F494702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1548 | 458 | 3096 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300042005|Ga0439448_0128794|Ga0439448_0128794_29_625 |
| Length | 198 |
| Sequence | MALSSAPAARGMFTVVCIKASFALHCCLRINASLQEPTMNVFDFQAASLDGKPVDLAQYRGKVLLIVNTASKCGFTPQYQGLESLYRDLHPRGLEVLGFPCNQFGSQEPGSEEEIGAFCEKNYGVSFPMFAKVDVNGDAAHPLFKHLKNAAPGVLGTEGIKWNFTKFLVGRDGQVLHRYAPQTKPEDIAADIGKALAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 83 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 101 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 102 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 103 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 236 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 237 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 238 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 239 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 242 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 243 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 244 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 245 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 246 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 247 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 248 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 249 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 250 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 251 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 252 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 253 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 254 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 255 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 256 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 257 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 258 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 259 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 260 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 261 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 262 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 263 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 264 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 265 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 266 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 267 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 268 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 269 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 270 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 271 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 272 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 273 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 274 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 275 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 278 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 279 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 280 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 287 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 288 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 289 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 290 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 291 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 292 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 293 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 294 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 295 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 392 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 395 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 396 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 397 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 398 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 399 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 400 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 401 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 402 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 403 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 404 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 405 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 406 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 407 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 408 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 409 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 410 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 413 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 420 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 421 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 422 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 423 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 424 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 426 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 427 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 431 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 432 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 433 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 439 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 441 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 442 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 443 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 445 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 446 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 449 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 451 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 452 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 453 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 454 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 455 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 456 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 458 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.69 |
| Nodule | 0.26 |
| Rhizoplane | 1.94 |
| Rhizosphere | 85.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439448_0128794 | 3300042005 | Bacteria | 871 |
| 2 | MRS2a_Contig_45 | 2124908027 | Bacteria | 78063 |
| 3 | MRS2a_Contig_9372 | 2124908027 | Bacteria | 3191 |
| 4 | JGI24752J21851_1021702 | 3300001976 | Bacteria | 838 |
| 5 | JGI24735J21928_10021972 | 3300002067 | Bacteria | 1945 |
| 6 | JGI24738J21930_10001352 | 3300002075 | Bacteria | 6801 |
| 7 | JGI24751J29686_10000159 | 3300002459 | Bacteria | 32221 |
| 8 | JGI24751J29686_10088548 | 3300002459 | Bacteria | 643 |
| 9 | JGI25162J39368_1000077 | 3300002737 | Bacteria | 120042 |
| 10 | JGI25163J39215_1002571 | 3300002771 | Bacteria | 1793 |
| 11 | JGI25164J39214_1000054 | 3300002772 | Bacteria | 120042 |
| 12 | JGI25159J45721_1003671 | 3300002987 | Bacteria | 5331 |
| 13 | JGI25159J45721_1012560 | 3300002987 | Bacteria | 2014 |
| 14 | JGI25165J46597_1000141 | 3300003214 | Bacteria | 120042 |
| 15 | rootH2_10042118 | 3300003320 | Bacteria | 6183 |
| 16 | rootL2_10000012 | 3300003322 | Bacteria | 81982 |
| 17 | rootL2_10011570 | 3300003322 | Bacteria | 7799 |
| 18 | rootL2_10014870 | 3300003322 | Bacteria | 12640 |
| 19 | rootH1_10011197 | 3300003323 | Bacteria | 4602 |
| 20 | JGI25160J50197_1001086 | 3300003354 | Bacteria | 13949 |
| 21 | JGI25161J50226_1000635 | 3300003374 | Bacteria | 14223 |
| 22 | JGI25161J50226_1002018 | 3300003374 | Bacteria | 5542 |
| 23 | Ga0007409J51694_1020847 | 3300003575 | Bacteria | 540 |
| 24 | Ga0055525_1000006 | 3300003759 | Bacteria | 642912 |
| 25 | Ga0055535_1000125 | 3300003761 | Bacteria | 81678 |
| 26 | Ga0055529_1000027 | 3300003763 | Bacteria | 292744 |
| 27 | Ga0055529_1000266 | 3300003763 | Bacteria | 62097 |
| 28 | Ga0055526_1000026 | 3300003771 | Bacteria | 154116 |
| 29 | Ga0055526_1001230 | 3300003771 | Bacteria | 18427 |
| 30 | Ga0055526_1001493 | 3300003771 | Bacteria | 16559 |
| 31 | Ga0055526_1001929 | 3300003771 | Bacteria | 14341 |
| 32 | Ga0055537_1000040 | 3300003773 | Bacteria | 92014 |
| 33 | Ga0055537_1018304 | 3300003773 | Bacteria | 1123 |
| 34 | Ga0055524_1000022 | 3300003775 | Bacteria | 224103 |
| 35 | Ga0055524_1008037 | 3300003775 | Bacteria | 4418 |
| 36 | Ga0055536_1000239 | 3300003781 | Bacteria | 44007 |
| 37 | Ga0055534_1000315 | 3300003784 | Bacteria | 32280 |
| 38 | Ga0055534_1000721 | 3300003784 | Bacteria | 16013 |
| 39 | Ga0055528_1000031 | 3300003790 | Bacteria | 120960 |
| 40 | Ga0055528_1006806 | 3300003790 | Bacteria | 5138 |
| 41 | Ga0055530_10000289 | 3300003791 | Bacteria | 45948 |
| 42 | Ga0055530_10066717 | 3300003791 | Bacteria | 787 |
| 43 | Ga0055540_1000105 | 3300003792 | Bacteria | 93593 |
| 44 | Ga0055531_10000081 | 3300003794 | Bacteria | 103600 |
| 45 | Ga0055531_10004422 | 3300003794 | Bacteria | 8566 |
| 46 | Ga0055531_10017764 | 3300003794 | Bacteria | 2980 |
| 47 | Ga0055531_10029637 | 3300003794 | Bacteria | 1859 |
| 48 | Ga0055543_1000583 | 3300004625 | Bacteria | 20165 |
| 49 | Ga0065165_1001411 | 3300005262 | Bacteria | 26128 |
| 50 | Ga0065165_1001901 | 3300005262 | Bacteria | 20033 |
| 51 | Ga0065165_1027497 | 3300005262 | Bacteria | 1853 |
| 52 | Ga0065714_10000389 | 3300005288 | Bacteria | 5076 |
| 53 | Ga0065714_10002400 | 3300005288 | Bacteria | 22050 |
| 54 | Ga0065714_10005850 | 3300005288 | Bacteria | 5093 |
| 55 | Ga0065714_10008779 | 3300005288 | Bacteria | 3304 |
| 56 | Ga0065714_10023077 | 3300005288 | Bacteria | 1024 |
| 57 | Ga0065714_10026003 | 3300005288 | Bacteria | 1496 |
| 58 | Ga0065714_10067402 | 3300005288 | Bacteria | 5558 |
| 59 | Ga0065714_10079588 | 3300005288 | Bacteria | 2503 |
| 60 | Ga0065704_10140029 | 3300005289 | Bacteria | 1527 |
| 61 | Ga0065704_10289546 | 3300005289 | Bacteria | 906 |
| 62 | Ga0065704_10456255 | 3300005289 | Bacteria | 701 |
| 63 | Ga0065704_10519665 | 3300005289 | Bacteria | 654 |
| 64 | Ga0065712_10003377 | 3300005290 | Bacteria | 4239 |
| 65 | Ga0065715_10031490 | 3300005293 | Bacteria | 1268 |
| 66 | Ga0065707_10088786 | 3300005295 | Bacteria | 4550 |
| 67 | Ga0065707_10175196 | 3300005295 | Bacteria | 1456 |
| 68 | Ga0065707_10325404 | 3300005295 | Bacteria | 959 |
| 69 | Ga0070658_10021055 | 3300005327 | Bacteria | 5224 |
| 70 | Ga0070658_10197458 | 3300005327 | Bacteria | 1697 |
| 71 | Ga0070658_10275546 | 3300005327 | Bacteria | 1431 |
| 72 | Ga0070658_10853251 | 3300005327 | Bacteria | 791 |
| 73 | Ga0070676_10991683 | 3300005328 | Bacteria | 630 |
| 74 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 75 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 76 | Ga0070666_10016105 | 3300005335 | Bacteria | 4777 |
| 77 | Ga0070666_10229741 | 3300005335 | Bacteria | 1310 |
| 78 | Ga0070680_100030024 | 3300005336 | Bacteria | 4365 |
| 79 | Ga0070680_100213509 | 3300005336 | Bacteria | 1628 |
| 80 | Ga0070682_100011968 | 3300005337 | Bacteria | 4964 |
| 81 | Ga0070660_100020940 | 3300005339 | Bacteria | 4814 |
| 82 | Ga0070660_100150433 | 3300005339 | Bacteria | 1871 |
| 83 | Ga0070689_100172061 | 3300005340 | Bacteria | 1755 |
| 84 | Ga0070668_100000024 | 3300005347 | Bacteria | 94452 |
| 85 | Ga0070669_100000044 | 3300005353 | Bacteria | 121087 |
| 86 | Ga0070669_100001750 | 3300005353 | Bacteria | 15645 |
| 87 | Ga0070669_100324128 | 3300005353 | Bacteria | 1245 |
| 88 | Ga0070671_100000021 | 3300005355 | Bacteria | 127093 |
| 89 | Ga0070671_100000022 | 3300005355 | Bacteria | 124364 |
| 90 | Ga0070671_100203697 | 3300005355 | Bacteria | 1678 |
| 91 | Ga0070671_100287788 | 3300005355 | Bacteria | 1398 |
| 92 | Ga0070674_100351426 | 3300005356 | Bacteria | 1191 |
| 93 | Ga0070688_100012791 | 3300005365 | Bacteria | 4713 |
| 94 | Ga0070659_100004222 | 3300005366 | Bacteria | 10260 |
| 95 | Ga0070659_100028518 | 3300005366 | Bacteria | 4312 |
| 96 | Ga0070659_100034293 | 3300005366 | Bacteria | 3947 |
| 97 | Ga0070667_100000007 | 3300005367 | Bacteria | 292130 |
| 98 | Ga0070667_100000009 | 3300005367 | Bacteria | 281488 |
| 99 | Ga0070667_100004979 | 3300005367 | Bacteria | 11135 |
| 100 | Ga0070667_100009741 | 3300005367 | Bacteria | 7966 |
| 101 | Ga0070681_10057938 | 3300005458 | Bacteria | 3854 |
| 102 | Ga0070685_10000045 | 3300005466 | Bacteria | 74434 |
| 103 | Ga0070706_100055284 | 3300005467 | Bacteria | 3664 |
| 104 | Ga0070706_100619303 | 3300005467 | Bacteria | 1005 |
| 105 | Ga0070679_100065992 | 3300005530 | Bacteria | 3607 |
| 106 | Ga0070679_101489182 | 3300005530 | Bacteria | 624 |
| 107 | Ga0068853_100102412 | 3300005539 | Bacteria | 2533 |
| 108 | Ga0068853_100341341 | 3300005539 | Bacteria | 1392 |
| 109 | Ga0068853_100377817 | 3300005539 | Bacteria | 1323 |
| 110 | Ga0070672_100202644 | 3300005543 | Bacteria | 1660 |
| 111 | Ga0070665_100007779 | 3300005548 | Bacteria | 10888 |
| 112 | Ga0070665_100107308 | 3300005548 | Bacteria | 2794 |
| 113 | Ga0070665_100203290 | 3300005548 | Bacteria | 1981 |
| 114 | Ga0070665_101139794 | 3300005548 | Bacteria | 791 |
| 115 | Ga0068855_100033044 | 3300005563 | Bacteria | 6176 |
| 116 | Ga0068855_100055196 | 3300005563 | Bacteria | 4667 |
| 117 | Ga0068855_100060086 | 3300005563 | Bacteria | 4446 |
| 118 | Ga0068855_100473000 | 3300005563 | Bacteria | 1365 |
| 119 | Ga0068855_100505663 | 3300005563 | Bacteria | 1312 |
| 120 | Ga0068855_100886500 | 3300005563 | Bacteria | 943 |
| 121 | Ga0070664_100006272 | 3300005564 | Bacteria | 9595 |
| 122 | Ga0070664_100297269 | 3300005564 | Bacteria | 1458 |
| 123 | Ga0068857_100039222 | 3300005577 | Bacteria | 4195 |
| 124 | Ga0068857_100478505 | 3300005577 | Bacteria | 1167 |
| 125 | Ga0068854_100760140 | 3300005578 | Bacteria | 842 |
| 126 | Ga0068854_100773527 | 3300005578 | Bacteria | 835 |
| 127 | Ga0068854_101253762 | 3300005578 | Bacteria | 666 |
| 128 | Ga0070702_100504323 | 3300005615 | Bacteria | 889 |
| 129 | Ga0068852_100777286 | 3300005616 | Bacteria | 971 |
| 130 | Ga0068852_101287808 | 3300005616 | Bacteria | 752 |
| 131 | Ga0068859_100004323 | 3300005617 | Bacteria | 14490 |
| 132 | Ga0068859_100009996 | 3300005617 | Bacteria | 9568 |
| 133 | Ga0068859_100018303 | 3300005617 | Bacteria | 7043 |
| 134 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 135 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 136 | Ga0068864_100001183 | 3300005618 | Bacteria | 21722 |
| 137 | Ga0068864_100776642 | 3300005618 | Bacteria | 940 |
| 138 | Ga0068861_100001464 | 3300005719 | Bacteria | 14949 |
| 139 | Ga0068861_100005090 | 3300005719 | Bacteria | 8867 |
| 140 | Ga0068861_100019600 | 3300005719 | Bacteria | 4832 |
| 141 | Ga0068863_100027064 | 3300005841 | Bacteria | 5469 |
| 142 | Ga0068863_100203117 | 3300005841 | Bacteria | 1907 |
| 143 | Ga0068863_100207590 | 3300005841 | Bacteria | 1886 |
| 144 | Ga0068863_100571281 | 3300005841 | Bacteria | 1118 |
| 145 | Ga0068858_100001634 | 3300005842 | Bacteria | 22875 |
| 146 | Ga0068858_100772035 | 3300005842 | Bacteria | 937 |
| 147 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 148 | Ga0068860_100052866 | 3300005843 | Bacteria | 3863 |
| 149 | Ga0068860_100846413 | 3300005843 | Bacteria | 929 |
| 150 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 151 | Ga0068862_100000031 | 3300005844 | Bacteria | 180203 |
| 152 | Ga0068862_100003139 | 3300005844 | Bacteria | 14374 |
| 153 | Ga0075363_100200978 | 3300006048 | Bacteria | 1139 |
| 154 | Ga0075364_10160659 | 3300006051 | Bacteria | 1516 |
| 155 | Ga0075432_10030143 | 3300006058 | Bacteria | 1874 |
| 156 | Ga0075362_10012369 | 3300006177 | Bacteria | 3389 |
| 157 | Ga0075362_10196274 | 3300006177 | Bacteria | 981 |
| 158 | Ga0075370_10112812 | 3300006353 | Bacteria | 1579 |
| 159 | Ga0068871_100453475 | 3300006358 | Bacteria | 1150 |
| 160 | Ga0075430_100209527 | 3300006846 | Bacteria | 1617 |
| 161 | Ga0075430_100343339 | 3300006846 | Bacteria | 1233 |
| 162 | Ga0075429_100004191 | 3300006880 | Bacteria | 12349 |
| 163 | Ga0075436_100017850 | 3300006914 | Bacteria | 4858 |
| 164 | Ga0075436_100160070 | 3300006914 | Bacteria | 1587 |
| 165 | Ga0097620_100004323 | 3300006931 | Bacteria | 14490 |
| 166 | Ga0097620_100009996 | 3300006931 | Bacteria | 9568 |
| 167 | Ga0097620_100018303 | 3300006931 | Bacteria | 7043 |
| 168 | Ga0079104_1000124 | 3300006946 | Bacteria | 110752 |
| 169 | Ga0099826_10000006 | 3300006948 | Bacteria | 432260 |
| 170 | Ga0105251_10017336 | 3300009011 | Bacteria | 3862 |
| 171 | Ga0105251_10018324 | 3300009011 | Bacteria | 3725 |
| 172 | Ga0105251_10052956 | 3300009011 | Bacteria | 1931 |
| 173 | Ga0105244_10037127 | 3300009036 | Bacteria | 2549 |
| 174 | Ga0105244_10038332 | 3300009036 | Bacteria | 2500 |
| 175 | Ga0105244_10122195 | 3300009036 | Bacteria | 1260 |
| 176 | Ga0105244_10128522 | 3300009036 | Bacteria | 1223 |
| 177 | Ga0105244_10135946 | 3300009036 | Bacteria | 1184 |
| 178 | Ga0105244_10397273 | 3300009036 | Bacteria | 634 |
| 179 | Ga0105250_10010197 | 3300009092 | Bacteria | 3921 |
| 180 | Ga0105250_10046527 | 3300009092 | Bacteria | 1740 |
| 181 | Ga0105250_10074668 | 3300009092 | Bacteria | 1371 |
| 182 | Ga0105250_10104162 | 3300009092 | Bacteria | 1159 |
| 183 | Ga0105250_10217304 | 3300009092 | Bacteria | 810 |
| 184 | Ga0105240_10005944 | 3300009093 | Bacteria | 18065 |
| 185 | Ga0105240_10129159 | 3300009093 | Bacteria | 3033 |
| 186 | Ga0111539_10017877 | 3300009094 | Bacteria | 8781 |
| 187 | Ga0105245_11278290 | 3300009098 | Bacteria | 782 |
| 188 | Ga0105247_10011895 | 3300009101 | Bacteria | 5231 |
| 189 | Ga0105247_10144347 | 3300009101 | Bacteria | 1563 |
| 190 | Ga0105243_10000103 | 3300009148 | Bacteria | 97091 |
| 191 | Ga0105243_10000405 | 3300009148 | Bacteria | 45268 |
| 192 | Ga0105243_10031470 | 3300009148 | Bacteria | 4091 |
| 193 | Ga0105243_10073320 | 3300009148 | Bacteria | 2774 |
| 194 | Ga0105243_10099353 | 3300009148 | Bacteria | 2412 |
| 195 | Ga0105241_10009599 | 3300009174 | Bacteria | 7114 |
| 196 | Ga0105241_10675699 | 3300009174 | Bacteria | 940 |
| 197 | Ga0105241_10910051 | 3300009174 | Bacteria | 817 |
| 198 | Ga0105242_10005643 | 3300009176 | Bacteria | 9661 |
| 199 | Ga0105242_10302456 | 3300009176 | Bacteria | 1460 |
| 200 | Ga0105248_10000287 | 3300009177 | Bacteria | 59537 |
| 201 | Ga0105248_10209731 | 3300009177 | Bacteria | 2195 |
| 202 | Ga0105248_10493043 | 3300009177 | Bacteria | 1381 |
| 203 | Ga0105248_10691642 | 3300009177 | Bacteria | 1150 |
| 204 | Ga0105248_10948822 | 3300009177 | Bacteria | 971 |
| 205 | Ga0105237_10078325 | 3300009545 | Bacteria | 3295 |
| 206 | Ga0105237_10135253 | 3300009545 | Bacteria | 2459 |
| 207 | Ga0105237_10680398 | 3300009545 | Bacteria | 1036 |
| 208 | Ga0105238_10018481 | 3300009551 | Bacteria | 7093 |
| 209 | Ga0105238_10285121 | 3300009551 | Bacteria | 1633 |
| 210 | Ga0105238_10317161 | 3300009551 | Bacteria | 1544 |
| 211 | Ga0105249_10278950 | 3300009553 | Bacteria | 1668 |
| 212 | Ga0105249_10758855 | 3300009553 | Bacteria | 1032 |
| 213 | Ga0105239_10397996 | 3300010375 | Bacteria | 1558 |
