw44_181558_c1 3300050492 Bacteria 1062
1108 nmdc:mga0yw44_203529_c1 3300050492 Bacteria 1308
1109 nmdc:mga0yw44_213182_c1 3300050492 Bacteria 1278
1110 nmdc:mga0yw44_251698_c1 3300050492 Bacteria 1176
1111 nmdc:mga06z11_104363_c1 3300050494 Bacteria 1560
1112 nmdc:mga06z11_52985_c1 3300050494 Bacteria 2085
1113 nmdc:mga07m45_12517_c1 3300050496 Bacteria 1420
1114 nmdc:mga0qj67_42480_c1 3300050509 Bacteria 3579
1115 nmdc:mga06r32_229207_c1 3300050510 Bacteria 1846
1116 nmdc:mga08y16_60200_c1 3300050511 Bacteria 3967
1117 nmdc:mga0rr50_65155_c1 3300050513 Bacteria 2759
1118 nmdc:mga0sz30_116998_c1 3300050516 Bacteria 1170
1119 nmdc:mga0sz30_21000_c1 3300050516 Bacteria 2638
1120 nmdc:mga0sz30_47514_c1 3300050516 Bacteria 1814
1121 nmdc:mga0sz30_91481_c1 3300050516 Bacteria 1324
1122 Ga0495601_0015586 3300053077 Bacteria 4594
1123 Ga0500578_0038076 3300053086 Bacteria 3089
1124 Ga0500651_0091527 3300053093 Bacteria 1872
1125 Ga0500555_016706 3300053103 Bacteria 2115
1126 Ga0500557_009472 3300053105 Bacteria 2388
1127 Ga0500594_0010885 3300053118 Bacteria 2117
1128 Ga0500595_010497 3300053119 Bacteria 3679
1129 Ga0500568_0000048 3300053139 Bacteria 119025
1130 Ga0500568_0000998 3300053139 Bacteria 19367
1131 Ga0500568_0002382 3300053139 Bacteria 11118
1132 Ga0500568_0131522 3300053139 Bacteria 930
1133 Ga0500573_0206447 3300053140 Bacteria 1039
1134 Ga0500574_000440 3300053141 Bacteria 5262
1135 Ga0500590_002471 3300053148 Bacteria 8219
1136 Ga0500604_0038263 3300053151 Bacteria 1438
1137 Ga0500616_0001692 3300053153 Bacteria 20304
1138 Ga0500616_0008346 3300053153 Bacteria 6445
1139 Ga0500616_0077829 3300053153 Bacteria 1674
1140 Ga0500619_000066 3300053154 Bacteria 31862
1141 Ga0500622_0002387 3300053156 Bacteria 13602
1142 Ga0500624_029146 3300053157 Bacteria 939
1143 Ga0500627_0000054 3300053158 Bacteria 55229
1144 Ga0500627_0059356 3300053158 Bacteria 1680
1145 Ga0500634_0000019 3300053161 Bacteria 109764
1146 Ga0500634_0024557 3300053161 Bacteria 3277
1147 Ga0501084_0001717 3300054114 Bacteria 17403
1148 Ga0501084_0251833 3300054114 Bacteria 1491
1149 Ga0501082_0001282 3300060353 Bacteria 22071
1150 Ga0466962_0002343 3300061719 Bacteria 8983
1151 2585847286 2585427594 Bacteria 6180594
1152 2509108916 2508501122 Bacteria 6292184
1153 2509375362 2509276019 Bacteria 6802256
1154 2509387786 2509276021 Bacteria 7634384
1155 2509443386 2509276033 Bacteria 7180565
1156 2510132233 2510065019 Bacteria 6903379
1157 2510251687 2510065045 Bacteria 7761063
1158 2510307297 2510065057 Bacteria 6649661
1159 2510898571 2510461076 Bacteria 8618824
1160 2511133567 2510917022 Bacteria 6504556
1161 2511187365 2510917028 Bacteria 6185411
1162 2511197915 2510917030 Bacteria 7460662
1163 2511390258 2511231027 Bacteria 5013807
1164 2512973085 2512875026 Bacteria 6861065
1165 2513569070 2513237084 Bacteria 7231967
1166 2513580787 2513237085 Bacteria 7695351
1167 2513596179 2513237088 Bacteria 6927906
1168 2513604333 2513237089 Bacteria 6553624
1169 2513616181 2513237091 Bacteria 6900273
1170 2513630862 2513237093 Bacteria 7545552
1171 2513709273 2513237103 Bacteria 7647401
1172 2513865694 2513237138 Bacteria 7368160
1173 2513882666 2513237140 Bacteria 7076289
1174 2513906466 2513237143 Bacteria 6664116
1175 2513907595 2513237144 Bacteria 7530820
1176 2513925641 2513237146 Bacteria 7166346
1177 2513983147 2513237156 Bacteria 6402557
1178 2513996311 2513237159 Bacteria 6810126
1179 2514008152 2513237160 Bacteria 6650282
1180 2514024462 2513237162 Bacteria 7468464
1181 2514054242 2513237166 Bacteria 10373764
1182 2514586359 2513237351 Bacteria 6968952
1183 2515111216 2515075009 Bacteria 7288508
1184 2515607382 2515154107 Bacteria 6795637
1185 2515635996 2515154113 Bacteria 7807172
1186 2515642648 2515154114 Bacteria 7848616
1187 2515658835 2515154116 Bacteria 7552979
1188 2515680590 2515154122 Bacteria 8609520
1189 2515740395 2515154134 Bacteria 7220242
1190 2517039859 2516653077 Bacteria 7555578
1191 2517075400 2516653085 Bacteria 7346596
1192 2517093989 2517093000 Bacteria 7412387
1193 2517405803 2517287029 Bacteria 6905599
1194 2517571914 2517487022 Bacteria 7227575
1195 2520375315 2519899620 Bacteria 6499161
1196 2523466451 2523231067 Bacteria 5230452
1197 2524450879 2524023207 Bacteria 6813453
1198 2524460722 2524023209 Bacteria 6679728
1199 2527075719 2526164713 Bacteria 6780608
1200 2530643960 2529292951 Bacteria 6916614
1201 2558866452 2558860100 Bacteria 8458965
1202 2585164480 2582581283 Bacteria 6030556
1203 2585203009 2582581294 Bacteria 6626667
1204 2585220922 2582581298 Bacteria 7315509
1205 2585230486 2582581299 Bacteria 6518058
1206 2585256682 2582581304 Bacteria 5831370
1207 2585264785 2582581306 Bacteria 6450535
1208 2585273336 2582581307 Bacteria 6597605
1209 2585278833 2582581308 Bacteria 7413247
1210 2585325552 2582581315 Bacteria 7318924
1211 2585329706 2582581316 Bacteria 7774528
1212 2585386146 2582581865 Bacteria 6644329
1213 2585394762 2582581866 Bacteria 6859583
1214 2585400216 2582581867 Bacteria 7184437
1215 2585527897 2585427526 Bacteria 7258840
1216 2585537300 2585427527 Bacteria 7273426
1217 2585541499 2585427528 Bacteria 6842387
1218 2585549979 2585427529 Bacteria 7395659
1219 2585556356 2585427530 Bacteria 7383882
1220 2585559363 2585427531 Bacteria 6992870
1221 2585822757 2585427590 Bacteria 6824633
1222 2585839368 2585427593 Bacteria 7141551
1223 2585902035 2585427608 Bacteria 6544331
1224 2585905260 2585427609 Bacteria 6667127
1225 2587979625 2585428125 Bacteria 6662905
1226 2599332462 2599185156 Bacteria 5403036
1227 2599418660 2599185170 Bacteria 7295545
1228 2600194956 2599185352 Bacteria 7228948
1229 2616296705 2615840624 Bacteria 6557588
1230 2616305893 2615840626 Bacteria 7921970
1231 2616553865 2615840698 Bacteria 7319877
1232 2617383790 2617270742 Bacteria 6808054
1233 2643770639 2643221550 Bacteria 4619371
1234 2643805929 2643221557 Bacteria 7184309
1235 2643838229 2643221564 Bacteria 4193379
1236 2643910223 2643221580 Bacteria 3816678
1237 2643963928 2643221591 Bacteria 4397626
1238 2644007854 2643221599 Bacteria 6292121
1239 2644051560 2643221607 Bacteria 6314006
1240 2644066105 2643221610 Bacteria 7480339
1241 2644144531 2643221626 Bacteria 8069654
1242 2644165064 2643221629 Bacteria 5850260
1243 2644196445 2643221634 Bacteria 6705461
1244 2644200058 2643221636 Bacteria 6583769
1245 2644207213 2643221637 Bacteria 5345260
1246 2644242817 2643221643 Bacteria 5749658
1247 2644306582 2643221655 Bacteria 7722067
1248 2644330772 2643221659 Bacteria 7890716
1249 2644345667 2643221662 Bacteria 5851492
1250 2644377189 2643221668 Bacteria 7306521
1251 2644417436 2643221675 Bacteria 7473456
1252 2644450832 2643221680 Bacteria 7473610
1253 2644480429 2643221686 Bacteria 6310811
1254 2644498841 2643221689 Bacteria 6042950
1255 2644542422 2643221698 Bacteria 7756764
1256 2644612193 2643221712 Bacteria 7729434
