F494707

General Info

Members Datasets Scaffolds Average Seq Length
1549 383 3096 171

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10947929|Ga0163162_109479291
Length 188
Sequence MSRSLHSSSQVHEHGDDRVSAAPDDDQRWFAIWTRSRHEQVVREQLLQKQIDTFLPTVTRWSRWKDRKKKIDWPLFPGYCFARFNPRERLPILKCTGVVTIISSQGGEPSAIPEHEIEGIRQLVQSDLAFDPCPMIREGTLVEVIHGPLKGVIGRLLRKSDKARLVLSVDLIGQAVSVEVDAADVRAY

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
216 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
217 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
218 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
219 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
252 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
253 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
257 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
258 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
347 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
348 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
349 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
350 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
375 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
376 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
377 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 2.97
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 32.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10947929 3300013306 Unclassified 972
2 JGI24033J26618_1016701 3300002155 Unclassified 914
3 JGI24751J29686_10013893 3300002459 Bacteria 1662
4 JGI25406J46586_10097873 3300003203 Bacteria 878
5 Ga0065714_10083408 3300005288 Bacteria 2244
6 Ga0065704_10148721 3300005289 Unclassified 1413
7 Ga0065704_10537012 3300005289 Bacteria 643
8 Ga0065712_10002622 3300005290 Bacteria 5006
9 Ga0065712_10067818 3300005290 Bacteria 29246
10 Ga0065712_10099576 3300005290 Unclassified 2087
11 Ga0065712_10149758 3300005290 Bacteria 1373
12 Ga0065712_10162315 3300005290 Bacteria 1294
13 Ga0065712_10319358 3300005290 Unclassified 831
14 Ga0065715_10103959 3300005293 Unclassified 2995
15 Ga0065715_10146880 3300005293 Unclassified 1771
16 Ga0065715_10147926 3300005293 Bacteria 1765
17 Ga0065715_10158966 3300005293 Bacteria 1648
18 Ga0065715_10168749 3300005293 Bacteria 1564
19 Ga0065715_10236028 3300005293 Bacteria 1216
20 Ga0065715_10279735 3300005293 Bacteria 1078
21 Ga0065715_10408396 3300005293 Unclassified 873
22 Ga0065707_10247239 3300005295 Bacteria 1133
23 Ga0065707_10289450 3300005295 Unclassified 1028
24 Ga0065707_10302678 3300005295 Bacteria 1001
25 Ga0065707_10412332 3300005295 Unclassified 840
26 Ga0065707_10484671 3300005295 Bacteria 770
27 Ga0070676_10026241 3300005328 Bacteria 3298
28 Ga0070676_10199862 3300005328 Unclassified 1310
29 Ga0070676_10297952 3300005328 Bacteria 1092
30 Ga0070676_10331366 3300005328 Bacteria 1041
31 Ga0070676_10357983 3300005328 Unclassified 1005
32 Ga0070676_10438005 3300005328 Unclassified 916
33 Ga0070676_10832927 3300005328 Unclassified 683
34 Ga0070683_100024470 3300005329 Bacteria 5409
35 Ga0070683_100338820 3300005329 Unclassified 1432
36 Ga0070690_100000920 3300005330 Bacteria 14972
37 Ga0070690_100166363 3300005330 Unclassified 1515
38 Ga0070690_100197332 3300005330 Bacteria 1399
39 Ga0070690_100922612 3300005330 Bacteria 684
40 Ga0070690_100946779 3300005330 Unclassified 676
41 Ga0070690_101430069 3300005330 Bacteria 557
42 Ga0070670_100015640 3300005331 Bacteria 6514
43 Ga0070670_100026375 3300005331 Bacteria 5001
44 Ga0070670_100052956 3300005331 Bacteria 3486
45 Ga0070670_100161978 3300005331 Unclassified 1939
46 Ga0070670_100300500 3300005331 Unclassified 1404
47 Ga0070670_100901418 3300005331 Unclassified 801
48 Ga0070677_10013312 3300005333 Bacteria 2875
49 Ga0070677_10044554 3300005333 Unclassified 1766
50 Ga0070677_10049012 3300005333 Bacteria 1699
51 Ga0070677_10279774 3300005333 Bacteria 840
52 Ga0070677_10284896 3300005333 Unclassified 834
53 Ga0070677_10422995 3300005333 Unclassified 707
54 Ga0068869_100002153 3300005334 Bacteria 11844
55 Ga0068869_100048862 3300005334 Bacteria 3061
56 Ga0068869_100092460 3300005334 Unclassified 2277
57 Ga0068869_100103497 3300005334 Bacteria 2157
58 Ga0068869_100174532 3300005334 Unclassified 1681
59 Ga0068869_100280507 3300005334 Bacteria 1340
60 Ga0068869_100536026 3300005334 Unclassified 981
61 Ga0068869_101215174 3300005334 Bacteria 663
62 Ga0070666_10196882 3300005335 Unclassified 1417
63 Ga0070666_10198726 3300005335 Bacteria 1410
64 Ga0070666_10729581 3300005335 Bacteria 728
65 Ga0070680_100025422 3300005336 Bacteria 4733
66 Ga0070680_100153630 3300005336 Unclassified 1933
67 Ga0070680_100630050 3300005336 Bacteria 921
68 Ga0070680_100866206 3300005336 Bacteria 779
69 Ga0070682_100900612 3300005337 Unclassified 727
70 Ga0070682_101072323 3300005337 Bacteria 673
71 Ga0070682_101249949 3300005337 Bacteria 629
72 Ga0068868_100034955 3300005338 Bacteria 3882
73 Ga0068868_100064048 3300005338 Unclassified 2918
74 Ga0068868_100291802 3300005338 Unclassified 1383
75 Ga0068868_100330401 3300005338 Bacteria 1301
76 Ga0068868_100352495 3300005338 Unclassified 1261
77 Ga0068868_100639711 3300005338 Unclassified 946
78 Ga0068868_100741312 3300005338 Bacteria 882
79 Ga0068868_101181271 3300005338 Unclassified 707
80 Ga0070660_100001092 3300005339 Bacteria 18217
81 Ga0070660_100441529 3300005339 Bacteria 1079
82 Ga0070689_100043202 3300005340 Bacteria 3463
83 Ga0070689_100065174 3300005340 Bacteria 2836
84 Ga0070689_100199760 3300005340 Unclassified 1632
85 Ga0070689_100215050 3300005340 Bacteria 1575
86 Ga0070689_100327105 3300005340 Unclassified 1281
87 Ga0070689_100340128 3300005340 Unclassified 1257
88 Ga0070689_100586620 3300005340 Unclassified 964
89 Ga0070689_100740161 3300005340 Bacteria 861
90 Ga0070691_10000892 3300005341 Bacteria 12096
91 Ga0070691_10043112 3300005341 Unclassified 2137
92 Ga0070691_10149628 3300005341 Unclassified 1196
93 Ga0070687_100038743 3300005343 Unclassified 2391
94 Ga0070687_100095286 3300005343 Bacteria 1655
95 Ga0070661_100265127 3300005344 Unclassified 1329
96 Ga0070661_100414251 3300005344 Bacteria 1067
97 Ga0070661_100608875 3300005344 Bacteria 884
98 Ga0070661_101372584 3300005344 Unclassified 594
99 Ga0070692_10035812 3300005345 Viruses 2515
100 Ga0070692_10458705 3300005345 Bacteria 817
101 Ga0070668_100105729 3300005347 Bacteria 2236
102 Ga0070668_100454436 3300005347 Unclassified 1102
103 Ga0070668_100735908 3300005347 Bacteria 872
104 Ga0070669_100003474 3300005353 Bacteria 11357
105 Ga0070669_100031310 3300005353 Viruses 3843
106 Ga0070669_100038193 3300005353 Bacteria 3485
107 Ga0070669_100092083 3300005353 Bacteria 2275
108 Ga0070669_100162925 3300005353 Unclassified 1734
109 Ga0070669_100313428 3300005353 Bacteria 1265
110 Ga0070669_100339396 3300005353 Bacteria 1217
111 Ga0070669_100423022 3300005353 Unclassified 1094
112 Ga0070669_100548837 3300005353 Bacteria 963
113 Ga0070669_100615765 3300005353 Bacteria 911
114 Ga0070669_100669953 3300005353 Unclassified 874
115 Ga0070669_100678850 3300005353 Unclassified 868
116 Ga0070675_100000433 3300005354 Bacteria 28442
117 Ga0070675_100001643 3300005354 Bacteria 16516
118 Ga0070675_100003018 3300005354 Bacteria 12707
119 Ga0070675_100007486 3300005354 Bacteria 8435
120 Ga0070675_100007803 3300005354 Bacteria 8291
121 Ga0070675_100022727 3300005354 Bacteria 5010
122 Ga0070675_100036669 3300005354 Bacteria 3991
123 Ga0070675_100205743 3300005354 Bacteria 1709
124 Ga0070675_100217685 3300005354 Bacteria 1662
125 Ga0070675_100313845 3300005354 Bacteria 1384
126 Ga0070675_100344667 3300005354 Bacteria 1320
127 Ga0070675_100439608 3300005354 Archaea 1168
128 Ga0070675_100539788 3300005354 Unclassified 1054
129 Ga0070671_100034834 3300005355 Bacteria 4169
130 Ga0070671_100048508 3300005355 Bacteria 3531
131 Ga0070671_100320519 3300005355 Bacteria 1321
132 Ga0070671_100354947 3300005355 Bacteria 1252
133 Ga0070671_100782269 3300005355 Bacteria 830
134 Ga0070674_100021951 3300005356 Bacteria 4110
135 Ga0070674_100044223 3300005356 Bacteria 3035
136 Ga0070674_100140019 3300005356 Unclassified 1815
137 Ga0070674_100241008 3300005356 Unclassified 1416
138 Ga0070674_100519194 3300005356 Unclassified 995
139 Ga0070674_100674351 3300005356 Bacteria 881
140 Ga0070674_100779800 3300005356 Unclassified 824
141 Ga0070674_101006082 3300005356 Unclassified 732
142 Ga0070674_101255596 3300005356 Unclassified 659
143 Ga0070674_101265879 3300005356 Unclassified 657
144 Ga0070674_101447295 3300005356 Unclassified 616
145 Ga0070673_100003132 3300005364 Bacteria 10234
146 Ga0070673_100043274 3300005364 Unclassified 3478
147 Ga0070673_100050178 3300005364 Bacteria 3261
148 Ga0070673_100058513 3300005364 Unclassified 3047
149 Ga0070673_100137316 3300005364 Unclassified 2059
150 Ga0070673_100171940 3300005364 Bacteria 1850
151 Ga0070673_100183156 3300005364 Unclassified 1794
152 Ga0070673_100196196 3300005364 Bacteria 1736
153 Ga0070673_100208212 3300005364 Unclassified 1687
154 Ga0070673_100549318 3300005364 Bacteria 1049
155 Ga0070673_100635366 3300005364 Bacteria 976
156 Ga0070688_100060927 3300005365 Bacteria 2384
157 Ga0070688_100098261 3300005365 Unclassified 1925
158 Ga0070688_100216235 3300005365 Unclassified 1348
159 Ga0070688_100476940 3300005365 Unclassified 937
160 Ga0070688_101083333 3300005365 Unclassified 640
161 Ga0070659_100197547 3300005366 Bacteria 1655
162 Ga0070667_100179209 3300005367 Unclassified 1873
163 Ga0070667_100414741 3300005367 Bacteria 1227
164 Ga0070667_100587289 3300005367 Unclassified 1026
165 Ga0070709_10007316 3300005434 Bacteria 6051
166 Ga0070709_10759539 3300005434 Bacteria 758
167 Ga0070714_100003070 3300005435 Bacteria 12391
168 Ga0070713_100004893 3300005436 Bacteria 9089
169 Ga0070713_100193518 3300005436 Bacteria 1834
170 Ga0070713_100900072 3300005436 Unclassified 851
171 Ga0070713_101253314 3300005436 Unclassified 718
172 Ga0070713_101716902 3300005436 Unclassified 609
173 Ga0070701_10080120 3300005438 Bacteria 1765
174 Ga0070701_10102714 3300005438 Unclassified 1586
175 Ga0070705_100001404 3300005440 Bacteria 12773
176 Ga0070705_100014875 3300005440 Bacteria 4013
177 Ga0070705_100053659 3300005440 Bacteria 2361
178 Ga0070705_100135726 3300005440 Bacteria 1611
179 Ga0070700_100000788 3300005441 Bacteria 15603
180 Ga0070700_100006082 3300005441 Bacteria 6427
181 Ga0070700_100059550 3300005441 Unclassified 2404
182 Ga0070700_100068953 3300005441 Unclassified 2250
183 Ga0070700_100274394 3300005441 Bacteria 1220
184 Ga0070700_100906779 3300005441 Bacteria 718
185 Ga0070694_100002894 3300005444 Bacteria 10201
186 Ga0070694_100005858 3300005444 Bacteria 7456
187 Ga0070694_100007026 3300005444 Bacteria 6848
188 Ga0070694_100172110 3300005444 Bacteria 1596
189 Ga0070694_100379711 3300005444 Bacteria 1102
190 Ga0070694_100502706 3300005444 Unclassified 965
191 Ga0070694_100802159 3300005444 Bacteria 772
192 Ga0070708_100032111 3300005445 Bacteria 4551
193 Ga0070708_100519664 3300005445 Bacteria 1123
194 Ga0070708_100607625 3300005445 Unclassified 1031
195 Ga0070708_100868844 3300005445 Bacteria 847
196 Ga0070663_100037019 3300005455 Bacteria 3394
197 Ga0070663_100878596 3300005455 Unclassified 773
198 Ga0070678_100109353 3300005456 Bacteria 2159
199 Ga0070678_100116947 3300005456 Bacteria 2096
200 Ga0070678_100130775 3300005456 Bacteria 1994
201 Ga0070678_100140021 3300005456 Bacteria 1935
202 Ga0070678_100494754 3300005456 Unclassified 1078
203 Ga0070678_100653885 3300005456 Unclassified 943
204 Ga0070678_100709470 3300005456 Bacteria 907
205 Ga0070662_100073576 3300005457 Bacteria 2525
206 Ga0070662_100203340 3300005457 Unclassified 1573
207 Ga0070662_100380504 3300005457 Bacteria 1162
208 Ga0070662_100593270 3300005457 Unclassified 931
209 Ga0070662_100874882 3300005457 Unclassified 766
210 Ga0070662_101063022 3300005457 Bacteria 694
211 Ga0070681_10386081 3300005458 Bacteria 1311
212 Ga0070681_11157304 3300005458 Bacteria 695
213 Ga0068867_100000380 3300005459 Bacteria 29556
214 Ga0068867_100115369 3300005459 Bacteria 2069
215 Ga0068867_100138704 3300005459 Bacteria 1898
216 Ga0068867_100139519 3300005459 Unclassified 1893
217 Ga0068867_100686917 3300005459 Bacteria 902
218 Ga0068867_100709371 3300005459 Bacteria 888
219 Ga0068867_100713581 3300005459 Unclassified 886
220 Ga0068867_100944408 3300005459 Unclassified 779
221 Ga0068867_101063118 3300005459 Bacteria 737
222 Ga0068867_101672557 3300005459 Bacteria 596
223 Ga0068867_101710127 3300005459 Unclassified 590
224 Ga0070685_10047159 3300005466 Bacteria 2477
225 Ga0070685_10050222 3300005466 Unclassified 2409
226 Ga0070685_10106243 3300005466 Bacteria 1722
227 Ga0070685_10197670 3300005466 Unclassified 1305
228 Ga0070685_10545954 3300005466 Unclassified 826
229 Ga0070706_100186401 3300005467 Bacteria 1939
230 Ga0070706_100236430 3300005467 Bacteria 1706
231 Ga0070706_100286210 3300005467 Bacteria 1538
232 Ga0070706_100774035 3300005467 Bacteria 889
233 Ga0070706_101121435 3300005467 Unclassified 724
234 Ga0070706_101226546 3300005467 Unclassified 689
235 Ga0070707_100442076 3300005468 Bacteria 1261
236 Ga0070707_100657285 3300005468 Bacteria 1011
237 Ga0070707_101094705 3300005468 Unclassified 763
238 Ga0070707_101286300 3300005468 Unclassified 698
239 Ga0070698_100003115 3300005471 Bacteria 18284
240 Ga0070698_100006640 3300005471 Bacteria 12545
241 Ga0070698_100011223 3300005471 Bacteria 9517
242 Ga0070698_100072413 3300005471 Bacteria 3454
243 Ga0070698_100138182 3300005471 Unclassified 2390
244 Ga0070698_100394572 3300005471 Bacteria 1317
245 Ga0070699_100003719 3300005518 Bacteria 13483
246 Ga0070699_100006814 3300005518 Bacteria 9942
247 Ga0070699_100100290 3300005518 Bacteria 2538
248 Ga0070699_100123199 3300005518 Unclassified 2281
249 Ga0070679_100010050 3300005530 Bacteria 8963
250 Ga0070679_100127817 3300005530 Unclassified 2523
251 Ga0070679_100548131 3300005530 Bacteria 1100
252 Ga0070679_100776591 3300005530 Unclassified 901
253 Ga0070684_100076110 3300005535 Bacteria 2962
254 Ga0070684_100179696 3300005535 Bacteria 1924
255 Ga0070684_100519127 3300005535 Bacteria 1104
256 Ga0070684_101199138 3300005535 Bacteria 714
257 Ga0068853_100611029 3300005539 Unclassified 1036
258 Ga0070672_100004404 3300005543 Bacteria 9223
259 Ga0070672_100005217 3300005543 Bacteria 8597
260 Ga0070672_100062004 3300005543 Bacteria 2950
261 Ga0070672_100157158 3300005543 Unclassified 1884
262 Ga0070672_100196808 3300005543 Bacteria 1684
263 Ga0070672_100213036 3300005543 Unclassified 1618
264 Ga0070672_100617737 3300005543 Bacteria 945
265 Ga0070672_100692814 3300005543 Bacteria 892
266 Ga0070672_100729197 3300005543 Unclassified 869
267 Ga0070672_101137246 3300005543 Unclassified 694
268 Ga0070686_100000153 3300005544 Bacteria 47434
269 Ga0070686_100030299 3300005544 Unclassified 3299