| 214 | Ga0105239_11722376 | 3300010375 | Bacteria | 726 |
| 215 | Ga0105246_10000120 | 3300011119 | Bacteria | 35764 |
| 216 | Ga0105246_10098461 | 3300011119 | Bacteria | 2124 |
| 217 | Ga0157336_1000705 | 3300012477 | Bacteria | 1573 |
| 218 | Ga0157319_1000002 | 3300012497 | Bacteria | 410803 |
| 219 | Ga0157345_1000026 | 3300012498 | Bacteria | 37334 |
| 220 | Ga0157345_1001725 | 3300012498 | Bacteria | 1527 |
| 221 | Ga0157326_1000736 | 3300012513 | Bacteria | 3838 |
| 222 | Ga0157373_10020155 | 3300013100 | Bacteria | 4850 |
| 223 | Ga0157373_10607360 | 3300013100 | Bacteria | 797 |
| 224 | Ga0157373_10828189 | 3300013100 | Bacteria | 683 |
| 225 | Ga0157371_10000306 | 3300013102 | Bacteria | 64149 |
| 226 | Ga0157371_10000390 | 3300013102 | Bacteria | 55089 |
| 227 | Ga0157370_10007188 | 3300013104 | Bacteria | 12151 |
| 228 | Ga0157370_10314896 | 3300013104 | Bacteria | 1444 |
| 229 | Ga0157370_11078259 | 3300013104 | Bacteria | 726 |
| 230 | Ga0157370_11457266 | 3300013104 | Bacteria | 616 |
| 231 | Ga0157370_11626435 | 3300013104 | Bacteria | 580 |
| 232 | Ga0157369_10059341 | 3300013105 | Bacteria | 4125 |
| 233 | Ga0157369_10620265 | 3300013105 | Bacteria | 1116 |
| 234 | Ga0157369_10642728 | 3300013105 | Bacteria | 1094 |
| 235 | Ga0157369_10664827 | 3300013105 | Bacteria | 1074 |
| 236 | Ga0157369_11830509 | 3300013105 | Bacteria | 616 |
| 237 | Ga0157374_12457235 | 3300013296 | Bacteria | 548 |
| 238 | Ga0163162_10000072 | 3300013306 | Bacteria | 92818 |
| 239 | Ga0163162_10062385 | 3300013306 | Bacteria | 3767 |
| 240 | Ga0163162_10149464 | 3300013306 | Bacteria | 2453 |
| 241 | Ga0163162_10420529 | 3300013306 | Bacteria | 1469 |
| 242 | Ga0163162_10923522 | 3300013306 | Bacteria | 985 |
| 243 | Ga0163162_11560880 | 3300013306 | Bacteria | 753 |
| 244 | Ga0157375_10682091 | 3300013308 | Bacteria | 1182 |
| 245 | Ga0157375_11095634 | 3300013308 | Bacteria | 932 |
| 246 | Ga0157375_11871629 | 3300013308 | Bacteria | 712 |
| 247 | Ga0163163_10015793 | 3300014325 | Bacteria | 6993 |
| 248 | Ga0157380_10000755 | 3300014326 | Bacteria | 20159 |
| 249 | Ga0182008_10000074 | 3300014497 | Bacteria | 78116 |
| 250 | Ga0182008_10001641 | 3300014497 | Bacteria | 14788 |
| 251 | Ga0182008_10022635 | 3300014497 | Bacteria | 3218 |
| 252 | Ga0182008_10086187 | 3300014497 | Bacteria | 1546 |
| 253 | Ga0182008_10125378 | 3300014497 | Bacteria | 1278 |
| 254 | Ga0182008_10165707 | 3300014497 | Bacteria | 1114 |
| 255 | Ga0157379_10000004 | 3300014968 | Bacteria | 173351 |
| 256 | Ga0157379_10172034 | 3300014968 | Bacteria | 1955 |
| 257 | Ga0157379_10278871 | 3300014968 | Bacteria | 1521 |
| 258 | Ga0157379_10791007 | 3300014968 | Bacteria | 895 |
| 259 | Ga0157376_10935445 | 3300014969 | Bacteria | 886 |
| 260 | Ga0157376_11490178 | 3300014969 | Bacteria | 709 |
| 261 | Ga0182006_1000541 | 3300015261 | Bacteria | 28690 |
| 262 | Ga0182006_1005789 | 3300015261 | Bacteria | 5826 |
| 263 | Ga0182006_1014845 | 3300015261 | Bacteria | 3351 |
| 264 | Ga0182006_1073447 | 3300015261 | Bacteria | 1262 |
| 265 | Ga0182005_1000322 | 3300015265 | Bacteria | 28505 |
| 266 | Ga0182005_1006967 | 3300015265 | Bacteria | 3418 |
| 267 | Ga0182005_1014740 | 3300015265 | Bacteria | 2185 |
| 268 | Ga0182005_1199075 | 3300015265 | Bacteria | 602 |
| 269 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 270 | Ga0163161_10002829 | 3300017792 | Bacteria | 12311 |
| 271 | Ga0163161_10010736 | 3300017792 | Bacteria | 6345 |
| 272 | Ga0163161_10191969 | 3300017792 | Bacteria | 1571 |
| 273 | Ga0163161_10367156 | 3300017792 | Bacteria | 1148 |
| 274 | Ga0163161_10549660 | 3300017792 | Bacteria | 946 |
| 275 | Ga0163161_11388787 | 3300017792 | Bacteria | 613 |
| 276 | Ga0213872_10040129 | 3300021361 | Bacteria | 2137 |
| 277 | Ga0209760_100634 | 3300025207 | Bacteria | 5896 |
| 278 | Ga0209436_100125 | 3300025208 | Bacteria | 37810 |
| 279 | Ga0209436_100539 | 3300025208 | Bacteria | 16421 |
| 280 | Ga0209672_104200 | 3300025228 | Bacteria | 2736 |
| 281 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 282 | Ga0207427_100074 | 3300025231 | Bacteria | 153455 |
| 283 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 284 | Ga0209258_100071 | 3300025242 | Bacteria | 278319 |
| 285 | Ga0207425_1000517 | 3300025245 | Bacteria | 23589 |
| 286 | Ga0209148_1000650 | 3300025254 | Bacteria | 30019 |
| 287 | Ga0209148_1005652 | 3300025254 | Bacteria | 2828 |
| 288 | Ga0209759_1004340 | 3300025256 | Bacteria | 5327 |
| 289 | Ga0209759_1007277 | 3300025256 | Bacteria | 3583 |
| 290 | Ga0209129_1008048 | 3300025258 | Bacteria | 3001 |
| 291 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 292 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 293 | Ga0209565_1000205 | 3300025263 | Bacteria | 69314 |
| 294 | Ga0209565_1000806 | 3300025263 | Bacteria | 17938 |
| 295 | Ga0209565_1001799 | 3300025263 | Bacteria | 8646 |
| 296 | Ga0209565_1002557 | 3300025263 | Bacteria | 6464 |
| 297 | Ga0209565_1006496 | 3300025263 | Bacteria | 3271 |
| 298 | Ga0209455_1000030 | 3300025272 | Bacteria | 533479 |
| 299 | Ga0209455_1000033 | 3300025272 | Bacteria | 504606 |
| 300 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 301 | Ga0209130_1001037 | 3300025284 | Bacteria | 21228 |
| 302 | Ga0209130_1005649 | 3300025284 | Bacteria | 4279 |
| 303 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 304 | Ga0209675_1000619 | 3300025291 | Bacteria | 25376 |
| 305 | Ga0209675_1001166 | 3300025291 | Bacteria | 15960 |
| 306 | Ga0209675_1017207 | 3300025291 | Bacteria | 2071 |
| 307 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 308 | Ga0209676_1007925 | 3300025292 | Bacteria | 4859 |
| 309 | Ga0209564_1000028 | 3300025295 | Bacteria | 510986 |
| 310 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 311 | Ga0209564_1000088 | 3300025295 | Bacteria | 250268 |
| 312 | Ga0209564_1001146 | 3300025295 | Bacteria | 31046 |
| 313 | Ga0209564_1039876 | 3300025295 | Bacteria | 1284 |
| 314 | Ga0209050_1000078 | 3300025298 | Bacteria | 278409 |
| 315 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 316 | Ga0209050_1000363 | 3300025298 | Bacteria | 86923 |
| 317 | Ga0209050_1001071 | 3300025298 | Bacteria | 33572 |
| 318 | Ga0209050_1002993 | 3300025298 | Bacteria | 13139 |
| 319 | Ga0209050_1003567 | 3300025298 | Bacteria | 11323 |
| 320 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 321 | Ga0209256_1000141 | 3300025299 | Bacteria | 152280 |
| 322 | Ga0209256_1000881 | 3300025299 | Bacteria | 37099 |
| 323 | Ga0209256_1005238 | 3300025299 | Bacteria | 7590 |
| 324 | Ga0207426_1002420 | 3300025302 | Bacteria | 11966 |
| 325 | Ga0209051_1000185 | 3300025303 | Bacteria | 110195 |
| 326 | Ga0209051_1004165 | 3300025303 | Bacteria | 9039 |
| 327 | Ga0209051_1021803 | 3300025303 | Bacteria | 2714 |
| 328 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 329 | Ga0209257_1000097 | 3300025304 | Bacteria | 259243 |
| 330 | Ga0209257_1000827 | 3300025304 | Bacteria | 44761 |
| 331 | Ga0209257_1001135 | 3300025304 | Bacteria | 34110 |
| 332 | Ga0207696_1000198 | 3300025711 | Bacteria | 92750 |
| 333 | Ga0207696_1001551 | 3300025711 | Bacteria | 12276 |
| 334 | Ga0207696_1001818 | 3300025711 | Bacteria | 10985 |
| 335 | Ga0207696_1020214 | 3300025711 | Bacteria | 2152 |
| 336 | Ga0207696_1084367 | 3300025711 | Bacteria | 875 |
| 337 | Ga0207696_1122563 | 3300025711 | Bacteria | 700 |
| 338 | Ga0207655_1000505 | 3300025728 | Bacteria | 49919 |
| 339 | Ga0207655_1018354 | 3300025728 | Bacteria | 3715 |
| 340 | Ga0207655_1024723 | 3300025728 | Bacteria | 2935 |
| 341 | Ga0207655_1029455 | 3300025728 | Bacteria | 2570 |
| 342 | Ga0207655_1034195 | 3300025728 | Bacteria | 2288 |
| 343 | Ga0207655_1054186 | 3300025728 | Bacteria | 1597 |
| 344 | Ga0207655_1066996 | 3300025728 | Bacteria | 1354 |
| 345 | Ga0207713_1000236 | 3300025735 | Bacteria | 73781 |
| 346 | Ga0207713_1000431 | 3300025735 | Bacteria | 44260 |
| 347 | Ga0207713_1002985 | 3300025735 | Bacteria | 11827 |
| 348 | Ga0207713_1004782 | 3300025735 | Bacteria | 8706 |
| 349 | Ga0207713_1020123 | 3300025735 | Bacteria | 3244 |
| 350 | Ga0207710_10134701 | 3300025900 | Bacteria | 1188 |
| 351 | Ga0207710_10302873 | 3300025900 | Bacteria | 808 |
| 352 | Ga0207680_10006656 | 3300025903 | Bacteria | 5606 |
| 353 | Ga0207680_10212894 | 3300025903 | Bacteria | 1322 |
| 354 | Ga0207645_10678672 | 3300025907 | Bacteria | 700 |
| 355 | Ga0207705_10012900 | 3300025909 | Bacteria | 6032 |
| 356 | Ga0207705_10094828 | 3300025909 | Bacteria | 2189 |
| 357 | Ga0207705_10099155 | 3300025909 | Bacteria | 2142 |
| 358 | Ga0207705_10367513 | 3300025909 | Bacteria | 1110 |
| 359 | Ga0207684_10329325 | 3300025910 | Bacteria | 1316 |
| 360 | Ga0207654_10001978 | 3300025911 | Bacteria | 10588 |
| 361 | Ga0207695_11119213 | 3300025913 | Bacteria | 667 |
| 362 | Ga0207660_10180780 | 3300025917 | Bacteria | 1638 |
| 363 | Ga0207657_10004584 | 3300025919 | Bacteria | 14601 |
| 364 | Ga0207657_10032291 | 3300025919 | Bacteria | 4732 |
| 365 | Ga0207649_10008924 | 3300025920 | Bacteria | 5474 |
| 366 | Ga0207681_10000041 | 3300025923 | Bacteria | 140201 |
| 367 | Ga0207681_10012062 | 3300025923 | Bacteria | 5324 |
| 368 | Ga0207681_10172296 | 3300025923 | Bacteria | 1641 |
| 369 | Ga0207694_10202623 | 3300025924 | Bacteria | 1615 |
| 370 | Ga0207694_10312050 | 3300025924 | Bacteria | 1296 |
| 371 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 372 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 373 | Ga0207650_10008367 | 3300025925 | Bacteria | 7062 |
| 374 | Ga0207687_10901955 | 3300025927 | Bacteria | 756 |
| 375 | Ga0207687_11527976 | 3300025927 | Bacteria | 573 |
| 376 | Ga0207644_10000037 | 3300025931 | Bacteria | 124306 |
| 377 | Ga0207644_10000054 | 3300025931 | Bacteria | 86116 |
| 378 | Ga0207690_10267705 | 3300025932 | Bacteria | 1326 |
| 379 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 380 | Ga0207709_10000283 | 3300025935 | Bacteria | 57947 |
| 381 | Ga0207709_10014214 | 3300025935 | Bacteria | 4394 |
| 382 | Ga0207709_10067294 | 3300025935 | Bacteria | 2260 |
| 383 | Ga0207709_10827826 | 3300025935 | Bacteria | 749 |
| 384 | Ga0207691_10129092 | 3300025940 | Bacteria | 2234 |
| 385 | Ga0207711_10000480 | 3300025941 | Bacteria | 41229 |
| 386 | Ga0207711_10003358 | 3300025941 | Bacteria | 13863 |
| 387 | Ga0207711_10464923 | 3300025941 | Bacteria | 1178 |
| 388 | Ga0207661_11291360 | 3300025944 | Bacteria | 671 |
| 389 | Ga0207679_10119252 | 3300025945 | Bacteria | 2097 |
| 390 | Ga0207679_10326592 | 3300025945 | Bacteria | 1330 |
| 391 | Ga0207667_10168374 | 3300025949 | Bacteria | 2252 |
| 392 | Ga0207667_10576915 | 3300025949 | Bacteria | 1136 |
| 393 | Ga0207712_10092928 | 3300025961 | Bacteria | 2225 |
| 394 | Ga0207712_10172126 | 3300025961 | Bacteria | 1693 |
| 395 | Ga0207668_10000031 | 3300025972 | Bacteria | 122168 |
| 396 | Ga0207668_10051367 | 3300025972 | Bacteria | 2847 |
| 397 | Ga0207640_10179862 | 3300025981 | Bacteria | 1585 |
| 398 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 399 | Ga0207658_10000009 | 3300025986 | Bacteria | 264118 |
| 400 | Ga0207658_10000381 | 3300025986 | Bacteria | 43297 |
| 401 | Ga0207703_10001276 | 3300026035 | Bacteria | 23365 |
| 402 | Ga0207703_10027314 | 3300026035 | Bacteria | 4494 |
| 403 | Ga0207703_10548923 | 3300026035 | Bacteria | 1089 |
| 404 | Ga0207639_10797900 | 3300026041 | Bacteria | 880 |
| 405 | Ga0207678_11598169 | 3300026067 | Bacteria | 574 |
| 406 | Ga0207641_10002913 | 3300026088 | Bacteria | 15493 |
| 407 | Ga0207641_10004628 | 3300026088 | Bacteria | 11883 |
| 408 | Ga0207641_10027763 | 3300026088 | Bacteria | 4675 |
| 409 | Ga0207641_10114688 | 3300026088 | Bacteria | 2394 |
| 410 | Ga0207641_10136732 | 3300026088 | Bacteria | 2206 |
| 411 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 412 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 413 | Ga0207676_10001065 | 3300026095 | Bacteria | 20883 |
| 414 | Ga0207676_11682203 | 3300026095 | Bacteria | 633 |
| 415 | Ga0207674_10042101 | 3300026116 | Bacteria | 4720 |
| 416 | Ga0207675_100000309 | 3300026118 | Bacteria | 46765 |
| 417 | Ga0207675_100009819 | 3300026118 | Bacteria | 8960 |
| 418 | Ga0207675_100012694 | 3300026118 | Bacteria | 7873 |
| 419 | Ga0207698_10098775 | 3300026142 | Bacteria | 2413 |
| 420 | Ga0207698_10573405 | 3300026142 | Bacteria | 1109 |
| 421 | Ga0207698_11016656 | 3300026142 | Bacteria | 840 |
| 422 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 423 | Ga0209371_1023215 | 3300027312 | Bacteria | 1464 |
| 424 | Ga0209983_1004669 | 3300027665 | Bacteria | 2869 |
| 425 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 426 | Ga0209971_1117345 | 3300027682 | Bacteria | 654 |
| 427 | Ga0209974_10086143 | 3300027876 | Bacteria | 1086 |
| 428 | Ga0207428_10007690 | 3300027907 | Bacteria | 9809 |
| 429 | Ga0207428_10078446 | 3300027907 | Bacteria | 2584 |
| 430 | Ga0207428_10088731 | 3300027907 | Bacteria | 2405 |
| 431 | Ga0207428_10133642 | 3300027907 | Bacteria | 1898 |
| 432 | Ga0207428_10220000 | 3300027907 | Bacteria | 1424 |
| 433 | Ga0268266_10008246 | 3300028379 | Bacteria | 9285 |
| 434 | Ga0268266_10085365 | 3300028379 | Bacteria | 2758 |
| 435 | Ga0268266_10454785 | 3300028379 | Bacteria | 1217 |
| 436 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 437 | Ga0268265_10000748 | 3300028380 | Bacteria | 31601 |
| 438 | Ga0268265_10005078 | 3300028380 | Bacteria | 9027 |
| 439 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 440 | Ga0268264_10000016 | 3300028381 | Bacteria | 502537 |
| 441 | Ga0268264_10765337 | 3300028381 | Bacteria | 963 |
| 442 | Ga0265326_10030208 | 3300028558 | Bacteria | 1543 |
| 443 | Ga0265319_1020444 | 3300028563 | Bacteria | 2453 |
| 444 | Ga0265334_10008838 | 3300028573 | Bacteria | 4278 |
| 445 | Ga0265318_10000875 | 3300028577 | Bacteria | 19662 |
| 446 | Ga0265338_10018652 | 3300028800 | Bacteria | 7414 |
| 447 | Ga0265338_10169791 | 3300028800 | Bacteria | 1674 |
| 448 | Ga0265324_10089934 | 3300029957 | Bacteria | 1044 |
| 449 | Ga0268256_1026304 | 3300030500 | Bacteria | 1464 |
| 450 | Ga0307511_10000452 | 3300030521 | Bacteria | 44212 |
| 451 | Ga0307511_10088789 | 3300030521 | Bacteria | 2111 |
| 452 | Ga0265330_10020416 | 3300031235 | Bacteria | 3026 |
| 453 | Ga0265332_10151075 | 3300031238 | Bacteria | 971 |
| 454 | Ga0265328_10032777 | 3300031239 | Bacteria | 1927 |
| 455 | Ga0265320_10006928 | 3300031240 | Bacteria | 7076 |
| 456 | Ga0265325_10140235 | 3300031241 | Bacteria | 1150 |
| 457 | Ga0265329_10057521 | 3300031242 | Bacteria | 1232 |
| 458 | Ga0265339_10212330 | 3300031249 | Bacteria | 950 |
| 459 | Ga0265331_10036074 | 3300031250 | Bacteria | 2430 |
| 460 | Ga0265327_10000407 | 3300031251 | Bacteria | 79425 |
| 461 | Ga0265316_10017255 | 3300031344 | Bacteria | 6245 |
| 462 | Ga0307509_10000079 | 3300031507 | Bacteria | 135772 |
| 463 | Ga0307408_100000125 | 3300031548 | Bacteria | 84749 |
| 464 | Ga0307408_100001980 | 3300031548 | Bacteria | 14784 |
| 465 | Ga0307408_100025379 | 3300031548 | Bacteria | 4059 |
| 466 | Ga0307408_100025714 | 3300031548 | Bacteria | 4034 |
| 467 | Ga0307408_100026373 | 3300031548 | Bacteria | 3991 |
| 468 | Ga0307408_100048588 | 3300031548 | Bacteria | 3044 |
| 469 | Ga0307408_100053575 | 3300031548 | Bacteria | 2914 |
| 470 | Ga0307408_100142539 | 3300031548 | Bacteria | 1882 |
| 471 | Ga0307408_100445715 | 3300031548 | Bacteria | 1122 |
| 472 | Ga0307408_101482769 | 3300031548 | Bacteria | 641 |
| 473 | Ga0265313_10020636 | 3300031595 | Bacteria | 3629 |
| 474 | Ga0307508_10080812 | 3300031616 | Bacteria | 2832 |
| 475 | Ga0265314_10023783 | 3300031711 | Bacteria | 4662 |
| 476 | Ga0265314_10030574 | 3300031711 | Bacteria | 3984 |
| 477 | Ga0265342_10017130 | 3300031712 | Bacteria | 4718 |
| 478 | Ga0307516_10000033 | 3300031730 | Bacteria | 155697 |
| 479 | Ga0307518_10027884 | 3300031838 | Bacteria | 4075 |
| 480 | Ga0307406_10403734 | 3300031901 | Bacteria | 1084 |
| 481 | Ga0307407_10282715 | 3300031903 | Bacteria | 1150 |
| 482 | Ga0307407_10609336 | 3300031903 | Bacteria | 814 |
| 483 | Ga0307412_10000494 | 3300031911 | Bacteria | 23538 |
| 484 | Ga0307412_10321339 | 3300031911 | Bacteria | 1231 |
| 485 | Ga0307412_10331787 | 3300031911 | Bacteria | 1214 |
| 486 | Ga0307409_100270412 | 3300031995 | Bacteria | 1565 |
| 487 | Ga0307416_100299290 | 3300032002 | Bacteria | 1598 |
| 488 | Ga0307416_101156589 | 3300032002 | Bacteria | 879 |
| 489 | Ga0307414_10012007 | 3300032004 | Bacteria | 5106 |
| 490 | Ga0307414_10638339 | 3300032004 | Bacteria | 959 |
| 491 | Ga0307411_10266404 | 3300032005 | Bacteria | 1356 |
| 492 | Ga0307411_10404057 | 3300032005 | Bacteria | 1130 |
| 493 | Ga0307415_100491065 | 3300032126 | Bacteria | 1071 |
| 494 | Ga0307510_10001867 | 3300033180 | Bacteria | 23626 |
| 495 | Ga0395899_0006030 | 3300037312 | Bacteria | 9409 |
| 496 | Ga0395899_0013681 | 3300037312 | Bacteria | 6203 |
| 497 | Ga0395899_0030728 | 3300037312 | Bacteria | 4038 |
| 498 | Ga0395899_0131420 | 3300037312 | Bacteria | 1787 |
| 499 | Ga0395899_0268885 | 3300037312 | Bacteria | 1163 |
| 500 | Ga0395899_0375700 | 3300037312 | Bacteria | 945 |
| 501 | Ga0395900_0000992 | 3300037418 | Bacteria | 36889 |
| 502 | Ga0395900_0002266 | 3300037418 | Bacteria | 21375 |
| 503 | Ga0395900_0002848 | 3300037418 | Bacteria | 18873 |
| 504 | Ga0395900_0024512 | 3300037418 | Bacteria | 6178 |
| 505 | Ga0395900_0028549 | 3300037418 | Bacteria | 5716 |
| 506 | Ga0395900_0049730 | 3300037418 | Bacteria | 4319 |
| 507 | Ga0395900_0162231 | 3300037418 | Bacteria | 2279 |
| 508 | Ga0395900_0304277 | 3300037418 | Bacteria | 1579 |
| 509 | Ga0395900_0455141 | 3300037418 | Bacteria | 1235 |
| 510 | Ga0395898_0025838 | 3300037466 | Bacteria | 5912 |
| 511 | Ga0395898_0126191 | 3300037466 | Bacteria | 2451 |
| 512 | Ga0395898_0141935 | 3300037466 | Bacteria | 2299 |
| 513 | Ga0395898_0147155 | 3300037466 | Bacteria | 2254 |
| 514 | Ga0395898_0365455 | 3300037466 | Bacteria | 1376 |
| 515 | Ga0395898_0370114 | 3300037466 | Bacteria | 1366 |
| 516 | Ga0395898_0373139 | 3300037466 | Bacteria | 1360 |
| 517 | Ga0395898_0486151 | 3300037466 | Bacteria | 1174 |
| 518 | Ga0395898_0489257 | 3300037466 | Bacteria | 1170 |
| 519 | Ga0395898_0521572 | 3300037466 | Bacteria | 1129 |
| 520 | Ga0395905_0021824 | 3300037471 | Bacteria | 6056 |
| 521 | Ga0395905_0177617 | 3300037471 | Bacteria | 1998 |
| 522 | Ga0395905_0462420 | 3300037471 | Bacteria | 1167 |
| 523 | Ga0395901_0000103 | 3300038443 | Bacteria | 115060 |
| 524 | Ga0395901_0002810 | 3300038443 | Bacteria | 17579 |
| 525 | Ga0395901_0179648 | 3300038443 | Bacteria | 2219 |
| 526 | Ga0395901_0660791 | 3300038443 | Bacteria | 1047 |
| 527 | Ga0395901_0770512 | 3300038443 | Bacteria | 953 |
| 528 | Ga0395901_1019276 | 3300038443 | Bacteria | 802 |
| 529 | Ga0237819_04939 | 3300038705 | Bacteria | 2138 |
| 530 | Ga0436361_0258724 | 3300039447 | Bacteria | 6063 |
| 531 | Ga0436361_0496938 | 3300039447 | Bacteria | 1065 |
