F494707
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1549 | 383 | 3096 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10947929|Ga0163162_109479291 |
| Length | 188 |
| Sequence | MSRSLHSSSQVHEHGDDRVSAAPDDDQRWFAIWTRSRHEQVVREQLLQKQIDTFLPTVTRWSRWKDRKKKIDWPLFPGYCFARFNPRERLPILKCTGVVTIISSQGGEPSAIPEHEIEGIRQLVQSDLAFDPCPMIREGTLVEVIHGPLKGVIGRLLRKSDKARLVLSVDLIGQAVSVEVDAADVRAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 217 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 246 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 247 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 252 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 253 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 254 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 255 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 256 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 257 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 258 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 350 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 375 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 377 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 2.97 |
| Rhizosphere | 96.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 32.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10947929 | 3300013306 | Unclassified | 972 |
| 2 | JGI24033J26618_1016701 | 3300002155 | Unclassified | 914 |
| 3 | JGI24751J29686_10013893 | 3300002459 | Bacteria | 1662 |
| 4 | JGI25406J46586_10097873 | 3300003203 | Bacteria | 878 |
| 5 | Ga0065714_10083408 | 3300005288 | Bacteria | 2244 |
| 6 | Ga0065704_10148721 | 3300005289 | Unclassified | 1413 |
| 7 | Ga0065704_10537012 | 3300005289 | Bacteria | 643 |
| 8 | Ga0065712_10002622 | 3300005290 | Bacteria | 5006 |
| 9 | Ga0065712_10067818 | 3300005290 | Bacteria | 29246 |
| 10 | Ga0065712_10099576 | 3300005290 | Unclassified | 2087 |
| 11 | Ga0065712_10149758 | 3300005290 | Bacteria | 1373 |
| 12 | Ga0065712_10162315 | 3300005290 | Bacteria | 1294 |
| 13 | Ga0065712_10319358 | 3300005290 | Unclassified | 831 |
| 14 | Ga0065715_10103959 | 3300005293 | Unclassified | 2995 |
| 15 | Ga0065715_10146880 | 3300005293 | Unclassified | 1771 |
| 16 | Ga0065715_10147926 | 3300005293 | Bacteria | 1765 |
| 17 | Ga0065715_10158966 | 3300005293 | Bacteria | 1648 |
| 18 | Ga0065715_10168749 | 3300005293 | Bacteria | 1564 |
| 19 | Ga0065715_10236028 | 3300005293 | Bacteria | 1216 |
| 20 | Ga0065715_10279735 | 3300005293 | Bacteria | 1078 |
| 21 | Ga0065715_10408396 | 3300005293 | Unclassified | 873 |
| 22 | Ga0065707_10247239 | 3300005295 | Bacteria | 1133 |
| 23 | Ga0065707_10289450 | 3300005295 | Unclassified | 1028 |
| 24 | Ga0065707_10302678 | 3300005295 | Bacteria | 1001 |
| 25 | Ga0065707_10412332 | 3300005295 | Unclassified | 840 |
| 26 | Ga0065707_10484671 | 3300005295 | Bacteria | 770 |
| 27 | Ga0070676_10026241 | 3300005328 | Bacteria | 3298 |
| 28 | Ga0070676_10199862 | 3300005328 | Unclassified | 1310 |