270 Ga0070686_100084274 3300005544 Bacteria 2111
271 Ga0070686_100188159 3300005544 Bacteria 1472
272 Ga0070686_100218647 3300005544 Bacteria 1376
273 Ga0070686_100313655 3300005544 Unclassified 1167
274 Ga0070686_100375621 3300005544 Unclassified 1075
275 Ga0070686_100537386 3300005544 Unclassified 912
276 Ga0070695_100016291 3300005545 Bacteria 4496
277 Ga0070695_100027664 3300005545 Bacteria 3515
278 Ga0070695_100170257 3300005545 Bacteria 1536
279 Ga0070695_100502552 3300005545 Unclassified 938
280 Ga0070695_100826694 3300005545 Unclassified 744
281 Ga0070695_100954808 3300005545 Unclassified 695
282 Ga0070696_100018169 3300005546 Bacteria 4750
283 Ga0070696_100039612 3300005546 Bacteria 3253
284 Ga0070696_100112265 3300005546 Unclassified 1964
285 Ga0070696_100552454 3300005546 Unclassified 923
286 Ga0070696_100587157 3300005546 Bacteria 897
287 Ga0070693_100169522 3300005547 Bacteria 1397
288 Ga0070693_100720868 3300005547 Bacteria 732
289 Ga0070693_100759909 3300005547 Unclassified 715
290 Ga0070693_100836877 3300005547 Unclassified 685
291 Ga0070665_100002502 3300005548 Bacteria 20209
292 Ga0070665_100010631 3300005548 Bacteria 9316
293 Ga0070665_100020086 3300005548 Bacteria 6706
294 Ga0070665_100078682 3300005548 Bacteria 3304
295 Ga0070665_100195381 3300005548 Unclassified 2024
296 Ga0070665_100950167 3300005548 Unclassified 872
297 Ga0070704_100000089 3300005549 Bacteria 31704
298 Ga0070704_100026609 3300005549 Unclassified 3825
299 Ga0070704_100032604 3300005549 Unclassified 3516
300 Ga0070704_100074989 3300005549 Bacteria 2469
301 Ga0070704_100134456 3300005549 Bacteria 1922
302 Ga0070704_100631855 3300005549 Unclassified 944
303 Ga0070704_100700314 3300005549 Unclassified 898
304 Ga0070704_101267826 3300005549 Unclassified 674
305 Ga0070704_101301510 3300005549 Unclassified 665
306 Ga0068855_100020680 3300005563 Bacteria 7892
307 Ga0068855_100238478 3300005563 Bacteria 2033
308 Ga0068855_100450881 3300005563 Unclassified 1404
309 Ga0068855_100492643 3300005563 Unclassified 1333
310 Ga0068855_100652639 3300005563 Bacteria 1130
311 Ga0068855_100798835 3300005563 Bacteria 1003
312 Ga0070664_100009603 3300005564 Bacteria 7847
313 Ga0070664_100097790 3300005564 Bacteria 2549
314 Ga0070664_100236671 3300005564 Bacteria 1638
315 Ga0070664_100346288 3300005564 Unclassified 1351
316 Ga0068857_100136211 3300005577 Unclassified 2217
317 Ga0068857_100358762 3300005577 Bacteria 1351
318 Ga0068857_100522165 3300005577 Bacteria 1116
319 Ga0068857_100639122 3300005577 Bacteria 1008
320 Ga0068854_100163499 3300005578 Unclassified 1726
321 Ga0068854_101120050 3300005578 Unclassified 702
322 Ga0068856_101833176 3300005614 Bacteria 618
323 Ga0068856_101950599 3300005614 Unclassified 598
324 Ga0070702_100003228 3300005615 Bacteria 7254
325 Ga0070702_100053993 3300005615 Unclassified 2310
326 Ga0070702_100357397 3300005615 Unclassified 1031
327 Ga0070702_100962764 3300005615 Bacteria 673
328 Ga0068852_100377942 3300005616 Bacteria 1389
329 Ga0068852_100746608 3300005616 Bacteria 991
330 Ga0068852_101897063 3300005616 Unclassified 618
331 Ga0068859_100025246 3300005617 Bacteria 5963
332 Ga0068859_100137975 3300005617 Bacteria 2512
333 Ga0068859_100191448 3300005617 Unclassified 2130
334 Ga0068859_100208366 3300005617 Bacteria 2041
335 Ga0068859_100504379 3300005617 Bacteria 1305
336 Ga0068859_100506815 3300005617 Bacteria 1302
337 Ga0068859_100714266 3300005617 Unclassified 1092
338 Ga0068859_100759169 3300005617 Bacteria 1059
339 Ga0068859_101723599 3300005617 Unclassified 692
340 Ga0068864_100002939 3300005618 Bacteria 14090
341 Ga0068864_100099244 3300005618 Unclassified 2579
342 Ga0068864_100201604 3300005618 Viruses 1828
343 Ga0068864_100207644 3300005618 Unclassified 1802
344 Ga0068864_100234303 3300005618 Bacteria 1699
345 Ga0068864_100234644 3300005618 Bacteria 1698
346 Ga0068864_100313810 3300005618 Unclassified 1471
347 Ga0068864_100391631 3300005618 Unclassified 1319
348 Ga0068864_100975212 3300005618 Bacteria 840
349 Ga0068866_10009441 3300005718 Bacteria 4142
350 Ga0068866_10024941 3300005718 Unclassified 2805
351 Ga0068866_10084161 3300005718 Unclassified 1716
352 Ga0068866_10085221 3300005718 Bacteria 1707
353 Ga0068861_100010565 3300005719 Bacteria 6410
354 Ga0068861_100079028 3300005719 Viruses 2571
355 Ga0068861_100091306 3300005719 Unclassified 2404
356 Ga0068861_100093769 3300005719 Bacteria 2374
357 Ga0068861_100129925 3300005719 Bacteria 2044
358 Ga0068861_100164360 3300005719 Unclassified 1834
359 Ga0068861_100253110 3300005719 Bacteria 1504
360 Ga0068861_100488257 3300005719 Unclassified 1111
361 Ga0068861_100823788 3300005719 Unclassified 873
362 Ga0068861_101454819 3300005719 Unclassified 671
363 Ga0068851_10033637 3300005834 Bacteria 2556
364 Ga0068851_10150437 3300005834 Unclassified 1272
365 Ga0068870_10002891 3300005840 Bacteria 7236
366 Ga0068870_10032435 3300005840 Bacteria 2656
367 Ga0068870_10034344 3300005840 Bacteria 2595
368 Ga0068870_10234070 3300005840 Bacteria 1131
369 Ga0068870_10616965 3300005840 Bacteria 739
370 Ga0068863_100062464 3300005841 Bacteria 3523
371 Ga0068863_100143458 3300005841 Unclassified 2283
372 Ga0068863_100184236 3300005841 Bacteria 2005
373 Ga0068863_100199173 3300005841 Unclassified 1926
374 Ga0068863_100300972 3300005841 Bacteria 1556
375 Ga0068863_100313525 3300005841 Unclassified 1523
376 Ga0068863_100650258 3300005841 Unclassified 1046
377 Ga0068863_101144537 3300005841 Unclassified 783
378 Ga0068858_100003255 3300005842 Bacteria 16182
379 Ga0068858_100017044 3300005842 Bacteria 6819
380 Ga0068858_100039216 3300005842 Bacteria 4393
381 Ga0068858_100075256 3300005842 Bacteria 3136
382 Ga0068858_100130019 3300005842 Bacteria 2360
383 Ga0068858_100206865 3300005842 Bacteria 1857
384 Ga0068858_100559154 3300005842 Unclassified 1108
385 Ga0068858_101037450 3300005842 Unclassified 804
386 Ga0068860_100017193 3300005843 Bacteria 7050
387 Ga0068860_100034523 3300005843 Unclassified 4852
388 Ga0068860_100219487 3300005843 Bacteria 1846
389 Ga0068860_100271636 3300005843 Unclassified 1655
390 Ga0068860_100347516 3300005843 Bacteria 1459
391 Ga0068860_100354361 3300005843 Unclassified 1445
392 Ga0068860_100356221 3300005843 Unclassified 1441
393 Ga0068860_100392211 3300005843 Bacteria 1372
394 Ga0068862_100021517 3300005844 Bacteria 5389
395 Ga0068862_100024869 3300005844 Bacteria 5025
396 Ga0068862_100040092 3300005844 Unclassified 3980
397 Ga0068862_100053094 3300005844 Bacteria 3469
398 Ga0068862_100260760 3300005844 Bacteria 1582
399 Ga0068862_100384271 3300005844 Bacteria 1310
400 Ga0068862_100429973 3300005844 Bacteria 1241
401 Ga0068862_100594903 3300005844 Bacteria 1061
402 Ga0068862_100636813 3300005844 Unclassified 1027
403 Ga0068862_100657343 3300005844 Bacteria 1011
404 Ga0068862_100746979 3300005844 Unclassified 951
405 Ga0081455_10008971 3300005937 Bacteria 10330
406 Ga0081455_10047875 3300005937 Bacteria 3698
407 Ga0081539_10002012 3300005985 Bacteria 30795
408 Ga0070717_11361300 3300006028 Bacteria 645
409 Ga0075365_10059942 3300006038 Bacteria 2538
410 Ga0070715_10045399 3300006163 Unclassified 1863
411 Ga0070715_10059729 3300006163 Unclassified 1669
412 Ga0070715_10370458 3300006163 Bacteria 788
413 Ga0070716_100007561 3300006173 Bacteria 5360
414 Ga0070716_100112531 3300006173 Bacteria 1690
415 Ga0070716_100520649 3300006173 Bacteria 881
416 Ga0070716_100865244 3300006173 Unclassified 705
417 Ga0070712_100031176 3300006175 Bacteria 3590
418 Ga0070712_100416201 3300006175 Unclassified 1113
419 Ga0097621_100000125 3300006237 Bacteria 44370
420 Ga0097621_100014893 3300006237 Bacteria 5835
421 Ga0097621_100017310 3300006237 Bacteria 5470
422 Ga0097621_100039658 3300006237 Bacteria 3784
423 Ga0097621_100069253 3300006237 Bacteria 2913
424 Ga0097621_100113414 3300006237 Unclassified 2293
425 Ga0097621_100126207 3300006237 Bacteria 2174
426 Ga0097621_100378715 3300006237 Bacteria 1263
427 Ga0097621_100616551 3300006237 Bacteria 993
428 Ga0097621_100643048 3300006237 Unclassified 973
429 Ga0097621_100724582 3300006237 Unclassified 917
430 Ga0097621_101182064 3300006237 Unclassified 720
431 Ga0068871_100000134 3300006358 Bacteria 47412
432 Ga0068871_100005587 3300006358 Bacteria 8816
433 Ga0068871_100039886 3300006358 Unclassified 3759
434 Ga0068871_100063808 3300006358 Bacteria 3014
435 Ga0068871_100069169 3300006358 Bacteria 2899
436 Ga0068871_100077391 3300006358 Bacteria 2749
437 Ga0068871_100146031 3300006358 Unclassified 2014
438 Ga0068871_100149927 3300006358 Bacteria 1988
439 Ga0068871_100193434 3300006358 Bacteria 1753
440 Ga0068871_100291605 3300006358 Bacteria 1430
441 Ga0068871_100497971 3300006358 Bacteria 1098
442 Ga0068871_100649783 3300006358 Bacteria 963
443 Ga0068871_100695008 3300006358 Unclassified 931
444 Ga0075428_100000497 3300006844 Bacteria 39844
445 Ga0075428_100006846 3300006844 Bacteria 12668
446 Ga0075428_100009506 3300006844 Bacteria 10796
447 Ga0075428_100026808 3300006844 Bacteria 6380
448 Ga0075428_100031650 3300006844 Bacteria 5845
449 Ga0075428_100057506 3300006844 Bacteria 4257
450 Ga0075428_100089732 3300006844 Bacteria 3352
451 Ga0075428_100121569 3300006844 Unclassified 2843
452 Ga0075428_100245232 3300006844 Bacteria 1932
453 Ga0075428_100310045 3300006844 Bacteria 1696
454 Ga0075428_100429732 3300006844 Unclassified 1415
455 Ga0075428_100602931 3300006844 Bacteria 1173
456 Ga0075428_101084827 3300006844 Bacteria 846
457 Ga0075428_101635840 3300006844 Bacteria 673
458 Ga0075430_100001681 3300006846 Bacteria 18091
459 Ga0075430_100002096 3300006846 Bacteria 16500
460 Ga0075430_100013822 3300006846 Bacteria 6877
461 Ga0075430_100019140 3300006846 Bacteria 5823
462 Ga0075430_100025839 3300006846 Bacteria 4997
463 Ga0075430_100028057 3300006846 Bacteria 4782
464 Ga0075430_100054894 3300006846 Unclassified 3351
465 Ga0075431_100001219 3300006847 Bacteria 23281
466 Ga0075431_100003323 3300006847 Bacteria 15578
467 Ga0075431_100023672 3300006847 Bacteria 6287
468 Ga0075431_100069493 3300006847 Unclassified 3633
469 Ga0075431_100079466 3300006847 Bacteria 3385
470 Ga0075431_100199916 3300006847 Bacteria 2045
471 Ga0075431_100215703 3300006847 Bacteria 1959
472 Ga0075431_100241070 3300006847 Bacteria 1839
473 Ga0075431_100486414 3300006847 Unclassified 1226
474 Ga0075431_100830336 3300006847 Bacteria 896
475 Ga0075433_10000157 3300006852 Bacteria 36577
476 Ga0075433_10116506 3300006852 Bacteria 2370
477 Ga0075433_10146790 3300006852 Bacteria 2097
478 Ga0075433_10177266 3300006852 Unclassified 1896
479 Ga0075433_10323195 3300006852 Bacteria 1365
480 Ga0075433_10336636 3300006852 Unclassified 1334
481 Ga0075433_10467641 3300006852 Bacteria 1111
482 Ga0075433_10615587 3300006852 Unclassified 953
483 Ga0075433_10789605 3300006852 Bacteria 830
484 Ga0075433_10835721 3300006852 Bacteria 804
485 Ga0075433_11039815 3300006852 Unclassified 713
486 Ga0075433_11078459 3300006852 Bacteria 699
487 Ga0075434_100002504 3300006871 Bacteria 16204
488 Ga0075434_100005743 3300006871 Bacteria 11328
489 Ga0075434_100006773 3300006871 Bacteria 10532
490 Ga0075434_100011771 3300006871 Bacteria 8264
491 Ga0075434_100017244 3300006871 Bacteria 6954
492 Ga0075434_100029295 3300006871 Bacteria 5414
493 Ga0075434_100065080 3300006871 Unclassified 3631
494 Ga0075434_100082673 3300006871 Bacteria 3209
495 Ga0075434_100151742 3300006871 Bacteria 2337
496 Ga0075434_100192229 3300006871 Bacteria 2061
497 Ga0075434_100302147 3300006871 Bacteria 1621
498 Ga0075434_100453363 3300006871 Bacteria 1304
499 Ga0075434_100476073 3300006871 Bacteria 1270
500 Ga0075434_100489240 3300006871 Bacteria 1251
501 Ga0075434_100524690 3300006871 Unclassified 1205
502 Ga0075429_100004479 3300006880 Bacteria 12017
503 Ga0075429_100005139 3300006880 Bacteria 11253
504 Ga0075429_100008026 3300006880 Bacteria 9173
505 Ga0075429_100019963 3300006880 Bacteria 5812
506 Ga0075429_100096081 3300006880 Bacteria 2584
507 Ga0075429_100122343 3300006880 Unclassified 2275
508 Ga0075429_100126374 3300006880 Bacteria 2236
509 Ga0075429_100239199 3300006880 Unclassified 1590
510 Ga0075429_100266863 3300006880 Bacteria 1499
511 Ga0075429_100314822 3300006880 Bacteria 1370
512 Ga0075429_100319622 3300006880 Unclassified 1359
513 Ga0068865_100002757 3300006881 Bacteria 10443
514 Ga0068865_100030248 3300006881 Bacteria 3601
515 Ga0068865_100076131 3300006881 Bacteria 2394
516 Ga0068865_100145708 3300006881 Bacteria 1791
517 Ga0068865_100189475 3300006881 Unclassified 1589
518 Ga0068865_100576003 3300006881 Unclassified 948
519 Ga0068865_100760792 3300006881 Unclassified 833
520 Ga0068865_100834735 3300006881 Bacteria 797
521 Ga0075436_100004813 3300006914 Bacteria 9275
522 Ga0075436_100017704 3300006914 Bacteria 4877
523 Ga0075436_100017749 3300006914 Bacteria 4872
524 Ga0075436_100084710 3300006914 Unclassified 2200
525 Ga0075436_100104286 3300006914 Unclassified 1976
526 Ga0075436_100132881 3300006914 Bacteria 1746
527 Ga0075436_100241247 3300006914 Bacteria 1285
528 Ga0097620_100025246 3300006931 Bacteria 5963
529 Ga0097620_100137972 3300006931 Bacteria 2512
530 Ga0097620_100191442 3300006931 Unclassified 2130
531 Ga0097620_100208383 3300006931 Bacteria 2041
532 Ga0097620_100504446 3300006931 Bacteria 1305
533 Ga0097620_100506803 3300006931 Bacteria 1302
534 Ga0097620_100714267 3300006931 Unclassified 1092
535 Ga0097620_100759135 3300006931 Bacteria 1059
536 Ga0097620_100837173 3300006931 Bacteria 1006
537 Ga0097620_101723800 3300006931 Unclassified 692
538 Ga0075435_100000204 3300007076 Bacteria 35933
539 Ga0075435_100007928 3300007076 Bacteria 7601
540 Ga0075435_100015754 3300007076 Bacteria 5688
541 Ga0075435_100027042 3300007076 Bacteria 4484
542 Ga0075435_100065934 3300007076 Bacteria 2944
543 Ga0075435_100177038 3300007076 Bacteria 1801
544 Ga0075435_100212697 3300007076 Bacteria 1641
545 Ga0075435_100310333 3300007076 Bacteria 1350
546 Ga0075435_100494082 3300007076 Bacteria 1058
547 Ga0075435_100509157 3300007076 Bacteria 1041
548 Ga0105251_10096311 3300009011 Bacteria 1356
549 Ga0105244_10445466 3300009036 Unclassified 596
550 Ga0105240_10037691 3300009093 Bacteria 6211
551 Ga0105240_10170233 3300009093 Bacteria 2581
552 Ga0105240_10311990 3300009093 Unclassified 1796
553 Ga0105240_10450127 3300009093 Unclassified 1441
554 Ga0105240_10794797 3300009093 Bacteria 1025
555 Ga0105240_11465595 3300009093 Unclassified 716
556 Ga0111539_10000014 3300009094 Bacteria 307501
557 Ga0111539_10000134 3300009094 Bacteria 84765
558 Ga0111539_10001078 3300009094 Bacteria 36028
559 Ga0111539_10002632 3300009094 Bacteria 23770
560 Ga0111539_10004027 3300009094 Bacteria 19292
561 Ga0111539_10010143 3300009094 Bacteria 11870
562 Ga0111539_10015933 3300009094 Bacteria 9339
563 Ga0111539_10018505 3300009094 Bacteria 8629
564 Ga0111539_10066788 3300009094 Bacteria 4248