| 532 | Ga0436363_1668220 | 3300039450 | Bacteria | 776 |
| 533 | Ga0439436_0000014 | 3300041404 | Bacteria | 90241 |
| 534 | Ga0439438_000363 | 3300041405 | Bacteria | 20308 |
| 535 | Ga0439438_004231 | 3300041405 | Bacteria | 5576 |
| 536 | Ga0439438_016708 | 3300041405 | Bacteria | 2130 |
| 537 | Ga0439438_022331 | 3300041405 | Bacteria | 1755 |
| 538 | Ga0439438_056604 | 3300041405 | Bacteria | 987 |
| 539 | Ga0439447_001403 | 3300041407 | Bacteria | 8831 |
| 540 | Ga0439447_002343 | 3300041407 | Bacteria | 6924 |
| 541 | Ga0439447_006880 | 3300041407 | Bacteria | 3651 |
| 542 | Ga0439466_0000767 | 3300041411 | Bacteria | 12149 |
| 543 | Ga0439466_0005120 | 3300041411 | Bacteria | 5026 |
| 544 | Ga0439466_0019911 | 3300041411 | Bacteria | 2397 |
| 545 | Ga0439466_0033724 | 3300041411 | Bacteria | 1738 |
| 546 | Ga0451795_0246213 | 3300041456 | Bacteria | 645 |
| 547 | Ga0451800_1513713 | 3300041459 | Bacteria | 1577 |
| 548 | Ga0451833_1376099 | 3300041491 | Bacteria | 1915 |
| 549 | Ga0451839_1486879 | 3300041496 | Bacteria | 1067 |
| 550 | Ga0451843_0957511 | 3300041509 | Bacteria | 1101 |
| 551 | Ga0439433_0022531 | 3300041999 | Bacteria | 1414 |
| 552 | Ga0439437_031554 | 3300042000 | Bacteria | 667 |
| 553 | Ga0439448_0002067 | 3300042005 | Bacteria | 5387 |
| 554 | Ga0439432_000089 | 3300042006 | Bacteria | 28832 |
| 555 | Ga0439432_005254 | 3300042006 | Bacteria | 4674 |
| 556 | Ga0439432_008913 | 3300042006 | Bacteria | 3506 |
| 557 | Ga0439432_009027 | 3300042006 | Bacteria | 3484 |
| 558 | Ga0439450_081225 | 3300042008 | Bacteria | 806 |
| 559 | Ga0439451_000403 | 3300042009 | Bacteria | 8429 |
| 560 | Ga0439451_012152 | 3300042009 | Bacteria | 1736 |
| 561 | Ga0439451_014769 | 3300042009 | Bacteria | 1575 |
| 562 | Ga0439451_019813 | 3300042009 | Bacteria | 1355 |
| 563 | Ga0439451_037443 | 3300042009 | Bacteria | 974 |
| 564 | Ga0439452_000091 | 3300042010 | Bacteria | 78007 |
| 565 | Ga0439452_001363 | 3300042010 | Bacteria | 10138 |
| 566 | Ga0439452_006059 | 3300042010 | Bacteria | 3823 |
| 567 | Ga0439452_024504 | 3300042010 | Bacteria | 1541 |
| 568 | Ga0439452_092459 | 3300042010 | Bacteria | 653 |
| 569 | Ga0439455_0017104 | 3300042012 | Bacteria | 1685 |
| 570 | Ga0439456_006684 | 3300042013 | Bacteria | 2359 |
| 571 | Ga0439456_007483 | 3300042013 | Bacteria | 2243 |
| 572 | Ga0439456_103421 | 3300042013 | Bacteria | 645 |
| 573 | Ga0439457_014363 | 3300042014 | Bacteria | 1773 |
| 574 | Ga0439463_037676 | 3300042016 | Bacteria | 1226 |
| 575 | Ga0450911_000083 | 3300042115 | Bacteria | 37916 |
| 576 | Ga0450911_001316 | 3300042115 | Bacteria | 5861 |
| 577 | Ga0450915_005280 | 3300042119 | Bacteria | 792 |
| 578 | Ga0450920_007155 | 3300042122 | Bacteria | 2017 |
| 579 | Ga0450922_000035 | 3300042124 | Bacteria | 11958 |
| 580 | Ga0450922_003196 | 3300042124 | Bacteria | 1511 |
| 581 | Ga0450922_021394 | 3300042124 | Bacteria | 669 |
| 582 | Ga0450890_000146 | 3300042127 | Bacteria | 11047 |
| 583 | Ga0450890_003694 | 3300042127 | Bacteria | 2024 |
| 584 | Ga0450895_001837 | 3300042132 | Bacteria | 1527 |
| 585 | Ga0450899_006066 | 3300042135 | Bacteria | 1305 |
| 586 | Ga0450902_004905 | 3300042137 | Bacteria | 2004 |
| 587 | Ga0450902_018112 | 3300042137 | Bacteria | 1153 |
| 588 | Ga0450902_045647 | 3300042137 | Bacteria | 749 |
| 589 | Ga0450903_013689 | 3300042138 | Bacteria | 1289 |
| 590 | Ga0450903_039479 | 3300042138 | Bacteria | 700 |
| 591 | Ga0450904_000019 | 3300042139 | Bacteria | 39540 |
| 592 | Ga0450905_002439 | 3300042142 | Bacteria | 2388 |
| 593 | Ga0450906_000234 | 3300042145 | Bacteria | 10619 |
| 594 | Ga0450906_006567 | 3300042145 | Bacteria | 2340 |
| 595 | Ga0450907_000005 | 3300042146 | Bacteria | 118532 |
| 596 | Ga0450907_004197 | 3300042146 | Bacteria | 2496 |
| 597 | Ga0450907_024508 | 3300042146 | Bacteria | 1020 |
| 598 | Ga0450910_009290 | 3300042147 | Bacteria | 1392 |
| 599 | Ga0439446_0003548 | 3300042156 | Bacteria | 3886 |
| 600 | Ga0439446_0007859 | 3300042156 | Bacteria | 2813 |
| 601 | Ga0439446_0088405 | 3300042156 | Bacteria | 967 |
| 602 | Ga0439458_0003406 | 3300042157 | Bacteria | 3725 |
| 603 | Ga0450908_013461 | 3300042184 | Bacteria | 1476 |
| 604 | Ga0450909_004355 | 3300042185 | Bacteria | 2020 |
| 605 | Ga0439434_0000046 | 3300042435 | Bacteria | 29715 |
| 606 | Ga0439459_0001868 | 3300042438 | Bacteria | 3184 |
| 607 | Ga0439459_0002525 | 3300042438 | Bacteria | 2831 |
| 608 | Ga0439459_0004492 | 3300042438 | Bacteria | 2245 |
| 609 | Ga0439464_0000129 | 3300042439 | Bacteria | 11975 |
| 610 | Ga0439460_0000142 | 3300042461 | Bacteria | 12955 |
| 611 | Ga0439460_0008864 | 3300042461 | Bacteria | 2542 |
| 612 | Ga0451577_0261902 | 3300042876 | Bacteria | 1566 |
| 613 | Ga0451577_1420229 | 3300042876 | Bacteria | 615 |
| 614 | Ga0439440_0011280 | 3300042993 | Bacteria | 1882 |
| 615 | Ga0466969_0290130 | 3300044656 | Bacteria | 740 |
| 616 | Ga0466972_0000682 | 3300044658 | Bacteria | 16285 |
| 617 | Ga0466972_0212189 | 3300044658 | Bacteria | 906 |
| 618 | Ga0466973_0221370 | 3300044659 | Bacteria | 1374 |
| 619 | Ga0466965_0002135 | 3300044683 | Bacteria | 8311 |
| 620 | Ga0466965_0013014 | 3300044683 | Bacteria | 3919 |
| 621 | Ga0466965_0017999 | 3300044683 | Bacteria | 3381 |
| 622 | Ga0466965_0023997 | 3300044683 | Bacteria | 2948 |
| 623 | Ga0466965_0885238 | 3300044683 | Bacteria | 520 |
| 624 | Ga0466966_0007700 | 3300044684 | Bacteria | 7132 |
| 625 | Ga0466966_0062814 | 3300044684 | Bacteria | 2341 |
| 626 | Ga0466966_0068825 | 3300044684 | Bacteria | 2221 |
| 627 | Ga0466966_0166959 | 3300044684 | Bacteria | 1338 |
| 628 | Ga0466961_0045978 | 3300044693 | Bacteria | 2792 |
| 629 | Ga0466961_0071451 | 3300044693 | Bacteria | 2202 |
| 630 | Ga0466961_0206892 | 3300044693 | Bacteria | 1212 |
| 631 | Ga0466964_0000989 | 3300044706 | Bacteria | 9431 |
| 632 | Ga0466964_0271188 | 3300044706 | Bacteria | 844 |
| 633 | Ga0453684_0020297 | 3300044712 | Bacteria | 10033 |
| 634 | Ga0453684_1691249 | 3300044712 | Bacteria | 647 |
| 635 | Ga0466971_0029329 | 3300044719 | Bacteria | 2460 |
| 636 | Ga0466968_0001118 | 3300044735 | Bacteria | 9505 |
| 637 | Ga0466968_0092311 | 3300044735 | Bacteria | 1343 |
| 638 | Ga0466968_0144212 | 3300044735 | Bacteria | 1091 |
| 639 | Ga0466970_0560010 | 3300044765 | Bacteria | 661 |
| 640 | Ga0466957_0000012 | 3300044842 | Bacteria | 72537 |
| 641 | Ga0466957_0017995 | 3300044842 | Bacteria | 4144 |
| 642 | Ga0466957_0024252 | 3300044842 | Bacteria | 3589 |
| 643 | Ga0466960_0109373 | 3300044901 | Bacteria | 1434 |
| 644 | Ga0466959_0003130 | 3300045049 | Bacteria | 10726 |
| 645 | Ga0466959_0024626 | 3300045049 | Bacteria | 4459 |
| 646 | Ga0466959_0079968 | 3300045049 | Bacteria | 2357 |
| 647 | Ga0466959_0182466 | 3300045049 | Bacteria | 1467 |
| 648 | Ga0466959_0336383 | 3300045049 | Bacteria | 1030 |
| 649 | Ga0451576_0000140 | 3300045051 | Bacteria | 183279 |
| 650 | Ga0451576_0083727 | 3300045051 | Bacteria | 3318 |
| 651 | Ga0451576_0145942 | 3300045051 | Bacteria | 2467 |
| 652 | Ga0451576_0326266 | 3300045051 | Bacteria | 1607 |
| 653 | Ga0466958_0007731 | 3300045836 | Bacteria | 5930 |
| 654 | Ga0466958_0327810 | 3300045836 | Bacteria | 984 |
| 655 | Ga0466967_0077220 | 3300045976 | Bacteria | 2997 |
| 656 | Ga0466967_0090925 | 3300045976 | Bacteria | 2773 |
| 657 | Ga0466967_0138198 | 3300045976 | Bacteria | 2267 |
| 658 | Ga0495617_000212 | 3300046452 | Bacteria | 35622 |
| 659 | Ga0495617_001234 | 3300046452 | Bacteria | 11505 |
| 660 | Ga0495617_004740 | 3300046452 | Bacteria | 4911 |
| 661 | Ga0495617_015864 | 3300046452 | Bacteria | 2549 |
| 662 | Ga0495617_044578 | 3300046452 | Bacteria | 1480 |
| 663 | Ga0495617_060904 | 3300046452 | Bacteria | 1248 |
| 664 | Ga0495617_061442 | 3300046452 | Bacteria | 1242 |
| 665 | Ga0495617_124938 | 3300046452 | Bacteria | 827 |
| 666 | Ga0495617_128019 | 3300046452 | Bacteria | 815 |
| 667 | Ga0495627_000447 | 3300046453 | Bacteria | 35930 |
| 668 | Ga0495627_006245 | 3300046453 | Bacteria | 4686 |
| 669 | Ga0495627_006800 | 3300046453 | Bacteria | 4450 |
| 670 | Ga0495627_009590 | 3300046453 | Bacteria | 3555 |
| 671 | Ga0495627_066403 | 3300046453 | Bacteria | 1059 |
| 672 | Ga0495603_0020695 | 3300046455 | Bacteria | 3985 |
| 673 | Ga0495603_0102061 | 3300046455 | Bacteria | 1674 |
| 674 | Ga0495603_0112753 | 3300046455 | Bacteria | 1585 |
| 675 | Ga0495603_0430957 | 3300046455 | Bacteria | 755 |
| 676 | Ga0495590_0000179 | 3300046457 | Bacteria | 37217 |
| 677 | Ga0495590_0001314 | 3300046457 | Bacteria | 10807 |
| 678 | Ga0495590_0005456 | 3300046457 | Bacteria | 5043 |
| 679 | Ga0495590_0019559 | 3300046457 | Bacteria | 2410 |
| 680 | Ga0495590_0047112 | 3300046457 | Bacteria | 1503 |
| 681 | Ga0495591_000114 | 3300046458 | Bacteria | 93304 |
| 682 | Ga0495591_000127 | 3300046458 | Bacteria | 83271 |
| 683 | Ga0495591_004626 | 3300046458 | Bacteria | 6630 |
| 684 | Ga0495591_005973 | 3300046458 | Bacteria | 5499 |
| 685 | Ga0495591_009907 | 3300046458 | Bacteria | 3742 |
| 686 | Ga0495591_010092 | 3300046458 | Bacteria | 3693 |
| 687 | Ga0495591_016938 | 3300046458 | Bacteria | 2518 |
| 688 | Ga0495591_042597 | 3300046458 | Bacteria | 1282 |
| 689 | Ga0495591_052352 | 3300046458 | Bacteria | 1110 |
| 690 | Ga0495629_0068190 | 3300046459 | Bacteria | 2482 |
| 691 | Ga0495629_0291844 | 3300046459 | Bacteria | 1118 |
| 692 | Ga0495638_0001389 | 3300046460 | Bacteria | 22074 |
| 693 | Ga0495638_0001963 | 3300046460 | Bacteria | 17613 |
| 694 | Ga0495638_0002800 | 3300046460 | Bacteria | 13981 |
| 695 | Ga0495638_0020036 | 3300046460 | Bacteria | 4420 |
| 696 | Ga0495638_0049561 | 3300046460 | Bacteria | 2625 |
| 697 | Ga0495638_0061153 | 3300046460 | Bacteria | 2328 |
| 698 | Ga0495638_0099121 | 3300046460 | Bacteria | 1744 |
| 699 | Ga0495638_0256523 | 3300046460 | Bacteria | 961 |
| 700 | Ga0495638_0303030 | 3300046460 | Bacteria | 860 |
| 701 | Ga0495638_0406906 | 3300046460 | Bacteria | 705 |
| 702 | Ga0495641_0451884 | 3300046461 | Bacteria | 585 |
| 703 | Ga0495651_0001004 | 3300046462 | Bacteria | 21915 |
| 704 | Ga0495653_0000029 | 3300046463 | Bacteria | 145049 |
| 705 | Ga0495653_0014654 | 3300046463 | Bacteria | 6396 |
| 706 | Ga0495653_0055485 | 3300046463 | Bacteria | 3023 |
| 707 | Ga0495653_0071090 | 3300046463 | Bacteria | 2603 |
| 708 | Ga0495653_0079484 | 3300046463 | Bacteria | 2428 |
| 709 | Ga0495653_0089093 | 3300046463 | Bacteria | 2261 |
| 710 | Ga0495653_0155568 | 3300046463 | Bacteria | 1592 |
| 711 | Ga0495653_0389953 | 3300046463 | Bacteria | 887 |
| 712 | Ga0495650_0003574 | 3300046471 | Bacteria | 11241 |
| 713 | Ga0495650_0012294 | 3300046471 | Bacteria | 4612 |
| 714 | Ga0495650_0014352 | 3300046471 | Bacteria | 4129 |
| 715 | Ga0495650_0015155 | 3300046471 | Bacteria | 3967 |
| 716 | Ga0495650_0017405 | 3300046471 | Bacteria | 3604 |
| 717 | Ga0495650_0038021 | 3300046471 | Bacteria | 2088 |
| 718 | Ga0495650_0043043 | 3300046471 | Bacteria | 1919 |
| 719 | Ga0495650_0218881 | 3300046471 | Bacteria | 656 |
| 720 | Ga0495580_0080750 | 3300046472 | Bacteria | 2266 |
| 721 | Ga0495580_0230922 | 3300046472 | Bacteria | 1270 |
| 722 | Ga0495580_0329803 | 3300046472 | Bacteria | 1036 |
| 723 | Ga0495582_0013147 | 3300046473 | Bacteria | 4555 |
| 724 | Ga0495582_0015376 | 3300046473 | Bacteria | 4204 |
| 725 | Ga0495582_0044218 | 3300046473 | Bacteria | 2453 |
| 726 | Ga0495582_0130705 | 3300046473 | Bacteria | 1418 |
| 727 | Ga0495582_0669463 | 3300046473 | Bacteria | 601 |
| 728 | Ga0495605_0000039 | 3300046474 | Bacteria | 196802 |
| 729 | Ga0495605_0000771 | 3300046474 | Bacteria | 23130 |
| 730 | Ga0495605_0001627 | 3300046474 | Bacteria | 14510 |
| 731 | Ga0495605_0007537 | 3300046474 | Bacteria | 6170 |
| 732 | Ga0495605_0008843 | 3300046474 | Bacteria | 5677 |
| 733 | Ga0495605_0009786 | 3300046474 | Bacteria | 5383 |
| 734 | Ga0495605_0012496 | 3300046474 | Bacteria | 4708 |
| 735 | Ga0495605_0017802 | 3300046474 | Bacteria | 3818 |
| 736 | Ga0495605_0021153 | 3300046474 | Bacteria | 3449 |
| 737 | Ga0495605_0025844 | 3300046474 | Bacteria | 3056 |
| 738 | Ga0495605_0033789 | 3300046474 | Bacteria | 2594 |
| 739 | Ga0495605_0037504 | 3300046474 | Bacteria | 2437 |
| 740 | Ga0495605_0038358 | 3300046474 | Bacteria | 2404 |
| 741 | Ga0495605_0060326 | 3300046474 | Bacteria | 1818 |
| 742 | Ga0495605_0180220 | 3300046474 | Bacteria | 929 |
| 743 | Ga0495639_0031362 | 3300046475 | Bacteria | 2365 |
| 744 | Ga0495639_0215909 | 3300046475 | Bacteria | 942 |
| 745 | Ga0495584_0000013 | 3300046491 | Bacteria | 185735 |
| 746 | Ga0495584_0000278 | 3300046491 | Bacteria | 36319 |
| 747 | Ga0495584_0000387 | 3300046491 | Bacteria | 30269 |
| 748 | Ga0495584_0000606 | 3300046491 | Bacteria | 24016 |
| 749 | Ga0495584_0000772 | 3300046491 | Bacteria | 21165 |
| 750 | Ga0495584_0000923 | 3300046491 | Bacteria | 18628 |
| 751 | Ga0495584_0001007 | 3300046491 | Bacteria | 17629 |
| 752 | Ga0495584_0001104 | 3300046491 | Bacteria | 16759 |
| 753 | Ga0495584_0005965 | 3300046491 | Bacteria | 6419 |
| 754 | Ga0495584_0006877 | 3300046491 | Bacteria | 5946 |
| 755 | Ga0495584_0009481 | 3300046491 | Bacteria | 5012 |
| 756 | Ga0495584_0009755 | 3300046491 | Bacteria | 4938 |
| 757 | Ga0495584_0009804 | 3300046491 | Bacteria | 4928 |
| 758 | Ga0495584_0012661 | 3300046491 | Bacteria | 4305 |
| 759 | Ga0495584_0014765 | 3300046491 | Bacteria | 3978 |
| 760 | Ga0495584_0016643 | 3300046491 | Bacteria | 3749 |
| 761 | Ga0495584_0018020 | 3300046491 | Bacteria | 3589 |
| 762 | Ga0495584_0018988 | 3300046491 | Bacteria | 3493 |
| 763 | Ga0495584_0044568 | 3300046491 | Bacteria | 2238 |
| 764 | Ga0495584_0058711 | 3300046491 | Bacteria | 1935 |
| 765 | Ga0495584_0088360 | 3300046491 | Bacteria | 1562 |
| 766 | Ga0495584_0156425 | 3300046491 | Bacteria | 1158 |
| 767 | Ga0495585_0000245 | 3300046492 | Bacteria | 56106 |
| 768 | Ga0495585_0001160 | 3300046492 | Bacteria | 21459 |
| 769 | Ga0495585_0005349 | 3300046492 | Bacteria | 8103 |
| 770 | Ga0495585_0007605 | 3300046492 | Bacteria | 6619 |
| 771 | Ga0495585_0007793 | 3300046492 | Bacteria | 6524 |
| 772 | Ga0495585_0011728 | 3300046492 | Bacteria | 5180 |
| 773 | Ga0495585_0020877 | 3300046492 | Bacteria | 3762 |
| 774 | Ga0495585_0020878 | 3300046492 | Bacteria | 3762 |
| 775 | Ga0495585_0020935 | 3300046492 | Bacteria | 3757 |
| 776 | Ga0495585_0041055 | 3300046492 | Bacteria | 2595 |
| 777 | Ga0495585_0047914 | 3300046492 | Bacteria | 2377 |
| 778 | Ga0495585_0055681 | 3300046492 | Bacteria | 2185 |
| 779 | Ga0495585_0058781 | 3300046492 | Bacteria | 2121 |
| 780 | Ga0495594_0000740 | 3300046499 | Bacteria | 16768 |
| 781 | Ga0495594_0025269 | 3300046499 | Bacteria | 3192 |
| 782 | Ga0495594_0056351 | 3300046499 | Bacteria | 2168 |
| 783 | Ga0495594_0089534 | 3300046499 | Bacteria | 1723 |
| 784 | Ga0495594_0095004 | 3300046499 | Bacteria | 1673 |
| 785 | Ga0495594_0131200 | 3300046499 | Bacteria | 1419 |
| 786 | Ga0495594_0152449 | 3300046499 | Bacteria | 1312 |
| 787 | Ga0495596_0000107 | 3300046500 | Bacteria | 59095 |
| 788 | Ga0495596_0000526 | 3300046500 | Bacteria | 24051 |
| 789 | Ga0495596_0003741 | 3300046500 | Bacteria | 7599 |
| 790 | Ga0495596_0003902 | 3300046500 | Bacteria | 7393 |
| 791 | Ga0495596_0010020 | 3300046500 | Bacteria | 4146 |
| 792 | Ga0495596_0022201 | 3300046500 | Bacteria | 2585 |
| 793 | Ga0495596_0026812 | 3300046500 | Bacteria | 2320 |
| 794 | Ga0495596_0033697 | 3300046500 | Bacteria | 2037 |
| 795 | Ga0495596_0071281 | 3300046500 | Bacteria | 1349 |
| 796 | Ga0495596_0083210 | 3300046500 | Bacteria | 1242 |
| 797 | Ga0495607_0000159 | 3300046501 | Bacteria | 71580 |
| 798 | Ga0495607_0004232 | 3300046501 | Bacteria | 10642 |
| 799 | Ga0495607_0004835 | 3300046501 | Bacteria | 9824 |
| 800 | Ga0495607_0004934 | 3300046501 | Bacteria | 9692 |
| 801 | Ga0495607_0007881 | 3300046501 | Bacteria | 7327 |
| 802 | Ga0495607_0011520 | 3300046501 | Bacteria | 5883 |
| 803 | Ga0495607_0015812 | 3300046501 | Bacteria | 4881 |
| 804 | Ga0495607_0018336 | 3300046501 | Bacteria | 4464 |
| 805 | Ga0495607_0019923 | 3300046501 | Bacteria | 4249 |
| 806 | Ga0495607_0020566 | 3300046501 | Bacteria | 4169 |
| 807 | Ga0495607_0021685 | 3300046501 | Bacteria | 4039 |
| 808 | Ga0495607_0024625 | 3300046501 | Bacteria | 3749 |
| 809 | Ga0495607_0036487 | 3300046501 | Bacteria | 2961 |
| 810 | Ga0495607_0053962 | 3300046501 | Bacteria | 2318 |
| 811 | Ga0495607_0066275 | 3300046501 | Bacteria | 2032 |
| 812 | Ga0495607_0104268 | 3300046501 | Bacteria | 1513 |
| 813 | Ga0495607_0111429 | 3300046501 | Bacteria | 1450 |
| 814 | Ga0495607_0116471 | 3300046501 | Bacteria | 1409 |
| 815 | Ga0495607_0167906 | 3300046501 | Bacteria | 1110 |
| 816 | Ga0495583_0000881 | 3300046506 | Bacteria | 36218 |
| 817 | Ga0495583_0000940 | 3300046506 | Bacteria | 33943 |
| 818 | Ga0495583_0001071 | 3300046506 | Bacteria | 30564 |
| 819 | Ga0495583_0003792 | 3300046506 | Bacteria | 11229 |
| 820 | Ga0495583_0007613 | 3300046506 | Bacteria | 6760 |
| 821 | Ga0495583_0009134 | 3300046506 | Bacteria | 5958 |
| 822 | Ga0495583_0178645 | 3300046506 | Bacteria | 869 |
| 823 | Ga0495606_0000004 | 3300046507 | Bacteria | 406209 |
| 824 | Ga0495606_0001081 | 3300046507 | Bacteria | 39097 |
| 825 | Ga0495606_0001228 | 3300046507 | Bacteria | 35889 |
| 826 | Ga0495606_0001258 | 3300046507 | Bacteria | 35384 |
| 827 | Ga0495606_0002911 | 3300046507 | Bacteria | 18917 |
| 828 | Ga0495606_0031444 | 3300046507 | Bacteria | 3690 |
| 829 | Ga0495606_0031913 | 3300046507 | Bacteria | 3656 |
| 830 | Ga0495606_0033534 | 3300046507 | Bacteria | 3540 |
| 831 | Ga0495606_0035055 | 3300046507 | Bacteria | 3435 |
| 832 | Ga0495606_0037578 | 3300046507 | Bacteria | 3287 |
| 833 | Ga0495606_0110133 | 3300046507 | Bacteria | 1662 |
| 834 | Ga0495606_0130770 | 3300046507 | Bacteria | 1492 |
| 835 | Ga0495606_0193715 | 3300046507 | Bacteria | 1163 |
| 836 | Ga0495606_0342613 | 3300046507 | Bacteria | 796 |
| 837 | Ga0495606_0550726 | 3300046507 | Bacteria | 574 |
| 838 | Ga0495608_0014026 | 3300046511 | Bacteria | 5561 |
| 839 | Ga0495610_0000452 | 3300046512 | Bacteria | 42500 |
| 840 | Ga0495610_0000723 | 3300046512 | Bacteria | 31412 |
| 841 | Ga0495610_0001271 | 3300046512 | Bacteria | 22594 |
| 842 | Ga0495610_0001560 | 3300046512 | Bacteria | 20180 |
| 843 | Ga0495610_0004206 | 3300046512 | Bacteria | 10739 |
| 844 | Ga0495610_0007934 | 3300046512 | Bacteria | 6968 |
| 845 | Ga0495610_0019077 | 3300046512 | Bacteria | 3849 |
| 846 | Ga0495610_0022636 | 3300046512 | Bacteria | 3433 |
| 847 | Ga0495610_0022850 | 3300046512 | Bacteria | 3411 |
| 848 | Ga0495610_0028730 | 3300046512 | Bacteria | 2937 |
| 849 | Ga0495610_0037379 | 3300046512 | Bacteria | 2471 |
| 850 | Ga0495610_0082821 | 3300046512 | Bacteria | 1469 |
| 851 | Ga0495610_0098855 | 3300046512 | Bacteria | 1310 |
| 852 | Ga0495610_0337916 | 3300046512 | Bacteria | 570 |
| 853 | Ga0495616_0000942 | 3300046513 | Bacteria | 20913 |