1257 2644650861 2643221718 Bacteria 5345506
1258 2644671614 2643221723 Bacteria 7095460
1259 2644692745 2643221726 Bacteria 7455827
1260 2644728586 2643221733 Bacteria 5690728
1261 2644736975 2643221734 Bacteria 5365412
1262 2657682893 2657244999 Bacteria 5946535
1263 2671112791 2667528174 Bacteria 6435400
1264 2673822106 2671180694 Bacteria 7506943
1265 2719180188 2718217882 Bacteria 6556348
1266 2719384785 2718217927 Bacteria 6972593
1267 2719664546 2718217997 Bacteria 6740740
1268 2719730937 2718218009 Bacteria 6478651
1269 2720490966 2718218199 Bacteria 6740745
1270 2720612328 2718218232 Bacteria 6720332
1271 2720619166 2718218233 Bacteria 6662049
1272 2720630568 2718218235 Bacteria 6630699
1273 2720774261 2718218269 Bacteria 6906114
1274 2721146282 2718218363 Bacteria 6524337
1275 2721157802 2718218365 Bacteria 6274507
1276 2721163161 2718218366 Bacteria 6425255
1277 2721398496 2718218423 Bacteria 6438183
1278 2722839331 2721755514 Bacteria 6424414
1279 2723025988 2721755556 Bacteria 6745503
1280 2723559532 2721755684 Bacteria 6859907
1281 2723566149 2721755685 Bacteria 6704835
1282 2724037309 2721755809 Bacteria 6438790
1283 2724043693 2721755810 Bacteria 6479005
1284 2724088868 2721755819 Bacteria 6906405
1285 2724103414 2721755822 Bacteria 6726041
1286 2724109258 2721755823 Bacteria 6752556
1287 2725948417 2724679232 Bacteria 7646494
1288 2730106924 2728369352 Bacteria 6745171
1289 2730163425 2728369365 Bacteria 6555560
1290 2730297434 2728369397 Bacteria 6274511
1291 2738803665 2738541293 Bacteria 7065685
1292 2739035829 2738541333 Bacteria 7106503
1293 2739350580 2738543031 Bacteria 5769731
1294 2753569754 2751185846 Bacteria 7242164
1295 2765466438 2765235802 Bacteria 5618596
1296 2766067670 2765235942 Bacteria 7445910
1297 2770197039 2767802442 Bacteria 5747986
1298 2776270340 2775506902 Bacteria 6208009
1299 2776282312 2775506904 Bacteria 5954060
1300 2778177392 2775507266 Bacteria 7392367
1301 2792583229 2791355082 Bacteria 5973319
1302 2792621089 2791355091 Bacteria 6135441
1303 2792625303 2791355092 Bacteria 6248105
1304 2792637733 2791355094 Bacteria 7011481
1305 2793283548 2791355253 Bacteria 5171699
1306 2793296135 2791355256 Bacteria 6798008
1307 2793316859 2791355259 Bacteria 7254731
1308 2793322686 2791355260 Bacteria 6598818
1309 2793330964 2791355261 Bacteria 6661293
1310 2793333541 2791355262 Bacteria 6774204
1311 2793339871 2791355263 Bacteria 6872478
1312 2793350121 2791355264 Bacteria 6429314
1313 2793353501 2791355265 Bacteria 6539969
1314 2793358845 2791355266 Bacteria 7116587
1315 2793370537 2791355267 Bacteria 7222458
1316 2802718652 2802428858 Bacteria 6636079
1317 2802724333 2802428859 Bacteria 6667919
1318 2802730005 2802428860 Bacteria 6525526
1319 2802737348 2802428861 Bacteria 6534206
1320 2802742264 2802428862 Bacteria 6633353
1321 2802748947 2802428863 Bacteria 6410669
1322 2804754112 2802429268 Bacteria 6094027
1323 2805926644 2802429605 Bacteria 6875453
1324 2805937498 2802429606 Bacteria 6346811
1325 2806046992 2802429633 Bacteria 7341974
1326 2806052575 2802429634 Bacteria 7083200
1327 2806058654 2802429635 Bacteria 7650140
1328 2806067578 2802429636 Bacteria 7597525
1329 2806073894 2802429637 Bacteria 7067217
1330 2819544994 2818991436 Bacteria 5376622
1331 2819612282 2818991448 Bacteria 6772224
1332 2819639322 2818991453 Bacteria 7181617
1333 2819719862 2818991467 Bacteria 5893227
1334 2838017217 2838016132 Bacteria 6577831
1335 2838023262 2838022645 Bacteria 6494267
1336 2838031344 2838029111 Bacteria 6603031
1337 2838037650 2838035591 Bacteria 7166484
1338 2838047005 2838042994 Bacteria 6046894
1339 2838049302 2838048938 Bacteria 6044578
1340 2838063253 2838061910 Bacteria 6794874
1341 2838074631 2838068647 Bacteria 6208656
1342 2838075001 2838074704 Bacteria 6785777
1343 2838662657 2838661181 Bacteria 7385261
1344 2838670779 2838668709 Bacteria 6671819
1345 2838681271 2838680041 Bacteria 6545511
1346 2838688684 2838686498 Bacteria 7807632
1347 2838694695 2838694306 Bacteria 6853137
1348 2838703150 2838701080 Bacteria 6669771
1349 2838708072 2838707686 Bacteria 6619912
1350 2838730979 2838729681 Bacteria 7400765
1351 2838744127 2838742623 Bacteria 7396178
1352 2839998205 2839993093 Bacteria 5512535
1353 2840769043 2840764183 Bacteria 6358399
1354 2841856808 2841851746 Bacteria 7532261
1355 2841865549 2841864319 Bacteria 6742987
1356 2842080696 2842077413 Bacteria 6508645
1357 2842117636 2842110456 Bacteria 7656360
1358 2842121315 2842118031 Bacteria 7033875
1359 2842147626 2842146304 Bacteria 5957337
1360 2842159978 2842156927 Bacteria 6894975
1361 2842168220 2842163707 Bacteria 6916235
1362 2842183405 2842180545 Bacteria 6888678
1363 2842197882 2842192696 Bacteria 6147454
1364 2842199690 2842198810 Bacteria 6608673
1365 2842207768 2842205361 Bacteria 6340321
1366 2842221135 2842217011 Bacteria 7497767
1367 2842234994 2842229732 Bacteria 7475766
1368 2842237484 2842237096 Bacteria 6620661
1369 2842245591 2842243621 Bacteria 7421798
1370 2842252692 2842250916 Bacteria 6579627
1371 2842259759 2842257432 Bacteria 7401195
1372 2842270161 2842264693 Bacteria 6472963
1373 2842274598 2842271015 Bacteria 7807131
1374 2842281437 2842278818 Bacteria 6340002
1375 2842287184 2842285085 Bacteria 6011953
1376 2842294353 2842291075 Bacteria 7076806
1377 2842302526 2842298080 Bacteria 6123127
1378 2842306842 2842304105 Bacteria 7023636
1379 2842314522 2842311132 Bacteria 6616990
1380 2842318720 2842317721 Bacteria 6793725
1381 2842343670 2842341865 Bacteria 7003929
1382 2842360741 2842357229 Bacteria 6485165
1383 2842365102 2842363717 Bacteria 6844742
1384 2842371734 2842370503 Bacteria 7038661
1385 2842380750 2842377471 Bacteria 7140707
1386 2842387821 2842384541 Bacteria 7057858
1387 2842398340 2842395702 Bacteria 6780583
1388 2842404452 2842402390 Bacteria 6681310
1389 2842410863 2842409023 Bacteria 6687331
1390 2842417681 2842415677 Bacteria 6596907
1391 2842427285 2842422224 Bacteria 6239196
1392 2842433983 2842428310 Bacteria 6767288
1393 2842440359 2842434925 Bacteria 6502746
1394 2842446908 2842441272 Bacteria 6769273
1395 2842453441 2842447887 Bacteria 6754142
1396 2842468402 2842462802 Bacteria 6588055
1397 2842474920 2842469257 Bacteria 6752936
1398 2842478061 2842475841 Bacteria 6603183
1399 2842482781 2842482326 Bacteria 7212537
1400 2842493690 2842489311 Bacteria 6620893
1401 2842497355 2842495871 Bacteria 6820686
1402 2842504870 2842502639 Bacteria 6604161
1403 2842509653 2842509118 Bacteria 6850950
1404 2842521269 2842521101 Bacteria 6569494
1405 2842872225 2842871566 Bacteria 4827117
1406 2842922731 2842922631 Bacteria 5824079
1407 2844170072 2844163670 Bacteria 7266046
1408 2844455209 2844454524 Bacteria 7952546
1409 2850079572 2850079185 Bacteria 6848280
1410 2852388997 2852387548 Bacteria 8025568
1411 2855827875 2855825444 Bacteria 6785811
1412 2857520359 2857516855 Bacteria 7787325