565 Ga0111539_10097678 3300009094 Bacteria 3450
566 Ga0111539_10187478 3300009094 Bacteria 2415
567 Ga0111539_10291782 3300009094 Unclassified 1898
568 Ga0111539_10321189 3300009094 Bacteria 1802
569 Ga0111539_10426199 3300009094 Bacteria 1545
570 Ga0111539_10510089 3300009094 Bacteria 1401
571 Ga0111539_10661077 3300009094 Bacteria 1217
572 Ga0111539_10806024 3300009094 Bacteria 1093
573 Ga0111539_11242735 3300009094 Unclassified 865
574 Ga0111539_11566589 3300009094 Unclassified 764
575 Ga0105245_10018654 3300009098 Bacteria 6068
576 Ga0105245_10046562 3300009098 Bacteria 3876
577 Ga0105245_10266120 3300009098 Bacteria 1670
578 Ga0105245_10518549 3300009098 Bacteria 1210
579 Ga0105245_10832324 3300009098 Unclassified 962
580 Ga0105245_11922539 3300009098 Unclassified 645
581 Ga0105247_10058133 3300009101 Bacteria 2392
582 Ga0105247_10159725 3300009101 Bacteria 1491
583 Ga0105247_10271953 3300009101 Bacteria 1166
584 Ga0114129_10000426 3300009147 Bacteria 50026
585 Ga0114129_10001213 3300009147 Bacteria 34237
586 Ga0114129_10004137 3300009147 Bacteria 20495
587 Ga0114129_10009181 3300009147 Bacteria 14099
588 Ga0114129_10009385 3300009147 Bacteria 13946
589 Ga0114129_10011201 3300009147 Bacteria 12784
590 Ga0114129_10016744 3300009147 Bacteria 10441
591 Ga0114129_10016919 3300009147 Bacteria 10383
592 Ga0114129_10029055 3300009147 Bacteria 7831
593 Ga0114129_10048963 3300009147 Bacteria 5939
594 Ga0114129_10051960 3300009147 Bacteria 5753
595 Ga0114129_10057730 3300009147 Bacteria 5430
596 Ga0114129_10064329 3300009147 Bacteria 5118
597 Ga0114129_10067793 3300009147 Bacteria 4975
598 Ga0114129_10072643 3300009147 Bacteria 4795
599 Ga0114129_10073868 3300009147 Bacteria 4750
600 Ga0114129_10095042 3300009147 Unclassified 4128
601 Ga0114129_10109022 3300009147 Bacteria 3822
602 Ga0114129_10143188 3300009147 Bacteria 3276
603 Ga0114129_10295970 3300009147 Bacteria 2159
604 Ga0114129_10566980 3300009147 Bacteria 1475
605 Ga0114129_11160523 3300009147 Bacteria 964
606 Ga0114129_11692215 3300009147 Unclassified 772
607 Ga0114129_12487459 3300009147 Unclassified 619
608 Ga0114129_12703291 3300009147 Unclassified 591
609 Ga0105243_10006934 3300009148 Bacteria 8724
610 Ga0105243_10010791 3300009148 Bacteria 6914
611 Ga0105243_10089689 3300009148 Bacteria 2529
612 Ga0105243_10175709 3300009148 Bacteria 1858
613 Ga0105243_10506248 3300009148 Bacteria 1145
614 Ga0105243_10771100 3300009148 Unclassified 945
615 Ga0105243_10923197 3300009148 Unclassified 870
616 Ga0105243_11471236 3300009148 Bacteria 704
617 Ga0105243_11608999 3300009148 Unclassified 676
618 Ga0105241_10026107 3300009174 Bacteria 4345
619 Ga0105241_10568860 3300009174 Bacteria 1020
620 Ga0105241_11039566 3300009174 Bacteria 768
621 Ga0105241_11892246 3300009174 Unclassified 584
622 Ga0105242_10022412 3300009176 Bacteria 4966
623 Ga0105242_10026817 3300009176 Unclassified 4569
624 Ga0105242_10268432 3300009176 Unclassified 1544
625 Ga0105242_10328003 3300009176 Bacteria 1406
626 Ga0105242_10366387 3300009176 Bacteria 1335
627 Ga0105242_10665893 3300009176 Bacteria 1014
628 Ga0105242_11024614 3300009176 Bacteria 835
629 Ga0105248_10002172 3300009177 Bacteria 21714
630 Ga0105248_10007536 3300009177 Bacteria 11949
631 Ga0105248_10043045 3300009177 Bacteria 5064
632 Ga0105248_10052710 3300009177 Bacteria 4565
633 Ga0105248_10059992 3300009177 Bacteria 4272
634 Ga0105248_10068556 3300009177 Bacteria 3982
635 Ga0105248_10107031 3300009177 Bacteria 3153
636 Ga0105248_10162200 3300009177 Unclassified 2521
637 Ga0105248_10200910 3300009177 Unclassified 2246
638 Ga0105248_10231761 3300009177 Unclassified 2079
639 Ga0105248_10320423 3300009177 Unclassified 1746
640 Ga0105248_10411347 3300009177 Unclassified 1523
641 Ga0105248_10495834 3300009177 Unclassified 1377
642 Ga0105248_11356672 3300009177 Bacteria 804
643 Ga0105248_12175856 3300009177 Unclassified 631
644 Ga0105237_10709398 3300009545 Bacteria 1012
645 Ga0105237_11273509 3300009545 Bacteria 742
646 Ga0105238_10036372 3300009551 Bacteria 5005
647 Ga0105238_10251909 3300009551 Unclassified 1744
648 Ga0105238_11837913 3300009551 Bacteria 638
649 Ga0105249_10025255 3300009553 Bacteria 5347
650 Ga0105249_10081617 3300009553 Bacteria 3006
651 Ga0105249_10272878 3300009553 Unclassified 1685
652 Ga0105249_10293297 3300009553 Unclassified 1629
653 Ga0105249_10350611 3300009553 Unclassified 1495
654 Ga0105249_10455199 3300009553 Unclassified 1319
655 Ga0105249_10867528 3300009553 Unclassified 969
656 Ga0105249_11977180 3300009553 Unclassified 656
657 Ga0105249_12262412 3300009553 Unclassified 616
658 Ga0105239_10699477 3300010375 Bacteria 1159
659 Ga0105239_10713110 3300010375 Bacteria 1147
660 Ga0105239_10815702 3300010375 Unclassified 1069
661 Ga0105246_10105238 3300011119 Unclassified 2062
662 Ga0105246_10467635 3300011119 Bacteria 1064
663 Ga0105246_10868449 3300011119 Unclassified 806
664 Ga0157373_11108636 3300013100 Unclassified 594
665 Ga0157370_10733794 3300013104 Unclassified 900
666 Ga0157374_10083773 3300013296 Bacteria 3030
667 Ga0157374_10104979 3300013296 Unclassified 2713
668 Ga0157374_10443606 3300013296 Bacteria 1299
669 Ga0157374_11656934 3300013296 Unclassified 664
670 Ga0157378_10009109 3300013297 Bacteria 8639
671 Ga0157378_10144928 3300013297 Bacteria 2208
672 Ga0157378_10561950 3300013297 Bacteria 1148
673 Ga0163162_10186185 3300013306 Unclassified 2203
674 Ga0163162_10549926 3300013306 Bacteria 1283
675 Ga0163162_10559856 3300013306 Bacteria 1271
676 Ga0163162_10609618 3300013306 Bacteria 1217
677 Ga0163162_11769678 3300013306 Bacteria 706
678 Ga0157372_10454180 3300013307 Bacteria 1493
679 Ga0157375_10055322 3300013308 Bacteria 3912
680 Ga0157375_10265853 3300013308 Unclassified 1877
681 Ga0157375_10340654 3300013308 Unclassified 1665
682 Ga0157375_10374552 3300013308 Unclassified 1590
683 Ga0157375_10587096 3300013308 Unclassified 1274
684 Ga0157375_10658352 3300013308 Unclassified 1203
685 Ga0157375_11224686 3300013308 Bacteria 881
686 Ga0163163_10006091 3300014325 Bacteria 10498
687 Ga0163163_10024951 3300014325 Bacteria 5693
688 Ga0163163_10033095 3300014325 Bacteria 4999
689 Ga0163163_10044334 3300014325 Bacteria 4363
690 Ga0163163_10049145 3300014325 Bacteria 4150
691 Ga0163163_10457893 3300014325 Unclassified 1336
692 Ga0163163_10662976 3300014325 Unclassified 1107
693 Ga0163163_11872649 3300014325 Bacteria 660
694 Ga0163163_12172974 3300014325 Unclassified 614
695 Ga0157380_10002946 3300014326 Bacteria 11577
696 Ga0157380_10008813 3300014326 Bacteria 7207
697 Ga0157380_10018744 3300014326 Bacteria 5145
698 Ga0157380_10048867 3300014326 Unclassified 3334
699 Ga0157380_10078622 3300014326 Unclassified 2692
700 Ga0157380_10088271 3300014326 Bacteria 2551
701 Ga0157380_10279419 3300014326 Bacteria 1527
702 Ga0157380_10417166 3300014326 Unclassified 1279
703 Ga0157380_10691176 3300014326 Unclassified 1024
704 Ga0157380_11418633 3300014326 Unclassified 745
705 Ga0157380_11524746 3300014326 Bacteria 722
706 Ga0157380_11547105 3300014326 Unclassified 717
707 Ga0157380_11772989 3300014326 Unclassified 676
708 Ga0182008_10291273 3300014497 Bacteria 852
709 Ga0157377_10066174 3300014745 Unclassified 2077
710 Ga0157377_10095762 3300014745 Bacteria 1760
711 Ga0157377_10155723 3300014745 Unclassified 1417
712 Ga0157377_10275103 3300014745 Bacteria 1101
713 Ga0157377_10331777 3300014745 Unclassified 1014
714 Ga0157377_10550822 3300014745 Unclassified 815
715 Ga0157379_10007040 3300014968 Bacteria 9721
716 Ga0157379_10007133 3300014968 Bacteria 9664
717 Ga0157379_10030765 3300014968 Bacteria 4780
718 Ga0157379_10037871 3300014968 Bacteria 4302
719 Ga0157379_10222767 3300014968 Bacteria 1709
720 Ga0157379_10304951 3300014968 Bacteria 1452
721 Ga0157379_10328355 3300014968 Bacteria 1397
722 Ga0157379_10640056 3300014968 Bacteria 995
723 Ga0157376_10024569 3300014969 Unclassified 4734
724 Ga0157376_10024693 3300014969 Bacteria 4724
725 Ga0157376_10086620 3300014969 Unclassified 2701
726 Ga0157376_10189607 3300014969 Bacteria 1885
727 Ga0157376_10366170 3300014969 Unclassified 1384
728 Ga0157376_10823342 3300014969 Bacteria 942
729 Ga0157376_11082052 3300014969 Unclassified 827
730 Ga0163161_10279799 3300017792 Bacteria 1308
731 Ga0163161_10379530 3300017792 Bacteria 1129
732 Ga0163161_10965245 3300017792 Unclassified 726
733 Ga0213876_10074971 3300021384 Bacteria 1787
734 Ga0207697_10024138 3300025315 Unclassified 2490
735 Ga0207697_10072296 3300025315 Bacteria 1446
736 Ga0207697_10274146 3300025315 Bacteria 747
737 Ga0207697_10357179 3300025315 Unclassified 649
738 Ga0207656_10097732 3300025321 Unclassified 1342
739 Ga0207653_10093372 3300025885 Unclassified 1056
740 Ga0207682_10004207 3300025893 Bacteria 6079
741 Ga0207682_10045366 3300025893 Unclassified 1803
742 Ga0207682_10048222 3300025893 Bacteria 1756
743 Ga0207682_10052586 3300025893 Unclassified 1688
744 Ga0207682_10064298 3300025893 Bacteria 1542
745 Ga0207682_10089494 3300025893 Unclassified 1332
746 Ga0207682_10093133 3300025893 Unclassified 1309
747 Ga0207682_10327128 3300025893 Unclassified 720
748 Ga0207692_10397454 3300025898 Bacteria 859
749 Ga0207642_10036643 3300025899 Bacteria 2107
750 Ga0207642_10101553 3300025899 Unclassified 1445
751 Ga0207710_10082088 3300025900 Bacteria 1497
752 Ga0207688_10348566 3300025901 Unclassified 912
753 Ga0207680_10023105 3300025903 Bacteria 3391
754 Ga0207680_10049583 3300025903 Unclassified 2500
755 Ga0207680_10132754 3300025903 Bacteria 1643
756 Ga0207680_10318152 3300025903 Unclassified 1088
757 Ga0207680_10792231 3300025903 Unclassified 679
758 Ga0207685_10174223 3300025905 Bacteria 992
759 Ga0207699_10026366 3300025906 Bacteria 3203
760 Ga0207699_10257100 3300025906 Bacteria 1206
761 Ga0207645_10001406 3300025907 Bacteria 19717
762 Ga0207645_10002286 3300025907 Bacteria 15200
763 Ga0207645_10065309 3300025907 Bacteria 2325
764 Ga0207645_10142585 3300025907 Unclassified 1561
765 Ga0207645_10148909 3300025907 Unclassified 1527
766 Ga0207643_10003202 3300025908 Bacteria 8817
767 Ga0207643_10042613 3300025908 Bacteria 2559
768 Ga0207643_10057393 3300025908 Bacteria 2216
769 Ga0207643_10077467 3300025908 Bacteria 1922
770 Ga0207643_10549995 3300025908 Unclassified 741
771 Ga0207684_10180841 3300025910 Unclassified 1818
772 Ga0207684_10189929 3300025910 Bacteria 1772
773 Ga0207684_10228661 3300025910 Bacteria 1605
774 Ga0207654_10301123 3300025911 Unclassified 1090
775 Ga0207707_10331947 3300025912 Bacteria 1312
776 Ga0207695_10151584 3300025913 Unclassified 2257
777 Ga0207695_10360308 3300025913 Unclassified 1341
778 Ga0207695_10428856 3300025913 Bacteria 1206
779 Ga0207695_10757082 3300025913 Bacteria 851
780 Ga0207671_10227660 3300025914 Bacteria 1462
781 Ga0207671_11049257 3300025914 Bacteria 641
782 Ga0207693_10139612 3300025915 Bacteria 1906
783 Ga0207693_10488325 3300025915 Unclassified 962
784 Ga0207693_10738222 3300025915 Unclassified 761
785 Ga0207663_10226206 3300025916 Unclassified 1364
786 Ga0207660_10085009 3300025917 Unclassified 2333
787 Ga0207660_10096368 3300025917 Bacteria 2202
788 Ga0207660_10165751 3300025917 Unclassified 1707
789 Ga0207660_10247169 3300025917 Bacteria 1407
790 Ga0207662_10007637 3300025918 Bacteria 5894
791 Ga0207662_10015889 3300025918 Bacteria 4241
792 Ga0207662_10099277 3300025918 Bacteria 1802
793 Ga0207662_10131006 3300025918 Unclassified 1581
794 Ga0207657_10006096 3300025919 Bacteria 12536
795 Ga0207657_10144559 3300025919 Bacteria 1941
796 Ga0207649_10073295 3300025920 Unclassified 2193
797 Ga0207649_10075530 3300025920 Unclassified 2166
798 Ga0207649_10727068 3300025920 Bacteria 771
799 Ga0207649_10857902 3300025920 Unclassified 711
800 Ga0207652_10052515 3300025921 Bacteria 3499
801 Ga0207652_10360643 3300025921 Unclassified 1312
802 Ga0207652_10399292 3300025921 Bacteria 1240
803 Ga0207652_10697637 3300025921 Unclassified 906
804 Ga0207652_10727255 3300025921 Bacteria 884
805 Ga0207646_10067972 3300025922 Bacteria 3182
806 Ga0207646_10146933 3300025922 Unclassified 2124
807 Ga0207646_10167580 3300025922 Bacteria 1983
808 Ga0207646_10658221 3300025922 Unclassified 938
809 Ga0207646_10771753 3300025922 Unclassified 857
810 Ga0207646_10980208 3300025922 Bacteria 747
811 Ga0207681_10009178 3300025923 Bacteria 6042
812 Ga0207681_10022038 3300025923 Bacteria 4059
813 Ga0207681_10025121 3300025923 Bacteria 3829
814 Ga0207681_10036364 3300025923 Bacteria 3248
815 Ga0207681_10051798 3300025923 Unclassified 2782
816 Ga0207681_10146109 3300025923 Bacteria 1767
817 Ga0207681_10438186 3300025923 Bacteria 1061
818 Ga0207694_10142401 3300025924 Unclassified 1929
819 Ga0207650_10002374 3300025925 Bacteria 13100
820 Ga0207650_10084901 3300025925 Bacteria 2407
821 Ga0207650_10121252 3300025925 Unclassified 2036
822 Ga0207650_10295594 3300025925 Unclassified 1322
823 Ga0207650_10549731 3300025925 Unclassified 968
824 Ga0207650_10801154 3300025925 Unclassified 798
825 Ga0207659_10000079 3300025926 Bacteria 60790
826 Ga0207659_10001272 3300025926 Bacteria 15110
827 Ga0207659_10001629 3300025926 Bacteria 13323
828 Ga0207659_10012585 3300025926 Bacteria 5389
829 Ga0207659_10029655 3300025926 Bacteria 3731
830 Ga0207659_10058294 3300025926 Bacteria 2772
831 Ga0207659_10097120 3300025926 Bacteria 2212
832 Ga0207659_10136365 3300025926 Bacteria 1900
833 Ga0207659_10163907 3300025926 Bacteria 1748
834 Ga0207659_10193963 3300025926 Bacteria 1618
835 Ga0207659_10235224 3300025926 Bacteria 1479
836 Ga0207659_10581384 3300025926 Bacteria 954
837 Ga0207687_10124628 3300025927 Bacteria 1932
838 Ga0207687_10136073 3300025927 Viruses 1858
839 Ga0207687_10263500 3300025927 Bacteria 1375
840 Ga0207687_11381762 3300025927 Unclassified 605
841 Ga0207700_10005583 3300025928 Bacteria 7549
842 Ga0207700_10006132 3300025928 Bacteria 7239
843 Ga0207700_10279505 3300025928 Bacteria 1436
844 Ga0207700_10438202 3300025928 Bacteria 1150
845 Ga0207700_11121973 3300025928 Bacteria 703
846 Ga0207664_10139643 3300025929 Bacteria 2048
847 Ga0207644_10098430 3300025931 Bacteria 2192
848 Ga0207644_10103306 3300025931 Bacteria 2144
849 Ga0207644_10464392 3300025931 Bacteria 1041
850 Ga0207644_11140984 3300025931 Unclassified 655
851 Ga0207690_10116446 3300025932 Bacteria 1933
852 Ga0207690_10159647 3300025932 Bacteria 1680
853 Ga0207706_10006050 3300025933 Bacteria 11253
854 Ga0207706_10101857 3300025933 Unclassified 2527
855 Ga0207706_10129500 3300025933 Unclassified 2219
856 Ga0207706_10134783 3300025933 Bacteria 2172
857 Ga0207706_10164552 3300025933 Bacteria 1949
858 Ga0207706_10167166 3300025933 Bacteria 1933
859 Ga0207706_10388096 3300025933 Unclassified 1211
860 Ga0207706_10418896 3300025933 Unclassified 1160
861 Ga0207706_10902198 3300025933 Unclassified 746
862 Ga0207686_10012850 3300025934 Bacteria 4615
863 Ga0207686_10020581 3300025934 Bacteria 3771
864 Ga0207686_10049693 3300025934 Bacteria 2604