| 29 | Ga0070676_10297952 | 3300005328 | Bacteria | 1092 |
| 30 | Ga0070676_10331366 | 3300005328 | Bacteria | 1041 |
| 31 | Ga0070676_10357983 | 3300005328 | Unclassified | 1005 |
| 32 | Ga0070676_10438005 | 3300005328 | Unclassified | 916 |
| 33 | Ga0070676_10832927 | 3300005328 | Unclassified | 683 |
| 34 | Ga0070683_100024470 | 3300005329 | Bacteria | 5409 |
| 35 | Ga0070683_100338820 | 3300005329 | Unclassified | 1432 |
| 36 | Ga0070690_100000920 | 3300005330 | Bacteria | 14972 |
| 37 | Ga0070690_100166363 | 3300005330 | Unclassified | 1515 |
| 38 | Ga0070690_100197332 | 3300005330 | Bacteria | 1399 |
| 39 | Ga0070690_100922612 | 3300005330 | Bacteria | 684 |
| 40 | Ga0070690_100946779 | 3300005330 | Unclassified | 676 |
| 41 | Ga0070690_101430069 | 3300005330 | Bacteria | 557 |
| 42 | Ga0070670_100015640 | 3300005331 | Bacteria | 6514 |
| 43 | Ga0070670_100026375 | 3300005331 | Bacteria | 5001 |
| 44 | Ga0070670_100052956 | 3300005331 | Bacteria | 3486 |
| 45 | Ga0070670_100161978 | 3300005331 | Unclassified | 1939 |
| 46 | Ga0070670_100300500 | 3300005331 | Unclassified | 1404 |
| 47 | Ga0070670_100901418 | 3300005331 | Unclassified | 801 |
| 48 | Ga0070677_10013312 | 3300005333 | Bacteria | 2875 |
| 49 | Ga0070677_10044554 | 3300005333 | Unclassified | 1766 |
| 50 | Ga0070677_10049012 | 3300005333 | Bacteria | 1699 |
| 51 | Ga0070677_10279774 | 3300005333 | Bacteria | 840 |
| 52 | Ga0070677_10284896 | 3300005333 | Unclassified | 834 |
| 53 | Ga0070677_10422995 | 3300005333 | Unclassified | 707 |
| 54 | Ga0068869_100002153 | 3300005334 | Bacteria | 11844 |
| 55 | Ga0068869_100048862 | 3300005334 | Bacteria | 3061 |
| 56 | Ga0068869_100092460 | 3300005334 | Unclassified | 2277 |
| 57 | Ga0068869_100103497 | 3300005334 | Bacteria | 2157 |
| 58 | Ga0068869_100174532 | 3300005334 | Unclassified | 1681 |
| 59 | Ga0068869_100280507 | 3300005334 | Bacteria | 1340 |
| 60 | Ga0068869_100536026 | 3300005334 | Unclassified | 981 |
| 61 | Ga0068869_101215174 | 3300005334 | Bacteria | 663 |
| 62 | Ga0070666_10196882 | 3300005335 | Unclassified | 1417 |
| 63 | Ga0070666_10198726 | 3300005335 | Bacteria | 1410 |
| 64 | Ga0070666_10729581 | 3300005335 | Bacteria | 728 |
| 65 | Ga0070680_100025422 | 3300005336 | Bacteria | 4733 |
| 66 | Ga0070680_100153630 | 3300005336 | Unclassified | 1933 |
| 67 | Ga0070680_100630050 | 3300005336 | Bacteria | 921 |
| 68 | Ga0070680_100866206 | 3300005336 | Bacteria | 779 |
| 69 | Ga0070682_100900612 | 3300005337 | Unclassified | 727 |
| 70 | Ga0070682_101072323 | 3300005337 | Bacteria | 673 |
| 71 | Ga0070682_101249949 | 3300005337 | Bacteria | 629 |
| 72 | Ga0068868_100034955 | 3300005338 | Bacteria | 3882 |
| 73 | Ga0068868_100064048 | 3300005338 | Unclassified | 2918 |
| 74 | Ga0068868_100291802 | 3300005338 | Unclassified | 1383 |
| 75 | Ga0068868_100330401 | 3300005338 | Bacteria | 1301 |
| 76 | Ga0068868_100352495 | 3300005338 | Unclassified | 1261 |
| 77 | Ga0068868_100639711 | 3300005338 | Unclassified | 946 |