1413 2858802971 2858800743 Bacteria 6603254
1414 2891376610 2891373044 Bacteria 5202277
1415 2894655664 2894652903 Bacteria 4587256
1416 2896384713 2896384573 Bacteria 7700774
1417 2904439117 2904434214 Bacteria 6230908
1418 2904487293 2904483920 Bacteria 7545285
1419 2904582178 2904578770 Bacteria 5302906
1420 2913298296 2913295892 Bacteria 6333755
1421 2915986577 2915980308 Bacteria 6624279
1422 2915989408 2915986958 Bacteria 6739310
1423 2916032806 2916028427 Bacteria 6748433
1424 2916044567 2916041962 Bacteria 6820487
1425 2916054754 2916048683 Bacteria 6543552
1426 2916057144 2916055098 Bacteria 6758838
1427 2916065907 2916061851 Bacteria 6737736
1428 2916079643 2916076590 Bacteria 6596108
1429 2917558625 2917554339 Bacteria 4987857
1430 2917704234 2917699015 Bacteria 7043791
1431 2919103759 2919100787 Bacteria 7710546
1432 2919123042 2919119836 Bacteria 5208557
1433 2919409230 2919408235 Bacteria 6149349
1434 2920763745 2920760137 Bacteria 7427611
1435 2920822967 2920822456 Bacteria 6897201
1436 2921254892 2921250672 Bacteria 6677771
1437 2921267341 2921263974 Bacteria 6864552
1438 2921653940 2921643360 Bacteria 11448031
1439 2923557644 2923556063 Bacteria 6793593
1440 2924179568 2924172951 Bacteria 6749356
1441 2928131604 2928130867 Bacteria 5467269
1442 2928524154 2928521798 Bacteria 4960112
1443 2933021059 2933016740 Bacteria 6355406
1444 2933573044 2933570622 Bacteria 7023390
1445 2933593694 2933586486 Bacteria 7667493
1446 2933605061 2933599457 Bacteria 5858799
1447 2935895217 2935894831 Bacteria 6620579
1448 2935904206 2935901341 Bacteria 7341747
1449 2936368194 2936367885 Bacteria 7324495
1450 2936381413 2936375103 Bacteria 6652732
1451 2936388062 2936381700 Bacteria 7006523
1452 2936998631 2936996657 Bacteria 6298727
1453 2937033594 2937029754 Bacteria 6424026
1454 2937040371 2937036028 Bacteria 6846469
1455 2937047676 2937042894 Bacteria 6741576
1456 2937069938 2937063883 Bacteria 7199456
1457 2937082683 2937078374 Bacteria 6610289
1458 2937089489 2937084907 Bacteria 6618516
1459 2937843594 2937843397 Bacteria 5256375
1460 2939671722 2939669807 Bacteria 5028511
1461 2941501076 2941499720 Bacteria 7599444
1462 2945984872 2945984333 Bacteria 7358892
1463 2954013101 2954011201 Bacteria 4762601
1464 2957377883 2957375807 Bacteria 6425588
1465 2957443822 2957437181 Bacteria 6568994
1466 2957446849 2957443900 Bacteria 6869977
1467 2957481249 2957478035 Bacteria 6756658
1468 2960593284 2960591022 Bacteria 6622873
1469 2960613724 2960610863 Bacteria 6691244
1470 2960620375 2960617483 Bacteria 6727748
1471 2960626227 2960624210 Bacteria 6875384
1472 2960637070 2960631154 Bacteria 6732508
1473 2960660756 2960660292 Bacteria 7041660
1474 2960685228 2960680706 Bacteria 6624464
1475 2960688476 2960687367 Bacteria 6535474
1476 2960697395 2960693952 Bacteria 6749742
1477 2967689936 2967686174 Bacteria 6678622
1478 2967732807 2967728569 Bacteria 6641507
1479 2967777970 2967775926 Bacteria 6738189
1480 2970031074 2970026789 Bacteria 6785236
1481 2970040170 2970033650 Bacteria 7118744
1482 2970075214 2970068827 Bacteria 7123112
1483 2970088010 2970082768 Bacteria 6183754
1484 2970127957 2970122695 Bacteria 6625855
1485 2970148886 2970143518 Bacteria 6446480
1486 2970179031 2970177841 Bacteria 6768001
1487 2970194870 2970191845 Bacteria 7032787
1488 2977521904 2977516862 Bacteria 6940108
1489 2977531015 2977530762 Bacteria 6951399
1490 2977548664 2977544691 Bacteria 6875412
1491 2989354256 2989349275 Bacteria 6349068
1492 2989771973 2989771324 Bacteria 5605128
1493 2996313978 2996310559 Bacteria 6357320
1494 2996890894 2996887358 Bacteria 5795980
1495 2996896588 2996893221 Bacteria 5823108
1496 3002145040 3002141150 Bacteria 5254435
1497 3005412332 3005409236 Bacteria 7188837
1498 3005417070 3005416602 Bacteria 7064308
1499 3005446691 3005445848 Bacteria 6906074
1500 3005453373 3005452660 Bacteria 5889319
1501 639647368 639633055 Bacteria 7751309
1502 8003995825 8003992118 Bacteria 7266902
1503 8004003585 8003999396 Bacteria 7063185
1504 8005262148 8005258706 Bacteria 6184835
1505 8005279503 8005275841 Bacteria 6929066
1506 8005286465 8005282627 Bacteria 6675747
1507 8005292725 8005289223 Bacteria 6634003
1508 8005304497 8005301065 Bacteria 6614431
1509 8005309098 8005307578 Bacteria 7395396
1510 8005315131 8005314921 Bacteria 7072929
1511 8005325421 8005321885 Bacteria 5795980
1512 8005376681 8005376324 Bacteria 6590079
1513 8005386072 8005382845 Bacteria 6732062
1514 8005397534 8005395548 Bacteria 6806915
1515 8005432195 8005430974 Bacteria 6689030
1516 8005461857 8005460587 Bacteria 7157962
1517 8005485699 8005484373 Bacteria 6297373
1518 8005499261 8005497431 Bacteria 6477605
1519 8005544280 8005542996 Bacteria 7077758
1520 8005558993 8005556819 Bacteria 6908598
1521 8005570369 8005563573 Bacteria 7153261
1522 8005572614 8005570704 Bacteria 6957481
1523 8005620456 8005619151 Bacteria 7030230
1524 8005628822 8005626139 Bacteria 6534237
1525 8005648281 8005645114 Bacteria 6950293
1526 8005670677 8005668836 Bacteria 6953162
1527 8005684669 8005682033 Bacteria 6726518
1528 8005690918 8005688590 Bacteria 6610080
1529 8005698865 8005695170 Bacteria 6912330
1530 8018131235 8018127388 Bacteria 7351159
1531 8018169090 8018163183 Bacteria 7277977
1532 8018177320 8018176218 Bacteria 6896178
1533 8022952979 8022948649 Bacteria 5366783
1534 8023687050 8023680758 Bacteria 7729763
1535 8024481036 8024479707 Bacteria 6954785
1536 8024489822 8024486573 Bacteria 6540512
1537 8024503331 8024501048 Bacteria 6427847
1538 8039104029 8039098773 Bacteria 6602928
1539 8046767606 8046767195 Bacteria 7547379
1540 8049296729 8049293176 Bacteria 6128433
1541 8054007159 8054002106 Bacteria 7987183
1542 8055266838 8055266321 Bacteria 7999742
1543 8055301840 8055301274 Bacteria 8587385
1544 8056379498 8056375014 Bacteria 7006639
1545 8056384826 8056382006 Bacteria 6408074
1546 8057579052 8057575449 Bacteria 7367519
1547 8057879521 8057874678 Bacteria 7494653
1548 JGI24740J21852_10000928
1549 JGI24739J22299_10016037
1550 JGI24739J22299_10057113
1551 JGI24735J21928_10000173
1552 JGI24735J21928_10036629
1553 JGI25155J39150_1000072
1554 JGI25156J39149_1000086
1555 JGI25156J39149_1000831
1556 JGI25156J39149_1001033
1557 JGI25156J39149_1003343
1558 JGI25162J39368_1000015
1559 JGI25162J39368_1000458
1560 JGI25162J39368_1000463
1561 JGI25154J39366_1000449
1562 JGI25158J39367_1000141
1563 JGI25157J39369_1000113
1564 JGI25152J39213_1001001
1565 JGI25152J39213_1001038
1566 JGI25152J39213_1003216
1567 JGI25152J39213_1012723
1568 JGI25150J39212_1000031
1569 JGI25159J45721_1000064
1570 JGI25159J45721_1027232
1571 JGI25151J46595_10000039
1572 JGI25151J46595_10000062
1573 JGI25151J46595_10000350
1574 JGI25151J46595_10003129
1575 JGI25151J46595_10020812
1576 JGI25151J46595_10050012
1577 JGI25406J46586_10064268
1578 JGI25165J46597_1000001
1579 JGI25165J46597_1000582