| 854 | Ga0495616_0001324 | 3300046513 | Bacteria | 17296 |
| 855 | Ga0495616_0001515 | 3300046513 | Bacteria | 16011 |
| 856 | Ga0495616_0005293 | 3300046513 | Bacteria | 7954 |
| 857 | Ga0495616_0007003 | 3300046513 | Bacteria | 6783 |
| 858 | Ga0495616_0007106 | 3300046513 | Bacteria | 6724 |
| 859 | Ga0495616_0008838 | 3300046513 | Bacteria | 5926 |
| 860 | Ga0495616_0013479 | 3300046513 | Bacteria | 4610 |
| 861 | Ga0495616_0019189 | 3300046513 | Bacteria | 3734 |
| 862 | Ga0495616_0019857 | 3300046513 | Bacteria | 3662 |
| 863 | Ga0495616_0024909 | 3300046513 | Bacteria | 3203 |
| 864 | Ga0495616_0028061 | 3300046513 | Bacteria | 2982 |
| 865 | Ga0495616_0031043 | 3300046513 | Bacteria | 2802 |
| 866 | Ga0495616_0046465 | 3300046513 | Bacteria | 2191 |
| 867 | Ga0495616_0065069 | 3300046513 | Bacteria | 1778 |
| 868 | Ga0495616_0090536 | 3300046513 | Bacteria | 1449 |
| 869 | Ga0495620_0000307 | 3300046515 | Bacteria | 34934 |
| 870 | Ga0495620_0012488 | 3300046515 | Bacteria | 4382 |
| 871 | Ga0495620_0015524 | 3300046515 | Bacteria | 3842 |
| 872 | Ga0495620_0023043 | 3300046515 | Bacteria | 2985 |
| 873 | Ga0495620_0050425 | 3300046515 | Bacteria | 1776 |
| 874 | Ga0495620_0057564 | 3300046515 | Bacteria | 1630 |
| 875 | Ga0495628_0000646 | 3300046516 | Bacteria | 31897 |
| 876 | Ga0495628_0104045 | 3300046516 | Bacteria | 2188 |
| 877 | Ga0495628_0128806 | 3300046516 | Bacteria | 1937 |
| 878 | Ga0495630_0014595 | 3300046517 | Bacteria | 5725 |
| 879 | Ga0495630_0042722 | 3300046517 | Bacteria | 3385 |
| 880 | Ga0495630_0113451 | 3300046517 | Bacteria | 2053 |
| 881 | Ga0495630_0397760 | 3300046517 | Bacteria | 1055 |
| 882 | Ga0495630_0407044 | 3300046517 | Bacteria | 1042 |
| 883 | Ga0495631_0000020 | 3300046518 | Bacteria | 92958 |
| 884 | Ga0495631_0001363 | 3300046518 | Bacteria | 14907 |
| 885 | Ga0495631_0001942 | 3300046518 | Bacteria | 12123 |
| 886 | Ga0495631_0005097 | 3300046518 | Bacteria | 6919 |
| 887 | Ga0495631_0008597 | 3300046518 | Bacteria | 5139 |
| 888 | Ga0495631_0009192 | 3300046518 | Bacteria | 4950 |
| 889 | Ga0495631_0009256 | 3300046518 | Bacteria | 4928 |
| 890 | Ga0495631_0043386 | 3300046518 | Bacteria | 1984 |
| 891 | Ga0495631_0058684 | 3300046518 | Bacteria | 1673 |
| 892 | Ga0495631_0063341 | 3300046518 | Bacteria | 1601 |
| 893 | Ga0495631_0070557 | 3300046518 | Bacteria | 1510 |
| 894 | Ga0495632_0000430 | 3300046519 | Bacteria | 39988 |
| 895 | Ga0495632_0000436 | 3300046519 | Bacteria | 39746 |
| 896 | Ga0495632_0000682 | 3300046519 | Bacteria | 31006 |
| 897 | Ga0495632_0001221 | 3300046519 | Bacteria | 21803 |
| 898 | Ga0495632_0002044 | 3300046519 | Bacteria | 15859 |
| 899 | Ga0495632_0002718 | 3300046519 | Bacteria | 13144 |
| 900 | Ga0495632_0008131 | 3300046519 | Bacteria | 6486 |
| 901 | Ga0495632_0014318 | 3300046519 | Bacteria | 4490 |
| 902 | Ga0495632_0020129 | 3300046519 | Bacteria | 3620 |
| 903 | Ga0495632_0021207 | 3300046519 | Bacteria | 3504 |
| 904 | Ga0495632_0026710 | 3300046519 | Bacteria | 3034 |
| 905 | Ga0495632_0049241 | 3300046519 | Bacteria | 2083 |
| 906 | Ga0495632_0059727 | 3300046519 | Bacteria | 1854 |
| 907 | Ga0495637_0000029 | 3300046520 | Bacteria | 143929 |
| 908 | Ga0495637_0000283 | 3300046520 | Bacteria | 39761 |
| 909 | Ga0495637_0000507 | 3300046520 | Bacteria | 28254 |
| 910 | Ga0495637_0003470 | 3300046520 | Bacteria | 8374 |
| 911 | Ga0495637_0007167 | 3300046520 | Bacteria | 5549 |
| 912 | Ga0495637_0013261 | 3300046520 | Bacteria | 3916 |
| 913 | Ga0495637_0014493 | 3300046520 | Bacteria | 3719 |
| 914 | Ga0495637_0025130 | 3300046520 | Bacteria | 2687 |
| 915 | Ga0495637_0036664 | 3300046520 | Bacteria | 2133 |
| 916 | Ga0495637_0041760 | 3300046520 | Bacteria | 1965 |
| 917 | Ga0495637_0042963 | 3300046520 | Bacteria | 1931 |
| 918 | Ga0495637_0077468 | 3300046520 | Bacteria | 1331 |
| 919 | Ga0495637_0108918 | 3300046520 | Bacteria | 1075 |
| 920 | Ga0495643_0000450 | 3300046522 | Bacteria | 52786 |
| 921 | Ga0495643_0000876 | 3300046522 | Bacteria | 32061 |
| 922 | Ga0495643_0005182 | 3300046522 | Bacteria | 8892 |
| 923 | Ga0495643_0011635 | 3300046522 | Bacteria | 5348 |
| 924 | Ga0495643_0014503 | 3300046522 | Bacteria | 4687 |
| 925 | Ga0495643_0019305 | 3300046522 | Bacteria | 3946 |
| 926 | Ga0495643_0019738 | 3300046522 | Bacteria | 3896 |
| 927 | Ga0495643_0022760 | 3300046522 | Bacteria | 3569 |
| 928 | Ga0495643_0034141 | 3300046522 | Bacteria | 2808 |
| 929 | Ga0495643_0063352 | 3300046522 | Bacteria | 1955 |
| 930 | Ga0495643_0069878 | 3300046522 | Bacteria | 1845 |
| 931 | Ga0495643_0090448 | 3300046522 | Bacteria | 1579 |
| 932 | Ga0495643_0106721 | 3300046522 | Bacteria | 1429 |
| 933 | Ga0495643_0179217 | 3300046522 | Bacteria | 1031 |
| 934 | Ga0495643_0196485 | 3300046522 | Bacteria | 971 |
| 935 | Ga0495643_0230660 | 3300046522 | Bacteria | 873 |
| 936 | Ga0495644_0003292 | 3300046523 | Bacteria | 6387 |
| 937 | Ga0495644_0006258 | 3300046523 | Bacteria | 4623 |
| 938 | Ga0495644_0007323 | 3300046523 | Bacteria | 4262 |
| 939 | Ga0495644_0029115 | 3300046523 | Bacteria | 2087 |
| 940 | Ga0495644_0030169 | 3300046523 | Bacteria | 2047 |
| 941 | Ga0495644_0032477 | 3300046523 | Bacteria | 1972 |
| 942 | Ga0495644_0102259 | 3300046523 | Bacteria | 1084 |
| 943 | Ga0495644_0156026 | 3300046523 | Bacteria | 874 |
| 944 | Ga0495648_0000627 | 3300046524 | Bacteria | 37754 |
| 945 | Ga0495648_0001736 | 3300046524 | Bacteria | 21072 |
| 946 | Ga0495648_0011158 | 3300046524 | Bacteria | 6790 |
| 947 | Ga0495648_0025052 | 3300046524 | Bacteria | 4047 |
| 948 | Ga0495648_0026259 | 3300046524 | Bacteria | 3924 |
| 949 | Ga0495648_0030985 | 3300046524 | Bacteria | 3528 |
| 950 | Ga0495648_0034664 | 3300046524 | Bacteria | 3282 |
| 951 | Ga0495648_0042570 | 3300046524 | Bacteria | 2856 |
| 952 | Ga0495648_0045434 | 3300046524 | Bacteria | 2732 |
| 953 | Ga0495648_0051266 | 3300046524 | Bacteria | 2515 |
| 954 | Ga0495648_0059152 | 3300046524 | Bacteria | 2288 |
| 955 | Ga0495648_0081320 | 3300046524 | Bacteria | 1843 |
| 956 | Ga0495648_0104764 | 3300046524 | Bacteria | 1552 |
| 957 | Ga0495648_0105278 | 3300046524 | Bacteria | 1547 |
| 958 | Ga0495648_0247263 | 3300046524 | Bacteria | 863 |
| 959 | Ga0495648_0288238 | 3300046524 | Bacteria | 775 |
| 960 | Ga0495648_0306893 | 3300046524 | Bacteria | 741 |
| 961 | Ga0495666_0010812 | 3300046526 | Bacteria | 4551 |
| 962 | Ga0495666_0011769 | 3300046526 | Bacteria | 4361 |
| 963 | Ga0495666_0012333 | 3300046526 | Bacteria | 4261 |
| 964 | Ga0495666_0016424 | 3300046526 | Bacteria | 3686 |
| 965 | Ga0495666_0025502 | 3300046526 | Bacteria | 2919 |
| 966 | Ga0495666_0041133 | 3300046526 | Bacteria | 2239 |
| 967 | Ga0495666_0072077 | 3300046526 | Bacteria | 1641 |
| 968 | Ga0495666_0103802 | 3300046526 | Bacteria | 1338 |
| 969 | Ga0495642_0000033 | 3300046528 | Bacteria | 85849 |
| 970 | Ga0495642_0000251 | 3300046528 | Bacteria | 30079 |
| 971 | Ga0495642_0000505 | 3300046528 | Bacteria | 20125 |
| 972 | Ga0495642_0000997 | 3300046528 | Bacteria | 13147 |
| 973 | Ga0495642_0001460 | 3300046528 | Bacteria | 10580 |
| 974 | Ga0495642_0006484 | 3300046528 | Bacteria | 4490 |
| 975 | Ga0495642_0009271 | 3300046528 | Bacteria | 3769 |
| 976 | Ga0495642_0014315 | 3300046528 | Bacteria | 3072 |
| 977 | Ga0495642_0015678 | 3300046528 | Bacteria | 2948 |
| 978 | Ga0495642_0016484 | 3300046528 | Bacteria | 2880 |
| 979 | Ga0495642_0073336 | 3300046528 | Bacteria | 1434 |
| 980 | Ga0495642_0133232 | 3300046528 | Bacteria | 1070 |
| 981 | Ga0495642_0169526 | 3300046528 | Bacteria | 948 |
| 982 | Ga0495642_0206891 | 3300046528 | Bacteria | 856 |
| 983 | Ga0495642_0340185 | 3300046528 | Bacteria | 659 |
| 984 | Ga0495652_0012939 | 3300046529 | Bacteria | 7520 |
| 985 | Ga0495652_0067304 | 3300046529 | Bacteria | 3003 |
| 986 | Ga0495652_0616841 | 3300046529 | Bacteria | 738 |
| 987 | Ga0495654_0000025 | 3300046530 | Bacteria | 236572 |
| 988 | Ga0495654_0001842 | 3300046530 | Bacteria | 14128 |
| 989 | Ga0495654_0006480 | 3300046530 | Bacteria | 6648 |
| 990 | Ga0495654_0008351 | 3300046530 | Bacteria | 5725 |
| 991 | Ga0495654_0016289 | 3300046530 | Bacteria | 3934 |
| 992 | Ga0495654_0020667 | 3300046530 | Bacteria | 3429 |
| 993 | Ga0495654_0023526 | 3300046530 | Bacteria | 3190 |
| 994 | Ga0495654_0025348 | 3300046530 | Bacteria | 3055 |
| 995 | Ga0495654_0030894 | 3300046530 | Bacteria | 2721 |
| 996 | Ga0495654_0038054 | 3300046530 | Bacteria | 2407 |
| 997 | Ga0495654_0042719 | 3300046530 | Bacteria | 2248 |
| 998 | Ga0495654_0057759 | 3300046530 | Bacteria | 1873 |
| 999 | Ga0495654_0121152 | 3300046530 | Bacteria | 1184 |
| 1000 | Ga0495654_0268155 | 3300046530 | Bacteria | 706 |
| 1001 | Ga0495665_0001295 | 3300046531 | Bacteria | 13345 |
| 1002 | Ga0495665_0011916 | 3300046531 | Bacteria | 4706 |
| 1003 | Ga0495665_0035944 | 3300046531 | Bacteria | 2644 |
| 1004 | Ga0495640_0073827 | 3300046533 | Bacteria | 2283 |
| 1005 | Ga0495640_0192097 | 3300046533 | Bacteria | 1297 |
| 1006 | Ga0495586_0010241 | 3300046535 | Bacteria | 4985 |
| 1007 | Ga0495586_0012286 | 3300046535 | Bacteria | 4544 |
| 1008 | Ga0495586_0047507 | 3300046535 | Bacteria | 2317 |
| 1009 | Ga0495586_0116287 | 3300046535 | Bacteria | 1491 |
| 1010 | Ga0495586_0221484 | 3300046535 | Bacteria | 1075 |
| 1011 | Ga0495586_0286734 | 3300046535 | Bacteria | 942 |
| 1012 | Ga0495587_0000454 | 3300046536 | Bacteria | 28585 |
| 1013 | Ga0495587_0021742 | 3300046536 | Bacteria | 3958 |
| 1014 | Ga0495587_0247023 | 3300046536 | Bacteria | 1003 |
| 1015 | Ga0495587_0482950 | 3300046536 | Bacteria | 685 |
| 1016 | Ga0495609_0000005 | 3300046538 | Bacteria | 439165 |
| 1017 | Ga0495609_0000686 | 3300046538 | Bacteria | 26127 |
| 1018 | Ga0495609_0001090 | 3300046538 | Bacteria | 18895 |
| 1019 | Ga0495609_0001117 | 3300046538 | Bacteria | 18610 |
| 1020 | Ga0495609_0001315 | 3300046538 | Bacteria | 16897 |
| 1021 | Ga0495609_0001690 | 3300046538 | Bacteria | 14318 |
| 1022 | Ga0495609_0036470 | 3300046538 | Bacteria | 2220 |
| 1023 | Ga0495609_0038444 | 3300046538 | Bacteria | 2157 |
| 1024 | Ga0495609_0042085 | 3300046538 | Bacteria | 2051 |
| 1025 | Ga0495609_0044507 | 3300046538 | Bacteria | 1990 |
| 1026 | Ga0495609_0052589 | 3300046538 | Bacteria | 1812 |
| 1027 | Ga0495609_0053826 | 3300046538 | Bacteria | 1788 |
| 1028 | Ga0495609_0094987 | 3300046538 | Bacteria | 1294 |
| 1029 | Ga0495609_0172498 | 3300046538 | Bacteria | 913 |
| 1030 | Ga0495597_0000731 | 3300046542 | Bacteria | 26231 |
| 1031 | Ga0495597_0001213 | 3300046542 | Bacteria | 19204 |
| 1032 | Ga0495597_0001876 | 3300046542 | Bacteria | 14363 |
| 1033 | Ga0495597_0002617 | 3300046542 | Bacteria | 11199 |
| 1034 | Ga0495597_0003236 | 3300046542 | Bacteria | 9676 |
| 1035 | Ga0495597_0006469 | 3300046542 | Bacteria | 6060 |
| 1036 | Ga0495597_0008617 | 3300046542 | Bacteria | 5102 |
| 1037 | Ga0495597_0010418 | 3300046542 | Bacteria | 4547 |
| 1038 | Ga0495597_0012917 | 3300046542 | Bacteria | 4013 |
| 1039 | Ga0495597_0014733 | 3300046542 | Bacteria | 3718 |
| 1040 | Ga0495597_0040635 | 3300046542 | Bacteria | 2079 |
| 1041 | Ga0495597_0075603 | 3300046542 | Bacteria | 1445 |
| 1042 | Ga0495597_0083913 | 3300046542 | Bacteria | 1359 |
| 1043 | Ga0495597_0084751 | 3300046542 | Bacteria | 1351 |
| 1044 | Ga0495597_0089509 | 3300046542 | Bacteria | 1308 |
| 1045 | Ga0495597_0102188 | 3300046542 | Bacteria | 1208 |
| 1046 | Ga0495597_0134846 | 3300046542 | Bacteria | 1022 |
| 1047 | Ga0495645_0045476 | 3300046543 | Bacteria | 3203 |
| 1048 | Ga0495645_0066820 | 3300046543 | Bacteria | 2597 |
| 1049 | Ga0495622_0000092 | 3300046557 | Bacteria | 80637 |
| 1050 | Ga0495622_0000346 | 3300046557 | Bacteria | 33256 |
| 1051 | Ga0495622_0001961 | 3300046557 | Bacteria | 10089 |
| 1052 | Ga0495622_0002752 | 3300046557 | Bacteria | 8407 |
| 1053 | Ga0495622_0014884 | 3300046557 | Bacteria | 3616 |
| 1054 | Ga0495622_0027915 | 3300046557 | Bacteria | 2634 |
| 1055 | Ga0495622_0126267 | 3300046557 | Bacteria | 1167 |
| 1056 | Ga0495633_0002295 | 3300046558 | Bacteria | 13656 |
| 1057 | Ga0495633_0002345 | 3300046558 | Bacteria | 13449 |
| 1058 | Ga0495633_0003592 | 3300046558 | Bacteria | 10261 |
| 1059 | Ga0495633_0007303 | 3300046558 | Bacteria | 6377 |
| 1060 | Ga0495633_0216605 | 3300046558 | Bacteria | 877 |
| 1061 | Ga0495656_0005267 | 3300046615 | Bacteria | 4455 |
| 1062 | Ga0495656_0024814 | 3300046615 | Bacteria | 2372 |
| 1063 | Ga0495656_0030588 | 3300046615 | Bacteria | 2177 |
| 1064 | Ga0495656_0253451 | 3300046615 | Bacteria | 890 |
| 1065 | Ga0495668_0000568 | 3300046616 | Bacteria | 45426 |
| 1066 | Ga0495668_0001045 | 3300046616 | Bacteria | 29353 |
| 1067 | Ga0495668_0008186 | 3300046616 | Bacteria | 6569 |
| 1068 | Ga0495668_0011340 | 3300046616 | Bacteria | 5344 |
| 1069 | Ga0495668_0012044 | 3300046616 | Bacteria | 5147 |
| 1070 | Ga0495668_0027212 | 3300046616 | Bacteria | 3240 |
| 1071 | Ga0495668_0030583 | 3300046616 | Bacteria | 3039 |
| 1072 | Ga0495668_0035692 | 3300046616 | Bacteria | 2786 |
| 1073 | Ga0495668_0036724 | 3300046616 | Bacteria | 2744 |
| 1074 | Ga0495668_0074896 | 3300046616 | Bacteria | 1859 |
| 1075 | Ga0495668_0098823 | 3300046616 | Bacteria | 1597 |
| 1076 | Ga0495668_0235829 | 3300046616 | Bacteria | 1002 |
| 1077 | Ga0495668_0509378 | 3300046616 | Bacteria | 663 |
| 1078 | Ga0495668_0812367 | 3300046616 | Bacteria | 518 |
| 1079 | Ga0495634_0048427 | 3300046642 | Bacteria | 2861 |
| 1080 | Ga0495634_0091355 | 3300046642 | Bacteria | 1976 |
| 1081 | Ga0495634_0321060 | 3300046642 | Bacteria | 932 |
| 1082 | Ga0495611_0000913 | 3300046648 | Bacteria | 15999 |
| 1083 | Ga0495611_0001898 | 3300046648 | Bacteria | 9945 |
| 1084 | Ga0495611_0005791 | 3300046648 | Bacteria | 5272 |
| 1085 | Ga0495611_0019324 | 3300046648 | Bacteria | 2925 |
| 1086 | Ga0495611_0035949 | 3300046648 | Bacteria | 2196 |
| 1087 | Ga0495611_0073394 | 3300046648 | Bacteria | 1566 |
| 1088 | Ga0495611_0203297 | 3300046648 | Bacteria | 923 |
| 1089 | Ga0495611_0298796 | 3300046648 | Bacteria | 742 |
| 1090 | Ga0495611_0482891 | 3300046648 | Bacteria | 563 |
| 1091 | Ga0495625_0001188 | 3300046660 | Bacteria | 33368 |
| 1092 | Ga0495625_0002099 | 3300046660 | Bacteria | 22263 |
| 1093 | Ga0495625_0011658 | 3300046660 | Bacteria | 7151 |
| 1094 | Ga0495625_0029000 | 3300046660 | Bacteria | 4142 |
| 1095 | Ga0495625_0034634 | 3300046660 | Bacteria | 3725 |
| 1096 | Ga0495625_0043885 | 3300046660 | Bacteria | 3239 |
| 1097 | Ga0495625_0063334 | 3300046660 | Bacteria | 2611 |
| 1098 | Ga0495625_0063636 | 3300046660 | Bacteria | 2604 |
| 1099 | Ga0495625_0065385 | 3300046660 | Bacteria | 2564 |
| 1100 | Ga0495625_0071586 | 3300046660 | Bacteria | 2433 |
| 1101 | Ga0495625_0071844 | 3300046660 | Bacteria | 2428 |
| 1102 | Ga0495625_0124215 | 3300046660 | Bacteria | 1753 |
| 1103 | Ga0495625_0155114 | 3300046660 | Bacteria | 1537 |
| 1104 | Ga0495625_0166309 | 3300046660 | Bacteria | 1474 |
| 1105 | Ga0495625_0176818 | 3300046660 | Bacteria | 1422 |
| 1106 | Ga0495625_0259670 | 3300046660 | Bacteria | 1124 |
| 1107 | Ga0495625_0333212 | 3300046660 | Bacteria | 963 |
| 1108 | Ga0495625_0462908 | 3300046660 | Bacteria | 781 |
| 1109 | Ga0495625_0551675 | 3300046660 | Bacteria | 698 |
| 1110 | Ga0495625_0621771 | 3300046660 | Bacteria | 646 |
| 1111 | Ga0495635_0024425 | 3300046663 | Bacteria | 4211 |
| 1112 | Ga0495635_0032724 | 3300046663 | Bacteria | 3606 |
| 1113 | Ga0495635_0301912 | 3300046663 | Bacteria | 1073 |
| 1114 | Ga0495659_0000957 | 3300046664 | Bacteria | 10234 |
| 1115 | Ga0495659_0011094 | 3300046664 | Bacteria | 2902 |
| 1116 | Ga0495661_0000308 | 3300046665 | Bacteria | 55826 |
| 1117 | Ga0495661_0000855 | 3300046665 | Bacteria | 28339 |
| 1118 | Ga0495661_0001225 | 3300046665 | Bacteria | 22260 |
| 1119 | Ga0495661_0001803 | 3300046665 | Bacteria | 17174 |
| 1120 | Ga0495661_0005046 | 3300046665 | Bacteria | 9421 |
| 1121 | Ga0495661_0007189 | 3300046665 | Bacteria | 7768 |
| 1122 | Ga0495661_0010783 | 3300046665 | Bacteria | 6220 |
| 1123 | Ga0495661_0015641 | 3300046665 | Bacteria | 5059 |
| 1124 | Ga0495661_0016585 | 3300046665 | Bacteria | 4879 |
| 1125 | Ga0495661_0039840 | 3300046665 | Bacteria | 2917 |
| 1126 | Ga0495661_0046874 | 3300046665 | Bacteria | 2635 |
| 1127 | Ga0495661_0073877 | 3300046665 | Bacteria | 1985 |
| 1128 | Ga0495661_0083801 | 3300046665 | Bacteria | 1831 |
| 1129 | Ga0495661_0094120 | 3300046665 | Bacteria | 1698 |
| 1130 | Ga0495661_0099025 | 3300046665 | Bacteria | 1644 |
| 1131 | Ga0495661_0099813 | 3300046665 | Bacteria | 1636 |
| 1132 | Ga0495661_0102310 | 3300046665 | Bacteria | 1610 |
| 1133 | Ga0495661_0146400 | 3300046665 | Bacteria | 1279 |
| 1134 | Ga0495661_0197465 | 3300046665 | Bacteria | 1055 |
| 1135 | Ga0495661_0243095 | 3300046665 | Bacteria | 922 |
| 1136 | Ga0495661_0273416 | 3300046665 | Bacteria | 854 |
| 1137 | Ga0495661_0316941 | 3300046665 | Bacteria | 776 |
| 1138 | Ga0495661_0317409 | 3300046665 | Bacteria | 775 |
| 1139 | Ga0495661_0507420 | 3300046665 | Bacteria | 574 |
| 1140 | Ga0495588_0000059 | 3300046674 | Bacteria | 263358 |
| 1141 | Ga0495588_0002582 | 3300046674 | Bacteria | 7747 |
| 1142 | Ga0495588_0014944 | 3300046674 | Bacteria | 3726 |
| 1143 | Ga0495588_0016717 | 3300046674 | Bacteria | 3548 |
| 1144 | Ga0495588_0046451 | 3300046674 | Bacteria | 2227 |
| 1145 | Ga0495588_0094979 | 3300046674 | Bacteria | 1563 |
| 1146 | Ga0495588_0106104 | 3300046674 | Bacteria | 1478 |
| 1147 | Ga0495588_0134650 | 3300046674 | Bacteria | 1304 |
| 1148 | Ga0495588_0145295 | 3300046674 | Bacteria | 1253 |
| 1149 | Ga0495588_0353855 | 3300046674 | Bacteria | 771 |
| 1150 | Ga0495623_0015135 | 3300046679 | Bacteria | 4987 |
| 1151 | Ga0495623_0027814 | 3300046679 | Bacteria | 3640 |
| 1152 | Ga0495623_0060783 | 3300046679 | Bacteria | 2370 |
| 1153 | Ga0495623_0138459 | 3300046679 | Bacteria | 1450 |
| 1154 | Ga0495623_0148792 | 3300046679 | Bacteria | 1386 |
| 1155 | Ga0495646_0006253 | 3300046680 | Bacteria | 7550 |
| 1156 | Ga0495646_0132893 | 3300046680 | Bacteria | 1399 |
| 1157 | Ga0495646_0142533 | 3300046680 | Bacteria | 1339 |
| 1158 | Ga0495646_0211018 | 3300046680 | Bacteria | 1054 |
| 1159 | Ga0495669_0000210 | 3300046684 | Bacteria | 35427 |
| 1160 | Ga0495669_0000722 | 3300046684 | Bacteria | 14346 |
| 1161 | Ga0495669_0001185 | 3300046684 | Bacteria | 10834 |
| 1162 | Ga0495669_0014048 | 3300046684 | Bacteria | 3421 |
| 1163 | Ga0495669_0024903 | 3300046684 | Bacteria | 2607 |
| 1164 | Ga0495669_0040635 | 3300046684 | Bacteria | 2063 |
| 1165 | Ga0495669_0088530 | 3300046684 | Bacteria | 1427 |
| 1166 | Ga0495613_0020278 | 3300046689 | Bacteria | 4956 |
| 1167 | Ga0495613_0157664 | 3300046689 | Bacteria | 1616 |
| 1168 | Ga0495613_0421239 | 3300046689 | Bacteria | 908 |
| 1169 | Ga0495624_0079685 | 3300046690 | Bacteria | 2030 |
| 1170 | Ga0495670_0000115 | 3300046691 | Bacteria | 35545 |