865 Ga0207686_10238381 3300025934 Bacteria 1322
866 Ga0207686_10242409 3300025934 Bacteria 1313
867 Ga0207686_10647968 3300025934 Bacteria 835
868 Ga0207686_11249943 3300025934 Bacteria 609
869 Ga0207709_10004795 3300025935 Bacteria 7750
870 Ga0207709_10006292 3300025935 Bacteria 6666
871 Ga0207709_10194962 3300025935 Unclassified 1442
872 Ga0207709_10307838 3300025935 Bacteria 1181
873 Ga0207670_10002109 3300025936 Bacteria 10392
874 Ga0207670_10093752 3300025936 Unclassified 2128
875 Ga0207670_10163474 3300025936 Bacteria 1664
876 Ga0207670_10250581 3300025936 Bacteria 1368
877 Ga0207670_10341404 3300025936 Bacteria 1184
878 Ga0207670_10496198 3300025936 Bacteria 991
879 Ga0207670_10639302 3300025936 Bacteria 876
880 Ga0207670_10803123 3300025936 Unclassified 784
881 Ga0207669_10029033 3300025937 Bacteria 3052
882 Ga0207669_10322202 3300025937 Bacteria 1183
883 Ga0207669_10380953 3300025937 Unclassified 1099
884 Ga0207669_10612134 3300025937 Bacteria 886
885 Ga0207669_10702761 3300025937 Bacteria 831
886 Ga0207669_10807414 3300025937 Unclassified 778
887 Ga0207669_10889369 3300025937 Unclassified 743
888 Ga0207669_11210408 3300025937 Unclassified 640
889 Ga0207704_10001806 3300025938 Bacteria 9595
890 Ga0207704_10022964 3300025938 Bacteria 3353
891 Ga0207704_10095293 3300025938 Bacteria 1967
892 Ga0207704_10101794 3300025938 Bacteria 1917
893 Ga0207704_10141205 3300025938 Unclassified 1685
894 Ga0207704_10668633 3300025938 Bacteria 857
895 Ga0207665_10090888 3300025939 Unclassified 2116
896 Ga0207665_10553627 3300025939 Bacteria 894
897 Ga0207665_10852006 3300025939 Unclassified 722
898 Ga0207691_10018862 3300025940 Bacteria 6533
899 Ga0207691_10045113 3300025940 Bacteria 4054
900 Ga0207691_10070189 3300025940 Bacteria 3164
901 Ga0207691_10122904 3300025940 Bacteria 2298
902 Ga0207691_10176973 3300025940 Bacteria 1866
903 Ga0207691_10353247 3300025940 Bacteria 1257
904 Ga0207691_10428238 3300025940 Unclassified 1127
905 Ga0207691_10538456 3300025940 Bacteria 990
906 Ga0207691_10642074 3300025940 Unclassified 897
907 Ga0207691_10649339 3300025940 Unclassified 891
908 Ga0207711_10006268 3300025941 Bacteria 10036
909 Ga0207711_10027728 3300025941 Bacteria 4759
910 Ga0207711_10036902 3300025941 Bacteria 4148
911 Ga0207711_10057589 3300025941 Bacteria 3341
912 Ga0207711_10082424 3300025941 Bacteria 2811
913 Ga0207711_10141424 3300025941 Bacteria 2166
914 Ga0207711_10379055 3300025941 Bacteria 1312
915 Ga0207711_10584376 3300025941 Unclassified 1042
916 Ga0207711_10589809 3300025941 Bacteria 1037
917 Ga0207711_10821846 3300025941 Unclassified 865
918 Ga0207711_10920258 3300025941 Bacteria 813
919 Ga0207711_11097910 3300025941 Unclassified 736
920 Ga0207689_10000032 3300025942 Bacteria 96794
921 Ga0207689_10045085 3300025942 Bacteria 3647
922 Ga0207689_10081837 3300025942 Bacteria 2654
923 Ga0207689_10125401 3300025942 Bacteria 2112
924 Ga0207689_10228789 3300025942 Bacteria 1537
925 Ga0207689_10240049 3300025942 Bacteria 1498
926 Ga0207689_10323548 3300025942 Unclassified 1280
927 Ga0207661_10098786 3300025944 Viruses 2447
928 Ga0207661_10106732 3300025944 Unclassified 2361
929 Ga0207661_10334552 3300025944 Bacteria 1364
930 Ga0207661_10342356 3300025944 Bacteria 1348
931 Ga0207661_10396865 3300025944 Bacteria 1250
932 Ga0207661_10795048 3300025944 Bacteria 871
933 Ga0207679_10073204 3300025945 Bacteria 2591
934 Ga0207679_10686495 3300025945 Bacteria 928
935 Ga0207679_10744666 3300025945 Unclassified 891
936 Ga0207679_10801763 3300025945 Unclassified 858
937 Ga0207679_11371468 3300025945 Bacteria 649
938 Ga0207667_10104283 3300025949 Bacteria 2925
939 Ga0207667_10451829 3300025949 Bacteria 1306
940 Ga0207667_10866185 3300025949 Unclassified 897
941 Ga0207667_11025418 3300025949 Bacteria 811
942 Ga0207651_10010999 3300025960 Bacteria 5043
943 Ga0207651_10048187 3300025960 Unclassified 2878
944 Ga0207651_10110003 3300025960 Bacteria 2066
945 Ga0207651_10185688 3300025960 Bacteria 1654
946 Ga0207651_10342397 3300025960 Unclassified 1256
947 Ga0207651_10524791 3300025960 Bacteria 1027
948 Ga0207712_10073047 3300025961 Unclassified 2472
949 Ga0207712_10260004 3300025961 Bacteria 1407
950 Ga0207712_11240747 3300025961 Unclassified 666
951 Ga0207712_11279341 3300025961 Unclassified 655
952 Ga0207668_10085374 3300025972 Bacteria 2303
953 Ga0207668_10730246 3300025972 Bacteria 872
954 Ga0207668_11564651 3300025972 Unclassified 595
955 Ga0207640_10873542 3300025981 Unclassified 784
956 Ga0207640_10910496 3300025981 Unclassified 769
957 Ga0207640_11062493 3300025981 Unclassified 715
958 Ga0207677_10065710 3300026023 Unclassified 2532
959 Ga0207677_10201274 3300026023 Unclassified 1583
960 Ga0207677_10270975 3300026023 Bacteria 1389
961 Ga0207677_10331780 3300026023 Bacteria 1268
962 Ga0207677_10557228 3300026023 Unclassified 1000
963 Ga0207703_10008882 3300026035 Bacteria 7918
964 Ga0207703_10018977 3300026035 Bacteria 5372
965 Ga0207703_10045404 3300026035 Bacteria 3534
966 Ga0207703_10049674 3300026035 Bacteria 3392
967 Ga0207703_10065358 3300026035 Bacteria 2989
968 Ga0207703_10167253 3300026035 Unclassified 1931
969 Ga0207703_10227604 3300026035 Bacteria 1670
970 Ga0207703_10838593 3300026035 Bacteria 879
971 Ga0207703_10888294 3300026035 Unclassified 853
972 Ga0207703_11245904 3300026035 Unclassified 715
973 Ga0207639_10200242 3300026041 Bacteria 1712
974 Ga0207678_10054360 3300026067 Bacteria 3448
975 Ga0207678_10292250 3300026067 Bacteria 1400
976 Ga0207708_10004043 3300026075 Bacteria 10785
977 Ga0207708_10004337 3300026075 Bacteria 10446
978 Ga0207708_10102480 3300026075 Unclassified 2216
979 Ga0207708_10115449 3300026075 Unclassified 2088
980 Ga0207708_10132107 3300026075 Bacteria 1953
981 Ga0207708_10227810 3300026075 Bacteria 1495
982 Ga0207708_10231410 3300026075 Bacteria 1484
983 Ga0207708_10289983 3300026075 Bacteria 1328
984 Ga0207708_10419909 3300026075 Bacteria 1109
985 Ga0207702_10314643 3300026078 Unclassified 1489
986 Ga0207641_10000955 3300026088 Bacteria 29716
987 Ga0207641_10106423 3300026088 Bacteria 2479
988 Ga0207641_10329613 3300026088 Bacteria 1450
989 Ga0207641_10341335 3300026088 Unclassified 1425
990 Ga0207641_10790080 3300026088 Bacteria 938
991 Ga0207641_11598577 3300026088 Unclassified 654
992 Ga0207648_10001379 3300026089 Bacteria 26764
993 Ga0207648_10002536 3300026089 Bacteria 19594
994 Ga0207648_10053012 3300026089 Bacteria 3546
995 Ga0207648_10092785 3300026089 Bacteria 2640
996 Ga0207648_10099685 3300026089 Unclassified 2544
997 Ga0207648_10139264 3300026089 Bacteria 2138
998 Ga0207648_10211164 3300026089 Bacteria 1723
999 Ga0207648_10254914 3300026089 Unclassified 1565
1000 Ga0207648_10281533 3300026089 Unclassified 1487
1001 Ga0207648_10334651 3300026089 Unclassified 1362
1002 Ga0207648_11322834 3300026089 Bacteria 677
1003 Ga0207648_11467147 3300026089 Bacteria 641
1004 Ga0207676_10014812 3300026095 Bacteria 5618
1005 Ga0207676_10032483 3300026095 Bacteria 3934
1006 Ga0207676_10034193 3300026095 Bacteria 3847
1007 Ga0207676_10109644 3300026095 Unclassified 2307
1008 Ga0207676_10150793 3300026095 Bacteria 2002
1009 Ga0207676_10180475 3300026095 Viruses 1848
1010 Ga0207676_10307813 3300026095 Unclassified 1449
1011 Ga0207676_10525687 3300026095 Bacteria 1127
1012 Ga0207674_10061584 3300026116 Bacteria 3792
1013 Ga0207674_10592894 3300026116 Bacteria 1070
1014 Ga0207674_10656898 3300026116 Bacteria 1013
1015 Ga0207674_10707475 3300026116 Unclassified 972
1016 Ga0207675_100087094 3300026118 Unclassified 2933
1017 Ga0207675_100088170 3300026118 Bacteria 2914
1018 Ga0207675_100115838 3300026118 Unclassified 2532
1019 Ga0207675_100116172 3300026118 Bacteria 2529
1020 Ga0207675_100230505 3300026118 Bacteria 1787
1021 Ga0207675_100254408 3300026118 Bacteria 1701
1022 Ga0207675_100278637 3300026118 Bacteria 1624
1023 Ga0207675_100347885 3300026118 Unclassified 1452
1024 Ga0207675_100385732 3300026118 Bacteria 1378
1025 Ga0207675_100595480 3300026118 Bacteria 1108
1026 Ga0207675_100618544 3300026118 Bacteria 1087
1027 Ga0207675_100857438 3300026118 Unclassified 923
1028 Ga0207675_101042915 3300026118 Bacteria 837
1029 Ga0207683_10033044 3300026121 Bacteria 4493
1030 Ga0207683_10157417 3300026121 Bacteria 2052
1031 Ga0207683_10206224 3300026121 Bacteria 1788
1032 Ga0207683_10313072 3300026121 Unclassified 1437
1033 Ga0207683_10414536 3300026121 Bacteria 1240
1034 Ga0207683_10433160 3300026121 Bacteria 1212
1035 Ga0207683_10558342 3300026121 Bacteria 1059
1036 Ga0207683_10688106 3300026121 Unclassified 948
1037 Ga0207683_10800358 3300026121 Bacteria 875
1038 Ga0207683_11067291 3300026121 Unclassified 749
1039 Ga0207683_11146007 3300026121 Bacteria 721
1040 Ga0207698_10400208 3300026142 Unclassified 1312
1041 Ga0209983_1106675 3300027665 Unclassified 636
1042 Ga0209971_1026227 3300027682 Unclassified 1393
1043 Ga0209974_10063480 3300027876 Bacteria 1252
1044 Ga0207428_10000005 3300027907 Bacteria 520045
1045 Ga0207428_10000156 3300027907 Bacteria 93294
1046 Ga0207428_10003214 3300027907 Bacteria 15966
1047 Ga0207428_10006617 3300027907 Bacteria 10661
1048 Ga0207428_10007795 3300027907 Bacteria 9748
1049 Ga0207428_10017798 3300027907 Bacteria 6093
1050 Ga0207428_10032828 3300027907 Bacteria 4269
1051 Ga0207428_10035587 3300027907 Bacteria 4069
1052 Ga0207428_10331834 3300027907 Unclassified 1121
1053 Ga0207428_10630272 3300027907 Bacteria 771
1054 Ga0268266_10076315 3300028379 Bacteria 2912
1055 Ga0268266_10148463 3300028379 Bacteria 2110
1056 Ga0268266_10204191 3300028379 Bacteria 1810
1057 Ga0268266_10400322 3300028379 Unclassified 1298
1058 Ga0268265_10007655 3300028380 Bacteria 7289
1059 Ga0268265_10080399 3300028380 Bacteria 2570
1060 Ga0268265_10151383 3300028380 Unclassified 1957
1061 Ga0268265_10192637 3300028380 Bacteria 1762
1062 Ga0268265_10221870 3300028380 Unclassified 1655
1063 Ga0268265_10533288 3300028380 Bacteria 1111
1064 Ga0268265_10595829 3300028380 Unclassified 1055
1065 Ga0268264_10023300 3300028381 Bacteria 5051
1066 Ga0268264_10035080 3300028381 Bacteria 4130
1067 Ga0268264_10148355 3300028381 Bacteria 2100
1068 Ga0268264_10278405 3300028381 Bacteria 1566
1069 Ga0268264_10282422 3300028381 Unclassified 1556
1070 Ga0268264_10334699 3300028381 Unclassified 1436
1071 Ga0268264_10473607 3300028381 Unclassified 1217
1072 Ga0265316_10444674 3300031344 Bacteria 930
1073 Ga0307408_100078365 3300031548 Bacteria 2463
1074 Ga0307408_100081459 3300031548 Bacteria 2420
1075 Ga0307408_100392206 3300031548 Bacteria 1190
1076 Ga0307408_100803021 3300031548 Bacteria 854
1077 Ga0265314_10033286 3300031711 Bacteria 3782
1078 Ga0307405_10079173 3300031731 Unclassified 2141
1079 Ga0307405_10112523 3300031731 Unclassified 1847
1080 Ga0307405_10133043 3300031731 Bacteria 1722
1081 Ga0307405_10482364 3300031731 Unclassified 990
1082 Ga0307405_10597284 3300031731 Unclassified 900
1083 Ga0307413_10100156 3300031824 Unclassified 1912
1084 Ga0307413_10463454 3300031824 Unclassified 1009
1085 Ga0307413_10927710 3300031824 Unclassified 741
1086 Ga0307410_10051926 3300031852 Unclassified 2766
1087 Ga0307410_10079408 3300031852 Bacteria 2299
1088 Ga0307410_10116868 3300031852 Unclassified 1939
1089 Ga0307410_10124814 3300031852 Bacteria 1883
1090 Ga0307410_10835309 3300031852 Unclassified 785
1091 Ga0307406_10343830 3300031901 Bacteria 1163
1092 Ga0307407_10084019 3300031903 Unclassified 1933
1093 Ga0307412_10194730 3300031911 Bacteria 1535
1094 Ga0307412_10542345 3300031911 Bacteria 975
1095 Ga0307409_100074356 3300031995 Unclassified 2715
1096 Ga0307409_100300793 3300031995 Bacteria 1492
1097 Ga0307416_100028056 3300032002 Bacteria 4180
1098 Ga0307416_100038313 3300032002 Bacteria 3698
1099 Ga0307416_100059664 3300032002 Bacteria 3101
1100 Ga0307416_100300829 3300032002 Bacteria 1594
1101 Ga0307416_100374617 3300032002 Unclassified 1451
1102 Ga0307416_100707017 3300032002 Bacteria 1097
1103 Ga0307414_10097706 3300032004 Bacteria 2201
1104 Ga0307414_10129721 3300032004 Bacteria 1955
1105 Ga0307414_10349360 3300032004 Bacteria 1269
1106 Ga0307414_10615760 3300032004 Unclassified 975
1107 Ga0307414_10640988 3300032004 Unclassified 957
1108 Ga0307414_11121239 3300032004 Bacteria 727
1109 Ga0307411_10114535 3300032005 Unclassified 1937
1110 Ga0307411_10117822 3300032005 Unclassified 1914
1111 Ga0307411_10202710 3300032005 Bacteria 1525
1112 Ga0307411_10435962 3300032005 Bacteria 1092
1113 Ga0307411_10460682 3300032005 Unclassified 1066
1114 Ga0307415_100010673 3300032126 Bacteria 5213
1115 Ga0307415_100154027 3300032126 Bacteria 1773
1116 Ga0307415_100668424 3300032126 Unclassified 933
1117 Ga0307415_101172548 3300032126 Unclassified 722
1118 Ga0373930_0002854 3300034816 Bacteria 2711
1119 Ga0373948_0018575 3300034817 Unclassified 1307
1120 Ga0373950_0000492 3300034818 Bacteria 4841
1121 Ga0373958_0024338 3300034819 Bacteria 1145
1122 Ga0373928_0006977 3300035084 Bacteria 2177
1123 Ga0373929_0000407 3300035085 Bacteria 8103
1124 Ga0373949_0000966 3300035090 Bacteria 8928
1125 Ga0373952_0000798 3300035092 Bacteria 5659
1126 Ga0373923_0079124 3300035111 Unclassified 1424
1127 Ga0373939_0030625 3300035114 Bacteria 1549
1128 Ga0373939_0109649 3300035114 Unclassified 959
1129 Ga0373941_0013295 3300035115 Bacteria 2173
1130 Ga0373941_0183910 3300035115 Unclassified 786
1131 Ga0373953_0220071 3300035117 Bacteria 822
1132 Ga0373954_0051964 3300035118 Bacteria 1926
1133 Ga0373954_0184461 3300035118 Bacteria 1024
1134 Ga0373960_0217085 3300035121 Unclassified 683
1135 Ga0373943_0021226 3300035170 Bacteria 2997
1136 Ga0373943_0185733 3300035170 Bacteria 1145
1137 Ga0373943_0217615 3300035170 Unclassified 1063
1138 Ga0373943_0224021 3300035170 Bacteria 1048
1139 Ga0373946_0029315 3300035171 Bacteria 2190
1140 Ga0373946_0318098 3300035171 Bacteria 773
1141 Ga0373955_0003019 3300035172 Bacteria 7378
1142 Ga0373955_0046443 3300035172 Unclassified 2348
1143 Ga0373955_0076519 3300035172 Bacteria 1883
1144 Ga0373955_0442855 3300035172 Unclassified 791
1145 Ga0373955_0842861 3300035172 Unclassified 564
1146 Ga0373942_0001566 3300035207 Bacteria 5861
1147 Ga0373924_0021449 3300035410 Unclassified 2520
1148 Ga0373924_0140817 3300035410 Unclassified 1052
1149 Ga0373931_0007480 3300035691 Bacteria 5143
1150 Ga0373935_0083599 3300035692 Bacteria 2078
1151 Ga0373935_0134413 3300035692 Bacteria 1665
1152 Ga0373935_0164017 3300035692 Unclassified 1516
1153 Ga0373935_0185751 3300035692 Bacteria 1429
1154 Ga0373927_0155381 3300035695 Unclassified 1498
1155 Ga0373933_0418322 3300035724 Bacteria 875
1156 Ga0373933_0740285 3300035724 Unclassified 647
1157 Ga0373947_0003818 3300035725 Bacteria 8873
1158 Ga0373937_0012405 3300036401 Bacteria 7495
1159 Ga0373937_0176206 3300036401 Bacteria 2007
1160 Ga0373937_0381356 3300036401 Bacteria 1337
1161 Ga0373937_0393320 3300036401 Unclassified 1315