1580 JGI25165J46597_1001083
1581 JGI25165J46597_1001530
1582 JGI25165J46597_1002700
1583 JGI25165J46597_1005990
1584 JGI25153J46596_10001838
1585 JGI25153J46596_10006876
1586 rootH1_10035975
1587 rootH2_10019592
1588 rootL2_10037632
1589 rootH1_10082257
1590 JGI25160J50197_1000003
1591 JGI25160J50197_1000052
1592 JGI25161J50226_1000073
1593 JGI25161J50226_1000153
1594 JGI25161J50226_1002554
1595 Ga0006562J51391_1135276
1596 Ga0055538_1000001
1597 Ga0055538_1000057
1598 Ga0055539_1000001
1599 Ga0055539_1000088
1600 Ga0055533_1000003
1601 Ga0055533_1000093
1602 Ga0055533_1000096
1603 Ga0055533_1000767
1604 Ga0055532_1000039
1605 Ga0055532_1001175
1606 Ga0055532_1001955
1607 Ga0055525_1000087
1608 Ga0055525_1000129
1609 Ga0055527_1000024
1610 Ga0055535_1000028
1611 Ga0055542_1000047
1612 Ga0055529_1000054
1613 Ga0055526_1000799
1614 Ga0055526_1001895
1615 Ga0055526_1002211
1616 Ga0055526_1002843
1617 Ga0055526_1005878
1618 Ga0055526_1018334
1619 Ga0055524_1000061
1620 Ga0055524_1000104
1621 Ga0055524_1003002
1622 Ga0055524_1009869
1623 Ga0055524_1028264
1624 Ga0055536_1000985
1625 Ga0055536_1003268
1626 Ga0055528_1000097
1627 Ga0055528_1000443
1628 Ga0055528_1003367
1629 Ga0055528_1006401
1630 Ga0055528_1022523
1631 Ga0055528_1025399
1632 Ga0055528_1026904
1633 Ga0055530_10031312
1634 Ga0055540_1000914
1635 Ga0055540_1010936
1636 Ga0055540_1019357
1637 Ga0055540_1026966
1638 Ga0055540_1027399
1639 Ga0055531_10002899
1640 Ga0055541_1000001
1641 Ga0055541_1000059
1642 Ga0055543_1000035
1643 Ga0055543_1000048
1644 Ga0055543_1000223
1645 Ga0055543_1000656
1646 Ga0065165_1000025
1647 Ga0065165_1000253
1648 Ga0065165_1015178
1649 Ga0065165_1036906
1650 Ga0065165_1038777
1651 Ga0070658_10036537
1652 Ga0070658_10060723
1653 Ga0070658_10216633
1654 Ga0070658_10338925
1655 Ga0070658_10453788
1656 Ga0070676_10001679
1657 Ga0070676_10192414
1658 Ga0070683_100178043
1659 Ga0070670_100001192
1660 Ga0070670_100003745
1661 Ga0070670_100057022
1662 Ga0070677_10000284
1663 Ga0068869_100115170
1664 Ga0068869_100393467
1665 Ga0070666_10022585
1666 Ga0070660_100005906
1667 Ga0070660_100021197
1668 Ga0070660_100180996
1669 Ga0070660_100231945
1670 Ga0070689_100115054
1671 Ga0070661_100002923
1672 Ga0070661_100058287
1673 Ga0070661_100431540
1674 Ga0070692_10008165
1675 Ga0070668_100000600
1676 Ga0070668_100025707
1677 Ga0070668_100109681
1678 Ga0070668_100162422
1679 Ga0070668_100341717
1680 Ga0070668_100446881
1681 Ga0070669_100148124
1682 Ga0070669_100299976
1683 Ga0070675_100002372
1684 Ga0070675_100034354
1685 Ga0070675_100107731
1686 Ga0070671_100001633
1687 Ga0070671_100142156
1688 Ga0070671_100475872
1689 Ga0070673_100000043
1690 Ga0070673_100074646
1691 Ga0070667_100058849
1692 Ga0070667_100078167
1693 Ga0070701_10185635
1694 Ga0070708_100125001
1695 Ga0070663_100066979
1696 Ga0070678_100019749
1697 Ga0070662_100000595
1698 Ga0070662_100048049
1699 Ga0068867_100001617
1700 Ga0070706_100016889
1701 Ga0070706_100081551
1702 Ga0070706_100115512
1703 Ga0070707_100004732
1704 Ga0070707_100141523
1705 Ga0070707_100456213
1706 Ga0070699_100044905
1707 Ga0070679_100062946
1708 Ga0070684_100071484
1709 Ga0070697_100164846
1710 Ga0068853_100064851
1711 Ga0068853_100110235
1712 Ga0068853_100158742
1713 Ga0068853_100160419
1714 Ga0068853_100383734
1715 Ga0070672_100064224
1716 Ga0070695_100066305
1717 Ga0070695_100329856
1718 Ga0070696_100074468
1719 Ga0070665_100015106
1720 Ga0070665_100092333
1721 Ga0070665_100149969
1722 Ga0070665_100156932
1723 Ga0070665_100207892
1724 Ga0070704_100003833
1725 Ga0068855_100000112
1726 Ga0068855_100015721
1727 Ga0068855_100074547
1728 Ga0068855_100319434
1729 Ga0068855_100419693
1730 Ga0070664_100323440
1731 Ga0070664_100397442
1732 Ga0068857_100024609
1733 Ga0068857_100219721
1734 Ga0068854_100025684
1735 Ga0068856_100006424
1736 Ga0068856_100031300
1737 Ga0068856_100082339
1738 Ga0068856_100226625
1739 Ga0068856_100400672
1740 Ga0068852_100004716
1741 Ga0068852_100189595
1742 Ga0068852_100279307
1743 Ga0068864_100019540
1744 Ga0068866_10309396
1745 Ga0068861_100191729
1746 Ga0068870_10019746
1747 Ga0068870_10036685
1748 Ga0068863_100004844
1749 Ga0068863_100035979
1750 Ga0068863_100527127
1751 Ga0068858_100124490
1752 Ga0068860_100063158
1753 Ga0068860_100142447
1754 Ga0068860_100259739
1755 Ga0068862_100006394
1756 Ga0068862_100143321
1757 Ga0068862_100326284
1758 Ga0081455_10271262
1759 Ga0081455_10417943
1760 Ga0081540_1001564
1761 Ga0081540_1009283
1762 Ga0081539_10002371
1763 Ga0075365_10147251
1764 Ga0075365_10401157
1765 Ga0075368_10035926
1766 Ga0075363_100259492
1767 Ga0075362_10171136
1768 Ga0075367_10013064
1769 Ga0075367_10162178
1770 Ga0075367_10317937
1771 Ga0075369_10002189
1772 Ga0075369_10107811
1773 Ga0075366_10004184
1774 Ga0097621_100038145
1775 Ga0075370_10022947
1776 Ga0075370_10092723
1777 Ga0075370_10101670
1778 Ga0075370_10229329
1779 Ga0075428_100251624
1780 Ga0075428_100292380
1781 Ga0075430_100058566
1782 Ga0075430_100143631
1783 Ga0075430_100185000
1784 Ga0075430_100254970
1785 Ga0075430_100344974
1786 Ga0075434_100029314
1787 Ga0075434_100484348
1788 Ga0068865_100192877
1789 Ga0068865_100372296
1790 Ga0079104_1004107
1791 Ga0075435_100030554
1792 Ga0105251_10000186
1793 Ga0105251_10006290
1794 Ga0105240_10000027
1795 Ga0105240_10017895
1796 Ga0105240_10287812
1797 Ga0105240_10298298
1798 Ga0105240_10639168
1799 Ga0111539_10173003
1800 Ga0105245_10130450
1801 Ga0114129_10185856
1802 Ga0114129_10657355
1803 Ga0114129_11175263
1804 Ga0105241_10069410
1805 Ga0105241_10420023
1806 Ga0105248_10014055
1807 Ga0105248_10088824
1808 Ga0105248_10140496
1809 Ga0105237_10003459
1810 Ga0105237_10003513
1811 Ga0105237_10009004
1812 Ga0105237_10308750
1813 Ga0105238_10178777
1814 Ga0105238_10331242
1815 Ga0123341_1000048
1816 Ga0123342_1012205
1817 Ga0105239_10002416
1818 Ga0105239_10034949
1819 Ga0105239_10175230
1820 Ga0105239_11020694
1821 Ga0105246_10074599
1822 Ga0157371_10026978
1823 Ga0157370_10000372
1824 Ga0157370_10003889
1825 Ga0157370_10040302
1826 Ga0157370_10634856
1827 Ga0157369_10000044
1828 Ga0157369_10021119
1829 Ga0171463_1001
1830 Ga0171462_1008
1831 Ga0157374_10063155
1832 Ga0157374_10140441
1833 Ga0163162_10023344
1834 Ga0163162_10443893
1835 Ga0163162_10608508
1836 Ga0157372_10244644
1837 Ga0157372_10456406
1838 Ga0157375_10009041
1839 Ga0157375_10290094
1840 Ga0157380_10241916
1841 Ga0182008_10004471
1842 Ga0182008_10050647
1843 Ga0182008_10058210
1844 Ga0157376_10060111
1845 Ga0157376_10085241
1846 Ga0157376_10126778
1847 Ga0182006_1004028
1848 Ga0182006_1043889
1849 Ga0182007_10001095
1850 Ga0182007_10003604
1851 Ga0182005_1001513
1852 Ga0182005_1003388
1853 Ga0182005_1042792
1854 Ga0183363_1135
1855 Ga0163161_10019638
1856 Ga0163161_10353914
1857 Ga0197907_11172017
1858 Ga0206356_10374673
1859 Ga0206356_10961327
1860 Ga0206353_12038952
1861 Ga0214542_1023210
1862 Ga0214543_1000049