| 1171 | Ga0495670_0000146 | 3300046691 | Bacteria | 31027 |
| 1172 | Ga0495670_0000559 | 3300046691 | Bacteria | 17717 |
| 1173 | Ga0495670_0001150 | 3300046691 | Bacteria | 12853 |
| 1174 | Ga0495670_0010847 | 3300046691 | Bacteria | 4477 |
| 1175 | Ga0495670_0014215 | 3300046691 | Bacteria | 3916 |
| 1176 | Ga0495670_0022351 | 3300046691 | Bacteria | 3123 |
| 1177 | Ga0495670_0027519 | 3300046691 | Bacteria | 2817 |
| 1178 | Ga0495670_0057525 | 3300046691 | Bacteria | 1952 |
| 1179 | Ga0495670_0066364 | 3300046691 | Bacteria | 1820 |
| 1180 | Ga0495670_0100706 | 3300046691 | Bacteria | 1487 |
| 1181 | Ga0495670_0127108 | 3300046691 | Bacteria | 1327 |
| 1182 | Ga0495671_0000380 | 3300046692 | Bacteria | 36521 |
| 1183 | Ga0495671_0000808 | 3300046692 | Bacteria | 22380 |
| 1184 | Ga0495671_0004909 | 3300046692 | Bacteria | 7907 |
| 1185 | Ga0495671_0013456 | 3300046692 | Bacteria | 4431 |
| 1186 | Ga0495671_0049463 | 3300046692 | Bacteria | 2095 |
| 1187 | Ga0495671_0084445 | 3300046692 | Bacteria | 1555 |
| 1188 | Ga0495671_0136159 | 3300046692 | Bacteria | 1197 |
| 1189 | Ga0495671_0138046 | 3300046692 | Bacteria | 1188 |
| 1190 | Ga0495671_0174625 | 3300046692 | Bacteria | 1044 |
| 1191 | Ga0495671_0202550 | 3300046692 | Bacteria | 962 |
| 1192 | Ga0495671_0203745 | 3300046692 | Bacteria | 959 |
| 1193 | Ga0495649_0000243 | 3300046694 | Bacteria | 48016 |
| 1194 | Ga0495649_0000580 | 3300046694 | Bacteria | 30670 |
| 1195 | Ga0495649_0001732 | 3300046694 | Bacteria | 16121 |
| 1196 | Ga0495649_0008945 | 3300046694 | Bacteria | 5988 |
| 1197 | Ga0495649_0013542 | 3300046694 | Bacteria | 4701 |
| 1198 | Ga0495649_0019465 | 3300046694 | Bacteria | 3814 |
| 1199 | Ga0495649_0026238 | 3300046694 | Bacteria | 3242 |
| 1200 | Ga0495649_0032628 | 3300046694 | Bacteria | 2867 |
| 1201 | Ga0495649_0035673 | 3300046694 | Bacteria | 2734 |
| 1202 | Ga0495649_0037611 | 3300046694 | Bacteria | 2656 |
| 1203 | Ga0495649_0042427 | 3300046694 | Bacteria | 2485 |
| 1204 | Ga0495649_0055759 | 3300046694 | Bacteria | 2134 |
| 1205 | Ga0495649_0060330 | 3300046694 | Bacteria | 2040 |
| 1206 | Ga0495649_0093249 | 3300046694 | Bacteria | 1603 |
| 1207 | Ga0495649_0214089 | 3300046694 | Bacteria | 998 |
| 1208 | Ga0495589_0000095 | 3300046794 | Bacteria | 84563 |
| 1209 | Ga0495589_0000133 | 3300046794 | Bacteria | 68226 |
| 1210 | Ga0495589_0000399 | 3300046794 | Bacteria | 32701 |
| 1211 | Ga0495589_0001338 | 3300046794 | Bacteria | 14445 |
| 1212 | Ga0495589_0001411 | 3300046794 | Bacteria | 13927 |
| 1213 | Ga0495589_0005145 | 3300046794 | Bacteria | 6921 |
| 1214 | Ga0495589_0014303 | 3300046794 | Bacteria | 4089 |
| 1215 | Ga0495589_0014864 | 3300046794 | Bacteria | 4004 |
| 1216 | Ga0495589_0015436 | 3300046794 | Bacteria | 3930 |
| 1217 | Ga0495589_0157582 | 3300046794 | Bacteria | 1082 |
| 1218 | Ga0495589_0224287 | 3300046794 | Bacteria | 882 |
| 1219 | Ga0495589_0248310 | 3300046794 | Bacteria | 832 |
| 1220 | Ga0495589_0252548 | 3300046794 | Bacteria | 823 |
| 1221 | Ga0495589_0383136 | 3300046794 | Bacteria | 646 |
| 1222 | Ga0495600_0019152 | 3300046809 | Bacteria | 4367 |
| 1223 | Ga0495600_0123010 | 3300046809 | Bacteria | 1687 |
| 1224 | Ga0495600_0493009 | 3300046809 | Bacteria | 753 |
| 1225 | Ga0495660_0000135 | 3300046810 | Bacteria | 80391 |
| 1226 | Ga0495660_0001109 | 3300046810 | Bacteria | 19240 |
| 1227 | Ga0495660_0002439 | 3300046810 | Bacteria | 11861 |
| 1228 | Ga0495660_0018399 | 3300046810 | Bacteria | 4017 |
| 1229 | Ga0495660_0020729 | 3300046810 | Bacteria | 3768 |
| 1230 | Ga0495660_0024058 | 3300046810 | Bacteria | 3470 |
| 1231 | Ga0495660_0027189 | 3300046810 | Bacteria | 3237 |
| 1232 | Ga0495660_0027238 | 3300046810 | Bacteria | 3234 |
| 1233 | Ga0495660_0040853 | 3300046810 | Bacteria | 2570 |
| 1234 | Ga0495660_0044583 | 3300046810 | Bacteria | 2439 |
| 1235 | Ga0495660_0052625 | 3300046810 | Bacteria | 2211 |
| 1236 | Ga0495660_0056364 | 3300046810 | Bacteria | 2123 |
| 1237 | Ga0495660_0081089 | 3300046810 | Bacteria | 1701 |
| 1238 | Ga0495660_0098039 | 3300046810 | Bacteria | 1512 |
| 1239 | Ga0495581_0001182 | 3300047315 | Bacteria | 14322 |
| 1240 | Ga0495581_0018281 | 3300047315 | Bacteria | 4071 |
| 1241 | Ga0495604_0002061 | 3300047317 | Bacteria | 16221 |
| 1242 | Ga0495604_0009953 | 3300047317 | Bacteria | 7523 |
| 1243 | Ga0495604_0022590 | 3300047317 | Bacteria | 5022 |
| 1244 | Ga0495604_0053855 | 3300047317 | Bacteria | 3107 |
| 1245 | Ga0495604_0067426 | 3300047317 | Bacteria | 2719 |
| 1246 | Ga0495604_0161728 | 3300047317 | Bacteria | 1581 |
| 1247 | Ga0495636_0004934 | 3300047318 | Bacteria | 5231 |
| 1248 | Ga0495636_0010146 | 3300047318 | Bacteria | 3714 |
| 1249 | Ga0495636_0069254 | 3300047318 | Bacteria | 1503 |
| 1250 | Ga0495674_0105651 | 3300047319 | Bacteria | 2392 |
| 1251 | Ga0495672_0000175 | 3300047320 | Bacteria | 93127 |
| 1252 | Ga0495672_0000211 | 3300047320 | Bacteria | 83189 |
| 1253 | Ga0495672_0000713 | 3300047320 | Bacteria | 36575 |
| 1254 | Ga0495672_0000791 | 3300047320 | Bacteria | 34302 |
| 1255 | Ga0495672_0002178 | 3300047320 | Bacteria | 18255 |
| 1256 | Ga0495672_0004423 | 3300047320 | Bacteria | 11518 |
| 1257 | Ga0495672_0006647 | 3300047320 | Bacteria | 8884 |
| 1258 | Ga0495672_0017107 | 3300047320 | Bacteria | 4857 |
| 1259 | Ga0495672_0026020 | 3300047320 | Bacteria | 3738 |
| 1260 | Ga0495672_0026303 | 3300047320 | Bacteria | 3714 |
| 1261 | Ga0495672_0044888 | 3300047320 | Bacteria | 2648 |
| 1262 | Ga0495672_0045939 | 3300047320 | Bacteria | 2608 |
| 1263 | Ga0495672_0130230 | 3300047320 | Bacteria | 1324 |
| 1264 | Ga0495672_0139788 | 3300047320 | Bacteria | 1266 |
| 1265 | Ga0495676_0000249 | 3300047321 | Bacteria | 43337 |
| 1266 | Ga0495676_0022534 | 3300047321 | Bacteria | 5477 |
| 1267 | Ga0495676_0178833 | 3300047321 | Bacteria | 1488 |
| 1268 | Ga0495680_0011318 | 3300047322 | Bacteria | 7906 |
| 1269 | Ga0495680_0015065 | 3300047322 | Bacteria | 6677 |
| 1270 | Ga0495680_0031698 | 3300047322 | Bacteria | 4298 |
| 1271 | Ga0495680_0049045 | 3300047322 | Bacteria | 3311 |
| 1272 | Ga0495683_0000379 | 3300047323 | Bacteria | 36310 |
| 1273 | Ga0495683_0000455 | 3300047323 | Bacteria | 32160 |
| 1274 | Ga0495683_0011680 | 3300047323 | Bacteria | 4621 |
| 1275 | Ga0495683_0016203 | 3300047323 | Bacteria | 3871 |
| 1276 | Ga0495683_0016306 | 3300047323 | Bacteria | 3859 |
| 1277 | Ga0495683_0019281 | 3300047323 | Bacteria | 3521 |
| 1278 | Ga0495683_0025030 | 3300047323 | Bacteria | 3060 |
| 1279 | Ga0495683_0036817 | 3300047323 | Bacteria | 2482 |
| 1280 | Ga0495683_0103026 | 3300047323 | Bacteria | 1370 |
| 1281 | Ga0495683_0110945 | 3300047323 | Bacteria | 1309 |
| 1282 | Ga0495683_0156516 | 3300047323 | Bacteria | 1056 |
| 1283 | Ga0495683_0191766 | 3300047323 | Bacteria | 926 |
| 1284 | Ga0495683_0308166 | 3300047323 | Bacteria | 678 |
| 1285 | Ga0495683_0311056 | 3300047323 | Bacteria | 674 |
| 1286 | Ga0495683_0430931 | 3300047323 | Bacteria | 544 |
| 1287 | Ga0495687_000008 | 3300047443 | Bacteria | 546666 |
| 1288 | Ga0495687_000145 | 3300047443 | Bacteria | 108089 |
| 1289 | Ga0495687_000146 | 3300047443 | Bacteria | 107228 |
| 1290 | Ga0495687_000431 | 3300047443 | Bacteria | 51764 |
| 1291 | Ga0495687_000693 | 3300047443 | Bacteria | 38036 |
| 1292 | Ga0495687_000975 | 3300047443 | Bacteria | 29034 |
| 1293 | Ga0495687_002916 | 3300047443 | Bacteria | 13012 |
| 1294 | Ga0495675_0013464 | 3300047444 | Bacteria | 5163 |
| 1295 | Ga0495675_0013530 | 3300047444 | Bacteria | 5151 |
| 1296 | Ga0495677_0000032 | 3300047445 | Bacteria | 84112 |
| 1297 | Ga0495677_0000788 | 3300047445 | Bacteria | 12782 |
| 1298 | Ga0495677_0003156 | 3300047445 | Bacteria | 6427 |
| 1299 | Ga0495677_0005033 | 3300047445 | Bacteria | 5038 |
| 1300 | Ga0495677_0008007 | 3300047445 | Bacteria | 3927 |
| 1301 | Ga0495677_0024896 | 3300047445 | Bacteria | 2171 |
| 1302 | Ga0495677_0028261 | 3300047445 | Bacteria | 2036 |
| 1303 | Ga0495677_0031484 | 3300047445 | Bacteria | 1930 |
| 1304 | Ga0495677_0066973 | 3300047445 | Bacteria | 1336 |
| 1305 | Ga0495677_0124217 | 3300047445 | Bacteria | 985 |
| 1306 | Ga0495677_0377305 | 3300047445 | Bacteria | 560 |
| 1307 | Ga0495679_009031 | 3300047446 | Bacteria | 4015 |
| 1308 | Ga0495679_012864 | 3300047446 | Bacteria | 3166 |
| 1309 | Ga0495679_015239 | 3300047446 | Bacteria | 2818 |
| 1310 | Ga0495679_043903 | 3300047446 | Bacteria | 1371 |
| 1311 | Ga0495685_008153 | 3300047447 | Bacteria | 3471 |
| 1312 | Ga0495685_008948 | 3300047447 | Bacteria | 3338 |
| 1313 | Ga0495673_0000168 | 3300047469 | Bacteria | 108628 |
| 1314 | Ga0495673_0000345 | 3300047469 | Bacteria | 58540 |
| 1315 | Ga0495673_0000806 | 3300047469 | Bacteria | 29458 |
| 1316 | Ga0495673_0000864 | 3300047469 | Bacteria | 28042 |
| 1317 | Ga0495673_0001321 | 3300047469 | Bacteria | 20143 |
| 1318 | Ga0495673_0015400 | 3300047469 | Bacteria | 3942 |
| 1319 | Ga0495673_0030392 | 3300047469 | Bacteria | 2536 |
| 1320 | Ga0495673_0052620 | 3300047469 | Bacteria | 1778 |
| 1321 | Ga0495673_0058214 | 3300047469 | Bacteria | 1666 |
| 1322 | Ga0495673_0138087 | 3300047469 | Bacteria | 952 |
| 1323 | Ga0495681_0000226 | 3300047470 | Bacteria | 47165 |
| 1324 | Ga0495681_0000337 | 3300047470 | Bacteria | 37087 |
| 1325 | Ga0495681_0000352 | 3300047470 | Bacteria | 35925 |
| 1326 | Ga0495681_0000542 | 3300047470 | Bacteria | 28962 |
| 1327 | Ga0495681_0001101 | 3300047470 | Bacteria | 20520 |
| 1328 | Ga0495681_0002566 | 3300047470 | Bacteria | 12918 |
| 1329 | Ga0495681_0002749 | 3300047470 | Bacteria | 12452 |
| 1330 | Ga0495681_0003430 | 3300047470 | Bacteria | 11027 |
| 1331 | Ga0495681_0003770 | 3300047470 | Bacteria | 10505 |
| 1332 | Ga0495681_0006642 | 3300047470 | Bacteria | 7553 |
| 1333 | Ga0495681_0007160 | 3300047470 | Bacteria | 7174 |
| 1334 | Ga0495681_0009454 | 3300047470 | Bacteria | 6002 |
| 1335 | Ga0495681_0011118 | 3300047470 | Bacteria | 5394 |
| 1336 | Ga0495681_0012930 | 3300047470 | Bacteria | 4879 |
| 1337 | Ga0495681_0013140 | 3300047470 | Bacteria | 4825 |
| 1338 | Ga0495681_0013194 | 3300047470 | Bacteria | 4809 |
| 1339 | Ga0495681_0018952 | 3300047470 | Bacteria | 3774 |
| 1340 | Ga0495681_0034154 | 3300047470 | Bacteria | 2537 |
| 1341 | Ga0495681_0042900 | 3300047470 | Bacteria | 2185 |
| 1342 | Ga0495681_0269403 | 3300047470 | Bacteria | 667 |
| 1343 | Ga0495684_0019640 | 3300047471 | Bacteria | 5206 |
| 1344 | Ga0495686_0001754 | 3300047472 | Bacteria | 22253 |
| 1345 | Ga0495686_0001790 | 3300047472 | Bacteria | 21802 |
| 1346 | Ga0495686_0002429 | 3300047472 | Bacteria | 17615 |
| 1347 | Ga0495686_0007527 | 3300047472 | Bacteria | 8154 |
| 1348 | Ga0495686_0007845 | 3300047472 | Bacteria | 7936 |
| 1349 | Ga0495686_0015584 | 3300047472 | Bacteria | 5185 |
| 1350 | Ga0495686_0025391 | 3300047472 | Bacteria | 3884 |
| 1351 | Ga0495686_0026121 | 3300047472 | Bacteria | 3822 |
| 1352 | Ga0495686_0027612 | 3300047472 | Bacteria | 3704 |
| 1353 | Ga0495686_0055647 | 3300047472 | Bacteria | 2473 |
| 1354 | Ga0495593_0010306 | 3300047673 | Bacteria | 5402 |
| 1355 | Ga0495593_0013561 | 3300047673 | Bacteria | 4646 |
| 1356 | Ga0495593_0060193 | 3300047673 | Bacteria | 1988 |
| 1357 | Ga0495593_0169718 | 3300047673 | Bacteria | 1100 |
| 1358 | Ga0495602_0048745 | 3300048088 | Bacteria | 3802 |
| 1359 | Ga0495602_0109331 | 3300048088 | Bacteria | 2249 |
| 1360 | Ga0495614_0005443 | 3300048089 | Bacteria | 5739 |
| 1361 | Ga0495614_0045894 | 3300048089 | Bacteria | 1873 |
| 1362 | Ga0495615_0007411 | 3300048090 | Bacteria | 2082 |
| 1363 | Ga0495615_0174205 | 3300048090 | Bacteria | 653 |
| 1364 | Ga0495626_0000047 | 3300048091 | Bacteria | 161939 |
| 1365 | Ga0495626_0000144 | 3300048091 | Bacteria | 89793 |
| 1366 | Ga0495626_0000179 | 3300048091 | Bacteria | 77215 |
| 1367 | Ga0495626_0000438 | 3300048091 | Bacteria | 42557 |
| 1368 | Ga0495626_0000622 | 3300048091 | Bacteria | 34519 |
| 1369 | Ga0495626_0001050 | 3300048091 | Bacteria | 23620 |
| 1370 | Ga0495626_0002234 | 3300048091 | Bacteria | 13879 |
| 1371 | Ga0495626_0005272 | 3300048091 | Bacteria | 7639 |
| 1372 | Ga0495626_0005442 | 3300048091 | Bacteria | 7453 |
| 1373 | Ga0495626_0009525 | 3300048091 | Bacteria | 5247 |
| 1374 | Ga0495626_0012574 | 3300048091 | Bacteria | 4428 |
| 1375 | Ga0495626_0014314 | 3300048091 | Bacteria | 4096 |
| 1376 | Ga0495626_0019038 | 3300048091 | Bacteria | 3436 |
| 1377 | Ga0495626_0020586 | 3300048091 | Bacteria | 3284 |
| 1378 | Ga0495626_0020769 | 3300048091 | Bacteria | 3268 |
| 1379 | Ga0495626_0025765 | 3300048091 | Bacteria | 2873 |
| 1380 | Ga0495626_0025859 | 3300048091 | Bacteria | 2866 |
| 1381 | Ga0495626_0035950 | 3300048091 | Bacteria | 2362 |
| 1382 | Ga0495626_0039825 | 3300048091 | Bacteria | 2221 |
| 1383 | Ga0495626_0079086 | 3300048091 | Bacteria | 1463 |
| 1384 | Ga0495626_0096030 | 3300048091 | Bacteria | 1297 |
| 1385 | Ga0495626_0167515 | 3300048091 | Bacteria | 917 |
| 1386 | Ga0496100_0147676 | 3300048903 | Bacteria | 1673 |
| 1387 | Ga0496101_0787192 | 3300048904 | Bacteria | 750 |
| 1388 | Ga0496102_0000250 | 3300048905 | Bacteria | 70330 |
| 1389 | Ga0496102_0257558 | 3300048905 | Bacteria | 1645 |
| 1390 | Ga0496102_0343938 | 3300048905 | Bacteria | 1404 |
| 1391 | Ga0496103_0005019 | 3300048906 | Bacteria | 7980 |
| 1392 | Ga0496103_0561665 | 3300048906 | Bacteria | 728 |
| 1393 | Ga0496104_0761336 | 3300048907 | Bacteria | 875 |
| 1394 | Ga0496104_0806553 | 3300048907 | Bacteria | 845 |
| 1395 | Ga0496105_0193578 | 3300048908 | Bacteria | 1662 |
| 1396 | Ga0496106_0007635 | 3300048909 | Bacteria | 7997 |
| 1397 | Ga0496106_0192259 | 3300048909 | Bacteria | 1623 |
| 1398 | Ga0496107_0037923 | 3300048910 | Bacteria | 3459 |
| 1399 | Ga0496107_0162723 | 3300048910 | Bacteria | 1654 |
| 1400 | Ga0496108_0442207 | 3300048911 | Bacteria | 1136 |
| 1401 | Ga0496109_0561836 | 3300048912 | Bacteria | 1076 |
| 1402 | Ga0496110_0000454 | 3300048913 | Bacteria | 27858 |
| 1403 | Ga0496110_1212288 | 3300048913 | Bacteria | 664 |
| 1404 | Ga0496111_0074105 | 3300048914 | Bacteria | 2479 |
| 1405 | Ga0496111_0277262 | 3300048914 | Bacteria | 1244 |
| 1406 | Ga0496112_1817272 | 3300048915 | Bacteria | 521 |
| 1407 | Ga0496113_0022628 | 3300048916 | Bacteria | 4449 |
| 1408 | Ga0496113_0049917 | 3300048916 | Bacteria | 3117 |
| 1409 | Ga0496113_0345044 | 3300048916 | Bacteria | 1194 |
| 1410 | Ga0496114_0755263 | 3300048917 | Bacteria | 850 |
| 1411 | Ga0496115_0220198 | 3300048918 | Bacteria | 1566 |
| 1412 | Ga0496115_0730276 | 3300048918 | Bacteria | 776 |
| 1413 | Ga0496115_0939413 | 3300048918 | Bacteria | 665 |
| 1414 | Ga0496116_0000168 | 3300048919 | Bacteria | 132462 |
| 1415 | Ga0496116_0000963 | 3300048919 | Bacteria | 35538 |
| 1416 | Ga0496116_0028013 | 3300048919 | Bacteria | 4090 |
| 1417 | Ga0496116_0028221 | 3300048919 | Bacteria | 4070 |
| 1418 | Ga0496116_0244493 | 3300048919 | Bacteria | 898 |
| 1419 | Ga0496116_0251204 | 3300048919 | Bacteria | 880 |
| 1420 | Ga0496117_0000349 | 3300048920 | Bacteria | 81440 |
| 1421 | Ga0496117_0018177 | 3300048920 | Bacteria | 5836 |
| 1422 | Ga0496117_0032385 | 3300048920 | Bacteria | 3972 |
| 1423 | Ga0496117_0179959 | 3300048920 | Bacteria | 1216 |
| 1424 | Ga0496118_0033027 | 3300048921 | Bacteria | 4253 |
| 1425 | Ga0496118_0124642 | 3300048921 | Bacteria | 1670 |
| 1426 | Ga0496119_0019951 | 3300048922 | Bacteria | 4910 |
| 1427 | Ga0496121_0000199 | 3300048924 | Bacteria | 132751 |
| 1428 | Ga0496121_0041104 | 3300048924 | Bacteria | 4047 |
| 1429 | Ga0496121_0054073 | 3300048924 | Bacteria | 3358 |
| 1430 | Ga0496121_0273413 | 3300048924 | Bacteria | 1160 |
| 1431 | Ga0496122_0000316 | 3300048925 | Bacteria | 106100 |
| 1432 | Ga0496122_0000641 | 3300048925 | Bacteria | 71027 |
| 1433 | Ga0496122_0003680 | 3300048925 | Bacteria | 19876 |
| 1434 | Ga0496122_0011462 | 3300048925 | Bacteria | 8973 |
| 1435 | Ga0496122_0011785 | 3300048925 | Bacteria | 8800 |
| 1436 | Ga0496122_0014609 | 3300048925 | Bacteria | 7578 |
| 1437 | Ga0496122_0037555 | 3300048925 | Bacteria | 3895 |
| 1438 | Ga0496122_0050059 | 3300048925 | Bacteria | 3190 |
| 1439 | Ga0496122_0106080 | 3300048925 | Bacteria | 1861 |
| 1440 | Ga0496123_0000297 | 3300048926 | Bacteria | 97340 |
| 1441 | Ga0496123_0001430 | 3300048926 | Bacteria | 33347 |
| 1442 | Ga0496123_0002937 | 3300048926 | Bacteria | 19934 |
| 1443 | Ga0496123_0003718 | 3300048926 | Bacteria | 16784 |
| 1444 | Ga0496123_0007797 | 3300048926 | Bacteria | 9971 |
| 1445 | Ga0496123_0013631 | 3300048926 | Bacteria | 6801 |
| 1446 | Ga0496123_0023708 | 3300048926 | Bacteria | 4689 |
| 1447 | Ga0496123_0033396 | 3300048926 | Bacteria | 3704 |
| 1448 | Ga0496123_0149808 | 3300048926 | Bacteria | 1261 |
| 1449 | Ga0496124_0013088 | 3300048927 | Bacteria | 8125 |
| 1450 | Ga0496124_0025844 | 3300048927 | Bacteria | 5308 |
| 1451 | Ga0496124_0031442 | 3300048927 | Bacteria | 4698 |
| 1452 | Ga0496124_0047412 | 3300048927 | Bacteria | 3677 |
| 1453 | Ga0496124_0076175 | 3300048927 | Bacteria | 2770 |
| 1454 | Ga0496124_0103897 | 3300048927 | Bacteria | 2298 |
| 1455 | Ga0496124_0111067 | 3300048927 | Bacteria | 2206 |
| 1456 | Ga0496124_0124740 | 3300048927 | Bacteria | 2053 |
| 1457 | Ga0496124_0148196 | 3300048927 | Bacteria | 1844 |
| 1458 | Ga0496124_0166643 | 3300048927 | Bacteria | 1711 |
| 1459 | Ga0496124_0299627 | 3300048927 | Bacteria | 1162 |
| 1460 | Ga0496124_0474680 | 3300048927 | Bacteria | 846 |
| 1461 | Ga0496124_0727923 | 3300048927 | Bacteria | 625 |
| 1462 | Ga0496125_0003422 | 3300048928 | Bacteria | 19267 |
| 1463 | Ga0496125_0004591 | 3300048928 | Bacteria | 15786 |
| 1464 | Ga0496125_0030081 | 3300048928 | Bacteria | 4864 |
| 1465 | Ga0496125_0031181 | 3300048928 | Bacteria | 4755 |
| 1466 | Ga0496125_0041563 | 3300048928 | Bacteria | 3928 |
| 1467 | Ga0496125_0146229 | 3300048928 | Bacteria | 1633 |
| 1468 | Ga0496125_0389768 | 3300048928 | Bacteria | 818 |
| 1469 | Ga0496126_0043004 | 3300048929 | Bacteria | 4170 |
| 1470 | Ga0496126_0100020 | 3300048929 | Bacteria | 2539 |
| 1471 | Ga0496126_0635286 | 3300048929 | Bacteria | 837 |
| 1472 | Ga0495678_000013 | 3300049459 | Bacteria | 316375 |
| 1473 | Ga0495678_000194 | 3300049459 | Bacteria | 71366 |
| 1474 | Ga0495678_000546 | 3300049459 | Bacteria | 36290 |
| 1475 | Ga0495678_000698 | 3300049459 | Bacteria | 30571 |
| 1476 | Ga0495678_001022 | 3300049459 | Bacteria | 23793 |
| 1477 | Ga0495678_001038 | 3300049459 | Bacteria | 23535 |
| 1478 | Ga0495678_007887 | 3300049459 | Bacteria | 5465 |
| 1479 | Ga0495678_011877 | 3300049459 | Bacteria | 4151 |
| 1480 | Ga0495678_012756 | 3300049459 | Bacteria | 3970 |
| 1481 | Ga0495678_014774 | 3300049459 | Bacteria | 3618 |
| 1482 | Ga0495678_042536 | 3300049459 | Bacteria | 1810 |
| 1483 | Ga0495682_0002605 | 3300049460 | Bacteria | 8464 |
| 1484 | Ga0495682_0007313 | 3300049460 | Bacteria | 4404 |
| 1485 | Ga0495682_0007341 | 3300049460 | Bacteria | 4396 |
| 1486 | Ga0495682_0008144 | 3300049460 | Bacteria | 4140 |