1162 Ga0373937_0608866 3300036401 Unclassified 1037
1163 Ga0373937_1823949 3300036401 Bacteria 555
1164 Ga0373925_0266622 3300037068 Bacteria 1377
1165 Ga0373925_0482653 3300037068 Bacteria 1017
1166 Ga0373925_0542746 3300037068 Bacteria 956
1167 Ga0373925_1199410 3300037068 Bacteria 624
1168 Ga0395900_0459263 3300037418 Unclassified 1229
1169 Ga0395905_0197773 3300037471 Bacteria 1885
1170 Ga0242420_027094 3300038996 Unclassified 1049
1171 Ga0436365_0956175 3300039437 Bacteria 2742
1172 Ga0436365_1732685 3300039437 Bacteria 2188
1173 Ga0439439_0093016 3300041406 Bacteria 825
1174 Ga0439453_0017767 3300041408 Bacteria 1252
1175 Ga0439453_0026277 3300041408 Bacteria 1078
1176 Ga0439431_0006753 3300041997 Unclassified 2547
1177 Ga0439433_0001889 3300041999 Bacteria 4381
1178 Ga0439437_014446 3300042000 Unclassified 923
1179 Ga0439462_0051606 3300042015 Bacteria 1106
1180 Ga0450892_007492 3300042130 Bacteria 921
1181 Ga0439446_0028655 3300042156 Bacteria 1604
1182 Ga0439446_0095397 3300042156 Unclassified 935
1183 Ga0439446_0251776 3300042156 Bacteria 609
1184 Ga0439458_0092357 3300042157 Bacteria 780
1185 Ga0439434_0099914 3300042435 Bacteria 934
1186 Ga0439435_0052341 3300042436 Bacteria 1172
1187 Ga0439435_0069724 3300042436 Bacteria 1039
1188 Ga0439464_0061668 3300042439 Bacteria 1098
1189 Ga0439460_0040424 3300042461 Bacteria 1366
1190 Ga0439460_0063976 3300042461 Bacteria 1128
1191 Ga0439460_0123444 3300042461 Bacteria 849
1192 Ga0450916_034769 3300042530 Bacteria 747
1193 Ga0451577_0424665 3300042876 Unclassified 1207
1194 Ga0439440_0033118 3300042993 Bacteria 1230
1195 Ga0439440_0098351 3300042993 Unclassified 793
1196 Ga0466963_0184194 3300044694 Bacteria 1458
1197 Ga0466963_0239302 3300044694 Bacteria 1273
1198 Ga0466957_0155932 3300044842 Bacteria 1480
1199 Ga0451576_0003703 3300045051 Bacteria 20672
1200 Ga0451576_0301734 3300045051 Bacteria 1675
1201 Ga0466967_0493469 3300045976 Bacteria 1201
1202 Ga0495592_0025040 3300046454 Bacteria 4532
1203 Ga0495592_0139872 3300046454 Bacteria 1685
1204 Ga0495603_0028319 3300046455 Unclassified 3379
1205 Ga0495603_0042909 3300046455 Unclassified 2702
1206 Ga0495603_0358636 3300046455 Bacteria 836
1207 Ga0495629_0085053 3300046459 Unclassified 2207
1208 Ga0495629_0206389 3300046459 Unclassified 1358
1209 Ga0495580_0316248 3300046472 Viruses 1061
1210 Ga0495582_0181798 3300046473 Bacteria 1198
1211 Ga0495582_0472333 3300046473 Bacteria 725
1212 Ga0495639_0076786 3300046475 Unclassified 1550
1213 Ga0495664_0171598 3300046477 Bacteria 1316
1214 Ga0495664_0296679 3300046477 Bacteria 976
1215 Ga0495584_0025210 3300046491 Bacteria 3014
1216 Ga0495584_0410163 3300046491 Unclassified 689
1217 Ga0495594_0029180 3300046499 Unclassified 2981
1218 Ga0495594_0066860 3300046499 Bacteria 1994
1219 Ga0495594_0252872 3300046499 Bacteria 1004
1220 Ga0495594_0353963 3300046499 Bacteria 836
1221 Ga0495608_0003942 3300046511 Bacteria 10667
1222 Ga0495618_0086045 3300046514 Bacteria 2010
1223 Ga0495618_0617134 3300046514 Bacteria 644
1224 Ga0495630_0009709 3300046517 Bacteria 6922
1225 Ga0495630_1022797 3300046517 Unclassified 628
1226 Ga0495643_0009097 3300046522 Bacteria 6222
1227 Ga0495644_0096332 3300046523 Unclassified 1118
1228 Ga0495663_0017329 3300046525 Bacteria 2043
1229 Ga0495652_0245893 3300046529 Unclassified 1328
1230 Ga0495652_0635473 3300046529 Unclassified 724
1231 Ga0495654_0322069 3300046530 Unclassified 627
1232 Ga0495665_0483848 3300046531 Bacteria 624
1233 Ga0495640_0047607 3300046533 Bacteria 2967
1234 Ga0495640_0078023 3300046533 Unclassified 2207
1235 Ga0495640_0416169 3300046533 Bacteria 824
1236 Ga0495587_0051732 3300046536 Bacteria 2427
1237 Ga0495587_0176508 3300046536 Bacteria 1212
1238 Ga0495598_0012654 3300046537 Unclassified 2076
1239 Ga0495598_0117596 3300046537 Bacteria 898
1240 Ga0495598_0146081 3300046537 Unclassified 822
1241 Ga0495609_0019629 3300046538 Bacteria 3125
1242 Ga0495621_0003364 3300046539 Bacteria 4412
1243 Ga0495621_0037939 3300046539 Bacteria 1678
1244 Ga0495621_0109503 3300046539 Unclassified 1058
1245 Ga0495621_0116445 3300046539 Unclassified 1029
1246 Ga0495645_0000450 3300046543 Bacteria 28247
1247 Ga0495633_0093088 3300046558 Unclassified 1401
1248 Ga0495667_0040064 3300046559 Bacteria 3112
1249 Ga0495634_0081249 3300046642 Bacteria 2120
1250 Ga0495634_0326616 3300046642 Bacteria 923
1251 Ga0495634_0422055 3300046642 Bacteria 790
1252 Ga0495611_0197354 3300046648 Bacteria 939
1253 Ga0495635_0053736 3300046663 Bacteria 2775
1254 Ga0495635_0088667 3300046663 Bacteria 2117
1255 Ga0495659_0015579 3300046664 Bacteria 2501
1256 Ga0495659_0191227 3300046664 Unclassified 836
1257 Ga0495588_0057859 3300046674 Bacteria 2003
1258 Ga0495657_0311723 3300046675 Bacteria 937
1259 Ga0495623_0047499 3300046679 Unclassified 2725
1260 Ga0495647_0214209 3300046681 Bacteria 848
1261 Ga0495658_0025322 3300046683 Bacteria 3170
1262 Ga0495658_0090500 3300046683 Bacteria 1811
1263 Ga0495658_0168637 3300046683 Unclassified 1354
1264 Ga0495658_0580717 3300046683 Bacteria 718
1265 Ga0495669_0004081 3300046684 Bacteria 6006
1266 Ga0495669_0007347 3300046684 Bacteria 4616
1267 Ga0495669_0103649 3300046684 Unclassified 1323
1268 Ga0495669_0333198 3300046684 Unclassified 733
1269 Ga0495613_0001676 3300046689 Bacteria 16870
1270 Ga0495670_0077989 3300046691 Bacteria 1685
1271 Ga0495600_0092987 3300046809 Unclassified 1967
1272 Ga0495600_0332280 3300046809 Bacteria 954
1273 Ga0495636_0043766 3300047318 Bacteria 1863
1274 Ga0495674_0082858 3300047319 Unclassified 2750
1275 Ga0495674_0091091 3300047319 Bacteria 2605
1276 Ga0495674_0233224 3300047319 Unclassified 1518
1277 Ga0495676_0071461 3300047321 Unclassified 2668
1278 Ga0495675_0452837 3300047444 Unclassified 742
1279 Ga0495675_0476815 3300047444 Bacteria 719
1280 Ga0495677_0021678 3300047445 Bacteria 2329
1281 Ga0495685_063483 3300047447 Unclassified 1243
1282 Ga0495684_0002679 3300047471 Bacteria 14108
1283 Ga0495684_0025447 3300047471 Unclassified 4548
1284 Ga0495593_0174023 3300047673 Bacteria 1085
1285 Ga0495602_0401247 3300048088 Unclassified 978
1286 Ga0496100_0005315 3300048903 Bacteria 6921
1287 Ga0496100_1547020 3300048903 Unclassified 524
1288 Ga0496101_0000338 3300048904 Bacteria 31903
1289 Ga0496101_0163598 3300048904 Bacteria 1708
1290 Ga0496101_0504818 3300048904 Bacteria 955
1291 Ga0496102_0120104 3300048905 Unclassified 2454
1292 Ga0496102_0365200 3300048905 Bacteria 1359
1293 Ga0496104_0011885 3300048907 Bacteria 7814
1294 Ga0496104_0063755 3300048907 Bacteria 3496
1295 Ga0496104_0116270 3300048907 Bacteria 2567
1296 Ga0496104_0641105 3300048907 Bacteria 971
1297 Ga0496104_0791916 3300048907 Unclassified 854
1298 Ga0496105_0027444 3300048908 Bacteria 4652
1299 Ga0496105_0263662 3300048908 Bacteria 1393
1300 Ga0496105_0522093 3300048908 Bacteria 930
1301 Ga0496105_0534097 3300048908 Unclassified 917
1302 Ga0496106_0080483 3300048909 Unclassified 2502
1303 Ga0496107_0007329 3300048910 Bacteria 7605
1304 Ga0496108_0228402 3300048911 Bacteria 1618
1305 Ga0496108_0685751 3300048911 Bacteria 889
1306 Ga0496108_0934304 3300048911 Bacteria 743
1307 Ga0496109_0079029 3300048912 Bacteria 3030
1308 Ga0496109_0165002 3300048912 Bacteria 2076
1309 Ga0496109_0585075 3300048912 Bacteria 1052
1310 Ga0496109_0689410 3300048912 Bacteria 959
1311 Ga0496110_0659312 3300048913 Unclassified 947
1312 Ga0496111_0221188 3300048914 Bacteria 1407
1313 Ga0496111_1030007 3300048914 Bacteria 589
1314 Ga0496112_0002810 3300048915 Bacteria 14131
1315 Ga0496112_0086620 3300048915 Bacteria 3099
1316 Ga0496112_0167090 3300048915 Bacteria 2166
1317 Ga0496112_0216587 3300048915 Bacteria 1871
1318 Ga0496112_0242980 3300048915 Bacteria 1753
1319 Ga0496112_0422774 3300048915 Bacteria 1271
1320 Ga0496112_0456036 3300048915 Unclassified 1216
1321 Ga0496112_0741276 3300048915 Bacteria 909
1322 Ga0496113_0379672 3300048916 Bacteria 1134
1323 Ga0496114_0001212 3300048917 Bacteria 19503
1324 Ga0496114_0050503 3300048917 Bacteria 3462
1325 Ga0496114_0084214 3300048917 Bacteria 2692
1326 Ga0496114_0124083 3300048917 Bacteria 2224
1327 Ga0496114_0198014 3300048917 Bacteria 1759
1328 Ga0496114_0222524 3300048917 Unclassified 1657
1329 Ga0496114_0357960 3300048917 Bacteria 1291
1330 Ga0496114_0508159 3300048917 Unclassified 1066
1331 Ga0496115_0125497 3300048918 Bacteria 2114
1332 Ga0501299_060055 3300049522 Unclassified 804
1333 Ga0501031_0169692 3300049568 Bacteria 1426
1334 Ga0501031_0245236 3300049568 Bacteria 1164
1335 Ga0501031_0281248 3300049568 Bacteria 1079
1336 Ga0501034_0158536 3300049571 Bacteria 2236
1337 Ga0501036_0258953 3300049572 Bacteria 1457
1338 Ga0501036_0316407 3300049572 Bacteria 1304
1339 Ga0501036_0355452 3300049572 Bacteria 1223
1340 Ga0501036_0632035 3300049572 Unclassified 887
1341 Ga0501037_0177620 3300049573 Bacteria 1512
1342 Ga0501037_0531813 3300049573 Bacteria 795
1343 Ga0501038_0043210 3300049574 Bacteria 3920
1344 Ga0501038_0134017 3300049574 Bacteria 2031
1345 Ga0501039_0005083 3300049575 Bacteria 9967
1346 Ga0501040_0009144 3300049576 Bacteria 6452
1347 Ga0501040_0021727 3300049576 Bacteria 4290
1348 Ga0501040_0049618 3300049576 Bacteria 2870
1349 Ga0501040_0422137 3300049576 Bacteria 959
1350 Ga0501040_0617110 3300049576 Bacteria 784
1351 Ga0501041_0080818 3300049577 Bacteria 2001
1352 Ga0501041_0944903 3300049577 Unclassified 554
1353 Ga0501042_0003809 3300049578 Bacteria 9538
1354 Ga0501042_0085038 3300049578 Bacteria 2268
1355 Ga0501043_0038916 3300049579 Bacteria 3739
1356 Ga0501046_0047476 3300049580 Bacteria 3404
1357 Ga0501046_0054245 3300049580 Bacteria 3154
1358 Ga0501047_0453613 3300049581 Bacteria 1111
1359 Ga0501048_0049799 3300049582 Bacteria 2985
1360 Ga0501048_0279882 3300049582 Unclassified 1186
1361 Ga0501048_1149577 3300049582 Bacteria 558
1362 Ga0501068_0082561 3300049584 Bacteria 1974
1363 Ga0501068_0511945 3300049584 Bacteria 779
1364 Ga0501071_0015832 3300049587 Bacteria 5179
1365 Ga0501071_0192495 3300049587 Bacteria 1530
1366 Ga0501071_0934381 3300049587 Bacteria 669
1367 Ga0501072_0006572 3300049588 Bacteria 8854
1368 Ga0501072_0026593 3300049588 Bacteria 4511
1369 Ga0501073_0326630 3300049589 Bacteria 1059
1370 Ga0501075_0023042 3300049591 Bacteria 4555
1371 Ga0501075_0110545 3300049591 Bacteria 2089
1372 Ga0501075_0468852 3300049591 Unclassified 960
1373 Ga0501076_0040773 3300049592 Bacteria 3650
1374 Ga0501076_0136177 3300049592 Bacteria 1994
1375 Ga0501076_0423239 3300049592 Bacteria 1096
1376 Ga0501076_0656617 3300049592 Bacteria 865
1377 Ga0501077_0047177 3300049593 Bacteria 2737
1378 Ga0501077_0072533 3300049593 Bacteria 2182
1379 Ga0501216_072708 3300049660 Unclassified 714
1380 Ga0501221_035984 3300049704 Unclassified 1059
1381 Ga0501079_0005197 3300049741 Bacteria 9676
1382 Ga0501079_0087472 3300049741 Bacteria 2412
1383 Ga0501079_0669540 3300049741 Bacteria 817
1384 Ga0501080_0425907 3300049742 Bacteria 1192
1385 Ga0501081_0008696 3300049743 Bacteria 6598
1386 Ga0501081_0041776 3300049743 Bacteria 3141
1387 Ga0501081_0588644 3300049743 Unclassified 832
1388 Ga0501083_0073605 3300049744 Bacteria 2271
1389 Ga0501035_0192170 3300049822 Bacteria 1755
1390 Ga0501035_0933073 3300049822 Unclassified 686
1391 Ga0501035_0961356 3300049822 Bacteria 673
1392 Ga0501044_0092948 3300049823 Bacteria 3042
1393 Ga0501044_1290198 3300049823 Unclassified 597
1394 Ga0501045_0004657 3300049824 Bacteria 9472
1395 Ga0501045_0241444 3300049824 Unclassified 1345
1396 Ga0501045_0264909 3300049824 Bacteria 1279
1397 nmdc:mga03683_1149_c1 3300050489 Bacteria 7787
1398 nmdc:mga00v17_7255_c1 3300050491 Bacteria 5906
1399 nmdc:mga0yw44_555493_c1 3300050492 Unclassified 780
1400 nmdc:mga05p37_11071_c1 3300050507 Bacteria 10716
1401 nmdc:mga05p37_138803_c1 3300050507 Bacteria 2979
1402 nmdc:mga05p37_139331_c1 3300050507 Unclassified 2973
1403 nmdc:mga05p37_158861_c1 3300050507 Bacteria 2761
1404 nmdc:mga05p37_1965492_c1 3300050507 Unclassified 555
1405 nmdc:mga05p37_1997_c1 3300050507 Bacteria 23815
1406 nmdc:mga05p37_20363_c1 3300050507 Bacteria 8026
1407 nmdc:mga05p37_23209_c1 3300050507 Bacteria 7526
1408 nmdc:mga05p37_24698_c1 3300050507 Bacteria 7305
1409 nmdc:mga05p37_25595_c1 3300050507 Bacteria 7178
1410 nmdc:mga05p37_26118_c2 3300050507 Bacteria 5344
1411 nmdc:mga05p37_34921_c1 3300050507 Bacteria 6162
1412 nmdc:mga05p37_37736_c1 3300050507 Bacteria 5926
1413 nmdc:mga05p37_43651_c1 3300050507 Bacteria 5516
1414 nmdc:mga05p37_44023_c1 3300050507 Bacteria 5492
1415 nmdc:mga05p37_48901_c1 3300050507 Bacteria 5200
1416 nmdc:mga05p37_5217_c1 3300050507 Bacteria 15249
1417 nmdc:mga05p37_73083_c1 3300050507 Bacteria 4220
1418 nmdc:mga05p37_91576_c1 3300050507 Bacteria 3747
1419 nmdc:mga05p37_967626_c1 3300050507 Bacteria 909
1420 nmdc:mga09592_1189676_c1 3300050508 Bacteria 630
1421 nmdc:mga09592_13559_c1 3300050508 Bacteria 6657
1422 nmdc:mga09592_139923_c1 3300050508 Unclassified 2086
1423 nmdc:mga09592_149535_c1 3300050508 Unclassified 2014
1424 nmdc:mga09592_19921_c1 3300050508 Bacteria 5511
1425 nmdc:mga09592_201873_c1 3300050508 Bacteria 1722
1426 nmdc:mga09592_23513_c1 3300050508 Bacteria 5090
1427 nmdc:mga09592_26276_c1 3300050508 Bacteria 4822
1428 nmdc:mga09592_38159_c1 3300050508 Bacteria 4031
1429 nmdc:mga09592_456600_c1 3300050508 Bacteria 1102
1430 nmdc:mga09592_68792_c1 3300050508 Bacteria 3003
1431 nmdc:mga0qj67_194295_c1 3300050509 Bacteria 1649
1432 nmdc:mga0qj67_245188_c1 3300050509 Bacteria 1454
1433 nmdc:mga0qj67_255819_c1 3300050509 Bacteria 1421
1434 nmdc:mga0qj67_27328_c1 3300050509 Bacteria 4422
1435 nmdc:mga0qj67_7153_c1 3300050509 Bacteria 8234
1436 nmdc:mga0qj67_7629_c1 3300050509 Bacteria 7992
1437 nmdc:mga06r32_1076344_c1 3300050510 Bacteria 754
1438 nmdc:mga06r32_132439_c1 3300050510 Bacteria 2466
1439 nmdc:mga06r32_14936_c1 3300050510 Bacteria 7048
1440 nmdc:mga06r32_270474_c1 3300050510 Unclassified 1687
1441 nmdc:mga06r32_29574_c1 3300050510 Bacteria 5137
1442 nmdc:mga06r32_616343_c1 3300050510 Unclassified 1055
1443 nmdc:mga06r32_655429_c1 3300050510 Unclassified 1018
1444 nmdc:mga06r32_86132_c1 3300050510 Bacteria 3064
1445 nmdc:mga06r32_9476_c1 3300050510 Bacteria 8790
1446 nmdc:mga08y16_108808_c1 3300050511 Bacteria 2886
1447 nmdc:mga08y16_116259_c1 3300050511 Unclassified 2784
1448 nmdc:mga08y16_1178584_c1 3300050511 Bacteria 738
1449 nmdc:mga08y16_1367_c1 3300050511 Bacteria 24369
1450 nmdc:mga08y16_1568_c1 3300050511 Bacteria 23067
1451 nmdc:mga08y16_227293_c1 3300050511 Unclassified 1931
1452 nmdc:mga08y16_2507_c1 3300050511 Bacteria 18886
1453 nmdc:mga08y16_2643_c1 3300050511 Bacteria 18424
1454 nmdc:mga08y16_266469_c1 3300050511 Bacteria 1769
1455 nmdc:mga08y16_273804_c1 3300050511 Unclassified 1742
1456 nmdc:mga08y16_2862_c1 3300050511 Bacteria 17748
1457 nmdc:mga08y16_352547_c1 3300050511 Bacteria 1511
1458 nmdc:mga08y16_390387_c1 3300050511 Bacteria 1426