1863 Ga0213872_10011654
1864 Ga0224712_10000168
1865 Ga0228710_1000008
1866 Ga0209435_100036
1867 Ga0209435_105444
1868 Ga0209760_101367
1869 Ga0209436_100047
1870 Ga0209436_101464
1871 Ga0209784_100004
1872 Ga0209784_100009
1873 Ga0209566_100004
1874 Ga0209566_100007
1875 Ga0209674_100006
1876 Ga0209674_100013
1877 Ga0209674_100018
1878 Ga0209674_100308
1879 Ga0209672_100010
1880 Ga0209147_100006
1881 Ga0209563_100009
1882 Ga0209563_100020
1883 Ga0209563_107410
1884 Ga0207427_101102
1885 Ga0207427_104561
1886 Ga0209437_100004
1887 Ga0209437_100033
1888 Ga0209437_100036
1889 Ga0209258_100010
1890 Ga0207425_1000031
1891 Ga0207425_1001638
1892 Ga0207425_1005328
1893 Ga0209646_1000132
1894 Ga0209026_1000236
1895 Ga0209677_100005
1896 Ga0209677_100010
1897 Ga0209677_101419
1898 Ga0209148_1000018
1899 Ga0209148_1001099
1900 Ga0209759_1000148
1901 Ga0209759_1000269
1902 Ga0209759_1000307
1903 Ga0209129_1000053
1904 Ga0209129_1000125
1905 Ga0209129_1000310
1906 Ga0209129_1000585
1907 Ga0209129_1000772
1908 Ga0209129_1001648
1909 Ga0209129_1002237
1910 Ga0209233_1000005
1911 Ga0209233_1000056
1912 Ga0209233_1000064
1913 Ga0209233_1000135
1914 Ga0209233_1000492
1915 Ga0209233_1000519
1916 Ga0209565_1024431
1917 Ga0209565_1024863
1918 Ga0209455_1000015
1919 Ga0209455_1000542
1920 Ga0209673_1000254
1921 Ga0209673_1000420
1922 Ga0209673_1000946
1923 Ga0209673_1001299
1924 Ga0209673_1001710
1925 Ga0209673_1002387
1926 Ga0209673_1005272
1927 Ga0209673_1007188
1928 Ga0209130_1000005
1929 Ga0209130_1000006
1930 Ga0209130_1000018
1931 Ga0209675_1000452
1932 Ga0209676_1000296
1933 Ga0209676_1004393
1934 Ga0209676_1006421
1935 Ga0209025_1000008
1936 Ga0209025_1000087
1937 Ga0209025_1000165
1938 Ga0209025_1000284
1939 Ga0209025_1000900
1940 Ga0209025_1001720
1941 Ga0209025_1005547
1942 Ga0209025_1017626
1943 Ga0209025_1028874
1944 Ga0209025_1045059
1945 Ga0209564_1000015
1946 Ga0209564_1000031
1947 Ga0209564_1000217
1948 Ga0209564_1000233
1949 Ga0209564_1000399
1950 Ga0209564_1009805
1951 Ga0209564_1010691
1952 Ga0209758_1000081
1953 Ga0209758_1000313
1954 Ga0209758_1000420
1955 Ga0209758_1003751
1956 Ga0209758_1005053
1957 Ga0209758_1010064
1958 Ga0209758_1021831
1959 Ga0209758_1062664
1960 Ga0209050_1000773
1961 Ga0209050_1004963
1962 Ga0209050_1005751
1963 Ga0209256_1000027
1964 Ga0209256_1000030
1965 Ga0209256_1000062
1966 Ga0209256_1000762
1967 Ga0209256_1000882
1968 Ga0209256_1001301
1969 Ga0209256_1002206
1970 Ga0209256_1010006
1971 Ga0209256_1049104
1972 Ga0207426_1000015
1973 Ga0207426_1000044
1974 Ga0207426_1000106
1975 Ga0207426_1000265
1976 Ga0207426_1000417
1977 Ga0207426_1003845
1978 Ga0209051_1000339
1979 Ga0209051_1008214
1980 Ga0209051_1051500
1981 Ga0207713_1000804
1982 Ga0207713_1043867
1983 Ga0207682_10000255
1984 Ga0207642_10116105
1985 Ga0207710_10136093
1986 Ga0207680_10029569
1987 Ga0207647_10052263
1988 Ga0207645_10000696
1989 Ga0207645_10130673
1990 Ga0207645_10176646
1991 Ga0207643_10027655
1992 Ga0207643_10075194
1993 Ga0207705_10097002
1994 Ga0207705_10321491
1995 Ga0207684_10170292
1996 Ga0207684_10174289
1997 Ga0207684_10427432
1998 Ga0207707_10024271
1999 Ga0207695_10000024
2000 Ga0207695_10070854
2001 Ga0207695_10124846
2002 Ga0207695_10178269
2003 Ga0207695_10196802
2004 Ga0207671_10000504
2005 Ga0207671_10020765
2006 Ga0207671_10201687
2007 Ga0207671_10289010
2008 Ga0207663_10096245
2009 Ga0207660_10054495
2010 Ga0207660_10058661
2011 Ga0207657_10002628
2012 Ga0207657_10019972
2013 Ga0207657_10029830
2014 Ga0207657_10192848
2015 Ga0207649_10062944
2016 Ga0207649_10069688
2017 Ga0207649_10198305
2018 Ga0207652_10061952
2019 Ga0207646_10010934
2020 Ga0207646_10522183
2021 Ga0207681_10066969
2022 Ga0207681_10225049
2023 Ga0207694_10066506
2024 Ga0207650_10002047
2025 Ga0207650_10114414
2026 Ga0207650_10147814
2027 Ga0207650_10171275
2028 Ga0207650_10501588
2029 Ga0207659_10063962
2030 Ga0207644_10100442
2031 Ga0207644_10119456
2032 Ga0207644_10186405
2033 Ga0207706_10030908
2034 Ga0207706_10256326
2035 Ga0207670_10284360
2036 Ga0207669_10058807
2037 Ga0207704_10129306
2038 Ga0207665_10119488
2039 Ga0207691_10000029
2040 Ga0207691_10000111
2041 Ga0207691_10178528
2042 Ga0207691_10448631
2043 Ga0207711_10066509
2044 Ga0207711_10097229
2045 Ga0207689_10035410
2046 Ga0207689_10126643
2047 Ga0207679_10323687
2048 Ga0207667_10000032
2049 Ga0207667_10012150
2050 Ga0207667_10156498
2051 Ga0207667_10471585
2052 Ga0207667_10652535
2053 Ga0207651_10017619
2054 Ga0207668_10020700
2055 Ga0207668_10033890
2056 Ga0207668_10132835
2057 Ga0207668_10222677
2058 Ga0207640_10071336
2059 Ga0207658_10076986
2060 Ga0207703_10239102
2061 Ga0207639_10006241
2062 Ga0207639_10154897
2063 Ga0207639_10252998
2064 Ga0207678_10079742
2065 Ga0207678_10135000
2066 Ga0207708_10014634
2067 Ga0207702_10033194
2068 Ga0207702_10169535
2069 Ga0207702_10187226
2070 Ga0207641_10092852
2071 Ga0207641_10128584
2072 Ga0207648_10001008
2073 Ga0207676_10066093
2074 Ga0207674_10059902
2075 Ga0207674_10123109
2076 Ga0207674_10193307
2077 Ga0207675_100051114
2078 Ga0207675_100213524
2079 Ga0207675_100514325
2080 Ga0207683_10000164
2081 Ga0207698_10009652
2082 Ga0207698_10123156
2083 Ga0207698_10406051
2084 Ga0209281_1000134
2085 Ga0209281_1000319
2086 Ga0209371_1002406
2087 Ga0209969_1009777
2088 Ga0209999_1009256
2089 Ga0209970_1024307
2090 Ga0209282_1000029
2091 Ga0209813_10007265
2092 Ga0207428_10124091
2093 Ga0268266_10000002
2094 Ga0268266_10002704
2095 Ga0268266_10022595
2096 Ga0268266_10024678
2097 Ga0268266_10081449
2098 Ga0268266_10129895
2099 Ga0268266_10303159
2100 Ga0268265_10283677
2101 Ga0265318_10018442
2102 Ga0307515_10004491
2103 Ga0307515_10044853
2104 Ga0265338_10014553
2105 Ga0268256_1001914
2106 Ga0265330_10018309
2107 Ga0265332_10137458
2108 Ga0265328_10030250
2109 Ga0265325_10006250
2110 Ga0265325_10019300
2111 Ga0265325_10066323
2112 Ga0265340_10013579
2113 Ga0265340_10022646
2114 Ga0265340_10043305
2115 Ga0265339_10002167
2116 Ga0265339_10002978
2117 Ga0265339_10017930
2118 Ga0265331_10096775
2119 Ga0265327_10062208
2120 Ga0265316_10013087
2121 Ga0265316_10088953
2122 Ga0265316_10187826
2123 Ga0265316_10286349
2124 Ga0265316_10311642
2125 Ga0307513_10004452
2126 Ga0307513_10122586
2127 Ga0307513_10397807
2128 Ga0307408_100008435
2129 Ga0307408_100240572
2130 Ga0307408_100317073
2131 Ga0265313_10000044
2132 Ga0265313_10000481
2133 Ga0265313_10011274
2134 Ga0265313_10040457
2135 Ga0265313_10107878
2136 Ga0265313_10148949
2137 Ga0316575_10125039
2138 Ga0265314_10010039
2139 Ga0265314_10040857
2140 Ga0265314_10052311
2141 Ga0265342_10000926
2142 Ga0265342_10018725
2143 Ga0265342_10036960
2144 Ga0307405_10000891
2145 Ga0307413_10459871
2146 Ga0307406_10008115
2147 Ga0307406_10282757
2148 Ga0307406_10497205
2149 Ga0307412_10003099
2150 Ga0315914_1000021
2151 Ga0307409_100427434
2152 Ga0307416_100134577
2153 Ga0307416_100330957