| 1487 | Ga0495682_0008658 | 3300049460 | Bacteria | 4006 |
| 1488 | Ga0495682_0009742 | 3300049460 | Bacteria | 3742 |
| 1489 | Ga0495682_0033483 | 3300049460 | Bacteria | 1896 |
| 1490 | Ga0495682_0034287 | 3300049460 | Bacteria | 1872 |
| 1491 | Ga0495682_0086973 | 3300049460 | Bacteria | 1123 |
| 1492 | Ga0501297_027049 | 3300049520 | Bacteria | 746 |
| 1493 | Ga0501034_0014450 | 3300049571 | Bacteria | 8130 |
| 1494 | Ga0501039_0145308 | 3300049575 | Bacteria | 1864 |
| 1495 | Ga0501043_0003156 | 3300049579 | Bacteria | 13634 |
| 1496 | Ga0501043_0299962 | 3300049579 | Bacteria | 1228 |
| 1497 | Ga0501046_0559692 | 3300049580 | Bacteria | 814 |
| 1498 | Ga0501047_0002344 | 3300049581 | Bacteria | 18111 |
| 1499 | Ga0501047_0650630 | 3300049581 | Bacteria | 873 |
| 1500 | Ga0501071_1332578 | 3300049587 | Bacteria | 554 |
| 1501 | Ga0501207_051548 | 3300049654 | Bacteria | 736 |
| 1502 | Ga0501227_108976 | 3300049665 | Bacteria | 741 |
| 1503 | Ga0501235_060686 | 3300049669 | Bacteria | 885 |
| 1504 | Ga0501248_036485 | 3300049678 | Bacteria | 584 |
| 1505 | Ga0501221_068150 | 3300049704 | Bacteria | 835 |
| 1506 | Ga0501225_0089762 | 3300049705 | Bacteria | 889 |
| 1507 | Ga0501241_002151 | 3300049758 | Bacteria | 3847 |
| 1508 | Ga0501279_001689 | 3300049775 | Bacteria | 2908 |
| 1509 | Ga0501279_002506 | 3300049775 | Bacteria | 2406 |
| 1510 | Ga0501035_0002745 | 3300049822 | Bacteria | 17079 |
| 1511 | Ga0501044_0005853 | 3300049823 | Bacteria | 13619 |
| 1512 | Ga0501044_0045405 | 3300049823 | Bacteria | 4552 |
| 1513 | Ga0501045_0587792 | 3300049824 | Bacteria | 825 |
| 1514 | Ga0501226_000009 | 3300049853 | Bacteria | 194138 |
| 1515 | nmdc:mga03683_126408_c1 | 3300050489 | Bacteria | 1141 |
| 1516 | nmdc:mga03683_88772_c1 | 3300050489 | Bacteria | 1345 |
| 1517 | nmdc:mga0yw44_129498_c1 | 3300050492 | Bacteria | 1632 |
| 1518 | nmdc:mga09592_83307_c1 | 3300050508 | Bacteria | 2726 |
| 1519 | nmdc:mga0qj67_275453_c1 | 3300050509 | Bacteria | 1364 |
| 1520 | nmdc:mga0qj67_36742_c1 | 3300050509 | Bacteria | 3834 |
| 1521 | nmdc:mga08y16_18074_c1 | 3300050511 | Bacteria | 7426 |
| 1522 | nmdc:mga08x19_170545_c1 | 3300050514 | Bacteria | 1482 |
| 1523 | Ga0495601_0503555 | 3300053077 | Bacteria | 781 |
| 1524 | Ga0500643_003260 | 3300053087 | Bacteria | 7905 |
| 1525 | Ga0500644_0330723 | 3300053088 | Bacteria | 656 |
| 1526 | Ga0500647_0083897 | 3300053091 | Bacteria | 1528 |
| 1527 | Ga0500651_0004291 | 3300053093 | Bacteria | 7964 |
| 1528 | Ga0500641_0001855 | 3300053096 | Bacteria | 7498 |
| 1529 | Ga0500641_0038093 | 3300053096 | Bacteria | 1930 |
| 1530 | Ga0500556_0130829 | 3300053104 | Bacteria | 983 |
| 1531 | Ga0500595_016106 | 3300053119 | Bacteria | 2791 |
| 1532 | Ga0500617_218056 | 3300053124 | Bacteria | 681 |
| 1533 | Ga0500618_000166 | 3300053125 | Bacteria | 55289 |
| 1534 | Ga0500618_011422 | 3300053125 | Bacteria | 2354 |
| 1535 | Ga0500642_0021900 | 3300053130 | Bacteria | 2539 |
| 1536 | Ga0500655_000055 | 3300053133 | Bacteria | 30746 |
| 1537 | Ga0500658_0293939 | 3300053134 | Bacteria | 747 |
| 1538 | Ga0500588_0001411 | 3300053146 | Bacteria | 4561 |
| 1539 | Ga0500590_000433 | 3300053148 | Bacteria | 14077 |
| 1540 | Ga0500622_0003868 | 3300053156 | Bacteria | 9722 |
| 1541 | Ga0500622_0003968 | 3300053156 | Bacteria | 9547 |
| 1542 | Ga0500624_013669 | 3300053157 | Bacteria | 1218 |
| 1543 | Ga0500634_0045136 | 3300053161 | Bacteria | 2385 |
| 1544 | Ga0500570_006654 | 3300053724 | Bacteria | 6292 |
| 1545 | Ga0587083_0098646 | 3300059505 | Bacteria | 724 |
| 1546 | Ga0466962_0014880 | 3300061719 | Bacteria | 3749 |
| 1547 | 2886851987 | 2886848708 | Bacteria | 5632523 |
| 1548 | 2886853868 | 2886848708 | Bacteria | 5632523 |
| 1549 | Ga0439448_0128794 | |||
| 1550 | MRS2a_Contig_45 | |||
| 1551 | MRS2a_Contig_9372 | |||
| 1552 | JGI24752J21851_1021702 | |||
| 1553 | JGI24735J21928_10021972 | |||
| 1554 | JGI24738J21930_10001352 | |||
| 1555 | JGI24751J29686_10000159 | |||
| 1556 | JGI24751J29686_10088548 | |||
| 1557 | JGI25162J39368_1000077 | |||
| 1558 | JGI25163J39215_1002571 | |||
| 1559 | JGI25164J39214_1000054 | |||
| 1560 | JGI25159J45721_1003671 | |||
| 1561 | JGI25159J45721_1012560 | |||
| 1562 | JGI25165J46597_1000141 | |||
| 1563 | rootH2_10042118 | |||
| 1564 | rootL2_10000012 | |||
| 1565 | rootL2_10011570 | |||
| 1566 | rootL2_10014870 | |||
| 1567 | rootH1_10011197 | |||
| 1568 | JGI25160J50197_1001086 | |||
| 1569 | JGI25161J50226_1000635 | |||
| 1570 | JGI25161J50226_1002018 | |||
| 1571 | Ga0007409J51694_1020847 | |||
| 1572 | Ga0055525_1000006 | |||
| 1573 | Ga0055535_1000125 | |||
| 1574 | Ga0055529_1000027 | |||
| 1575 | Ga0055529_1000266 | |||
| 1576 | Ga0055526_1000026 | |||
| 1577 | Ga0055526_1001230 | |||
| 1578 | Ga0055526_1001493 | |||
| 1579 | Ga0055526_1001929 | |||
| 1580 | Ga0055537_1000040 | |||
| 1581 | Ga0055537_1018304 | |||
| 1582 | Ga0055524_1000022 | |||
| 1583 | Ga0055524_1008037 | |||
| 1584 | Ga0055536_1000239 | |||
| 1585 | Ga0055534_1000315 | |||
| 1586 | Ga0055534_1000721 | |||
| 1587 | Ga0055528_1000031 | |||
| 1588 | Ga0055528_1006806 | |||
| 1589 | Ga0055530_10000289 | |||
| 1590 | Ga0055530_10066717 | |||
| 1591 | Ga0055540_1000105 | |||
| 1592 | Ga0055531_10000081 | |||
| 1593 | Ga0055531_10004422 | |||
| 1594 | Ga0055531_10017764 | |||
| 1595 | Ga0055531_10029637 | |||
| 1596 | Ga0055543_1000583 | |||
| 1597 | Ga0065165_1001411 | |||
| 1598 | Ga0065165_1001901 | |||
| 1599 | Ga0065165_1027497 | |||
| 1600 | Ga0065714_10000389 | |||
| 1601 | Ga0065714_10002400 | |||
| 1602 | Ga0065714_10005850 | |||
| 1603 | Ga0065714_10008779 | |||
| 1604 | Ga0065714_10023077 | |||
| 1605 | Ga0065714_10026003 | |||
| 1606 | Ga0065714_10067402 | |||
| 1607 | Ga0065714_10079588 | |||
| 1608 | Ga0065704_10140029 | |||
| 1609 | Ga0065704_10289546 | |||
| 1610 | Ga0065704_10456255 | |||
| 1611 | Ga0065704_10519665 | |||
| 1612 | Ga0065712_10003377 | |||
| 1613 | Ga0065715_10031490 | |||
| 1614 | Ga0065707_10088786 | |||
| 1615 | Ga0065707_10175196 | |||
| 1616 | Ga0065707_10325404 | |||
| 1617 | Ga0070658_10021055 | |||
| 1618 | Ga0070658_10197458 | |||
| 1619 | Ga0070658_10275546 | |||
| 1620 | Ga0070658_10853251 | |||
| 1621 | Ga0070676_10991683 | |||
| 1622 | Ga0070670_100000002 | |||
| 1623 | Ga0070670_100000003 | |||
| 1624 | Ga0070666_10016105 | |||
| 1625 | Ga0070666_10229741 | |||
| 1626 | Ga0070680_100030024 | |||
| 1627 | Ga0070680_100213509 | |||
| 1628 | Ga0070682_100011968 | |||
| 1629 | Ga0070660_100020940 | |||
| 1630 | Ga0070660_100150433 | |||
| 1631 | Ga0070689_100172061 | |||
| 1632 | Ga0070668_100000024 | |||
| 1633 | Ga0070669_100000044 | |||
| 1634 | Ga0070669_100001750 | |||
| 1635 | Ga0070669_100324128 | |||
| 1636 | Ga0070671_100000021 | |||
| 1637 | Ga0070671_100000022 | |||
| 1638 | Ga0070671_100203697 | |||
| 1639 | Ga0070671_100287788 | |||
| 1640 | Ga0070674_100351426 | |||
| 1641 | Ga0070688_100012791 | |||
| 1642 | Ga0070659_100004222 | |||
| 1643 | Ga0070659_100028518 | |||
| 1644 | Ga0070659_100034293 | |||
| 1645 | Ga0070667_100000007 | |||
| 1646 | Ga0070667_100000009 | |||
| 1647 | Ga0070667_100004979 | |||
| 1648 | Ga0070667_100009741 | |||
| 1649 | Ga0070681_10057938 | |||
| 1650 | Ga0070685_10000045 | |||
| 1651 | Ga0070706_100055284 | |||
| 1652 | Ga0070706_100619303 | |||
| 1653 | Ga0070679_100065992 | |||
| 1654 | Ga0070679_101489182 | |||
| 1655 | Ga0068853_100102412 | |||
| 1656 | Ga0068853_100341341 | |||
| 1657 | Ga0068853_100377817 | |||
| 1658 | Ga0070672_100202644 | |||
| 1659 | Ga0070665_100007779 | |||
| 1660 | Ga0070665_100107308 | |||
| 1661 | Ga0070665_100203290 | |||
| 1662 | Ga0070665_101139794 | |||
| 1663 | Ga0068855_100033044 | |||
| 1664 | Ga0068855_100055196 | |||
| 1665 | Ga0068855_100060086 | |||
| 1666 | Ga0068855_100473000 | |||
| 1667 | Ga0068855_100505663 | |||
| 1668 | Ga0068855_100886500 | |||
| 1669 | Ga0070664_100006272 | |||
| 1670 | Ga0070664_100297269 | |||
| 1671 | Ga0068857_100039222 | |||
| 1672 | Ga0068857_100478505 | |||
| 1673 | Ga0068854_100760140 | |||
| 1674 | Ga0068854_100773527 | |||
| 1675 | Ga0068854_101253762 | |||
| 1676 | Ga0070702_100504323 | |||
| 1677 | Ga0068852_100777286 | |||
| 1678 | Ga0068852_101287808 | |||
| 1679 | Ga0068859_100004323 | |||
| 1680 | Ga0068859_100009996 | |||
| 1681 | Ga0068859_100018303 | |||
| 1682 | Ga0068864_100000003 | |||
| 1683 | Ga0068864_100000005 | |||
| 1684 | Ga0068864_100001183 | |||
| 1685 | Ga0068864_100776642 | |||
| 1686 | Ga0068861_100001464 | |||
| 1687 | Ga0068861_100005090 | |||
| 1688 | Ga0068861_100019600 | |||
| 1689 | Ga0068863_100027064 | |||
| 1690 | Ga0068863_100203117 | |||
| 1691 | Ga0068863_100207590 | |||
| 1692 | Ga0068863_100571281 | |||
| 1693 | Ga0068858_100001634 | |||
| 1694 | Ga0068858_100772035 | |||
| 1695 | Ga0068860_100000036 | |||
| 1696 | Ga0068860_100052866 | |||
| 1697 | Ga0068860_100846413 | |||
| 1698 | Ga0068862_100000001 | |||
| 1699 | Ga0068862_100000031 | |||
| 1700 | Ga0068862_100003139 | |||
| 1701 | Ga0075363_100200978 | |||
| 1702 | Ga0075364_10160659 | |||
| 1703 | Ga0075432_10030143 | |||
| 1704 | Ga0075362_10012369 | |||
| 1705 | Ga0075362_10196274 | |||
| 1706 | Ga0075370_10112812 | |||
| 1707 | Ga0068871_100453475 | |||
| 1708 | Ga0075430_100209527 | |||
| 1709 | Ga0075430_100343339 | |||
| 1710 | Ga0075429_100004191 | |||
| 1711 | Ga0075436_100017850 | |||
| 1712 | Ga0075436_100160070 | |||
| 1713 | Ga0097620_100004323 | |||
| 1714 | Ga0097620_100009996 | |||
| 1715 | Ga0097620_100018303 | |||
| 1716 | Ga0079104_1000124 | |||
| 1717 | Ga0099826_10000006 | |||
| 1718 | Ga0105251_10017336 | |||
| 1719 | Ga0105251_10018324 | |||
| 1720 | Ga0105251_10052956 | |||
| 1721 | Ga0105244_10037127 | |||
| 1722 | Ga0105244_10038332 | |||
| 1723 | Ga0105244_10122195 | |||
| 1724 | Ga0105244_10128522 | |||
| 1725 | Ga0105244_10135946 | |||
| 1726 | Ga0105244_10397273 | |||
| 1727 | Ga0105250_10010197 | |||
| 1728 | Ga0105250_10046527 | |||
| 1729 | Ga0105250_10074668 | |||
| 1730 | Ga0105250_10104162 | |||
| 1731 | Ga0105250_10217304 | |||
| 1732 | Ga0105240_10005944 | |||
| 1733 | Ga0105240_10129159 | |||
| 1734 | Ga0111539_10017877 | |||
| 1735 | Ga0105245_11278290 | |||
| 1736 | Ga0105247_10011895 | |||
| 1737 | Ga0105247_10144347 | |||
| 1738 | Ga0105243_10000103 | |||
| 1739 | Ga0105243_10000405 | |||
| 1740 | Ga0105243_10031470 | |||
| 1741 | Ga0105243_10073320 | |||
| 1742 | Ga0105243_10099353 | |||
| 1743 | Ga0105241_10009599 | |||
| 1744 | Ga0105241_10675699 | |||
| 1745 | Ga0105241_10910051 | |||
| 1746 | Ga0105242_10005643 | |||
| 1747 | Ga0105242_10302456 | |||
| 1748 | Ga0105248_10000287 | |||
| 1749 | Ga0105248_10209731 | |||
| 1750 | Ga0105248_10493043 | |||
| 1751 | Ga0105248_10691642 | |||
| 1752 | Ga0105248_10948822 | |||
| 1753 | Ga0105237_10078325 | |||
| 1754 | Ga0105237_10135253 | |||
| 1755 | Ga0105237_10680398 | |||
| 1756 | Ga0105238_10018481 | |||
| 1757 | Ga0105238_10285121 | |||
| 1758 | Ga0105238_10317161 | |||
| 1759 | Ga0105249_10278950 | |||
| 1760 | Ga0105249_10758855 | |||
| 1761 | Ga0105239_10397996 | |||
| 1762 | Ga0105239_11722376 | |||
| 1763 | Ga0105246_10000120 | |||
| 1764 | Ga0105246_10098461 | |||
| 1765 | Ga0157336_1000705 | |||
| 1766 | Ga0157319_1000002 | |||
| 1767 | Ga0157345_1000026 | |||
| 1768 | Ga0157345_1001725 | |||
| 1769 | Ga0157326_1000736 | |||
| 1770 | Ga0157373_10020155 | |||
| 1771 | Ga0157373_10607360 | |||
| 1772 | Ga0157373_10828189 | |||
| 1773 | Ga0157371_10000306 | |||
| 1774 | Ga0157371_10000390 | |||
| 1775 | Ga0157370_10007188 | |||
| 1776 | Ga0157370_10314896 | |||
| 1777 | Ga0157370_11078259 | |||
| 1778 | Ga0157370_11457266 | |||
| 1779 | Ga0157370_11626435 | |||
| 1780 | Ga0157369_10059341 | |||
| 1781 | Ga0157369_10620265 | |||
| 1782 | Ga0157369_10642728 | |||
| 1783 | Ga0157369_10664827 | |||
| 1784 | Ga0157369_11830509 | |||
| 1785 | Ga0157374_12457235 | |||
| 1786 | Ga0163162_10000072 | |||
| 1787 | Ga0163162_10062385 | |||
| 1788 | Ga0163162_10149464 | |||
| 1789 | Ga0163162_10420529 | |||
| 1790 | Ga0163162_10923522 | |||
| 1791 | Ga0163162_11560880 | |||
| 1792 | Ga0157375_10682091 | |||
| 1793 | Ga0157375_11095634 | |||
| 1794 | Ga0157375_11871629 | |||
| 1795 | Ga0163163_10015793 | |||
| 1796 | Ga0157380_10000755 | |||
| 1797 | Ga0182008_10000074 | |||
| 1798 | Ga0182008_10001641 | |||
| 1799 | Ga0182008_10022635 | |||
| 1800 | Ga0182008_10086187 | |||
| 1801 | Ga0182008_10125378 | |||
| 1802 | Ga0182008_10165707 | |||
| 1803 | Ga0157379_10000004 | |||
| 1804 | Ga0157379_10172034 | |||
| 1805 | Ga0157379_10278871 | |||
| 1806 | Ga0157379_10791007 | |||
| 1807 | Ga0157376_10935445 | |||
| 1808 | Ga0157376_11490178 | |||
| 1809 | Ga0182006_1000541 | |||
| 1810 | Ga0182006_1005789 | |||
| 1811 | Ga0182006_1014845 | |||
| 1812 | Ga0182006_1073447 | |||
| 1813 | Ga0182005_1000322 | |||
| 1814 | Ga0182005_1006967 | |||
| 1815 | Ga0182005_1014740 | |||
| 1816 | Ga0182005_1199075 | |||
| 1817 | Ga0183368_1003 | |||
| 1818 | Ga0163161_10002829 | |||
| 1819 | Ga0163161_10010736 | |||
| 1820 | Ga0163161_10191969 | |||
| 1821 | Ga0163161_10367156 | |||
| 1822 | Ga0163161_10549660 | |||
| 1823 | Ga0163161_11388787 | |||
| 1824 | Ga0213872_10040129 | |||
| 1825 | Ga0209760_100634 | |||
| 1826 | Ga0209436_100125 | |||
| 1827 | Ga0209436_100539 | |||
| 1828 | Ga0209672_104200 | |||
| 1829 | Ga0209563_100022 | |||
| 1830 | Ga0207427_100074 | |||
| 1831 | Ga0209437_100006 | |||
| 1832 | Ga0209258_100071 | |||
| 1833 | Ga0207425_1000517 | |||
| 1834 | Ga0209148_1000650 | |||
| 1835 | Ga0209148_1005652 | |||
| 1836 | Ga0209759_1004340 | |||
| 1837 | Ga0209759_1007277 | |||
| 1838 | Ga0209129_1008048 | |||
| 1839 | Ga0209233_1000105 | |||
| 1840 | Ga0209565_1000035 | |||
| 1841 | Ga0209565_1000205 | |||
| 1842 | Ga0209565_1000806 | |||
| 1843 | Ga0209565_1001799 | |||
| 1844 | Ga0209565_1002557 | |||
| 1845 | Ga0209565_1006496 | |||
| 1846 | Ga0209455_1000030 | |||
| 1847 | Ga0209455_1000033 | |||
| 1848 | Ga0209673_1000006 | |||
| 1849 | Ga0209130_1001037 | |||
| 1850 | Ga0209130_1005649 | |||
| 1851 | Ga0209675_1000005 | |||
| 1852 | Ga0209675_1000619 | |||
| 1853 | Ga0209675_1001166 | |||
| 1854 | Ga0209675_1017207 | |||
| 1855 | Ga0209676_1000010 | |||
| 1856 | Ga0209676_1007925 | |||
| 1857 | Ga0209564_1000028 | |||
| 1858 | Ga0209564_1000083 | |||
| 1859 | Ga0209564_1000088 | |||
| 1860 | Ga0209564_1001146 | |||
| 1861 | Ga0209564_1039876 | |||
| 1862 | Ga0209050_1000078 | |||
| 1863 | Ga0209050_1000081 | |||
| 1864 | Ga0209050_1000363 | |||
| 1865 | Ga0209050_1001071 | |||
| 1866 | Ga0209050_1002993 | |||
| 1867 | Ga0209050_1003567 | |||
| 1868 | Ga0209256_1000035 | |||
| 1869 | Ga0209256_1000141 | |||
| 1870 | Ga0209256_1000881 | |||
| 1871 | Ga0209256_1005238 | |||
| 1872 | Ga0207426_1002420 | |||
| 1873 | Ga0209051_1000185 | |||
| 1874 | Ga0209051_1004165 | |||
| 1875 | Ga0209051_1021803 | |||
| 1876 | Ga0209257_1000040 | |||
| 1877 | Ga0209257_1000097 | |||
| 1878 | Ga0209257_1000827 | |||
| 1879 | Ga0209257_1001135 | |||
| 1880 | Ga0207696_1000198 | |||
| 1881 | Ga0207696_1001551 | |||
| 1882 | Ga0207696_1001818 | |||
| 1883 | Ga0207696_1020214 | |||
| 1884 | Ga0207696_1084367 | |||
| 1885 | Ga0207696_1122563 | |||
| 1886 | Ga0207655_1000505 | |||
| 1887 | Ga0207655_1018354 | |||
| 1888 | Ga0207655_1024723 | |||
| 1889 | Ga0207655_1029455 | |||
| 1890 | Ga0207655_1034195 | |||
| 1891 | Ga0207655_1054186 | |||
| 1892 | Ga0207655_1066996 | |||
| 1893 | Ga0207713_1000236 | |||
| 1894 | Ga0207713_1000431 | |||
| 1895 | Ga0207713_1002985 | |||
| 1896 | Ga0207713_1004782 | |||
| 1897 | Ga0207713_1020123 | |||
| 1898 | Ga0207710_10134701 | |||
| 1899 | Ga0207710_10302873 | |||
| 1900 | Ga0207680_10006656 | |||
| 1901 | Ga0207680_10212894 | |||
| 1902 | Ga0207645_10678672 | |||
| 1903 | Ga0207705_10012900 | |||
| 1904 | Ga0207705_10094828 | |||
| 1905 | Ga0207705_10099155 | |||
| 1906 | Ga0207705_10367513 | |||
| 1907 | Ga0207684_10329325 | |||
| 1908 | Ga0207654_10001978 | |||
| 1909 | Ga0207695_11119213 | |||
| 1910 | Ga0207660_10180780 | |||
| 1911 | Ga0207657_10004584 | |||
| 1912 | Ga0207657_10032291 | |||
| 1913 | Ga0207649_10008924 | |||
| 1914 | Ga0207681_10000041 | |||
| 1915 | Ga0207681_10012062 | |||
| 1916 | Ga0207681_10172296 | |||
| 1917 | Ga0207694_10202623 | |||
| 1918 | Ga0207694_10312050 | |||
| 1919 | Ga0207650_10000003 | |||
| 1920 | Ga0207650_10000004 | |||
| 1921 | Ga0207650_10008367 | |||
| 1922 | Ga0207687_10901955 | |||
| 1923 | Ga0207687_11527976 | |||
| 1924 | Ga0207644_10000037 | |||
| 1925 | Ga0207644_10000054 | |||
| 1926 | Ga0207690_10267705 | |||
| 1927 | Ga0207709_10000035 | |||
| 1928 | Ga0207709_10000283 | |||
| 1929 | Ga0207709_10014214 | |||
| 1930 | Ga0207709_10067294 | |||
| 1931 | Ga0207709_10827826 | |||
| 1932 | Ga0207691_10129092 | |||
| 1933 | Ga0207711_10000480 | |||
| 1934 | Ga0207711_10003358 | |||
| 1935 | Ga0207711_10464923 | |||
| 1936 | Ga0207661_11291360 | |||
| 1937 | Ga0207679_10119252 | |||
| 1938 | Ga0207679_10326592 | |||
| 1939 | Ga0207667_10168374 | |||
| 1940 | Ga0207667_10576915 | |||
| 1941 | Ga0207712_10092928 | |||
| 1942 | Ga0207712_10172126 | |||
| 1943 | Ga0207668_10000031 | |||
| 1944 | Ga0207668_10051367 | |||
| 1945 | Ga0207640_10179862 | |||
| 1946 | Ga0207658_10000004 | |||
| 1947 | Ga0207658_10000009 | |||
| 1948 | Ga0207658_10000381 | |||
| 1949 | Ga0207703_10001276 | |||
| 1950 | Ga0207703_10027314 | |||
| 1951 | Ga0207703_10548923 | |||
| 1952 | Ga0207639_10797900 | |||
| 1953 | Ga0207678_11598169 | |||
| 1954 | Ga0207641_10002913 | |||
| 1955 | Ga0207641_10004628 | |||
| 1956 | Ga0207641_10027763 | |||
| 1957 | Ga0207641_10114688 | |||
| 1958 | Ga0207641_10136732 | |||
| 1959 | Ga0207676_10000003 | |||
| 1960 | Ga0207676_10000006 | |||
| 1961 | Ga0207676_10001065 | |||
| 1962 | Ga0207676_11682203 | |||
| 1963 | Ga0207674_10042101 | |||
| 1964 | Ga0207675_100000309 | |||
| 1965 | Ga0207675_100009819 | |||
| 1966 | Ga0207675_100012694 | |||
| 1967 | Ga0207698_10098775 | |||
| 1968 | Ga0207698_10573405 | |||
| 1969 | Ga0207698_11016656 | |||
| 1970 | Ga0209281_1000077 | |||
| 1971 | Ga0209371_1023215 | |||
| 1972 | Ga0209983_1004669 | |||
| 1973 | Ga0209282_1000003 | |||
| 1974 | Ga0209971_1117345 | |||
| 1975 | Ga0209974_10086143 | |||
| 1976 | Ga0207428_10007690 | |||
| 1977 | Ga0207428_10078446 | |||
| 1978 | Ga0207428_10088731 | |||
| 1979 | Ga0207428_10133642 | |||
| 1980 | Ga0207428_10220000 | |||
| 1981 | Ga0268266_10008246 | |||
| 1982 | Ga0268266_10085365 | |||
| 1983 | Ga0268266_10454785 | |||
| 1984 | Ga0268265_10000001 | |||
| 1985 | Ga0268265_10000748 | |||
| 1986 | Ga0268265_10005078 | |||
| 1987 | Ga0268264_10000001 | |||
| 1988 | Ga0268264_10000016 | |||
| 1989 | Ga0268264_10765337 | |||
| 1990 | Ga0265326_10030208 | |||
| 1991 | Ga0265319_1020444 | |||
| 1992 | Ga0265334_10008838 | |||
| 1993 | Ga0265318_10000875 | |||
| 1994 | Ga0265338_10018652 | |||
| 1995 | Ga0265338_10169791 | |||