1459 nmdc:mga08y16_449722_c1 3300050511 Bacteria 1314
1460 nmdc:mga08y16_4998_c1 3300050511 Bacteria 13866
1461 nmdc:mga08y16_658_c1 3300050511 Bacteria 32511
1462 nmdc:mga08y16_67477_c1 3300050511 Unclassified 3731
1463 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
1464 nmdc:mga0n895_1037810_c1 3300050512 Unclassified 799
1465 nmdc:mga0n895_13596_c1 3300050512 Bacteria 7353
1466 nmdc:mga0n895_141_c1 3300050512 Bacteria 43611
1467 nmdc:mga0n895_166078_c1 3300050512 Bacteria 2239
1468 nmdc:mga0n895_19824_c1 3300050512 Bacteria 6259
1469 nmdc:mga0n895_267490_c1 3300050512 Bacteria 1734
1470 nmdc:mga0n895_304759_c1 3300050512 Bacteria 1615
1471 nmdc:mga0n895_343217_c1 3300050512 Unclassified 1512
1472 nmdc:mga0n895_35782_c1 3300050512 Bacteria 4790
1473 nmdc:mga0n895_472679_c1 3300050512 Bacteria 1265
1474 nmdc:mga0n895_476418_c1 3300050512 Bacteria 1259
1475 nmdc:mga0n895_546195_c1 3300050512 Unclassified 1165
1476 nmdc:mga0n895_58404_c1 3300050512 Bacteria 3804
1477 nmdc:mga0n895_602783_c1 3300050512 Bacteria 1100
1478 nmdc:mga0n895_72372_c1 3300050512 Bacteria 3420
1479 nmdc:mga0n895_737660_c1 3300050512 Bacteria 979
1480 nmdc:mga0n895_81880_c1 3300050512 Unclassified 3217
1481 nmdc:mga0rr50_1006114_c1 3300050513 Bacteria 710
1482 nmdc:mga0rr50_12990_c1 3300050513 Bacteria 5404
1483 nmdc:mga0rr50_14183_c1 3300050513 Bacteria 5218
1484 nmdc:mga0rr50_176227_c1 3300050513 Bacteria 1745
1485 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1486 nmdc:mga0rr50_316066_c1 3300050513 Bacteria 1309
1487 nmdc:mga0rr50_398071_c1 3300050513 Bacteria 1163
1488 nmdc:mga0rr50_539301_c1 3300050513 Unclassified 993
1489 nmdc:mga0rr50_560727_c1 3300050513 Unclassified 973
1490 nmdc:mga0rr50_682119_c1 3300050513 Bacteria 877
1491 nmdc:mga0rr50_761091_c1 3300050513 Bacteria 827
1492 nmdc:mga0rr50_8550_c1 3300050513 Bacteria 6378
1493 nmdc:mga0rr50_8679_c1 3300050513 Bacteria 6338
1494 nmdc:mga08x19_148053_c1 3300050514 Unclassified 1589
1495 nmdc:mga08x19_153311_c1 3300050514 Bacteria 1562
1496 nmdc:mga08x19_191333_c1 3300050514 Bacteria 1400
1497 nmdc:mga08x19_3155_c1 3300050514 Bacteria 9893
1498 nmdc:mga08x19_34798_c1 3300050514 Unclassified 3185
1499 nmdc:mga08x19_416343_c1 3300050514 Unclassified 944
1500 nmdc:mga08x19_92_c1 3300050514 Bacteria 80986
1501 nmdc:mga0a205_112707_c2 3300050515 Bacteria 2158
1502 nmdc:mga0a205_120196_c1 3300050515 Unclassified 2526
1503 nmdc:mga0a205_12067_c2 3300050515 Bacteria 5976
1504 nmdc:mga0a205_1225776_c1 3300050515 Bacteria 598
1505 nmdc:mga0a205_131663_c1 3300050515 Bacteria 2401
1506 nmdc:mga0a205_132875_c1 3300050515 Unclassified 2389
1507 nmdc:mga0a205_151535_c1 3300050515 Unclassified 2218
1508 nmdc:mga0a205_167404_c1 3300050515 Unclassified 2094
1509 nmdc:mga0a205_219892_c1 3300050515 Bacteria 1785
1510 nmdc:mga0a205_2573_c1 3300050515 Bacteria 15998
1511 nmdc:mga0a205_281542_c1 3300050515 Unclassified 1538
1512 nmdc:mga0a205_370522_c1 3300050515 Bacteria 1298
1513 nmdc:mga0a205_394862_c1 3300050515 Bacteria 1247
1514 nmdc:mga0a205_532506_c1 3300050515 Bacteria 1031
1515 nmdc:mga0a205_649189_c1 3300050515 Bacteria 907
1516 nmdc:mga0a205_676287_c1 3300050515 Bacteria 883
1517 nmdc:mga0sz30_222545_c1 3300050516 Bacteria 839
1518 Ga0495601_0003730 3300053077 Bacteria 8770
1519 Ga0495601_0068407 3300053077 Bacteria 2264
1520 Ga0495601_0135362 3300053077 Bacteria 1606
1521 Ga0495595_0012548 3300053084 Bacteria 3564
1522 Ga0495595_0405849 3300053084 Bacteria 691
1523 Ga0495619_0006567 3300053085 Bacteria 7357
1524 Ga0495619_0280366 3300053085 Bacteria 1155
1525 Ga0495619_0433888 3300053085 Bacteria 906
1526 Ga0495619_0769263 3300053085 Unclassified 652
1527 Ga0500628_043052 3300053129 Bacteria 1040
1528 Ga0501084_0009574 3300054114 Bacteria 8018
1529 Ga0501084_0043281 3300054114 Bacteria 3767
1530 Ga0501084_0359012 3300054114 Unclassified 1231
1531 Ga0501084_1006567 3300054114 Unclassified 700
1532 Ga0590071_000739 3300059421 Bacteria 9160
1533 Ga0590071_005043 3300059421 Bacteria 3187
1534 Ga0590074_003587 3300059423 Bacteria 2570
1535 Ga0590074_042319 3300059423 Unclassified 821
1536 Ga0590075_001312 3300059424 Bacteria 6243
1537 Ga0590075_002211 3300059424 Bacteria 4679
1538 Ga0590075_057765 3300059424 Unclassified 999
1539 Ga0590075_113661 3300059424 Bacteria 707
1540 Ga0590077_000747 3300059426 Bacteria 8520
1541 Ga0587091_100514 3300059511 Bacteria 678
1542 Ga0587114_031768 3300059655 Unclassified 811
1543 Ga0501082_0163480 3300060353 Bacteria 1934
1544 Ga0501082_0444785 3300060353 Unclassified 1132
1545 Ga0501082_0818939 3300060353 Bacteria 814
1546 Ga0530510_0009184 3300061734 Bacteria 6928
1547 Ga0530510_0062078 3300061734 Bacteria 2705
1548 Ga0530510_0289552 3300061734 Unclassified 1224
1549 Ga0163162_10947929
1550 JGI24033J26618_1016701
1551 JGI24751J29686_10013893
1552 JGI25406J46586_10097873
1553 Ga0065714_10083408
1554 Ga0065704_10148721
1555 Ga0065704_10537012
1556 Ga0065712_10002622
1557 Ga0065712_10067818
1558 Ga0065712_10099576
1559 Ga0065712_10149758
1560 Ga0065712_10162315
1561 Ga0065712_10319358
1562 Ga0065715_10103959
1563 Ga0065715_10146880
1564 Ga0065715_10147926
1565 Ga0065715_10158966
1566 Ga0065715_10168749
1567 Ga0065715_10236028
1568 Ga0065715_10279735
1569 Ga0065715_10408396
1570 Ga0065707_10247239
1571 Ga0065707_10289450
1572 Ga0065707_10302678
1573 Ga0065707_10412332
1574 Ga0065707_10484671
1575 Ga0070676_10026241
1576 Ga0070676_10199862
1577 Ga0070676_10297952
1578 Ga0070676_10331366
1579 Ga0070676_10357983
1580 Ga0070676_10438005
1581 Ga0070676_10832927
1582 Ga0070683_100024470
1583 Ga0070683_100338820
1584 Ga0070690_100000920
1585 Ga0070690_100166363
1586 Ga0070690_100197332
1587 Ga0070690_100922612
1588 Ga0070690_100946779
1589 Ga0070690_101430069
1590 Ga0070670_100015640
1591 Ga0070670_100026375
1592 Ga0070670_100052956
1593 Ga0070670_100161978
1594 Ga0070670_100300500
1595 Ga0070670_100901418
1596 Ga0070677_10013312
1597 Ga0070677_10044554
1598 Ga0070677_10049012
1599 Ga0070677_10279774
1600 Ga0070677_10284896
1601 Ga0070677_10422995
1602 Ga0068869_100002153
1603 Ga0068869_100048862
1604 Ga0068869_100092460
1605 Ga0068869_100103497
1606 Ga0068869_100174532
1607 Ga0068869_100280507
1608 Ga0068869_100536026
1609 Ga0068869_101215174
1610 Ga0070666_10196882
1611 Ga0070666_10198726
1612 Ga0070666_10729581
1613 Ga0070680_100025422
1614 Ga0070680_100153630
1615 Ga0070680_100630050
1616 Ga0070680_100866206
1617 Ga0070682_100900612
1618 Ga0070682_101072323
1619 Ga0070682_101249949
1620 Ga0068868_100034955
1621 Ga0068868_100064048
1622 Ga0068868_100291802
1623 Ga0068868_100330401
1624 Ga0068868_100352495
1625 Ga0068868_100639711
1626 Ga0068868_100741312
1627 Ga0068868_101181271
1628 Ga0070660_100001092
1629 Ga0070660_100441529
1630 Ga0070689_100043202
1631 Ga0070689_100065174
1632 Ga0070689_100199760
1633 Ga0070689_100215050
1634 Ga0070689_100327105
1635 Ga0070689_100340128
1636 Ga0070689_100586620
1637 Ga0070689_100740161
1638 Ga0070691_10000892
1639 Ga0070691_10043112
1640 Ga0070691_10149628
1641 Ga0070687_100038743
1642 Ga0070687_100095286
1643 Ga0070661_100265127
1644 Ga0070661_100414251
1645 Ga0070661_100608875
1646 Ga0070661_101372584
1647 Ga0070692_10035812
1648 Ga0070692_10458705
1649 Ga0070668_100105729
1650 Ga0070668_100454436
1651 Ga0070668_100735908
1652 Ga0070669_100003474
1653 Ga0070669_100031310
1654 Ga0070669_100038193
1655 Ga0070669_100092083
1656 Ga0070669_100162925
1657 Ga0070669_100313428
1658 Ga0070669_100339396
1659 Ga0070669_100423022
1660 Ga0070669_100548837
1661 Ga0070669_100615765
1662 Ga0070669_100669953
1663 Ga0070669_100678850
1664 Ga0070675_100000433
1665 Ga0070675_100001643
1666 Ga0070675_100003018
1667 Ga0070675_100007486
1668 Ga0070675_100007803
1669 Ga0070675_100022727
1670 Ga0070675_100036669
1671 Ga0070675_100205743
1672 Ga0070675_100217685
1673 Ga0070675_100313845
1674 Ga0070675_100344667
1675 Ga0070675_100439608
1676 Ga0070675_100539788
1677 Ga0070671_100034834
1678 Ga0070671_100048508
1679 Ga0070671_100320519
1680 Ga0070671_100354947
1681 Ga0070671_100782269
1682 Ga0070674_100021951
1683 Ga0070674_100044223
1684 Ga0070674_100140019
1685 Ga0070674_100241008
1686 Ga0070674_100519194
1687 Ga0070674_100674351
1688 Ga0070674_100779800
1689 Ga0070674_101006082
1690 Ga0070674_101255596
1691 Ga0070674_101265879
1692 Ga0070674_101447295
1693 Ga0070673_100003132
1694 Ga0070673_100043274
1695 Ga0070673_100050178
1696 Ga0070673_100058513
1697 Ga0070673_100137316
1698 Ga0070673_100171940
1699 Ga0070673_100183156
1700 Ga0070673_100196196
1701 Ga0070673_100208212
1702 Ga0070673_100549318
1703 Ga0070673_100635366
1704 Ga0070688_100060927
1705 Ga0070688_100098261
1706 Ga0070688_100216235
1707 Ga0070688_100476940
1708 Ga0070688_101083333
1709 Ga0070659_100197547
1710 Ga0070667_100179209
1711 Ga0070667_100414741
1712 Ga0070667_100587289
1713 Ga0070709_10007316
1714 Ga0070709_10759539
1715 Ga0070714_100003070
1716 Ga0070713_100004893
1717 Ga0070713_100193518
1718 Ga0070713_100900072
1719 Ga0070713_101253314
1720 Ga0070713_101716902
1721 Ga0070701_10080120
1722 Ga0070701_10102714
1723 Ga0070705_100001404
1724 Ga0070705_100014875
1725 Ga0070705_100053659
1726 Ga0070705_100135726
1727 Ga0070700_100000788
1728 Ga0070700_100006082
1729 Ga0070700_100059550
1730 Ga0070700_100068953
1731 Ga0070700_100274394
1732 Ga0070700_100906779
1733 Ga0070694_100002894
1734 Ga0070694_100005858
1735 Ga0070694_100007026
1736 Ga0070694_100172110
1737 Ga0070694_100379711
1738 Ga0070694_100502706
1739 Ga0070694_100802159
1740 Ga0070708_100032111
1741 Ga0070708_100519664
1742 Ga0070708_100607625
1743 Ga0070708_100868844
1744 Ga0070663_100037019
1745 Ga0070663_100878596
1746 Ga0070678_100109353
1747 Ga0070678_100116947
1748 Ga0070678_100130775
1749 Ga0070678_100140021
1750 Ga0070678_100494754
1751 Ga0070678_100653885
1752 Ga0070678_100709470
1753 Ga0070662_100073576
1754 Ga0070662_100203340
1755 Ga0070662_100380504
1756 Ga0070662_100593270
1757 Ga0070662_100874882
1758 Ga0070662_101063022
1759 Ga0070681_10386081
1760 Ga0070681_11157304
1761 Ga0068867_100000380
1762 Ga0068867_100115369
1763 Ga0068867_100138704
1764 Ga0068867_100139519
1765 Ga0068867_100686917
1766 Ga0068867_100709371
1767 Ga0068867_100713581
1768 Ga0068867_100944408
1769 Ga0068867_101063118
1770 Ga0068867_101672557
1771 Ga0068867_101710127
1772 Ga0070685_10047159
1773 Ga0070685_10050222
1774 Ga0070685_10106243
1775 Ga0070685_10197670
1776 Ga0070685_10545954
1777 Ga0070706_100186401
1778 Ga0070706_100236430
1779 Ga0070706_100286210
1780 Ga0070706_100774035
1781 Ga0070706_101121435
1782 Ga0070706_101226546
1783 Ga0070707_100442076
1784 Ga0070707_100657285
1785 Ga0070707_101094705
1786 Ga0070707_101286300
1787 Ga0070698_100003115
1788 Ga0070698_100006640
1789 Ga0070698_100011223
1790 Ga0070698_100072413
1791 Ga0070698_100138182
1792 Ga0070698_100394572
1793 Ga0070699_100003719
1794 Ga0070699_100006814
1795 Ga0070699_100100290
1796 Ga0070699_100123199
1797 Ga0070679_100010050
1798 Ga0070679_100127817
1799 Ga0070679_100548131
1800 Ga0070679_100776591
1801 Ga0070684_100076110
1802 Ga0070684_100179696
1803 Ga0070684_100519127
1804 Ga0070684_101199138
1805 Ga0068853_100611029
1806 Ga0070672_100004404
1807 Ga0070672_100005217
1808 Ga0070672_100062004
1809 Ga0070672_100157158
1810 Ga0070672_100196808
1811 Ga0070672_100213036
1812 Ga0070672_100617737
1813 Ga0070672_100692814
1814 Ga0070672_100729197
1815 Ga0070672_101137246
1816 Ga0070686_100000153
1817 Ga0070686_100030299
1818 Ga0070686_100084274
1819 Ga0070686_100188159
1820 Ga0070686_100218647
1821 Ga0070686_100313655
1822 Ga0070686_100375621
1823 Ga0070686_100537386
1824 Ga0070695_100016291
1825 Ga0070695_100027664
1826 Ga0070695_100170257
1827 Ga0070695_100502552
1828 Ga0070695_100826694
1829 Ga0070695_100954808
1830 Ga0070696_100018169
1831 Ga0070696_100039612
1832 Ga0070696_100112265
1833 Ga0070696_100552454
1834 Ga0070696_100587157
1835 Ga0070693_100169522
1836 Ga0070693_100720868
1837 Ga0070693_100759909
1838 Ga0070693_100836877
1839 Ga0070665_100002502
1840 Ga0070665_100010631
1841 Ga0070665_100020086
1842 Ga0070665_100078682
1843 Ga0070665_100195381
1844 Ga0070665_100950167
1845 Ga0070704_100000089
1846 Ga0070704_100026609
1847 Ga0070704_100032604
1848 Ga0070704_100074989
1849 Ga0070704_100134456
1850 Ga0070704_100631855
1851 Ga0070704_100700314
1852 Ga0070704_101267826
1853 Ga0070704_101301510
1854 Ga0068855_100020680
1855 Ga0068855_100238478
1856 Ga0068855_100450881
1857 Ga0068855_100492643
1858 Ga0068855_100652639
1859 Ga0068855_100798835
1860 Ga0070664_100009603
1861 Ga0070664_100097790
1862 Ga0070664_100236671
1863 Ga0070664_100346288
1864 Ga0068857_100136211
1865 Ga0068857_100358762
1866 Ga0068857_100522165
1867 Ga0068857_100639122
1868 Ga0068854_100163499
1869 Ga0068854_101120050
1870 Ga0068856_101833176
1871 Ga0068856_101950599
1872 Ga0070702_100003228
1873 Ga0070702_100053993
1874 Ga0070702_100357397
1875 Ga0070702_100962764
1876 Ga0068852_100377942
1877 Ga0068852_100746608
1878 Ga0068852_101897063
1879 Ga0068859_100025246
1880 Ga0068859_100137975
1881 Ga0068859_100191448
1882 Ga0068859_100208366
1883 Ga0068859_100504379
1884 Ga0068859_100506815
1885 Ga0068859_100714266
1886 Ga0068859_100759169
1887 Ga0068859_101723599
1888 Ga0068864_100002939
1889 Ga0068864_100099244
1890 Ga0068864_100201604
1891 Ga0068864_100207644
1892 Ga0068864_100234303
1893 Ga0068864_100234644
1894 Ga0068864_100313810
1895 Ga0068864_100391631
1896 Ga0068864_100975212
1897 Ga0068866_10009441
1898 Ga0068866_10024941
1899 Ga0068866_10084161
1900 Ga0068866_10085221
1901 Ga0068861_100010565
1902 Ga0068861_100079028
1903 Ga0068861_100091306
1904 Ga0068861_100093769
1905 Ga0068861_100129925
1906 Ga0068861_100164360
1907 Ga0068861_100253110
1908 Ga0068861_100488257
1909 Ga0068861_100823788
1910 Ga0068861_101454819
1911 Ga0068851_10033637
1912 Ga0068851_10150437
1913 Ga0068870_10002891
1914 Ga0068870_10032435
1915 Ga0068870_10034344
1916 Ga0068870_10234070
1917 Ga0068870_10616965
1918 Ga0068863_100062464
1919 Ga0068863_100143458
1920 Ga0068863_100184236
1921 Ga0068863_100199173
1922 Ga0068863_100300972
1923 Ga0068863_100313525
1924 Ga0068863_100650258
1925 Ga0068863_101144537
1926 Ga0068858_100003255
1927 Ga0068858_100017044
1928 Ga0068858_100039216
1929 Ga0068858_100075256
1930 Ga0068858_100130019
1931 Ga0068858_100206865
1932 Ga0068858_100559154
1933 Ga0068858_101037450
1934 Ga0068860_100017193
1935 Ga0068860_100034523
1936 Ga0068860_100219487
1937 Ga0068860_100271636
1938 Ga0068860_100347516
1939 Ga0068860_100354361
1940 Ga0068860_100356221
1941 Ga0068860_100392211
1942 Ga0068862_100021517
1943 Ga0068862_100024869
1944 Ga0068862_100040092
1945 Ga0068862_100053094
1946 Ga0068862_100260760
1947 Ga0068862_100384271
1948 Ga0068862_100429973
1949 Ga0068862_100594903
1950 Ga0068862_100636813
1951 Ga0068862_100657343
1952 Ga0068862_100746979