2154 Ga0307414_10006260
2155 Ga0307414_10350310
2156 Ga0307411_10116431
2157 Ga0307415_100277707
2158 Ga0307510_10000006
2159 Ga0315913_1000014
2160 Ga0315915_1000003
2161 Ga0373940_0138878
2162 Ga0373931_0069030
2163 Ga0373925_0337993
2164 Ga0395899_0191350
2165 Ga0395900_0102955
2166 Ga0395898_0000734
2167 Ga0395898_0396096
2168 Ga0395905_0001622
2169 Ga0395905_0005671
2170 Ga0395905_0014502
2171 Ga0395905_0146917
2172 Ga0395901_0003838
2173 Ga0436361_0202578
2174 Ga0436361_0442404
2175 Ga0436361_0837169
2176 Ga0436361_0896770
2177 Ga0439465_0006444
2178 Ga0439465_0012770
2179 Ga0439465_0014683
2180 Ga0439465_0024073
2181 Ga0439465_0025832
2182 Ga0451787_404703
2183 Ga0451795_0556880
2184 Ga0451841_0396807
2185 Ga0451841_0417501
2186 Ga0451849_0336373
2187 Ga0451843_1415636
2188 Ga0451853_0588015
2189 Ga0451853_2057460
2190 Ga0439449_0019354
2191 Ga0439462_0053106
2192 Ga0450911_000165
2193 Ga0439435_0012453
2194 Ga0439435_0067682
2195 Ga0439460_0005081
2196 Ga0466969_0000465
2197 Ga0466972_0000754
2198 Ga0453683_0340108
2199 Ga0466965_0000062
2200 Ga0466966_0006620
2201 Ga0466961_0001589
2202 Ga0466961_0206928
2203 Ga0466963_0000730
2204 Ga0466971_0001288
2205 Ga0466957_0003439
2206 Ga0451576_0613565
2207 Ga0466958_0000130
2208 Ga0466967_0265249
2209 Ga0495592_0000829
2210 Ga0495592_0011881
2211 Ga0495592_0054299
2212 Ga0495592_0332200
2213 Ga0495603_0001794
2214 Ga0495603_0025778
2215 Ga0495590_0006612
2216 Ga0495629_0000914
2217 Ga0495629_0099308
2218 Ga0495629_0159995
2219 Ga0495638_0000909
2220 Ga0495641_0019229
2221 Ga0495641_0025194
2222 Ga0495651_0028826
2223 Ga0495651_0035189
2224 Ga0495651_0073024
2225 Ga0495651_0176149
2226 Ga0495651_0218766
2227 Ga0495651_0369145
2228 Ga0495653_0009203
2229 Ga0495653_0029136
2230 Ga0495653_0110376
2231 Ga0495653_0185586
2232 Ga0495653_0377172
2233 Ga0495650_0001446
2234 Ga0495650_0017389
2235 Ga0495650_0020552
2236 Ga0495580_0001047
2237 Ga0495580_0001253
2238 Ga0495580_0003602
2239 Ga0495580_0009008
2240 Ga0495580_0263550
2241 Ga0495582_0004389
2242 Ga0495582_0004650
2243 Ga0495605_0002885
2244 Ga0495605_0038228
2245 Ga0495662_0041724
2246 Ga0495662_0050211
2247 Ga0495664_0002924
2248 Ga0495664_0005874
2249 Ga0495664_0083059
2250 Ga0495585_0005637
2251 Ga0495585_0069050
2252 Ga0495585_0108761
2253 Ga0495596_0005869
2254 Ga0495607_0167571
2255 Ga0495583_0011359
2256 Ga0495583_0051746
2257 Ga0495583_0066627
2258 Ga0495606_0001156
2259 Ga0495606_0006718
2260 Ga0495606_0041695
2261 Ga0495606_0080461
2262 Ga0495606_0100057
2263 Ga0495608_0012173
2264 Ga0495610_0003480
2265 Ga0495610_0018326
2266 Ga0495610_0018570
2267 Ga0495618_0016257
2268 Ga0495620_0018573
2269 Ga0495628_0001001
2270 Ga0495628_0004631
2271 Ga0495628_0007758
2272 Ga0495628_0058964
2273 Ga0495628_0146980
2274 Ga0495628_0318805
2275 Ga0495630_0127841
2276 Ga0495631_0000552
2277 Ga0495632_0028804
2278 Ga0495632_0080712
2279 Ga0495643_0219742
2280 Ga0495648_0009668
2281 Ga0495648_0085051
2282 Ga0495648_0087345
2283 Ga0495663_0090151
2284 Ga0495666_0010278
2285 Ga0495666_0044960
2286 Ga0495642_0030212
2287 Ga0495652_0012335
2288 Ga0495652_0026326
2289 Ga0495652_0043479
2290 Ga0495652_0128645
2291 Ga0495652_0273874
2292 Ga0495652_0287220
2293 Ga0495654_0126313
2294 Ga0495654_0147139
2295 Ga0495665_0027389
2296 Ga0495665_0146855
2297 Ga0495665_0251171
2298 Ga0495586_0022263
2299 Ga0495586_0105143
2300 Ga0495586_0262906
2301 Ga0495587_0007517
2302 Ga0495597_0017347
2303 Ga0495597_0167452
2304 Ga0495645_0000268
2305 Ga0495645_0036074
2306 Ga0495622_0000160
2307 Ga0495622_0007629
2308 Ga0495622_0017577
2309 Ga0495622_0109639
2310 Ga0495633_0058097
2311 Ga0495633_0069262
2312 Ga0495667_0109801
2313 Ga0495668_0049554
2314 Ga0495668_0071996
2315 Ga0495634_0068259
2316 Ga0495634_0147543
2317 Ga0495611_0038900
2318 Ga0495625_0001787
2319 Ga0495625_0006284
2320 Ga0495625_0025409
2321 Ga0495625_0068718
2322 Ga0495625_0082331
2323 Ga0495635_0207830
2324 Ga0495661_0020669
2325 Ga0495588_0007107
2326 Ga0495657_0011098
2327 Ga0495599_0002233
2328 Ga0495599_0036699
2329 Ga0495599_0125995
2330 Ga0495623_0027830
2331 Ga0495623_0178717
2332 Ga0495646_0001211
2333 Ga0495646_0003303
2334 Ga0495646_0007299
2335 Ga0495646_0032075
2336 Ga0495646_0065350
2337 Ga0495646_0170947
2338 Ga0495646_0171724
2339 Ga0495658_0041794
2340 Ga0495669_0024288
2341 Ga0495669_0024927
2342 Ga0495669_0038291
2343 Ga0495613_0256182
2344 Ga0495624_0001055
2345 Ga0495624_0069594
2346 Ga0495624_0194905
2347 Ga0495670_0011202
2348 Ga0495649_0001938
2349 Ga0495649_0081534
2350 Ga0495649_0232439
2351 Ga0495589_0010589
2352 Ga0495589_0021089
2353 Ga0495600_0002896
2354 Ga0495600_0007763
2355 Ga0495600_0087224
2356 Ga0495600_0120164
2357 Ga0495660_0044719
2358 Ga0495660_0083315
2359 Ga0495581_0002646
2360 Ga0495581_0005299
2361 Ga0495581_0117571
2362 Ga0495604_0002922
2363 Ga0495604_0009191
2364 Ga0495604_0043051
2365 Ga0495636_0050053
2366 Ga0495674_0016282
2367 Ga0495674_0029960
2368 Ga0495674_0050664
2369 Ga0495674_0171596
2370 Ga0495674_0175754
2371 Ga0495674_0425790
2372 Ga0495672_0002790
2373 Ga0495672_0074266
2374 Ga0495672_0186410
2375 Ga0495676_0152252
2376 Ga0495676_0327926
2377 Ga0495680_0018718
2378 Ga0495680_0278453
2379 Ga0495680_0291187
2380 Ga0495683_0002161
2381 Ga0495683_0003724
2382 Ga0495683_0053342
2383 Ga0495683_0249605
2384 Ga0495687_006656
2385 Ga0495687_073084
2386 Ga0495675_0004153
2387 Ga0495675_0024861
2388 Ga0495675_0086462
2389 Ga0495675_0234792
2390 Ga0495679_001418
2391 Ga0495679_070370
2392 Ga0495686_0000032
2393 Ga0495686_0001669
2394 Ga0495686_0004735
2395 Ga0495686_0045477
2396 Ga0495686_0110324
2397 Ga0495686_0280146
2398 Ga0495593_0018207
2399 Ga0495593_0041468
2400 Ga0495593_0076431
2401 Ga0495593_0096987
2402 Ga0495602_0014072
2403 Ga0495602_0029701
2404 Ga0495602_0045355
2405 Ga0495602_0097981
2406 Ga0495602_0304329
2407 Ga0496100_0024570
2408 Ga0496100_0053319
2409 Ga0496100_0142950
2410 Ga0496101_0010604
2411 Ga0496101_0171604
2412 Ga0496101_0428097
2413 Ga0496101_0471118
2414 Ga0496102_0001378
2415 Ga0496102_0006765
2416 Ga0496102_0047107
2417 Ga0496102_0072128
2418 Ga0496102_0129990
2419 Ga0496102_0133589
2420 Ga0496103_0003884
2421 Ga0496103_0012238
2422 Ga0496103_0085632
2423 Ga0496103_0148233
2424 Ga0496104_0097819
2425 Ga0496105_0086571
2426 Ga0496105_0285139
2427 Ga0496105_0457244
2428 Ga0496106_0000053
2429 Ga0496106_0000290
2430 Ga0496106_0041981
2431 Ga0496106_0142362
2432 Ga0496106_0461213
2433 Ga0496107_0074890
2434 Ga0496107_0251450
2435 Ga0496107_0299235
2436 Ga0496108_0212210
2437 Ga0496110_0006578
2438 Ga0496110_0082373
2439 Ga0496111_0004953
2440 Ga0496111_0173692
2441 Ga0496112_0124154
2442 Ga0496113_0004113
2443 Ga0496113_0067500
2444 Ga0496113_0240781
2445 Ga0496114_0002052
2446 Ga0496114_0009661
2447 Ga0496116_0002110
2448 Ga0496116_0006225
2449 Ga0496116_0011824
2450 Ga0496116_0015688
2451 Ga0496116_0025729