| 1996 | Ga0265324_10089934 | |||
| 1997 | Ga0268256_1026304 | |||
| 1998 | Ga0307511_10000452 | |||
| 1999 | Ga0307511_10088789 | |||
| 2000 | Ga0265330_10020416 | |||
| 2001 | Ga0265332_10151075 | |||
| 2002 | Ga0265328_10032777 | |||
| 2003 | Ga0265320_10006928 | |||
| 2004 | Ga0265325_10140235 | |||
| 2005 | Ga0265329_10057521 | |||
| 2006 | Ga0265339_10212330 | |||
| 2007 | Ga0265331_10036074 | |||
| 2008 | Ga0265327_10000407 | |||
| 2009 | Ga0265316_10017255 | |||
| 2010 | Ga0307509_10000079 | |||
| 2011 | Ga0307408_100000125 | |||
| 2012 | Ga0307408_100001980 | |||
| 2013 | Ga0307408_100025379 | |||
| 2014 | Ga0307408_100025714 | |||
| 2015 | Ga0307408_100026373 | |||
| 2016 | Ga0307408_100048588 | |||
| 2017 | Ga0307408_100053575 | |||
| 2018 | Ga0307408_100142539 | |||
| 2019 | Ga0307408_100445715 | |||
| 2020 | Ga0307408_101482769 | |||
| 2021 | Ga0265313_10020636 | |||
| 2022 | Ga0307508_10080812 | |||
| 2023 | Ga0265314_10023783 | |||
| 2024 | Ga0265314_10030574 | |||
| 2025 | Ga0265342_10017130 | |||
| 2026 | Ga0307516_10000033 | |||
| 2027 | Ga0307518_10027884 | |||
| 2028 | Ga0307406_10403734 | |||
| 2029 | Ga0307407_10282715 | |||
| 2030 | Ga0307407_10609336 | |||
| 2031 | Ga0307412_10000494 | |||
| 2032 | Ga0307412_10321339 | |||
| 2033 | Ga0307412_10331787 | |||
| 2034 | Ga0307409_100270412 | |||
| 2035 | Ga0307416_100299290 | |||
| 2036 | Ga0307416_101156589 | |||
| 2037 | Ga0307414_10012007 | |||
| 2038 | Ga0307414_10638339 | |||
| 2039 | Ga0307411_10266404 | |||
| 2040 | Ga0307411_10404057 | |||
| 2041 | Ga0307415_100491065 | |||
| 2042 | Ga0307510_10001867 | |||
| 2043 | Ga0395899_0006030 | |||
| 2044 | Ga0395899_0013681 | |||
| 2045 | Ga0395899_0030728 | |||
| 2046 | Ga0395899_0131420 | |||
| 2047 | Ga0395899_0268885 | |||
| 2048 | Ga0395899_0375700 | |||
| 2049 | Ga0395900_0000992 | |||
| 2050 | Ga0395900_0002266 | |||
| 2051 | Ga0395900_0002848 | |||
| 2052 | Ga0395900_0024512 | |||
| 2053 | Ga0395900_0028549 | |||
| 2054 | Ga0395900_0049730 | |||
| 2055 | Ga0395900_0162231 | |||
| 2056 | Ga0395900_0304277 | |||
| 2057 | Ga0395900_0455141 | |||
| 2058 | Ga0395898_0025838 | |||
| 2059 | Ga0395898_0126191 | |||
| 2060 | Ga0395898_0141935 | |||
| 2061 | Ga0395898_0147155 | |||
| 2062 | Ga0395898_0365455 | |||
| 2063 | Ga0395898_0370114 | |||
| 2064 | Ga0395898_0373139 | |||
| 2065 | Ga0395898_0486151 | |||
| 2066 | Ga0395898_0489257 | |||
| 2067 | Ga0395898_0521572 | |||
| 2068 | Ga0395905_0021824 | |||
| 2069 | Ga0395905_0177617 | |||
| 2070 | Ga0395905_0462420 | |||
| 2071 | Ga0395901_0000103 | |||
| 2072 | Ga0395901_0002810 | |||
| 2073 | Ga0395901_0179648 | |||
| 2074 | Ga0395901_0660791 | |||
| 2075 | Ga0395901_0770512 | |||
| 2076 | Ga0395901_1019276 | |||
| 2077 | Ga0237819_04939 | |||
| 2078 | Ga0436361_0258724 | |||
| 2079 | Ga0436361_0496938 | |||
| 2080 | Ga0436363_1668220 | |||
| 2081 | Ga0439436_0000014 | |||
| 2082 | Ga0439438_000363 | |||
| 2083 | Ga0439438_004231 | |||
| 2084 | Ga0439438_016708 | |||
| 2085 | Ga0439438_022331 | |||
| 2086 | Ga0439438_056604 | |||
| 2087 | Ga0439447_001403 | |||
| 2088 | Ga0439447_002343 | |||
| 2089 | Ga0439447_006880 | |||
| 2090 | Ga0439466_0000767 | |||
| 2091 | Ga0439466_0005120 | |||
| 2092 | Ga0439466_0019911 | |||
| 2093 | Ga0439466_0033724 | |||
| 2094 | Ga0451795_0246213 | |||
| 2095 | Ga0451800_1513713 | |||
| 2096 | Ga0451833_1376099 | |||
| 2097 | Ga0451839_1486879 | |||
| 2098 | Ga0451843_0957511 | |||
| 2099 | Ga0439433_0022531 | |||
| 2100 | Ga0439437_031554 | |||
| 2101 | Ga0439448_0002067 | |||
| 2102 | Ga0439432_000089 | |||
| 2103 | Ga0439432_005254 | |||
| 2104 | Ga0439432_008913 | |||
| 2105 | Ga0439432_009027 | |||
| 2106 | Ga0439450_081225 | |||
| 2107 | Ga0439451_000403 | |||
| 2108 | Ga0439451_012152 | |||
| 2109 | Ga0439451_014769 | |||
| 2110 | Ga0439451_019813 | |||
| 2111 | Ga0439451_037443 | |||
| 2112 | Ga0439452_000091 | |||
| 2113 | Ga0439452_001363 | |||
| 2114 | Ga0439452_006059 | |||
| 2115 | Ga0439452_024504 | |||
| 2116 | Ga0439452_092459 | |||
| 2117 | Ga0439455_0017104 | |||
| 2118 | Ga0439456_006684 | |||
| 2119 | Ga0439456_007483 | |||
| 2120 | Ga0439456_103421 | |||
| 2121 | Ga0439457_014363 | |||
| 2122 | Ga0439463_037676 | |||
| 2123 | Ga0450911_000083 | |||
| 2124 | Ga0450911_001316 | |||
| 2125 | Ga0450915_005280 | |||
| 2126 | Ga0450920_007155 | |||
| 2127 | Ga0450922_000035 | |||
| 2128 | Ga0450922_003196 | |||
| 2129 | Ga0450922_021394 | |||
| 2130 | Ga0450890_000146 | |||
| 2131 | Ga0450890_003694 | |||
| 2132 | Ga0450895_001837 | |||
| 2133 | Ga0450899_006066 | |||
| 2134 | Ga0450902_004905 | |||
| 2135 | Ga0450902_018112 | |||
| 2136 | Ga0450902_045647 | |||
| 2137 | Ga0450903_013689 | |||
| 2138 | Ga0450903_039479 | |||
| 2139 | Ga0450904_000019 | |||
| 2140 | Ga0450905_002439 | |||
| 2141 | Ga0450906_000234 | |||
| 2142 | Ga0450906_006567 | |||
| 2143 | Ga0450907_000005 | |||
| 2144 | Ga0450907_004197 | |||
| 2145 | Ga0450907_024508 | |||
| 2146 | Ga0450910_009290 | |||
| 2147 | Ga0439446_0003548 | |||
| 2148 | Ga0439446_0007859 | |||
| 2149 | Ga0439446_0088405 | |||
| 2150 | Ga0439458_0003406 | |||
| 2151 | Ga0450908_013461 | |||
| 2152 | Ga0450909_004355 | |||
| 2153 | Ga0439434_0000046 | |||
| 2154 | Ga0439459_0001868 | |||
| 2155 | Ga0439459_0002525 | |||
| 2156 | Ga0439459_0004492 | |||
| 2157 | Ga0439464_0000129 | |||
| 2158 | Ga0439460_0000142 | |||
| 2159 | Ga0439460_0008864 | |||
| 2160 | Ga0451577_0261902 | |||
| 2161 | Ga0451577_1420229 | |||
| 2162 | Ga0439440_0011280 | |||
| 2163 | Ga0466969_0290130 | |||
| 2164 | Ga0466972_0000682 | |||
| 2165 | Ga0466972_0212189 | |||
| 2166 | Ga0466973_0221370 | |||
| 2167 | Ga0466965_0002135 | |||
| 2168 | Ga0466965_0013014 | |||
| 2169 | Ga0466965_0017999 | |||
| 2170 | Ga0466965_0023997 | |||
| 2171 | Ga0466965_0885238 | |||
| 2172 | Ga0466966_0007700 | |||
| 2173 | Ga0466966_0062814 | |||
| 2174 | Ga0466966_0068825 | |||
| 2175 | Ga0466966_0166959 | |||
| 2176 | Ga0466961_0045978 | |||
| 2177 | Ga0466961_0071451 | |||
| 2178 | Ga0466961_0206892 | |||
| 2179 | Ga0466964_0000989 | |||
| 2180 | Ga0466964_0271188 | |||
| 2181 | Ga0453684_0020297 | |||
| 2182 | Ga0453684_1691249 | |||
| 2183 | Ga0466971_0029329 | |||
| 2184 | Ga0466968_0001118 | |||
| 2185 | Ga0466968_0092311 | |||
| 2186 | Ga0466968_0144212 | |||
| 2187 | Ga0466970_0560010 | |||
| 2188 | Ga0466957_0000012 | |||
| 2189 | Ga0466957_0017995 | |||
| 2190 | Ga0466957_0024252 | |||
| 2191 | Ga0466960_0109373 | |||
| 2192 | Ga0466959_0003130 | |||
| 2193 | Ga0466959_0024626 | |||
| 2194 | Ga0466959_0079968 | |||
| 2195 | Ga0466959_0182466 | |||
| 2196 | Ga0466959_0336383 | |||
| 2197 | Ga0451576_0000140 | |||
| 2198 | Ga0451576_0083727 | |||
| 2199 | Ga0451576_0145942 | |||
| 2200 | Ga0451576_0326266 | |||
| 2201 | Ga0466958_0007731 | |||
| 2202 | Ga0466958_0327810 | |||
| 2203 | Ga0466967_0077220 | |||
| 2204 | Ga0466967_0090925 | |||
| 2205 | Ga0466967_0138198 | |||
| 2206 | Ga0495617_000212 | |||
| 2207 | Ga0495617_001234 | |||
| 2208 | Ga0495617_004740 | |||
| 2209 | Ga0495617_015864 | |||
| 2210 | Ga0495617_044578 | |||
| 2211 | Ga0495617_060904 | |||
| 2212 | Ga0495617_061442 | |||
| 2213 | Ga0495617_124938 | |||
| 2214 | Ga0495617_128019 | |||
| 2215 | Ga0495627_000447 | |||
| 2216 | Ga0495627_006245 | |||
| 2217 | Ga0495627_006800 | |||
| 2218 | Ga0495627_009590 | |||
| 2219 | Ga0495627_066403 | |||
| 2220 | Ga0495603_0020695 | |||
| 2221 | Ga0495603_0102061 | |||
| 2222 | Ga0495603_0112753 | |||
| 2223 | Ga0495603_0430957 | |||
| 2224 | Ga0495590_0000179 | |||
| 2225 | Ga0495590_0001314 | |||
| 2226 | Ga0495590_0005456 | |||
| 2227 | Ga0495590_0019559 | |||
| 2228 | Ga0495590_0047112 | |||
| 2229 | Ga0495591_000114 | |||
| 2230 | Ga0495591_000127 | |||
| 2231 | Ga0495591_004626 | |||
| 2232 | Ga0495591_005973 | |||
| 2233 | Ga0495591_009907 | |||
| 2234 | Ga0495591_010092 | |||
| 2235 | Ga0495591_016938 | |||
| 2236 | Ga0495591_042597 | |||
| 2237 | Ga0495591_052352 | |||
| 2238 | Ga0495629_0068190 | |||
| 2239 | Ga0495629_0291844 | |||
| 2240 | Ga0495638_0001389 | |||
| 2241 | Ga0495638_0001963 | |||
| 2242 | Ga0495638_0002800 | |||
| 2243 | Ga0495638_0020036 | |||
| 2244 | Ga0495638_0049561 | |||
| 2245 | Ga0495638_0061153 | |||
| 2246 | Ga0495638_0099121 | |||
| 2247 | Ga0495638_0256523 | |||
| 2248 | Ga0495638_0303030 | |||
| 2249 | Ga0495638_0406906 | |||
| 2250 | Ga0495641_0451884 | |||
| 2251 | Ga0495651_0001004 | |||
| 2252 | Ga0495653_0000029 | |||
| 2253 | Ga0495653_0014654 | |||
| 2254 | Ga0495653_0055485 | |||
| 2255 | Ga0495653_0071090 | |||
| 2256 | Ga0495653_0079484 | |||
| 2257 | Ga0495653_0089093 | |||
| 2258 | Ga0495653_0155568 | |||
| 2259 | Ga0495653_0389953 | |||
| 2260 | Ga0495650_0003574 | |||
| 2261 | Ga0495650_0012294 | |||
| 2262 | Ga0495650_0014352 | |||
| 2263 | Ga0495650_0015155 | |||
| 2264 | Ga0495650_0017405 | |||
| 2265 | Ga0495650_0038021 | |||
| 2266 | Ga0495650_0043043 | |||
| 2267 | Ga0495650_0218881 | |||
| 2268 | Ga0495580_0080750 | |||
| 2269 | Ga0495580_0230922 | |||
| 2270 | Ga0495580_0329803 | |||
| 2271 | Ga0495582_0013147 | |||
| 2272 | Ga0495582_0015376 | |||
| 2273 | Ga0495582_0044218 | |||
| 2274 | Ga0495582_0130705 | |||
| 2275 | Ga0495582_0669463 | |||
| 2276 | Ga0495605_0000039 | |||
| 2277 | Ga0495605_0000771 | |||
| 2278 | Ga0495605_0001627 | |||
| 2279 | Ga0495605_0007537 | |||
| 2280 | Ga0495605_0008843 | |||
| 2281 | Ga0495605_0009786 | |||
| 2282 | Ga0495605_0012496 | |||
| 2283 | Ga0495605_0017802 | |||
| 2284 | Ga0495605_0021153 | |||
| 2285 | Ga0495605_0025844 | |||
| 2286 | Ga0495605_0033789 | |||
| 2287 | Ga0495605_0037504 | |||
| 2288 | Ga0495605_0038358 | |||
| 2289 | Ga0495605_0060326 | |||
| 2290 | Ga0495605_0180220 | |||
| 2291 | Ga0495639_0031362 | |||
| 2292 | Ga0495639_0215909 | |||
| 2293 | Ga0495584_0000013 | |||
| 2294 | Ga0495584_0000278 | |||
| 2295 | Ga0495584_0000387 | |||
| 2296 | Ga0495584_0000606 | |||
| 2297 | Ga0495584_0000772 | |||
| 2298 | Ga0495584_0000923 | |||
| 2299 | Ga0495584_0001007 | |||
| 2300 | Ga0495584_0001104 | |||
| 2301 | Ga0495584_0005965 | |||
| 2302 | Ga0495584_0006877 | |||
| 2303 | Ga0495584_0009481 | |||
| 2304 | Ga0495584_0009755 | |||
| 2305 | Ga0495584_0009804 | |||
| 2306 | Ga0495584_0012661 | |||
| 2307 | Ga0495584_0014765 | |||
| 2308 | Ga0495584_0016643 | |||
| 2309 | Ga0495584_0018020 | |||
| 2310 | Ga0495584_0018988 | |||
| 2311 | Ga0495584_0044568 | |||
| 2312 | Ga0495584_0058711 | |||
| 2313 | Ga0495584_0088360 | |||
| 2314 | Ga0495584_0156425 | |||
| 2315 | Ga0495585_0000245 | |||
| 2316 | Ga0495585_0001160 | |||
| 2317 | Ga0495585_0005349 | |||
| 2318 | Ga0495585_0007605 | |||
| 2319 | Ga0495585_0007793 | |||
| 2320 | Ga0495585_0011728 | |||
| 2321 | Ga0495585_0020877 | |||
| 2322 | Ga0495585_0020878 | |||
| 2323 | Ga0495585_0020935 | |||
| 2324 | Ga0495585_0041055 | |||
| 2325 | Ga0495585_0047914 | |||
| 2326 | Ga0495585_0055681 | |||
| 2327 | Ga0495585_0058781 | |||
| 2328 | Ga0495594_0000740 | |||
| 2329 | Ga0495594_0025269 | |||
| 2330 | Ga0495594_0056351 | |||
| 2331 | Ga0495594_0089534 | |||
| 2332 | Ga0495594_0095004 | |||
| 2333 | Ga0495594_0131200 | |||
| 2334 | Ga0495594_0152449 | |||
| 2335 | Ga0495596_0000107 | |||
| 2336 | Ga0495596_0000526 | |||
| 2337 | Ga0495596_0003741 | |||
| 2338 | Ga0495596_0003902 | |||
| 2339 | Ga0495596_0010020 | |||
| 2340 | Ga0495596_0022201 | |||
| 2341 | Ga0495596_0026812 | |||
| 2342 | Ga0495596_0033697 | |||
| 2343 | Ga0495596_0071281 | |||
| 2344 | Ga0495596_0083210 | |||
| 2345 | Ga0495607_0000159 | |||
| 2346 | Ga0495607_0004232 | |||
| 2347 | Ga0495607_0004835 | |||
| 2348 | Ga0495607_0004934 | |||
| 2349 | Ga0495607_0007881 | |||
| 2350 | Ga0495607_0011520 | |||
| 2351 | Ga0495607_0015812 | |||
| 2352 | Ga0495607_0018336 | |||
| 2353 | Ga0495607_0019923 | |||
| 2354 | Ga0495607_0020566 | |||
| 2355 | Ga0495607_0021685 | |||
| 2356 | Ga0495607_0024625 | |||
| 2357 | Ga0495607_0036487 | |||
| 2358 | Ga0495607_0053962 | |||
| 2359 | Ga0495607_0066275 | |||
| 2360 | Ga0495607_0104268 | |||
| 2361 | Ga0495607_0111429 | |||
| 2362 | Ga0495607_0116471 | |||
| 2363 | Ga0495607_0167906 | |||
| 2364 | Ga0495583_0000881 | |||
| 2365 | Ga0495583_0000940 | |||
| 2366 | Ga0495583_0001071 | |||
| 2367 | Ga0495583_0003792 | |||
| 2368 | Ga0495583_0007613 | |||
| 2369 | Ga0495583_0009134 | |||
| 2370 | Ga0495583_0178645 | |||
| 2371 | Ga0495606_0000004 | |||
| 2372 | Ga0495606_0001081 | |||
| 2373 | Ga0495606_0001228 | |||
| 2374 | Ga0495606_0001258 | |||
| 2375 | Ga0495606_0002911 | |||
| 2376 | Ga0495606_0031444 | |||
| 2377 | Ga0495606_0031913 | |||
| 2378 | Ga0495606_0033534 | |||
| 2379 | Ga0495606_0035055 | |||
| 2380 | Ga0495606_0037578 | |||
| 2381 | Ga0495606_0110133 | |||
| 2382 | Ga0495606_0130770 | |||
| 2383 | Ga0495606_0193715 | |||
| 2384 | Ga0495606_0342613 | |||
| 2385 | Ga0495606_0550726 | |||
| 2386 | Ga0495608_0014026 | |||
| 2387 | Ga0495610_0000452 | |||
| 2388 | Ga0495610_0000723 | |||
| 2389 | Ga0495610_0001271 | |||
| 2390 | Ga0495610_0001560 | |||
| 2391 | Ga0495610_0004206 | |||
| 2392 | Ga0495610_0007934 | |||
| 2393 | Ga0495610_0019077 | |||
| 2394 | Ga0495610_0022636 | |||
| 2395 | Ga0495610_0022850 | |||
| 2396 | Ga0495610_0028730 | |||
| 2397 | Ga0495610_0037379 | |||
| 2398 | Ga0495610_0082821 | |||
| 2399 | Ga0495610_0098855 | |||
| 2400 | Ga0495610_0337916 | |||
| 2401 | Ga0495616_0000942 | |||
| 2402 | Ga0495616_0001324 | |||
| 2403 | Ga0495616_0001515 | |||
| 2404 | Ga0495616_0005293 | |||
| 2405 | Ga0495616_0007003 | |||
| 2406 | Ga0495616_0007106 | |||
| 2407 | Ga0495616_0008838 | |||
| 2408 | Ga0495616_0013479 | |||
| 2409 | Ga0495616_0019189 | |||
| 2410 | Ga0495616_0019857 | |||
| 2411 | Ga0495616_0024909 | |||
| 2412 | Ga0495616_0028061 | |||
| 2413 | Ga0495616_0031043 | |||
| 2414 | Ga0495616_0046465 | |||
| 2415 | Ga0495616_0065069 | |||
| 2416 | Ga0495616_0090536 | |||
| 2417 | Ga0495620_0000307 | |||
| 2418 | Ga0495620_0012488 | |||
| 2419 | Ga0495620_0015524 | |||
| 2420 | Ga0495620_0023043 | |||
| 2421 | Ga0495620_0050425 | |||
| 2422 | Ga0495620_0057564 | |||
| 2423 | Ga0495628_0000646 | |||
| 2424 | Ga0495628_0104045 | |||
| 2425 | Ga0495628_0128806 | |||
| 2426 | Ga0495630_0014595 | |||
| 2427 | Ga0495630_0042722 | |||
| 2428 | Ga0495630_0113451 | |||
| 2429 | Ga0495630_0397760 | |||
| 2430 | Ga0495630_0407044 | |||
| 2431 | Ga0495631_0000020 | |||
| 2432 | Ga0495631_0001363 | |||
| 2433 | Ga0495631_0001942 | |||
| 2434 | Ga0495631_0005097 | |||
| 2435 | Ga0495631_0008597 | |||
| 2436 | Ga0495631_0009192 | |||
| 2437 | Ga0495631_0009256 | |||
| 2438 | Ga0495631_0043386 | |||
| 2439 | Ga0495631_0058684 | |||
| 2440 | Ga0495631_0063341 | |||
| 2441 | Ga0495631_0070557 | |||
| 2442 | Ga0495632_0000430 | |||
| 2443 | Ga0495632_0000436 | |||
| 2444 | Ga0495632_0000682 | |||
| 2445 | Ga0495632_0001221 | |||
| 2446 | Ga0495632_0002044 | |||
| 2447 | Ga0495632_0002718 | |||
| 2448 | Ga0495632_0008131 | |||
| 2449 | Ga0495632_0014318 | |||
| 2450 | Ga0495632_0020129 | |||
| 2451 | Ga0495632_0021207 | |||
| 2452 | Ga0495632_0026710 | |||
| 2453 | Ga0495632_0049241 | |||
| 2454 | Ga0495632_0059727 | |||
| 2455 | Ga0495637_0000029 | |||
| 2456 | Ga0495637_0000283 | |||
| 2457 | Ga0495637_0000507 | |||
| 2458 | Ga0495637_0003470 | |||
| 2459 | Ga0495637_0007167 | |||
| 2460 | Ga0495637_0013261 | |||
| 2461 | Ga0495637_0014493 | |||
| 2462 | Ga0495637_0025130 | |||
| 2463 | Ga0495637_0036664 | |||
| 2464 | Ga0495637_0041760 | |||
| 2465 | Ga0495637_0042963 | |||
| 2466 | Ga0495637_0077468 | |||
| 2467 | Ga0495637_0108918 | |||
| 2468 | Ga0495643_0000450 | |||
| 2469 | Ga0495643_0000876 | |||
| 2470 | Ga0495643_0005182 | |||
| 2471 | Ga0495643_0011635 | |||
| 2472 | Ga0495643_0014503 | |||
| 2473 | Ga0495643_0019305 | |||
| 2474 | Ga0495643_0019738 | |||
| 2475 | Ga0495643_0022760 | |||
| 2476 | Ga0495643_0034141 | |||
| 2477 | Ga0495643_0063352 | |||
| 2478 | Ga0495643_0069878 | |||
| 2479 | Ga0495643_0090448 | |||
| 2480 | Ga0495643_0106721 | |||
| 2481 | Ga0495643_0179217 | |||
| 2482 | Ga0495643_0196485 | |||
| 2483 | Ga0495643_0230660 | |||
| 2484 | Ga0495644_0003292 | |||
| 2485 | Ga0495644_0006258 | |||
| 2486 | Ga0495644_0007323 | |||
| 2487 | Ga0495644_0029115 | |||
| 2488 | Ga0495644_0030169 | |||
| 2489 | Ga0495644_0032477 | |||
| 2490 | Ga0495644_0102259 | |||
| 2491 | Ga0495644_0156026 | |||
| 2492 | Ga0495648_0000627 | |||
| 2493 | Ga0495648_0001736 | |||
| 2494 | Ga0495648_0011158 | |||
| 2495 | Ga0495648_0025052 | |||
| 2496 | Ga0495648_0026259 | |||
| 2497 | Ga0495648_0030985 | |||
| 2498 | Ga0495648_0034664 | |||
| 2499 | Ga0495648_0042570 | |||
| 2500 | Ga0495648_0045434 | |||
| 2501 | Ga0495648_0051266 | |||
| 2502 | Ga0495648_0059152 | |||
| 2503 | Ga0495648_0081320 | |||
| 2504 | Ga0495648_0104764 | |||
| 2505 | Ga0495648_0105278 | |||
| 2506 | Ga0495648_0247263 | |||
| 2507 | Ga0495648_0288238 | |||
| 2508 | Ga0495648_0306893 | |||
| 2509 | Ga0495666_0010812 | |||
| 2510 | Ga0495666_0011769 | |||
| 2511 | Ga0495666_0012333 | |||
| 2512 | Ga0495666_0016424 | |||
| 2513 | Ga0495666_0025502 | |||
| 2514 | Ga0495666_0041133 | |||
| 2515 | Ga0495666_0072077 | |||
| 2516 | Ga0495666_0103802 | |||
| 2517 | Ga0495642_0000033 | |||
| 2518 | Ga0495642_0000251 | |||
| 2519 | Ga0495642_0000505 | |||
| 2520 | Ga0495642_0000997 | |||
| 2521 | Ga0495642_0001460 | |||
| 2522 | Ga0495642_0006484 | |||
| 2523 | Ga0495642_0009271 | |||
| 2524 | Ga0495642_0014315 | |||
| 2525 | Ga0495642_0015678 | |||
| 2526 | Ga0495642_0016484 | |||
| 2527 | Ga0495642_0073336 | |||
| 2528 | Ga0495642_0133232 | |||
| 2529 | Ga0495642_0169526 | |||
| 2530 | Ga0495642_0206891 | |||
| 2531 | Ga0495642_0340185 | |||
| 2532 | Ga0495652_0012939 | |||
| 2533 | Ga0495652_0067304 | |||
| 2534 | Ga0495652_0616841 | |||
| 2535 | Ga0495654_0000025 | |||
| 2536 | Ga0495654_0001842 | |||
| 2537 | Ga0495654_0006480 | |||
| 2538 | Ga0495654_0008351 | |||
| 2539 | Ga0495654_0016289 | |||
| 2540 | Ga0495654_0020667 | |||
| 2541 | Ga0495654_0023526 | |||
| 2542 | Ga0495654_0025348 | |||
| 2543 | Ga0495654_0030894 | |||
| 2544 | Ga0495654_0038054 | |||
| 2545 | Ga0495654_0042719 | |||
| 2546 | Ga0495654_0057759 | |||
| 2547 | Ga0495654_0121152 | |||
| 2548 | Ga0495654_0268155 | |||
| 2549 | Ga0495665_0001295 | |||
| 2550 | Ga0495665_0011916 | |||
| 2551 | Ga0495665_0035944 | |||
| 2552 | Ga0495640_0073827 | |||
| 2553 | Ga0495640_0192097 | |||
| 2554 | Ga0495586_0010241 | |||
| 2555 | Ga0495586_0012286 | |||
| 2556 | Ga0495586_0047507 | |||
| 2557 | Ga0495586_0116287 | |||
| 2558 | Ga0495586_0221484 | |||
| 2559 | Ga0495586_0286734 | |||
| 2560 | Ga0495587_0000454 | |||
| 2561 | Ga0495587_0021742 | |||
| 2562 | Ga0495587_0247023 | |||
| 2563 | Ga0495587_0482950 | |||
| 2564 | Ga0495609_0000005 | |||
| 2565 | Ga0495609_0000686 | |||
| 2566 | Ga0495609_0001090 | |||
| 2567 | Ga0495609_0001117 | |||
| 2568 | Ga0495609_0001315 | |||
| 2569 | Ga0495609_0001690 | |||
| 2570 | Ga0495609_0036470 | |||