1953 Ga0081455_10008971
1954 Ga0081455_10047875
1955 Ga0081539_10002012
1956 Ga0070717_11361300
1957 Ga0075365_10059942
1958 Ga0070715_10045399
1959 Ga0070715_10059729
1960 Ga0070715_10370458
1961 Ga0070716_100007561
1962 Ga0070716_100112531
1963 Ga0070716_100520649
1964 Ga0070716_100865244
1965 Ga0070712_100031176
1966 Ga0070712_100416201
1967 Ga0097621_100000125
1968 Ga0097621_100014893
1969 Ga0097621_100017310
1970 Ga0097621_100039658
1971 Ga0097621_100069253
1972 Ga0097621_100113414
1973 Ga0097621_100126207
1974 Ga0097621_100378715
1975 Ga0097621_100616551
1976 Ga0097621_100643048
1977 Ga0097621_100724582
1978 Ga0097621_101182064
1979 Ga0068871_100000134
1980 Ga0068871_100005587
1981 Ga0068871_100039886
1982 Ga0068871_100063808
1983 Ga0068871_100069169
1984 Ga0068871_100077391
1985 Ga0068871_100146031
1986 Ga0068871_100149927
1987 Ga0068871_100193434
1988 Ga0068871_100291605
1989 Ga0068871_100497971
1990 Ga0068871_100649783
1991 Ga0068871_100695008
1992 Ga0075428_100000497
1993 Ga0075428_100006846
1994 Ga0075428_100009506
1995 Ga0075428_100026808
1996 Ga0075428_100031650
1997 Ga0075428_100057506
1998 Ga0075428_100089732
1999 Ga0075428_100121569
2000 Ga0075428_100245232
2001 Ga0075428_100310045
2002 Ga0075428_100429732
2003 Ga0075428_100602931
2004 Ga0075428_101084827
2005 Ga0075428_101635840
2006 Ga0075430_100001681
2007 Ga0075430_100002096
2008 Ga0075430_100013822
2009 Ga0075430_100019140
2010 Ga0075430_100025839
2011 Ga0075430_100028057
2012 Ga0075430_100054894
2013 Ga0075431_100001219
2014 Ga0075431_100003323
2015 Ga0075431_100023672
2016 Ga0075431_100069493
2017 Ga0075431_100079466
2018 Ga0075431_100199916
2019 Ga0075431_100215703
2020 Ga0075431_100241070
2021 Ga0075431_100486414
2022 Ga0075431_100830336
2023 Ga0075433_10000157
2024 Ga0075433_10116506
2025 Ga0075433_10146790
2026 Ga0075433_10177266
2027 Ga0075433_10323195
2028 Ga0075433_10336636
2029 Ga0075433_10467641
2030 Ga0075433_10615587
2031 Ga0075433_10789605
2032 Ga0075433_10835721
2033 Ga0075433_11039815
2034 Ga0075433_11078459
2035 Ga0075434_100002504
2036 Ga0075434_100005743
2037 Ga0075434_100006773
2038 Ga0075434_100011771
2039 Ga0075434_100017244
2040 Ga0075434_100029295
2041 Ga0075434_100065080
2042 Ga0075434_100082673
2043 Ga0075434_100151742
2044 Ga0075434_100192229
2045 Ga0075434_100302147
2046 Ga0075434_100453363
2047 Ga0075434_100476073
2048 Ga0075434_100489240
2049 Ga0075434_100524690
2050 Ga0075429_100004479
2051 Ga0075429_100005139
2052 Ga0075429_100008026
2053 Ga0075429_100019963
2054 Ga0075429_100096081
2055 Ga0075429_100122343
2056 Ga0075429_100126374
2057 Ga0075429_100239199
2058 Ga0075429_100266863
2059 Ga0075429_100314822
2060 Ga0075429_100319622
2061 Ga0068865_100002757
2062 Ga0068865_100030248
2063 Ga0068865_100076131
2064 Ga0068865_100145708
2065 Ga0068865_100189475
2066 Ga0068865_100576003
2067 Ga0068865_100760792
2068 Ga0068865_100834735
2069 Ga0075436_100004813
2070 Ga0075436_100017704
2071 Ga0075436_100017749
2072 Ga0075436_100084710
2073 Ga0075436_100104286
2074 Ga0075436_100132881
2075 Ga0075436_100241247
2076 Ga0097620_100025246
2077 Ga0097620_100137972
2078 Ga0097620_100191442
2079 Ga0097620_100208383
2080 Ga0097620_100504446
2081 Ga0097620_100506803
2082 Ga0097620_100714267
2083 Ga0097620_100759135
2084 Ga0097620_100837173
2085 Ga0097620_101723800
2086 Ga0075435_100000204
2087 Ga0075435_100007928
2088 Ga0075435_100015754
2089 Ga0075435_100027042
2090 Ga0075435_100065934
2091 Ga0075435_100177038
2092 Ga0075435_100212697
2093 Ga0075435_100310333
2094 Ga0075435_100494082
2095 Ga0075435_100509157
2096 Ga0105251_10096311
2097 Ga0105244_10445466
2098 Ga0105240_10037691
2099 Ga0105240_10170233
2100 Ga0105240_10311990
2101 Ga0105240_10450127
2102 Ga0105240_10794797
2103 Ga0105240_11465595
2104 Ga0111539_10000014
2105 Ga0111539_10000134
2106 Ga0111539_10001078
2107 Ga0111539_10002632
2108 Ga0111539_10004027
2109 Ga0111539_10010143
2110 Ga0111539_10015933
2111 Ga0111539_10018505
2112 Ga0111539_10066788
2113 Ga0111539_10097678
2114 Ga0111539_10187478
2115 Ga0111539_10291782
2116 Ga0111539_10321189
2117 Ga0111539_10426199
2118 Ga0111539_10510089
2119 Ga0111539_10661077
2120 Ga0111539_10806024
2121 Ga0111539_11242735
2122 Ga0111539_11566589
2123 Ga0105245_10018654
2124 Ga0105245_10046562
2125 Ga0105245_10266120
2126 Ga0105245_10518549
2127 Ga0105245_10832324
2128 Ga0105245_11922539
2129 Ga0105247_10058133
2130 Ga0105247_10159725
2131 Ga0105247_10271953
2132 Ga0114129_10000426
2133 Ga0114129_10001213
2134 Ga0114129_10004137
2135 Ga0114129_10009181
2136 Ga0114129_10009385
2137 Ga0114129_10011201
2138 Ga0114129_10016744
2139 Ga0114129_10016919
2140 Ga0114129_10029055
2141 Ga0114129_10048963
2142 Ga0114129_10051960
2143 Ga0114129_10057730
2144 Ga0114129_10064329
2145 Ga0114129_10067793
2146 Ga0114129_10072643
2147 Ga0114129_10073868
2148 Ga0114129_10095042
2149 Ga0114129_10109022
2150 Ga0114129_10143188
2151 Ga0114129_10295970
2152 Ga0114129_10566980
2153 Ga0114129_11160523
2154 Ga0114129_11692215
2155 Ga0114129_12487459
2156 Ga0114129_12703291
2157 Ga0105243_10006934
2158 Ga0105243_10010791
2159 Ga0105243_10089689
2160 Ga0105243_10175709
2161 Ga0105243_10506248
2162 Ga0105243_10771100
2163 Ga0105243_10923197
2164 Ga0105243_11471236
2165 Ga0105243_11608999
2166 Ga0105241_10026107
2167 Ga0105241_10568860
2168 Ga0105241_11039566
2169 Ga0105241_11892246
2170 Ga0105242_10022412
2171 Ga0105242_10026817
2172 Ga0105242_10268432
2173 Ga0105242_10328003
2174 Ga0105242_10366387
2175 Ga0105242_10665893
2176 Ga0105242_11024614
2177 Ga0105248_10002172
2178 Ga0105248_10007536
2179 Ga0105248_10043045
2180 Ga0105248_10052710
2181 Ga0105248_10059992
2182 Ga0105248_10068556
2183 Ga0105248_10107031
2184 Ga0105248_10162200
2185 Ga0105248_10200910
2186 Ga0105248_10231761
2187 Ga0105248_10320423
2188 Ga0105248_10411347
2189 Ga0105248_10495834
2190 Ga0105248_11356672
2191 Ga0105248_12175856
2192 Ga0105237_10709398
2193 Ga0105237_11273509
2194 Ga0105238_10036372
2195 Ga0105238_10251909
2196 Ga0105238_11837913
2197 Ga0105249_10025255
2198 Ga0105249_10081617
2199 Ga0105249_10272878
2200 Ga0105249_10293297
2201 Ga0105249_10350611
2202 Ga0105249_10455199
2203 Ga0105249_10867528
2204 Ga0105249_11977180
2205 Ga0105249_12262412
2206 Ga0105239_10699477
2207 Ga0105239_10713110
2208 Ga0105239_10815702
2209 Ga0105246_10105238
2210 Ga0105246_10467635
2211 Ga0105246_10868449
2212 Ga0157373_11108636
2213 Ga0157370_10733794
2214 Ga0157374_10083773
2215 Ga0157374_10104979
2216 Ga0157374_10443606
2217 Ga0157374_11656934
2218 Ga0157378_10009109
2219 Ga0157378_10144928
2220 Ga0157378_10561950
2221 Ga0163162_10186185
2222 Ga0163162_10549926
2223 Ga0163162_10559856
2224 Ga0163162_10609618
2225 Ga0163162_11769678
2226 Ga0157372_10454180
2227 Ga0157375_10055322
2228 Ga0157375_10265853
2229 Ga0157375_10340654
2230 Ga0157375_10374552
2231 Ga0157375_10587096
2232 Ga0157375_10658352
2233 Ga0157375_11224686
2234 Ga0163163_10006091
2235 Ga0163163_10024951
2236 Ga0163163_10033095
2237 Ga0163163_10044334
2238 Ga0163163_10049145
2239 Ga0163163_10457893
2240 Ga0163163_10662976
2241 Ga0163163_11872649
2242 Ga0163163_12172974
2243 Ga0157380_10002946
2244 Ga0157380_10008813
2245 Ga0157380_10018744
2246 Ga0157380_10048867
2247 Ga0157380_10078622
2248 Ga0157380_10088271
2249 Ga0157380_10279419
2250 Ga0157380_10417166
2251 Ga0157380_10691176
2252 Ga0157380_11418633
2253 Ga0157380_11524746
2254 Ga0157380_11547105
2255 Ga0157380_11772989
2256 Ga0182008_10291273
2257 Ga0157377_10066174
2258 Ga0157377_10095762
2259 Ga0157377_10155723
2260 Ga0157377_10275103
2261 Ga0157377_10331777
2262 Ga0157377_10550822
2263 Ga0157379_10007040
2264 Ga0157379_10007133
2265 Ga0157379_10030765
2266 Ga0157379_10037871
2267 Ga0157379_10222767
2268 Ga0157379_10304951
2269 Ga0157379_10328355
2270 Ga0157379_10640056
2271 Ga0157376_10024569
2272 Ga0157376_10024693
2273 Ga0157376_10086620
2274 Ga0157376_10189607
2275 Ga0157376_10366170
2276 Ga0157376_10823342
2277 Ga0157376_11082052
2278 Ga0163161_10279799
2279 Ga0163161_10379530
2280 Ga0163161_10965245
2281 Ga0213876_10074971
2282 Ga0207697_10024138
2283 Ga0207697_10072296
2284 Ga0207697_10274146
2285 Ga0207697_10357179
2286 Ga0207656_10097732
2287 Ga0207653_10093372
2288 Ga0207682_10004207
2289 Ga0207682_10045366
2290 Ga0207682_10048222
2291 Ga0207682_10052586
2292 Ga0207682_10064298
2293 Ga0207682_10089494
2294 Ga0207682_10093133
2295 Ga0207682_10327128
2296 Ga0207692_10397454
2297 Ga0207642_10036643
2298 Ga0207642_10101553
2299 Ga0207710_10082088
2300 Ga0207688_10348566
2301 Ga0207680_10023105
2302 Ga0207680_10049583
2303 Ga0207680_10132754
2304 Ga0207680_10318152
2305 Ga0207680_10792231
2306 Ga0207685_10174223
2307 Ga0207699_10026366
2308 Ga0207699_10257100
2309 Ga0207645_10001406
2310 Ga0207645_10002286
2311 Ga0207645_10065309
2312 Ga0207645_10142585
2313 Ga0207645_10148909
2314 Ga0207643_10003202
2315 Ga0207643_10042613
2316 Ga0207643_10057393
2317 Ga0207643_10077467
2318 Ga0207643_10549995
2319 Ga0207684_10180841
2320 Ga0207684_10189929
2321 Ga0207684_10228661
2322 Ga0207654_10301123
2323 Ga0207707_10331947
2324 Ga0207695_10151584
2325 Ga0207695_10360308
2326 Ga0207695_10428856
2327 Ga0207695_10757082
2328 Ga0207671_10227660
2329 Ga0207671_11049257
2330 Ga0207693_10139612
2331 Ga0207693_10488325
2332 Ga0207693_10738222
2333 Ga0207663_10226206
2334 Ga0207660_10085009
2335 Ga0207660_10096368
2336 Ga0207660_10165751
2337 Ga0207660_10247169
2338 Ga0207662_10007637
2339 Ga0207662_10015889
2340 Ga0207662_10099277
2341 Ga0207662_10131006
2342 Ga0207657_10006096
2343 Ga0207657_10144559
2344 Ga0207649_10073295
2345 Ga0207649_10075530
2346 Ga0207649_10727068
2347 Ga0207649_10857902
2348 Ga0207652_10052515
2349 Ga0207652_10360643
2350 Ga0207652_10399292
2351 Ga0207652_10697637
2352 Ga0207652_10727255
2353 Ga0207646_10067972
2354 Ga0207646_10146933
2355 Ga0207646_10167580
2356 Ga0207646_10658221
2357 Ga0207646_10771753
2358 Ga0207646_10980208
2359 Ga0207681_10009178
2360 Ga0207681_10022038
2361 Ga0207681_10025121
2362 Ga0207681_10036364
2363 Ga0207681_10051798
2364 Ga0207681_10146109
2365 Ga0207681_10438186
2366 Ga0207694_10142401
2367 Ga0207650_10002374
2368 Ga0207650_10084901
2369 Ga0207650_10121252
2370 Ga0207650_10295594
2371 Ga0207650_10549731
2372 Ga0207650_10801154
2373 Ga0207659_10000079
2374 Ga0207659_10001272
2375 Ga0207659_10001629
2376 Ga0207659_10012585
2377 Ga0207659_10029655
2378 Ga0207659_10058294
2379 Ga0207659_10097120
2380 Ga0207659_10136365
2381 Ga0207659_10163907
2382 Ga0207659_10193963
2383 Ga0207659_10235224
2384 Ga0207659_10581384
2385 Ga0207687_10124628
2386 Ga0207687_10136073
2387 Ga0207687_10263500
2388 Ga0207687_11381762
2389 Ga0207700_10005583
2390 Ga0207700_10006132
2391 Ga0207700_10279505
2392 Ga0207700_10438202
2393 Ga0207700_11121973
2394 Ga0207664_10139643
2395 Ga0207644_10098430
2396 Ga0207644_10103306
2397 Ga0207644_10464392
2398 Ga0207644_11140984
2399 Ga0207690_10116446
2400 Ga0207690_10159647
2401 Ga0207706_10006050
2402 Ga0207706_10101857
2403 Ga0207706_10129500
2404 Ga0207706_10134783
2405 Ga0207706_10164552
2406 Ga0207706_10167166
2407 Ga0207706_10388096
2408 Ga0207706_10418896
2409 Ga0207706_10902198
2410 Ga0207686_10012850
2411 Ga0207686_10020581
2412 Ga0207686_10049693
2413 Ga0207686_10238381
2414 Ga0207686_10242409
2415 Ga0207686_10647968
2416 Ga0207686_11249943
2417 Ga0207709_10004795
2418 Ga0207709_10006292
2419 Ga0207709_10194962
2420 Ga0207709_10307838
2421 Ga0207670_10002109
2422 Ga0207670_10093752
2423 Ga0207670_10163474
2424 Ga0207670_10250581
2425 Ga0207670_10341404
2426 Ga0207670_10496198
2427 Ga0207670_10639302
2428 Ga0207670_10803123
2429 Ga0207669_10029033
2430 Ga0207669_10322202
2431 Ga0207669_10380953
2432 Ga0207669_10612134
2433 Ga0207669_10702761
2434 Ga0207669_10807414
2435 Ga0207669_10889369
2436 Ga0207669_11210408
2437 Ga0207704_10001806
2438 Ga0207704_10022964
2439 Ga0207704_10095293
2440 Ga0207704_10101794
2441 Ga0207704_10141205
2442 Ga0207704_10668633
2443 Ga0207665_10090888
2444 Ga0207665_10553627
2445 Ga0207665_10852006
2446 Ga0207691_10018862
2447 Ga0207691_10045113
2448 Ga0207691_10070189
2449 Ga0207691_10122904
2450 Ga0207691_10176973
2451 Ga0207691_10353247
2452 Ga0207691_10428238
2453 Ga0207691_10538456
2454 Ga0207691_10642074
2455 Ga0207691_10649339
2456 Ga0207711_10006268
2457 Ga0207711_10027728
2458 Ga0207711_10036902
2459 Ga0207711_10057589
2460 Ga0207711_10082424
2461 Ga0207711_10141424
2462 Ga0207711_10379055
2463 Ga0207711_10584376
2464 Ga0207711_10589809
2465 Ga0207711_10821846
2466 Ga0207711_10920258
2467 Ga0207711_11097910
2468 Ga0207689_10000032
2469 Ga0207689_10045085
2470 Ga0207689_10081837
2471 Ga0207689_10125401
2472 Ga0207689_10228789
2473 Ga0207689_10240049
2474 Ga0207689_10323548
2475 Ga0207661_10098786
2476 Ga0207661_10106732
2477 Ga0207661_10334552
2478 Ga0207661_10342356
2479 Ga0207661_10396865
2480 Ga0207661_10795048
2481 Ga0207679_10073204
2482 Ga0207679_10686495
2483 Ga0207679_10744666
2484 Ga0207679_10801763
2485 Ga0207679_11371468
2486 Ga0207667_10104283
2487 Ga0207667_10451829
2488 Ga0207667_10866185
2489 Ga0207667_11025418
2490 Ga0207651_10010999
2491 Ga0207651_10048187
2492 Ga0207651_10110003
2493 Ga0207651_10185688
2494 Ga0207651_10342397
2495 Ga0207651_10524791
2496 Ga0207712_10073047
2497 Ga0207712_10260004
2498 Ga0207712_11240747
2499 Ga0207712_11279341
2500 Ga0207668_10085374
2501 Ga0207668_10730246
2502 Ga0207668_11564651
2503 Ga0207640_10873542
2504 Ga0207640_10910496
2505 Ga0207640_11062493
2506 Ga0207677_10065710
2507 Ga0207677_10201274
2508 Ga0207677_10270975
2509 Ga0207677_10331780
2510 Ga0207677_10557228
2511 Ga0207703_10008882
2512 Ga0207703_10018977
2513 Ga0207703_10045404
2514 Ga0207703_10049674
2515 Ga0207703_10065358
2516 Ga0207703_10167253
2517 Ga0207703_10227604
2518 Ga0207703_10838593
2519 Ga0207703_10888294
2520 Ga0207703_11245904
2521 Ga0207639_10200242
2522 Ga0207678_10054360
2523 Ga0207678_10292250
2524 Ga0207708_10004043
2525 Ga0207708_10004337
2526 Ga0207708_10102480
2527 Ga0207708_10115449
2528 Ga0207708_10132107
2529 Ga0207708_10227810
2530 Ga0207708_10231410
2531 Ga0207708_10289983
2532 Ga0207708_10419909
2533 Ga0207702_10314643
2534 Ga0207641_10000955
2535 Ga0207641_10106423
2536 Ga0207641_10329613
2537 Ga0207641_10341335
2538 Ga0207641_10790080
2539 Ga0207641_11598577
2540 Ga0207648_10001379
2541 Ga0207648_10002536
2542 Ga0207648_10053012
2543 Ga0207648_10092785
2544 Ga0207648_10099685
2545 Ga0207648_10139264
2546 Ga0207648_10211164
2547 Ga0207648_10254914
2548 Ga0207648_10281533
2549 Ga0207648_10334651
2550 Ga0207648_11322834
2551 Ga0207648_11467147
2552 Ga0207676_10014812
2553 Ga0207676_10032483
2554 Ga0207676_10034193
2555 Ga0207676_10109644
2556 Ga0207676_10150793
2557 Ga0207676_10180475
2558 Ga0207676_10307813
2559 Ga0207676_10525687
2560 Ga0207674_10061584
2561 Ga0207674_10592894
2562 Ga0207674_10656898