2452 Ga0496117_0000090
2453 Ga0496117_0000537
2454 Ga0496117_0001435
2455 Ga0496117_0004435
2456 Ga0496117_0011926
2457 Ga0496117_0013560
2458 Ga0496117_0021217
2459 Ga0496117_0068914
2460 Ga0496118_0000032
2461 Ga0496118_0003531
2462 Ga0496118_0004184
2463 Ga0496118_0021868
2464 Ga0496118_0048497
2465 Ga0496118_0122525
2466 Ga0496119_0043730
2467 Ga0496119_0155536
2468 Ga0496120_0005377
2469 Ga0496121_0001496
2470 Ga0496121_0001984
2471 Ga0496121_0002741
2472 Ga0496121_0009025
2473 Ga0496121_0018227
2474 Ga0496121_0021093
2475 Ga0496121_0023889
2476 Ga0496121_0054942
2477 Ga0496121_0057992
2478 Ga0496121_0084193
2479 Ga0496121_0113677
2480 Ga0496121_0216832
2481 Ga0496121_0333886
2482 Ga0496122_0000205
2483 Ga0496122_0007852
2484 Ga0496122_0008322
2485 Ga0496122_0022648
2486 Ga0496122_0028681
2487 Ga0496122_0080317
2488 Ga0496122_0099422
2489 Ga0496123_0000103
2490 Ga0496123_0004660
2491 Ga0496123_0025121
2492 Ga0496123_0026340
2493 Ga0496123_0029459
2494 Ga0496123_0050517
2495 Ga0496123_0065239
2496 Ga0496123_0091738
2497 Ga0496124_0001267
2498 Ga0496124_0008624
2499 Ga0496124_0010914
2500 Ga0496124_0011588
2501 Ga0496124_0022738
2502 Ga0496124_0033325
2503 Ga0496124_0036438
2504 Ga0496124_0067522
2505 Ga0496124_0158505
2506 Ga0496124_0189741
2507 Ga0496124_0369134
2508 Ga0496125_0000276
2509 Ga0496125_0000385
2510 Ga0496125_0002618
2511 Ga0496125_0007498
2512 Ga0496125_0011149
2513 Ga0496125_0018320
2514 Ga0496125_0284806
2515 Ga0496126_0000034
2516 Ga0496126_0000606
2517 Ga0496126_0007343
2518 Ga0496126_0042028
2519 Ga0496126_0067656
2520 Ga0496126_0117887
2521 Ga0496126_0375367
2522 Ga0496126_0606897
2523 Ga0495678_059160
2524 Ga0501031_0098092
2525 Ga0501031_0117085
2526 Ga0501031_0191047
2527 Ga0501032_0000774
2528 Ga0501032_0047584
2529 Ga0501032_0050805
2530 Ga0501032_0057846
2531 Ga0501032_0071161
2532 Ga0501033_0001601
2533 Ga0501033_0003501
2534 Ga0501033_0006388
2535 Ga0501033_0073616
2536 Ga0501033_0093116
2537 Ga0501033_0103083
2538 Ga0501033_0166535
2539 Ga0501033_0391143
2540 Ga0501034_0012190
2541 Ga0501034_0014475
2542 Ga0501034_0020135
2543 Ga0501034_0031563
2544 Ga0501034_0051951
2545 Ga0501034_0063118
2546 Ga0501034_0152315
2547 Ga0501034_0281137
2548 Ga0501034_0297671
2549 Ga0501034_0414610
2550 Ga0501034_0419508
2551 Ga0501034_0476612
2552 Ga0501034_0517134
2553 Ga0501034_0524320
2554 Ga0501034_0618248
2555 Ga0501036_0122241
2556 Ga0501036_0145038
2557 Ga0501036_0161451
2558 Ga0501036_0174646
2559 Ga0501037_0000227
2560 Ga0501037_0016106
2561 Ga0501037_0048724
2562 Ga0501037_0064803
2563 Ga0501037_0071633
2564 Ga0501037_0073188
2565 Ga0501037_0204633
2566 Ga0501037_0362928
2567 Ga0501038_0065759
2568 Ga0501038_0105670
2569 Ga0501038_0182160
2570 Ga0501039_0055607
2571 Ga0501039_0068139
2572 Ga0501040_0000012
2573 Ga0501040_0009689
2574 Ga0501041_0051454
2575 Ga0501041_0197943
2576 Ga0501042_0000134
2577 Ga0501042_0047679
2578 Ga0501042_0072604
2579 Ga0501042_0239977
2580 Ga0501043_0000396
2581 Ga0501043_0036737
2582 Ga0501043_0052747
2583 Ga0501043_0054136
2584 Ga0501043_0087647
2585 Ga0501043_0233637
2586 Ga0501043_0251112
2587 Ga0501043_0251426
2588 Ga0501046_0074485
2589 Ga0501046_0367274
2590 Ga0501047_0021369
2591 Ga0501047_0031284
2592 Ga0501047_0060566
2593 Ga0501047_0160155
2594 Ga0501047_0189708
2595 Ga0501047_0203411
2596 Ga0501048_0171267
2597 Ga0501048_0203490
2598 Ga0501067_0002803
2599 Ga0501067_0234549
2600 Ga0501067_0300599
2601 Ga0501069_0000068
2602 Ga0501069_0040540
2603 Ga0501070_0000313
2604 Ga0501070_0001095
2605 Ga0501070_0005970
2606 Ga0501070_0011952
2607 Ga0501070_0127226
2608 Ga0501070_0160291
2609 Ga0501070_0166840
2610 Ga0501070_0201959
2611 Ga0501070_0386987
2612 Ga0501071_0571348
2613 Ga0501073_0004250
2614 Ga0501073_0031768
2615 Ga0501073_0055592
2616 Ga0501073_0073155
2617 Ga0501073_0075503
2618 Ga0501073_0209024
2619 Ga0501074_0000239
2620 Ga0501074_0040882
2621 Ga0501074_0068869
2622 Ga0501079_0294782
2623 Ga0501080_0000128
2624 Ga0501080_0010598
2625 Ga0501080_0058923
2626 Ga0501080_0117747
2627 Ga0501080_0148783
2628 Ga0501080_0277460
2629 Ga0501083_0000065
2630 Ga0501083_0000105
2631 Ga0501083_0002746
2632 Ga0501083_0017184
2633 Ga0501035_0000185
2634 Ga0501035_0002315
2635 Ga0501035_0002609
2636 Ga0501035_0004471
2637 Ga0501035_0004845
2638 Ga0501035_0055678
2639 Ga0501035_0076538
2640 Ga0501044_0000003
2641 Ga0501044_0026482
2642 Ga0501044_0027102
2643 Ga0501044_0039557
2644 Ga0501044_0042927
2645 Ga0501044_0071681
2646 Ga0501044_0071965
2647 Ga0501044_0096345
2648 Ga0501044_0143485
2649 Ga0501044_0162000
2650 Ga0501044_0428967
2651 Ga0501044_0542254
2652 Ga0501044_0561123
2653 nmdc:mga00v17_162864_c1
2654 nmdc:mga0yw44_181558_c1
2655 nmdc:mga0yw44_203529_c1
2656 nmdc:mga0yw44_213182_c1
2657 nmdc:mga0yw44_251698_c1
2658 nmdc:mga06z11_104363_c1
2659 nmdc:mga06z11_52985_c1
2660 nmdc:mga07m45_12517_c1
2661 nmdc:mga0qj67_42480_c1
2662 nmdc:mga06r32_229207_c1
2663 nmdc:mga08y16_60200_c1
2664 nmdc:mga0rr50_65155_c1
2665 nmdc:mga0sz30_116998_c1
2666 nmdc:mga0sz30_21000_c1
2667 nmdc:mga0sz30_47514_c1
2668 nmdc:mga0sz30_91481_c1
2669 Ga0495601_0015586
2670 Ga0500578_0038076
2671 Ga0500651_0091527
2672 Ga0500555_016706
2673 Ga0500557_009472
2674 Ga0500594_0010885
2675 Ga0500595_010497
2676 Ga0500568_0000048
2677 Ga0500568_0000998
2678 Ga0500568_0002382
2679 Ga0500568_0131522
2680 Ga0500573_0206447
2681 Ga0500574_000440
2682 Ga0500590_002471
2683 Ga0500604_0038263
2684 Ga0500616_0001692
2685 Ga0500616_0008346
2686 Ga0500616_0077829
2687 Ga0500619_000066
2688 Ga0500622_0002387
2689 Ga0500624_029146
2690 Ga0500627_0000054
2691 Ga0500627_0059356
2692 Ga0500634_0000019
2693 Ga0500634_0024557
2694 Ga0501084_0001717
2695 Ga0501084_0251833
2696 Ga0501082_0001282
2697 Ga0466962_0002343
2698 2585847286
2699 2509108916
2700 2509375362
2701 2509387786
2702 2509443386
2703 2510132233
2704 2510251687
2705 2510307297
2706 2510898571
2707 2511133567
2708 2511187365
2709 2511197915
2710 2511390258
2711 2512973085
2712 2513569070
2713 2513580787
2714 2513596179
2715 2513604333
2716 2513616181
2717 2513630862
2718 2513709273
2719 2513865694
2720 2513882666
2721 2513906466
2722 2513907595
2723 2513925641
2724 2513983147
2725 2513996311
2726 2514008152
2727 2514024462
2728 2514054242
2729 2514586359
2730 2515111216
2731 2515607382
2732 2515635996
2733 2515642648
2734 2515658835
2735 2515680590
2736 2515740395
2737 2517039859
2738 2517075400
2739 2517093989
2740 2517405803
2741 2517571914
2742 2520375315
2743 2523466451
2744 2524450879
2745 2524460722
2746 2527075719
2747 2530643960
2748 2558866452
2749 2585164480
2750 2585203009
2751 2585220922
2752 2585230486
2753 2585256682
2754 2585264785
2755 2585273336
2756 2585278833
2757 2585325552
2758 2585329706
2759 2585386146
2760 2585394762
2761 2585400216
2762 2585527897
2763 2585537300
2764 2585541499
2765 2585549979
2766 2585556356
2767 2585559363