| 2571 | Ga0495609_0038444 | |||
| 2572 | Ga0495609_0042085 | |||
| 2573 | Ga0495609_0044507 | |||
| 2574 | Ga0495609_0052589 | |||
| 2575 | Ga0495609_0053826 | |||
| 2576 | Ga0495609_0094987 | |||
| 2577 | Ga0495609_0172498 | |||
| 2578 | Ga0495597_0000731 | |||
| 2579 | Ga0495597_0001213 | |||
| 2580 | Ga0495597_0001876 | |||
| 2581 | Ga0495597_0002617 | |||
| 2582 | Ga0495597_0003236 | |||
| 2583 | Ga0495597_0006469 | |||
| 2584 | Ga0495597_0008617 | |||
| 2585 | Ga0495597_0010418 | |||
| 2586 | Ga0495597_0012917 | |||
| 2587 | Ga0495597_0014733 | |||
| 2588 | Ga0495597_0040635 | |||
| 2589 | Ga0495597_0075603 | |||
| 2590 | Ga0495597_0083913 | |||
| 2591 | Ga0495597_0084751 | |||
| 2592 | Ga0495597_0089509 | |||
| 2593 | Ga0495597_0102188 | |||
| 2594 | Ga0495597_0134846 | |||
| 2595 | Ga0495645_0045476 | |||
| 2596 | Ga0495645_0066820 | |||
| 2597 | Ga0495622_0000092 | |||
| 2598 | Ga0495622_0000346 | |||
| 2599 | Ga0495622_0001961 | |||
| 2600 | Ga0495622_0002752 | |||
| 2601 | Ga0495622_0014884 | |||
| 2602 | Ga0495622_0027915 | |||
| 2603 | Ga0495622_0126267 | |||
| 2604 | Ga0495633_0002295 | |||
| 2605 | Ga0495633_0002345 | |||
| 2606 | Ga0495633_0003592 | |||
| 2607 | Ga0495633_0007303 | |||
| 2608 | Ga0495633_0216605 | |||
| 2609 | Ga0495656_0005267 | |||
| 2610 | Ga0495656_0024814 | |||
| 2611 | Ga0495656_0030588 | |||
| 2612 | Ga0495656_0253451 | |||
| 2613 | Ga0495668_0000568 | |||
| 2614 | Ga0495668_0001045 | |||
| 2615 | Ga0495668_0008186 | |||
| 2616 | Ga0495668_0011340 | |||
| 2617 | Ga0495668_0012044 | |||
| 2618 | Ga0495668_0027212 | |||
| 2619 | Ga0495668_0030583 | |||
| 2620 | Ga0495668_0035692 | |||
| 2621 | Ga0495668_0036724 | |||
| 2622 | Ga0495668_0074896 | |||
| 2623 | Ga0495668_0098823 | |||
| 2624 | Ga0495668_0235829 | |||
| 2625 | Ga0495668_0509378 | |||
| 2626 | Ga0495668_0812367 | |||
| 2627 | Ga0495634_0048427 | |||
| 2628 | Ga0495634_0091355 | |||
| 2629 | Ga0495634_0321060 | |||
| 2630 | Ga0495611_0000913 | |||
| 2631 | Ga0495611_0001898 | |||
| 2632 | Ga0495611_0005791 | |||
| 2633 | Ga0495611_0019324 | |||
| 2634 | Ga0495611_0035949 | |||
| 2635 | Ga0495611_0073394 | |||
| 2636 | Ga0495611_0203297 | |||
| 2637 | Ga0495611_0298796 | |||
| 2638 | Ga0495611_0482891 | |||
| 2639 | Ga0495625_0001188 | |||
| 2640 | Ga0495625_0002099 | |||
| 2641 | Ga0495625_0011658 | |||
| 2642 | Ga0495625_0029000 | |||
| 2643 | Ga0495625_0034634 | |||
| 2644 | Ga0495625_0043885 | |||
| 2645 | Ga0495625_0063334 | |||
| 2646 | Ga0495625_0063636 | |||
| 2647 | Ga0495625_0065385 | |||
| 2648 | Ga0495625_0071586 | |||
| 2649 | Ga0495625_0071844 | |||
| 2650 | Ga0495625_0124215 | |||
| 2651 | Ga0495625_0155114 | |||
| 2652 | Ga0495625_0166309 | |||
| 2653 | Ga0495625_0176818 | |||
| 2654 | Ga0495625_0259670 | |||
| 2655 | Ga0495625_0333212 | |||
| 2656 | Ga0495625_0462908 | |||
| 2657 | Ga0495625_0551675 | |||
| 2658 | Ga0495625_0621771 | |||
| 2659 | Ga0495635_0024425 | |||
| 2660 | Ga0495635_0032724 | |||
| 2661 | Ga0495635_0301912 | |||
| 2662 | Ga0495659_0000957 | |||
| 2663 | Ga0495659_0011094 | |||
| 2664 | Ga0495661_0000308 | |||
| 2665 | Ga0495661_0000855 | |||
| 2666 | Ga0495661_0001225 | |||
| 2667 | Ga0495661_0001803 | |||
| 2668 | Ga0495661_0005046 | |||
| 2669 | Ga0495661_0007189 | |||
| 2670 | Ga0495661_0010783 | |||
| 2671 | Ga0495661_0015641 | |||
| 2672 | Ga0495661_0016585 | |||
| 2673 | Ga0495661_0039840 | |||
| 2674 | Ga0495661_0046874 | |||
| 2675 | Ga0495661_0073877 | |||
| 2676 | Ga0495661_0083801 | |||
| 2677 | Ga0495661_0094120 | |||
| 2678 | Ga0495661_0099025 | |||
| 2679 | Ga0495661_0099813 | |||
| 2680 | Ga0495661_0102310 | |||
| 2681 | Ga0495661_0146400 | |||
| 2682 | Ga0495661_0197465 | |||
| 2683 | Ga0495661_0243095 | |||
| 2684 | Ga0495661_0273416 | |||
| 2685 | Ga0495661_0316941 | |||
| 2686 | Ga0495661_0317409 | |||
| 2687 | Ga0495661_0507420 | |||
| 2688 | Ga0495588_0000059 | |||
| 2689 | Ga0495588_0002582 | |||
| 2690 | Ga0495588_0014944 | |||
| 2691 | Ga0495588_0016717 | |||
| 2692 | Ga0495588_0046451 | |||
| 2693 | Ga0495588_0094979 | |||
| 2694 | Ga0495588_0106104 | |||
| 2695 | Ga0495588_0134650 | |||
| 2696 | Ga0495588_0145295 | |||
| 2697 | Ga0495588_0353855 | |||
| 2698 | Ga0495623_0015135 | |||
| 2699 | Ga0495623_0027814 | |||
| 2700 | Ga0495623_0060783 | |||
| 2701 | Ga0495623_0138459 | |||
| 2702 | Ga0495623_0148792 | |||
| 2703 | Ga0495646_0006253 | |||
| 2704 | Ga0495646_0132893 | |||
| 2705 | Ga0495646_0142533 | |||
| 2706 | Ga0495646_0211018 | |||
| 2707 | Ga0495669_0000210 | |||
| 2708 | Ga0495669_0000722 | |||
| 2709 | Ga0495669_0001185 | |||
| 2710 | Ga0495669_0014048 | |||
| 2711 | Ga0495669_0024903 | |||
| 2712 | Ga0495669_0040635 | |||
| 2713 | Ga0495669_0088530 | |||
| 2714 | Ga0495613_0020278 | |||
| 2715 | Ga0495613_0157664 | |||
| 2716 | Ga0495613_0421239 | |||
| 2717 | Ga0495624_0079685 | |||
| 2718 | Ga0495670_0000115 | |||
| 2719 | Ga0495670_0000146 | |||
| 2720 | Ga0495670_0000559 | |||
| 2721 | Ga0495670_0001150 | |||
| 2722 | Ga0495670_0010847 | |||
| 2723 | Ga0495670_0014215 | |||
| 2724 | Ga0495670_0022351 | |||
| 2725 | Ga0495670_0027519 | |||
| 2726 | Ga0495670_0057525 | |||
| 2727 | Ga0495670_0066364 | |||
| 2728 | Ga0495670_0100706 | |||
| 2729 | Ga0495670_0127108 | |||
| 2730 | Ga0495671_0000380 | |||
| 2731 | Ga0495671_0000808 | |||
| 2732 | Ga0495671_0004909 | |||
| 2733 | Ga0495671_0013456 | |||
| 2734 | Ga0495671_0049463 | |||
| 2735 | Ga0495671_0084445 | |||
| 2736 | Ga0495671_0136159 | |||
| 2737 | Ga0495671_0138046 | |||
| 2738 | Ga0495671_0174625 | |||
| 2739 | Ga0495671_0202550 | |||
| 2740 | Ga0495671_0203745 | |||
| 2741 | Ga0495649_0000243 | |||
| 2742 | Ga0495649_0000580 | |||
| 2743 | Ga0495649_0001732 | |||
| 2744 | Ga0495649_0008945 | |||
| 2745 | Ga0495649_0013542 | |||
| 2746 | Ga0495649_0019465 | |||
| 2747 | Ga0495649_0026238 | |||
| 2748 | Ga0495649_0032628 | |||
| 2749 | Ga0495649_0035673 | |||
| 2750 | Ga0495649_0037611 | |||
| 2751 | Ga0495649_0042427 | |||
| 2752 | Ga0495649_0055759 | |||
| 2753 | Ga0495649_0060330 | |||
| 2754 | Ga0495649_0093249 | |||
| 2755 | Ga0495649_0214089 | |||
| 2756 | Ga0495589_0000095 | |||
| 2757 | Ga0495589_0000133 | |||
| 2758 | Ga0495589_0000399 | |||
| 2759 | Ga0495589_0001338 | |||
| 2760 | Ga0495589_0001411 | |||
| 2761 | Ga0495589_0005145 | |||
| 2762 | Ga0495589_0014303 | |||
| 2763 | Ga0495589_0014864 | |||
| 2764 | Ga0495589_0015436 | |||
| 2765 | Ga0495589_0157582 | |||
| 2766 | Ga0495589_0224287 | |||
| 2767 | Ga0495589_0248310 | |||
| 2768 | Ga0495589_0252548 | |||
| 2769 | Ga0495589_0383136 | |||
| 2770 | Ga0495600_0019152 | |||
| 2771 | Ga0495600_0123010 | |||
| 2772 | Ga0495600_0493009 | |||
| 2773 | Ga0495660_0000135 | |||
| 2774 | Ga0495660_0001109 | |||
| 2775 | Ga0495660_0002439 | |||
| 2776 | Ga0495660_0018399 | |||
| 2777 | Ga0495660_0020729 | |||
| 2778 | Ga0495660_0024058 | |||
| 2779 | Ga0495660_0027189 | |||
| 2780 | Ga0495660_0027238 | |||
| 2781 | Ga0495660_0040853 | |||
| 2782 | Ga0495660_0044583 | |||
| 2783 | Ga0495660_0052625 | |||
| 2784 | Ga0495660_0056364 | |||
| 2785 | Ga0495660_0081089 | |||
| 2786 | Ga0495660_0098039 | |||
| 2787 | Ga0495581_0001182 | |||
| 2788 | Ga0495581_0018281 | |||
| 2789 | Ga0495604_0002061 | |||
| 2790 | Ga0495604_0009953 | |||
| 2791 | Ga0495604_0022590 | |||
| 2792 | Ga0495604_0053855 | |||
| 2793 | Ga0495604_0067426 | |||
| 2794 | Ga0495604_0161728 | |||
| 2795 | Ga0495636_0004934 | |||
| 2796 | Ga0495636_0010146 | |||
| 2797 | Ga0495636_0069254 | |||
| 2798 | Ga0495674_0105651 | |||
| 2799 | Ga0495672_0000175 | |||
| 2800 | Ga0495672_0000211 | |||
| 2801 | Ga0495672_0000713 | |||
| 2802 | Ga0495672_0000791 | |||
| 2803 | Ga0495672_0002178 | |||
| 2804 | Ga0495672_0004423 | |||
| 2805 | Ga0495672_0006647 | |||
| 2806 | Ga0495672_0017107 | |||
| 2807 | Ga0495672_0026020 | |||
| 2808 | Ga0495672_0026303 | |||
| 2809 | Ga0495672_0044888 | |||
| 2810 | Ga0495672_0045939 | |||
| 2811 | Ga0495672_0130230 | |||
| 2812 | Ga0495672_0139788 | |||
| 2813 | Ga0495676_0000249 | |||
| 2814 | Ga0495676_0022534 | |||
| 2815 | Ga0495676_0178833 | |||
| 2816 | Ga0495680_0011318 | |||
| 2817 | Ga0495680_0015065 | |||
| 2818 | Ga0495680_0031698 | |||
| 2819 | Ga0495680_0049045 | |||
| 2820 | Ga0495683_0000379 | |||
| 2821 | Ga0495683_0000455 | |||
| 2822 | Ga0495683_0011680 | |||
| 2823 | Ga0495683_0016203 | |||
| 2824 | Ga0495683_0016306 | |||
| 2825 | Ga0495683_0019281 | |||
| 2826 | Ga0495683_0025030 | |||
| 2827 | Ga0495683_0036817 | |||
| 2828 | Ga0495683_0103026 | |||
| 2829 | Ga0495683_0110945 | |||
| 2830 | Ga0495683_0156516 | |||
| 2831 | Ga0495683_0191766 | |||
| 2832 | Ga0495683_0308166 | |||
| 2833 | Ga0495683_0311056 | |||
| 2834 | Ga0495683_0430931 | |||
| 2835 | Ga0495687_000008 | |||
| 2836 | Ga0495687_000145 | |||
| 2837 | Ga0495687_000146 | |||
| 2838 | Ga0495687_000431 | |||
| 2839 | Ga0495687_000693 | |||
| 2840 | Ga0495687_000975 | |||
| 2841 | Ga0495687_002916 | |||
| 2842 | Ga0495675_0013464 | |||
| 2843 | Ga0495675_0013530 | |||
| 2844 | Ga0495677_0000032 | |||
| 2845 | Ga0495677_0000788 | |||
| 2846 | Ga0495677_0003156 | |||
| 2847 | Ga0495677_0005033 | |||
| 2848 | Ga0495677_0008007 | |||
| 2849 | Ga0495677_0024896 | |||
| 2850 | Ga0495677_0028261 | |||
| 2851 | Ga0495677_0031484 | |||
| 2852 | Ga0495677_0066973 | |||
| 2853 | Ga0495677_0124217 | |||
| 2854 | Ga0495677_0377305 | |||
| 2855 | Ga0495679_009031 | |||
| 2856 | Ga0495679_012864 | |||
| 2857 | Ga0495679_015239 | |||
| 2858 | Ga0495679_043903 | |||
| 2859 | Ga0495685_008153 | |||
| 2860 | Ga0495685_008948 | |||
| 2861 | Ga0495673_0000168 | |||
| 2862 | Ga0495673_0000345 | |||
| 2863 | Ga0495673_0000806 | |||
| 2864 | Ga0495673_0000864 | |||
| 2865 | Ga0495673_0001321 | |||
| 2866 | Ga0495673_0015400 | |||
| 2867 | Ga0495673_0030392 | |||
| 2868 | Ga0495673_0052620 | |||
| 2869 | Ga0495673_0058214 | |||
| 2870 | Ga0495673_0138087 | |||
| 2871 | Ga0495681_0000226 | |||
| 2872 | Ga0495681_0000337 | |||
| 2873 | Ga0495681_0000352 | |||
| 2874 | Ga0495681_0000542 | |||
| 2875 | Ga0495681_0001101 | |||
| 2876 | Ga0495681_0002566 | |||
| 2877 | Ga0495681_0002749 | |||
| 2878 | Ga0495681_0003430 | |||
| 2879 | Ga0495681_0003770 | |||
| 2880 | Ga0495681_0006642 | |||
| 2881 | Ga0495681_0007160 | |||
| 2882 | Ga0495681_0009454 | |||
| 2883 | Ga0495681_0011118 | |||
| 2884 | Ga0495681_0012930 | |||
| 2885 | Ga0495681_0013140 | |||
| 2886 | Ga0495681_0013194 | |||
| 2887 | Ga0495681_0018952 | |||
| 2888 | Ga0495681_0034154 | |||
| 2889 | Ga0495681_0042900 | |||
| 2890 | Ga0495681_0269403 | |||
| 2891 | Ga0495684_0019640 | |||
| 2892 | Ga0495686_0001754 | |||
| 2893 | Ga0495686_0001790 | |||
| 2894 | Ga0495686_0002429 | |||
| 2895 | Ga0495686_0007527 | |||
| 2896 | Ga0495686_0007845 | |||
| 2897 | Ga0495686_0015584 | |||
| 2898 | Ga0495686_0025391 | |||
| 2899 | Ga0495686_0026121 | |||
| 2900 | Ga0495686_0027612 | |||
| 2901 | Ga0495686_0055647 | |||
| 2902 | Ga0495593_0010306 | |||
| 2903 | Ga0495593_0013561 | |||
| 2904 | Ga0495593_0060193 | |||
| 2905 | Ga0495593_0169718 | |||
| 2906 | Ga0495602_0048745 | |||
| 2907 | Ga0495602_0109331 | |||
| 2908 | Ga0495614_0005443 | |||
| 2909 | Ga0495614_0045894 | |||
| 2910 | Ga0495615_0007411 | |||
| 2911 | Ga0495615_0174205 | |||
| 2912 | Ga0495626_0000047 | |||
| 2913 | Ga0495626_0000144 | |||
| 2914 | Ga0495626_0000179 | |||
| 2915 | Ga0495626_0000438 | |||
| 2916 | Ga0495626_0000622 | |||
| 2917 | Ga0495626_0001050 | |||
| 2918 | Ga0495626_0002234 | |||
| 2919 | Ga0495626_0005272 | |||
| 2920 | Ga0495626_0005442 | |||
| 2921 | Ga0495626_0009525 | |||
| 2922 | Ga0495626_0012574 | |||
| 2923 | Ga0495626_0014314 | |||
| 2924 | Ga0495626_0019038 | |||
| 2925 | Ga0495626_0020586 | |||
| 2926 | Ga0495626_0020769 | |||
| 2927 | Ga0495626_0025765 | |||
| 2928 | Ga0495626_0025859 | |||
| 2929 | Ga0495626_0035950 | |||
| 2930 | Ga0495626_0039825 | |||
| 2931 | Ga0495626_0079086 | |||
| 2932 | Ga0495626_0096030 | |||
| 2933 | Ga0495626_0167515 | |||
| 2934 | Ga0496100_0147676 | |||
| 2935 | Ga0496101_0787192 | |||
| 2936 | Ga0496102_0000250 | |||
| 2937 | Ga0496102_0257558 | |||
| 2938 | Ga0496102_0343938 | |||
| 2939 | Ga0496103_0005019 | |||
| 2940 | Ga0496103_0561665 | |||
| 2941 | Ga0496104_0761336 | |||
| 2942 | Ga0496104_0806553 | |||
| 2943 | Ga0496105_0193578 | |||
| 2944 | Ga0496106_0007635 | |||
| 2945 | Ga0496106_0192259 | |||
| 2946 | Ga0496107_0037923 | |||
| 2947 | Ga0496107_0162723 | |||
| 2948 | Ga0496108_0442207 | |||
| 2949 | Ga0496109_0561836 | |||
| 2950 | Ga0496110_0000454 | |||
| 2951 | Ga0496110_1212288 | |||
| 2952 | Ga0496111_0074105 | |||
| 2953 | Ga0496111_0277262 | |||
| 2954 | Ga0496112_1817272 | |||
| 2955 | Ga0496113_0022628 | |||
| 2956 | Ga0496113_0049917 | |||
| 2957 | Ga0496113_0345044 | |||
| 2958 | Ga0496114_0755263 | |||
| 2959 | Ga0496115_0220198 | |||
| 2960 | Ga0496115_0730276 | |||
| 2961 | Ga0496115_0939413 | |||
| 2962 | Ga0496116_0000168 | |||
| 2963 | Ga0496116_0000963 | |||
| 2964 | Ga0496116_0028013 | |||
| 2965 | Ga0496116_0028221 | |||
| 2966 | Ga0496116_0244493 | |||
| 2967 | Ga0496116_0251204 | |||
| 2968 | Ga0496117_0000349 | |||
| 2969 | Ga0496117_0018177 | |||
| 2970 | Ga0496117_0032385 | |||
| 2971 | Ga0496117_0179959 | |||
| 2972 | Ga0496118_0033027 | |||
| 2973 | Ga0496118_0124642 | |||
| 2974 | Ga0496119_0019951 | |||
| 2975 | Ga0496121_0000199 | |||
| 2976 | Ga0496121_0041104 | |||
| 2977 | Ga0496121_0054073 | |||
| 2978 | Ga0496121_0273413 | |||
| 2979 | Ga0496122_0000316 | |||
| 2980 | Ga0496122_0000641 | |||
| 2981 | Ga0496122_0003680 | |||
| 2982 | Ga0496122_0011462 | |||
| 2983 | Ga0496122_0011785 | |||
| 2984 | Ga0496122_0014609 | |||
| 2985 | Ga0496122_0037555 | |||
| 2986 | Ga0496122_0050059 | |||
| 2987 | Ga0496122_0106080 | |||
| 2988 | Ga0496123_0000297 | |||
| 2989 | Ga0496123_0001430 | |||
| 2990 | Ga0496123_0002937 | |||
| 2991 | Ga0496123_0003718 | |||
| 2992 | Ga0496123_0007797 | |||
| 2993 | Ga0496123_0013631 | |||
| 2994 | Ga0496123_0023708 | |||
| 2995 | Ga0496123_0033396 | |||
| 2996 | Ga0496123_0149808 | |||
| 2997 | Ga0496124_0013088 | |||
| 2998 | Ga0496124_0025844 | |||
| 2999 | Ga0496124_0031442 | |||
| 3000 | Ga0496124_0047412 | |||
| 3001 | Ga0496124_0076175 | |||
| 3002 | Ga0496124_0103897 | |||
| 3003 | Ga0496124_0111067 | |||
| 3004 | Ga0496124_0124740 | |||
| 3005 | Ga0496124_0148196 | |||
| 3006 | Ga0496124_0166643 | |||
| 3007 | Ga0496124_0299627 | |||
| 3008 | Ga0496124_0474680 | |||
| 3009 | Ga0496124_0727923 | |||
| 3010 | Ga0496125_0003422 | |||
| 3011 | Ga0496125_0004591 | |||
| 3012 | Ga0496125_0030081 | |||
| 3013 | Ga0496125_0031181 | |||
| 3014 | Ga0496125_0041563 | |||
| 3015 | Ga0496125_0146229 | |||
| 3016 | Ga0496125_0389768 | |||
| 3017 | Ga0496126_0043004 | |||
| 3018 | Ga0496126_0100020 | |||
| 3019 | Ga0496126_0635286 | |||
| 3020 | Ga0495678_000013 | |||
| 3021 | Ga0495678_000194 | |||
| 3022 | Ga0495678_000546 | |||
| 3023 | Ga0495678_000698 | |||
| 3024 | Ga0495678_001022 | |||
| 3025 | Ga0495678_001038 | |||
| 3026 | Ga0495678_007887 | |||
| 3027 | Ga0495678_011877 | |||
| 3028 | Ga0495678_012756 | |||
| 3029 | Ga0495678_014774 | |||
| 3030 | Ga0495678_042536 | |||
| 3031 | Ga0495682_0002605 | |||
| 3032 | Ga0495682_0007313 | |||
| 3033 | Ga0495682_0007341 | |||
| 3034 | Ga0495682_0008144 | |||
| 3035 | Ga0495682_0008658 | |||
| 3036 | Ga0495682_0009742 | |||
| 3037 | Ga0495682_0033483 | |||
| 3038 | Ga0495682_0034287 | |||
| 3039 | Ga0495682_0086973 | |||
| 3040 | Ga0501297_027049 | |||
| 3041 | Ga0501034_0014450 | |||
| 3042 | Ga0501039_0145308 | |||
| 3043 | Ga0501043_0003156 | |||
| 3044 | Ga0501043_0299962 | |||
| 3045 | Ga0501046_0559692 | |||
| 3046 | Ga0501047_0002344 | |||
| 3047 | Ga0501047_0650630 | |||
| 3048 | Ga0501071_1332578 | |||
| 3049 | Ga0501207_051548 | |||
| 3050 | Ga0501227_108976 | |||
| 3051 | Ga0501235_060686 | |||
| 3052 | Ga0501248_036485 | |||
| 3053 | Ga0501221_068150 | |||
| 3054 | Ga0501225_0089762 | |||
| 3055 | Ga0501241_002151 | |||
| 3056 | Ga0501279_001689 | |||
| 3057 | Ga0501279_002506 | |||
| 3058 | Ga0501035_0002745 | |||
| 3059 | Ga0501044_0005853 | |||
| 3060 | Ga0501044_0045405 | |||
| 3061 | Ga0501045_0587792 | |||
| 3062 | Ga0501226_000009 | |||
| 3063 | nmdc:mga03683_126408_c1 | |||
| 3064 | nmdc:mga03683_88772_c1 | |||
| 3065 | nmdc:mga0yw44_129498_c1 | |||
| 3066 | nmdc:mga09592_83307_c1 | |||
| 3067 | nmdc:mga0qj67_275453_c1 | |||
| 3068 | nmdc:mga0qj67_36742_c1 | |||
| 3069 | nmdc:mga08y16_18074_c1 | |||
| 3070 | nmdc:mga08x19_170545_c1 | |||
| 3071 | Ga0495601_0503555 | |||
| 3072 | Ga0500643_003260 | |||
| 3073 | Ga0500644_0330723 | |||
| 3074 | Ga0500647_0083897 | |||
| 3075 | Ga0500651_0004291 | |||
| 3076 | Ga0500641_0001855 | |||
| 3077 | Ga0500641_0038093 | |||
| 3078 | Ga0500556_0130829 | |||
| 3079 | Ga0500595_016106 | |||
| 3080 | Ga0500617_218056 | |||
| 3081 | Ga0500618_000166 | |||
| 3082 | Ga0500618_011422 | |||
| 3083 | Ga0500642_0021900 | |||
| 3084 | Ga0500655_000055 | |||
| 3085 | Ga0500658_0293939 | |||
| 3086 | Ga0500588_0001411 | |||
| 3087 | Ga0500590_000433 | |||
| 3088 | Ga0500622_0003868 | |||
| 3089 | Ga0500622_0003968 | |||
| 3090 | Ga0500624_013669 | |||
| 3091 | Ga0500634_0045136 | |||
| 3092 | Ga0500570_006654 | |||
| 3093 | Ga0587083_0098646 | |||
| 3094 | Ga0466962_0014880 | |||
| 3095 | 2886851987 | |||
| 3096 | 2886853868 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2v1m-assembly1.cif.gz_A | crystal structure of schistosoma mansoni glutathione peroxidase | 0.9663 | 1 | 161 |
| 2wgr-assembly1.cif.gz_A | combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase | 0.9655 | 1 | 161 |
| 2v1m-assembly1.cif.gz_A | crystal structure of schistosoma mansoni glutathione peroxidase | 0.9604 | 1 | 161 |
| 2wgr-assembly1.cif.gz_A | combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase | 0.9596 | 1 | 161 |
| 2vup-assembly1.cif.gz_A | crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei | 0.9569 | 1 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q59WD3_4_171_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9746 | 5 | 160 | 3.40.30.10 |
| af_O59858_1_158_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9745 | 1 | 159 | 3.40.30.10 |
| af_Q2FUZ6_1_164_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9689 | 1 | 161 | 3.40.30.10 |
| af_Q2FUZ6_1_164_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.963 | 1 | 161 | 3.40.30.10 |
| af_O59858_1_158_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9624 | 1 | 159 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M4QYY1-F1-model_v4 | deleted | 0.9993 | 4 | 161 |
|
| AF-A0A656G7F7-F1-model_v4 | Glutathione peroxidase | 0.9964 | 32 | 161 |
GO:0004601
GO:0034599 |
| AF-A0A3M3YJA7-F1-model_v4 | Glutathione peroxidase | 0.9957 | 3 | 161 |
GO:0004601
GO:0034599 |
| AF-A0A3M6F251-F1-model_v4 | Glutathione peroxidase | 0.9956 | 3 | 161 |
GO:0004601
GO:0034599 |
| AF-Q48FR3-F1-model_v4 | Glutathione peroxidase | 0.9954 | 3 | 161 |
GO:0004601
GO:0034599 |