2563 Ga0207674_10707475
2564 Ga0207675_100087094
2565 Ga0207675_100088170
2566 Ga0207675_100115838
2567 Ga0207675_100116172
2568 Ga0207675_100230505
2569 Ga0207675_100254408
2570 Ga0207675_100278637
2571 Ga0207675_100347885
2572 Ga0207675_100385732
2573 Ga0207675_100595480
2574 Ga0207675_100618544
2575 Ga0207675_100857438
2576 Ga0207675_101042915
2577 Ga0207683_10033044
2578 Ga0207683_10157417
2579 Ga0207683_10206224
2580 Ga0207683_10313072
2581 Ga0207683_10414536
2582 Ga0207683_10433160
2583 Ga0207683_10558342
2584 Ga0207683_10688106
2585 Ga0207683_10800358
2586 Ga0207683_11067291
2587 Ga0207683_11146007
2588 Ga0207698_10400208
2589 Ga0209983_1106675
2590 Ga0209971_1026227
2591 Ga0209974_10063480
2592 Ga0207428_10000005
2593 Ga0207428_10000156
2594 Ga0207428_10003214
2595 Ga0207428_10006617
2596 Ga0207428_10007795
2597 Ga0207428_10017798
2598 Ga0207428_10032828
2599 Ga0207428_10035587
2600 Ga0207428_10331834
2601 Ga0207428_10630272
2602 Ga0268266_10076315
2603 Ga0268266_10148463
2604 Ga0268266_10204191
2605 Ga0268266_10400322
2606 Ga0268265_10007655
2607 Ga0268265_10080399
2608 Ga0268265_10151383
2609 Ga0268265_10192637
2610 Ga0268265_10221870
2611 Ga0268265_10533288
2612 Ga0268265_10595829
2613 Ga0268264_10023300
2614 Ga0268264_10035080
2615 Ga0268264_10148355
2616 Ga0268264_10278405
2617 Ga0268264_10282422
2618 Ga0268264_10334699
2619 Ga0268264_10473607
2620 Ga0265316_10444674
2621 Ga0307408_100078365
2622 Ga0307408_100081459
2623 Ga0307408_100392206
2624 Ga0307408_100803021
2625 Ga0265314_10033286
2626 Ga0307405_10079173
2627 Ga0307405_10112523
2628 Ga0307405_10133043
2629 Ga0307405_10482364
2630 Ga0307405_10597284
2631 Ga0307413_10100156
2632 Ga0307413_10463454
2633 Ga0307413_10927710
2634 Ga0307410_10051926
2635 Ga0307410_10079408
2636 Ga0307410_10116868
2637 Ga0307410_10124814
2638 Ga0307410_10835309
2639 Ga0307406_10343830
2640 Ga0307407_10084019
2641 Ga0307412_10194730
2642 Ga0307412_10542345
2643 Ga0307409_100074356
2644 Ga0307409_100300793
2645 Ga0307416_100028056
2646 Ga0307416_100038313
2647 Ga0307416_100059664
2648 Ga0307416_100300829
2649 Ga0307416_100374617
2650 Ga0307416_100707017
2651 Ga0307414_10097706
2652 Ga0307414_10129721
2653 Ga0307414_10349360
2654 Ga0307414_10615760
2655 Ga0307414_10640988
2656 Ga0307414_11121239
2657 Ga0307411_10114535
2658 Ga0307411_10117822
2659 Ga0307411_10202710
2660 Ga0307411_10435962
2661 Ga0307411_10460682
2662 Ga0307415_100010673
2663 Ga0307415_100154027
2664 Ga0307415_100668424
2665 Ga0307415_101172548
2666 Ga0373930_0002854
2667 Ga0373948_0018575
2668 Ga0373950_0000492
2669 Ga0373958_0024338
2670 Ga0373928_0006977
2671 Ga0373929_0000407
2672 Ga0373949_0000966
2673 Ga0373952_0000798
2674 Ga0373923_0079124
2675 Ga0373939_0030625
2676 Ga0373939_0109649
2677 Ga0373941_0013295
2678 Ga0373941_0183910
2679 Ga0373953_0220071
2680 Ga0373954_0051964
2681 Ga0373954_0184461
2682 Ga0373960_0217085
2683 Ga0373943_0021226
2684 Ga0373943_0185733
2685 Ga0373943_0217615
2686 Ga0373943_0224021
2687 Ga0373946_0029315
2688 Ga0373946_0318098
2689 Ga0373955_0003019
2690 Ga0373955_0046443
2691 Ga0373955_0076519
2692 Ga0373955_0442855
2693 Ga0373955_0842861
2694 Ga0373942_0001566
2695 Ga0373924_0021449
2696 Ga0373924_0140817
2697 Ga0373931_0007480
2698 Ga0373935_0083599
2699 Ga0373935_0134413
2700 Ga0373935_0164017
2701 Ga0373935_0185751
2702 Ga0373927_0155381
2703 Ga0373933_0418322
2704 Ga0373933_0740285
2705 Ga0373947_0003818
2706 Ga0373937_0012405
2707 Ga0373937_0176206
2708 Ga0373937_0381356
2709 Ga0373937_0393320
2710 Ga0373937_0608866
2711 Ga0373937_1823949
2712 Ga0373925_0266622
2713 Ga0373925_0482653
2714 Ga0373925_0542746
2715 Ga0373925_1199410
2716 Ga0395900_0459263
2717 Ga0395905_0197773
2718 Ga0242420_027094
2719 Ga0436365_0956175
2720 Ga0436365_1732685
2721 Ga0439439_0093016
2722 Ga0439453_0017767
2723 Ga0439453_0026277
2724 Ga0439431_0006753
2725 Ga0439433_0001889
2726 Ga0439437_014446
2727 Ga0439462_0051606
2728 Ga0450892_007492
2729 Ga0439446_0028655
2730 Ga0439446_0095397
2731 Ga0439446_0251776
2732 Ga0439458_0092357
2733 Ga0439434_0099914
2734 Ga0439435_0052341
2735 Ga0439435_0069724
2736 Ga0439464_0061668
2737 Ga0439460_0040424
2738 Ga0439460_0063976
2739 Ga0439460_0123444
2740 Ga0450916_034769
2741 Ga0451577_0424665
2742 Ga0439440_0033118
2743 Ga0439440_0098351
2744 Ga0466963_0184194
2745 Ga0466963_0239302
2746 Ga0466957_0155932
2747 Ga0451576_0003703
2748 Ga0451576_0301734
2749 Ga0466967_0493469
2750 Ga0495592_0025040
2751 Ga0495592_0139872
2752 Ga0495603_0028319
2753 Ga0495603_0042909
2754 Ga0495603_0358636
2755 Ga0495629_0085053
2756 Ga0495629_0206389
2757 Ga0495580_0316248
2758 Ga0495582_0181798
2759 Ga0495582_0472333
2760 Ga0495639_0076786
2761 Ga0495664_0171598
2762 Ga0495664_0296679
2763 Ga0495584_0025210
2764 Ga0495584_0410163
2765 Ga0495594_0029180
2766 Ga0495594_0066860
2767 Ga0495594_0252872
2768 Ga0495594_0353963
2769 Ga0495608_0003942
2770 Ga0495618_0086045
2771 Ga0495618_0617134
2772 Ga0495630_0009709
2773 Ga0495630_1022797
2774 Ga0495643_0009097
2775 Ga0495644_0096332
2776 Ga0495663_0017329
2777 Ga0495652_0245893
2778 Ga0495652_0635473
2779 Ga0495654_0322069
2780 Ga0495665_0483848
2781 Ga0495640_0047607
2782 Ga0495640_0078023
2783 Ga0495640_0416169
2784 Ga0495587_0051732
2785 Ga0495587_0176508
2786 Ga0495598_0012654
2787 Ga0495598_0117596
2788 Ga0495598_0146081
2789 Ga0495609_0019629
2790 Ga0495621_0003364
2791 Ga0495621_0037939
2792 Ga0495621_0109503
2793 Ga0495621_0116445
2794 Ga0495645_0000450
2795 Ga0495633_0093088
2796 Ga0495667_0040064
2797 Ga0495634_0081249
2798 Ga0495634_0326616
2799 Ga0495634_0422055
2800 Ga0495611_0197354
2801 Ga0495635_0053736
2802 Ga0495635_0088667
2803 Ga0495659_0015579
2804 Ga0495659_0191227
2805 Ga0495588_0057859
2806 Ga0495657_0311723
2807 Ga0495623_0047499
2808 Ga0495647_0214209
2809 Ga0495658_0025322
2810 Ga0495658_0090500
2811 Ga0495658_0168637
2812 Ga0495658_0580717
2813 Ga0495669_0004081
2814 Ga0495669_0007347
2815 Ga0495669_0103649
2816 Ga0495669_0333198
2817 Ga0495613_0001676
2818 Ga0495670_0077989
2819 Ga0495600_0092987
2820 Ga0495600_0332280
2821 Ga0495636_0043766
2822 Ga0495674_0082858
2823 Ga0495674_0091091
2824 Ga0495674_0233224
2825 Ga0495676_0071461
2826 Ga0495675_0452837
2827 Ga0495675_0476815
2828 Ga0495677_0021678
2829 Ga0495685_063483
2830 Ga0495684_0002679
2831 Ga0495684_0025447
2832 Ga0495593_0174023
2833 Ga0495602_0401247
2834 Ga0496100_0005315
2835 Ga0496100_1547020
2836 Ga0496101_0000338
2837 Ga0496101_0163598
2838 Ga0496101_0504818
2839 Ga0496102_0120104
2840 Ga0496102_0365200
2841 Ga0496104_0011885
2842 Ga0496104_0063755
2843 Ga0496104_0116270
2844 Ga0496104_0641105
2845 Ga0496104_0791916
2846 Ga0496105_0027444
2847 Ga0496105_0263662
2848 Ga0496105_0522093
2849 Ga0496105_0534097
2850 Ga0496106_0080483
2851 Ga0496107_0007329
2852 Ga0496108_0228402
2853 Ga0496108_0685751
2854 Ga0496108_0934304
2855 Ga0496109_0079029
2856 Ga0496109_0165002
2857 Ga0496109_0585075
2858 Ga0496109_0689410
2859 Ga0496110_0659312
2860 Ga0496111_0221188
2861 Ga0496111_1030007
2862 Ga0496112_0002810
2863 Ga0496112_0086620
2864 Ga0496112_0167090
2865 Ga0496112_0216587
2866 Ga0496112_0242980
2867 Ga0496112_0422774
2868 Ga0496112_0456036
2869 Ga0496112_0741276
2870 Ga0496113_0379672
2871 Ga0496114_0001212
2872 Ga0496114_0050503
2873 Ga0496114_0084214
2874 Ga0496114_0124083
2875 Ga0496114_0198014
2876 Ga0496114_0222524
2877 Ga0496114_0357960
2878 Ga0496114_0508159
2879 Ga0496115_0125497
2880 Ga0501299_060055
2881 Ga0501031_0169692
2882 Ga0501031_0245236
2883 Ga0501031_0281248
2884 Ga0501034_0158536
2885 Ga0501036_0258953
2886 Ga0501036_0316407
2887 Ga0501036_0355452
2888 Ga0501036_0632035
2889 Ga0501037_0177620
2890 Ga0501037_0531813
2891 Ga0501038_0043210
2892 Ga0501038_0134017
2893 Ga0501039_0005083
2894 Ga0501040_0009144
2895 Ga0501040_0021727
2896 Ga0501040_0049618
2897 Ga0501040_0422137
2898 Ga0501040_0617110
2899 Ga0501041_0080818
2900 Ga0501041_0944903
2901 Ga0501042_0003809
2902 Ga0501042_0085038
2903 Ga0501043_0038916
2904 Ga0501046_0047476
2905 Ga0501046_0054245
2906 Ga0501047_0453613
2907 Ga0501048_0049799
2908 Ga0501048_0279882
2909 Ga0501048_1149577
2910 Ga0501068_0082561
2911 Ga0501068_0511945
2912 Ga0501071_0015832
2913 Ga0501071_0192495
2914 Ga0501071_0934381
2915 Ga0501072_0006572
2916 Ga0501072_0026593
2917 Ga0501073_0326630
2918 Ga0501075_0023042
2919 Ga0501075_0110545
2920 Ga0501075_0468852
2921 Ga0501076_0040773
2922 Ga0501076_0136177
2923 Ga0501076_0423239
2924 Ga0501076_0656617
2925 Ga0501077_0047177
2926 Ga0501077_0072533
2927 Ga0501216_072708
2928 Ga0501221_035984
2929 Ga0501079_0005197
2930 Ga0501079_0087472
2931 Ga0501079_0669540
2932 Ga0501080_0425907
2933 Ga0501081_0008696
2934 Ga0501081_0041776
2935 Ga0501081_0588644
2936 Ga0501083_0073605
2937 Ga0501035_0192170
2938 Ga0501035_0933073
2939 Ga0501035_0961356
2940 Ga0501044_0092948
2941 Ga0501044_1290198
2942 Ga0501045_0004657
2943 Ga0501045_0241444
2944 Ga0501045_0264909
2945 nmdc:mga03683_1149_c1
2946 nmdc:mga00v17_7255_c1
2947 nmdc:mga0yw44_555493_c1
2948 nmdc:mga05p37_11071_c1
2949 nmdc:mga05p37_138803_c1
2950 nmdc:mga05p37_139331_c1
2951 nmdc:mga05p37_158861_c1
2952 nmdc:mga05p37_1965492_c1
2953 nmdc:mga05p37_1997_c1
2954 nmdc:mga05p37_20363_c1
2955 nmdc:mga05p37_23209_c1
2956 nmdc:mga05p37_24698_c1
2957 nmdc:mga05p37_25595_c1
2958 nmdc:mga05p37_26118_c2
2959 nmdc:mga05p37_34921_c1
2960 nmdc:mga05p37_37736_c1
2961 nmdc:mga05p37_43651_c1
2962 nmdc:mga05p37_44023_c1
2963 nmdc:mga05p37_48901_c1
2964 nmdc:mga05p37_5217_c1
2965 nmdc:mga05p37_73083_c1
2966 nmdc:mga05p37_91576_c1
2967 nmdc:mga05p37_967626_c1
2968 nmdc:mga09592_1189676_c1
2969 nmdc:mga09592_13559_c1
2970 nmdc:mga09592_139923_c1
2971 nmdc:mga09592_149535_c1
2972 nmdc:mga09592_19921_c1
2973 nmdc:mga09592_201873_c1
2974 nmdc:mga09592_23513_c1
2975 nmdc:mga09592_26276_c1
2976 nmdc:mga09592_38159_c1
2977 nmdc:mga09592_456600_c1
2978 nmdc:mga09592_68792_c1
2979 nmdc:mga0qj67_194295_c1
2980 nmdc:mga0qj67_245188_c1
2981 nmdc:mga0qj67_255819_c1
2982 nmdc:mga0qj67_27328_c1
2983 nmdc:mga0qj67_7153_c1
2984 nmdc:mga0qj67_7629_c1
2985 nmdc:mga06r32_1076344_c1
2986 nmdc:mga06r32_132439_c1
2987 nmdc:mga06r32_14936_c1
2988 nmdc:mga06r32_270474_c1
2989 nmdc:mga06r32_29574_c1
2990 nmdc:mga06r32_616343_c1
2991 nmdc:mga06r32_655429_c1
2992 nmdc:mga06r32_86132_c1
2993 nmdc:mga06r32_9476_c1
2994 nmdc:mga08y16_108808_c1
2995 nmdc:mga08y16_116259_c1
2996 nmdc:mga08y16_1178584_c1
2997 nmdc:mga08y16_1367_c1
2998 nmdc:mga08y16_1568_c1
2999 nmdc:mga08y16_227293_c1
3000 nmdc:mga08y16_2507_c1
3001 nmdc:mga08y16_2643_c1
3002 nmdc:mga08y16_266469_c1
3003 nmdc:mga08y16_273804_c1
3004 nmdc:mga08y16_2862_c1
3005 nmdc:mga08y16_352547_c1
3006 nmdc:mga08y16_390387_c1
3007 nmdc:mga08y16_449722_c1
3008 nmdc:mga08y16_4998_c1
3009 nmdc:mga08y16_658_c1
3010 nmdc:mga08y16_67477_c1
3011 nmdc:mga08y16_9_c1
3012 nmdc:mga0n895_1037810_c1
3013 nmdc:mga0n895_13596_c1
3014 nmdc:mga0n895_141_c1
3015 nmdc:mga0n895_166078_c1
3016 nmdc:mga0n895_19824_c1
3017 nmdc:mga0n895_267490_c1
3018 nmdc:mga0n895_304759_c1
3019 nmdc:mga0n895_343217_c1
3020 nmdc:mga0n895_35782_c1
3021 nmdc:mga0n895_472679_c1
3022 nmdc:mga0n895_476418_c1
3023 nmdc:mga0n895_546195_c1
3024 nmdc:mga0n895_58404_c1
3025 nmdc:mga0n895_602783_c1
3026 nmdc:mga0n895_72372_c1
3027 nmdc:mga0n895_737660_c1
3028 nmdc:mga0n895_81880_c1
3029 nmdc:mga0rr50_1006114_c1
3030 nmdc:mga0rr50_12990_c1
3031 nmdc:mga0rr50_14183_c1
3032 nmdc:mga0rr50_176227_c1
3033 nmdc:mga0rr50_1_c1
3034 nmdc:mga0rr50_316066_c1
3035 nmdc:mga0rr50_398071_c1
3036 nmdc:mga0rr50_539301_c1
3037 nmdc:mga0rr50_560727_c1
3038 nmdc:mga0rr50_682119_c1
3039 nmdc:mga0rr50_761091_c1
3040 nmdc:mga0rr50_8550_c1
3041 nmdc:mga0rr50_8679_c1
3042 nmdc:mga08x19_148053_c1
3043 nmdc:mga08x19_153311_c1
3044 nmdc:mga08x19_191333_c1
3045 nmdc:mga08x19_3155_c1
3046 nmdc:mga08x19_34798_c1
3047 nmdc:mga08x19_416343_c1
3048 nmdc:mga08x19_92_c1
3049 nmdc:mga0a205_112707_c2
3050 nmdc:mga0a205_120196_c1
3051 nmdc:mga0a205_12067_c2
3052 nmdc:mga0a205_1225776_c1
3053 nmdc:mga0a205_131663_c1
3054 nmdc:mga0a205_132875_c1
3055 nmdc:mga0a205_151535_c1
3056 nmdc:mga0a205_167404_c1
3057 nmdc:mga0a205_219892_c1
3058 nmdc:mga0a205_2573_c1
3059 nmdc:mga0a205_281542_c1
3060 nmdc:mga0a205_370522_c1
3061 nmdc:mga0a205_394862_c1
3062 nmdc:mga0a205_532506_c1
3063 nmdc:mga0a205_649189_c1
3064 nmdc:mga0a205_676287_c1
3065 nmdc:mga0sz30_222545_c1
3066 Ga0495601_0003730
3067 Ga0495601_0068407
3068 Ga0495601_0135362
3069 Ga0495595_0012548
3070 Ga0495595_0405849
3071 Ga0495619_0006567
3072 Ga0495619_0280366
3073 Ga0495619_0433888
3074 Ga0495619_0769263
3075 Ga0500628_043052
3076 Ga0501084_0009574
3077 Ga0501084_0043281
3078 Ga0501084_0359012
3079 Ga0501084_1006567
3080 Ga0590071_000739
3081 Ga0590071_005043
3082 Ga0590074_003587
3083 Ga0590074_042319
3084 Ga0590075_001312
3085 Ga0590075_002211
3086 Ga0590075_057765
3087 Ga0590075_113661
3088 Ga0590077_000747
3089 Ga0587091_100514
3090 Ga0587114_031768
3091 Ga0501082_0163480
3092 Ga0501082_0444785
3093 Ga0501082_0818939
3094 Ga0530510_0009184
3095 Ga0530510_0062078
3096 Ga0530510_0289552

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02357

NusG

Transcription termination factor nusG

27

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ej3-assembly1.cif.gz_G m. tuberculosis rnap pause escaped complex with bacillus subtilis nusg and gmpcpp 0.8273 4 97
6c6t-assembly1.cif.gz_D cryoem structure of e.coli rna polymerase elongation complex bound with rfah 0.8099 4 93
2oug-assembly4.cif.gz_D crystal structure of the rfah transcription factor at 2.1a resolution 0.7971 4 93
5ond-assembly1.cif.gz_A rfah from escherichia coli in complex with ops dna 0.7917 3 95
8exy-assembly1.cif.gz_G m. tuberculosis rnap paused complex with b. subtilis nusg and gmpcpp 0.782 4 96
ID Description Score Start End Superfamily
af_P9WIU9_43_152_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.8525 3 93 3.30.70.940
af_O13936_718_779_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.803 114 163 2.30.30.30
af_I1J750_105_222_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.8002 4 101 3.30.70.940
2ougC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.7995 4 93 3.30.70.940
af_P0AFG0_1_117_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.7717 2 101 3.30.70.940
ID Description Score Start End GO Terms
AF-A0A2U3QDJ7-F1-model_v4 Transcription termination factor NusG domain protein 0.9505 2 163 GO:0031564
GO:0140673
AF-A0A2H6FC29-F1-model_v4 Transcriptional activator RfaH 0.9485 2 163 GO:0031564
GO:0140673
AF-A0A6N6S5U6-F1-model_v4 UpxY family transcription antiterminator 0.9394 1 163 GO:0031564
GO:0140673
AF-A0A2U3QDJ7-F1-model_v4 Transcription termination factor NusG domain protein 0.9393 2 163 GO:0031564
GO:0140673
AF-A0A2H6FC29-F1-model_v4 Transcriptional activator RfaH 0.9374 2 163 GO:0031564
GO:0140673

Map