2768 2585822757
2769 2585839368
2770 2585902035
2771 2585905260
2772 2587979625
2773 2599332462
2774 2599418660
2775 2600194956
2776 2616296705
2777 2616305893
2778 2616553865
2779 2617383790
2780 2643770639
2781 2643805929
2782 2643838229
2783 2643910223
2784 2643963928
2785 2644007854
2786 2644051560
2787 2644066105
2788 2644144531
2789 2644165064
2790 2644196445
2791 2644200058
2792 2644207213
2793 2644242817
2794 2644306582
2795 2644330772
2796 2644345667
2797 2644377189
2798 2644417436
2799 2644450832
2800 2644480429
2801 2644498841
2802 2644542422
2803 2644612193
2804 2644650861
2805 2644671614
2806 2644692745
2807 2644728586
2808 2644736975
2809 2657682893
2810 2671112791
2811 2673822106
2812 2719180188
2813 2719384785
2814 2719664546
2815 2719730937
2816 2720490966
2817 2720612328
2818 2720619166
2819 2720630568
2820 2720774261
2821 2721146282
2822 2721157802
2823 2721163161
2824 2721398496
2825 2722839331
2826 2723025988
2827 2723559532
2828 2723566149
2829 2724037309
2830 2724043693
2831 2724088868
2832 2724103414
2833 2724109258
2834 2725948417
2835 2730106924
2836 2730163425
2837 2730297434
2838 2738803665
2839 2739035829
2840 2739350580
2841 2753569754
2842 2765466438
2843 2766067670
2844 2770197039
2845 2776270340
2846 2776282312
2847 2778177392
2848 2792583229
2849 2792621089
2850 2792625303
2851 2792637733
2852 2793283548
2853 2793296135
2854 2793316859
2855 2793322686
2856 2793330964
2857 2793333541
2858 2793339871
2859 2793350121
2860 2793353501
2861 2793358845
2862 2793370537
2863 2802718652
2864 2802724333
2865 2802730005
2866 2802737348
2867 2802742264
2868 2802748947
2869 2804754112
2870 2805926644
2871 2805937498
2872 2806046992
2873 2806052575
2874 2806058654
2875 2806067578
2876 2806073894
2877 2819544994
2878 2819612282
2879 2819639322
2880 2819719862
2881 2838017217
2882 2838023262
2883 2838031344
2884 2838037650
2885 2838047005
2886 2838049302
2887 2838063253
2888 2838074631
2889 2838075001
2890 2838662657
2891 2838670779
2892 2838681271
2893 2838688684
2894 2838694695
2895 2838703150
2896 2838708072
2897 2838730979
2898 2838744127
2899 2839998205
2900 2840769043
2901 2841856808
2902 2841865549
2903 2842080696
2904 2842117636
2905 2842121315
2906 2842147626
2907 2842159978
2908 2842168220
2909 2842183405
2910 2842197882
2911 2842199690
2912 2842207768
2913 2842221135
2914 2842234994
2915 2842237484
2916 2842245591
2917 2842252692
2918 2842259759
2919 2842270161
2920 2842274598
2921 2842281437
2922 2842287184
2923 2842294353
2924 2842302526
2925 2842306842
2926 2842314522
2927 2842318720
2928 2842343670
2929 2842360741
2930 2842365102
2931 2842371734
2932 2842380750
2933 2842387821
2934 2842398340
2935 2842404452
2936 2842410863
2937 2842417681
2938 2842427285
2939 2842433983
2940 2842440359
2941 2842446908
2942 2842453441
2943 2842468402
2944 2842474920
2945 2842478061
2946 2842482781
2947 2842493690
2948 2842497355
2949 2842504870
2950 2842509653
2951 2842521269
2952 2842872225
2953 2842922731
2954 2844170072
2955 2844455209
2956 2850079572
2957 2852388997
2958 2855827875
2959 2857520359
2960 2858802971
2961 2891376610
2962 2894655664
2963 2896384713
2964 2904439117
2965 2904487293
2966 2904582178
2967 2913298296
2968 2915986577
2969 2915989408
2970 2916032806
2971 2916044567
2972 2916054754
2973 2916057144
2974 2916065907
2975 2916079643
2976 2917558625
2977 2917704234
2978 2919103759
2979 2919123042
2980 2919409230
2981 2920763745
2982 2920822967
2983 2921254892
2984 2921267341
2985 2921653940
2986 2923557644
2987 2924179568
2988 2928131604
2989 2928524154
2990 2933021059
2991 2933573044
2992 2933593694
2993 2933605061
2994 2935895217
2995 2935904206
2996 2936368194
2997 2936381413
2998 2936388062
2999 2936998631
3000 2937033594
3001 2937040371
3002 2937047676
3003 2937069938
3004 2937082683
3005 2937089489
3006 2937843594
3007 2939671722
3008 2941501076
3009 2945984872
3010 2954013101
3011 2957377883
3012 2957443822
3013 2957446849
3014 2957481249
3015 2960593284
3016 2960613724
3017 2960620375
3018 2960626227
3019 2960637070
3020 2960660756
3021 2960685228
3022 2960688476
3023 2960697395
3024 2967689936
3025 2967732807
3026 2967777970
3027 2970031074
3028 2970040170
3029 2970075214
3030 2970088010
3031 2970127957
3032 2970148886
3033 2970179031
3034 2970194870
3035 2977521904
3036 2977531015
3037 2977548664
3038 2989354256
3039 2989771973
3040 2996313978
3041 2996890894
3042 2996896588
3043 3002145040
3044 3005412332
3045 3005417070
3046 3005446691
3047 3005453373
3048 639647368
3049 8003995825
3050 8004003585
3051 8005262148
3052 8005279503
3053 8005286465
3054 8005292725
3055 8005304497
3056 8005309098
3057 8005315131
3058 8005325421
3059 8005376681
3060 8005386072
3061 8005397534
3062 8005432195
3063 8005461857
3064 8005485699
3065 8005499261
3066 8005544280
3067 8005558993
3068 8005570369
3069 8005572614
3070 8005620456
3071 8005628822
3072 8005648281
3073 8005670677
3074 8005684669
3075 8005690918
3076 8005698865
3077 8018131235
3078 8018169090
3079 8018177320
3080 8022952979
3081 8023687050
3082 8024481036
3083 8024489822
3084 8024503331
3085 8039104029
3086 8046767606
3087 8049296729
3088 8054007159
3089 8055266838
3090 8055301840
3091 8056379498
3092 8056384826
3093 8057579052
3094 8057879521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04962

KduI

KduI/IolB family

45

303

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qjv-assembly1.cif.gz_A crystal structure of an iolb-like protein (stm4420) from salmonella typhimurium lt2 at 1.90 a resolution 0.984 3 263
2qjv-assembly1.cif.gz_A crystal structure of an iolb-like protein (stm4420) from salmonella typhimurium lt2 at 1.90 a resolution 0.9729 3 263
5j4f-assembly1.cif.gz_A crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695 0.8539 27 108
7ye3-assembly1.cif.gz_C crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mes 0.8402 28 257
7ye3-assembly1.cif.gz_E crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mes 0.8263 28 254
ID Description Score Start End Superfamily
2qjvB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.985 126 263 2.60.120.10
2qjvB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9511 13 124 2.60.120.10
2qjvB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9427 13 124 2.60.120.10
2qjvB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8902 126 263 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8593 136 247 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7X6ISU5-F1-model_v4 deleted 0.997 158 240
AF-A0A3D4NMZ7-F1-model_v4 5-deoxy-glucuronate isomerase 0.9968 163 265 GO:0008880
GO:0019310
AF-A0A261WB99-F1-model_v4 5-deoxy-glucuronate isomerase 0.9934 117 265 GO:0008880
GO:0019310
AF-A0A2G6IYU5-F1-model_v4 5-deoxy-glucuronate isomerase 0.9917 3 262 GO:0008880
GO:0019310
AF-A0A7G2IZY4-F1-model_v4 5-deoxy-glucuronate isomerase (EC 5.3.1.-) 0.9911 156 265 GO:0008880
GO:0019310

Map