| 78 | Ga0068868_100741312 | 3300005338 | Bacteria | 882 |
| 79 | Ga0068868_101181271 | 3300005338 | Unclassified | 707 |
| 80 | Ga0070660_100001092 | 3300005339 | Bacteria | 18217 |
| 81 | Ga0070660_100441529 | 3300005339 | Bacteria | 1079 |
| 82 | Ga0070689_100043202 | 3300005340 | Bacteria | 3463 |
| 83 | Ga0070689_100065174 | 3300005340 | Bacteria | 2836 |
| 84 | Ga0070689_100199760 | 3300005340 | Unclassified | 1632 |
| 85 | Ga0070689_100215050 | 3300005340 | Bacteria | 1575 |
| 86 | Ga0070689_100327105 | 3300005340 | Unclassified | 1281 |
| 87 | Ga0070689_100340128 | 3300005340 | Unclassified | 1257 |
| 88 | Ga0070689_100586620 | 3300005340 | Unclassified | 964 |
| 89 | Ga0070689_100740161 | 3300005340 | Bacteria | 861 |
| 90 | Ga0070691_10000892 | 3300005341 | Bacteria | 12096 |
| 91 | Ga0070691_10043112 | 3300005341 | Unclassified | 2137 |
| 92 | Ga0070691_10149628 | 3300005341 | Unclassified | 1196 |
| 93 | Ga0070687_100038743 | 3300005343 | Unclassified | 2391 |
| 94 | Ga0070687_100095286 | 3300005343 | Bacteria | 1655 |
| 95 | Ga0070661_100265127 | 3300005344 | Unclassified | 1329 |
| 96 | Ga0070661_100414251 | 3300005344 | Bacteria | 1067 |
| 97 | Ga0070661_100608875 | 3300005344 | Bacteria | 884 |
| 98 | Ga0070661_101372584 | 3300005344 | Unclassified | 594 |
| 99 | Ga0070692_10035812 | 3300005345 | Viruses | 2515 |
| 100 | Ga0070692_10458705 | 3300005345 | Bacteria | 817 |
| 101 | Ga0070668_100105729 | 3300005347 | Bacteria | 2236 |
| 102 | Ga0070668_100454436 | 3300005347 | Unclassified | 1102 |
| 103 | Ga0070668_100735908 | 3300005347 | Bacteria | 872 |
| 104 | Ga0070669_100003474 | 3300005353 | Bacteria | 11357 |
| 105 | Ga0070669_100031310 | 3300005353 | Viruses | 3843 |
| 106 | Ga0070669_100038193 | 3300005353 | Bacteria | 3485 |
| 107 | Ga0070669_100092083 | 3300005353 | Bacteria | 2275 |
| 108 | Ga0070669_100162925 | 3300005353 | Unclassified | 1734 |
| 109 | Ga0070669_100313428 | 3300005353 | Bacteria | 1265 |
| 110 | Ga0070669_100339396 | 3300005353 | Bacteria | 1217 |
| 111 | Ga0070669_100423022 | 3300005353 | Unclassified | 1094 |
| 112 | Ga0070669_100548837 | 3300005353 | Bacteria | 963 |
| 113 | Ga0070669_100615765 | 3300005353 | Bacteria | 911 |
| 114 | Ga0070669_100669953 | 3300005353 | Unclassified | 874 |
| 115 | Ga0070669_100678850 | 3300005353 | Unclassified | 868 |
| 116 | Ga0070675_100000433 | 3300005354 | Bacteria | 28442 |
| 117 | Ga0070675_100001643 | 3300005354 | Bacteria | 16516 |
| 118 | Ga0070675_100003018 | 3300005354 | Bacteria | 12707 |
| 119 | Ga0070675_100007486 | 3300005354 | Bacteria | 8435 |
| 120 | Ga0070675_100007803 | 3300005354 | Bacteria | 8291 |
| 121 | Ga0070675_100022727 | 3300005354 | Bacteria | 5010 |
| 122 | Ga0070675_100036669 | 3300005354 | Bacteria | 3991 |
| 123 | Ga0070675_100205743 | 3300005354 | Bacteria | 1709 |
| 124 | Ga0070675_100217685 | 3300005354 | Bacteria | 1662 |
| 125 | Ga0070675_100313845 | 3300005354 | Bacteria | 1384 |
| 126 | Ga0070675_100344667 | 3300005354 | Bacteria | 1320 |
| 127 | Ga0070675_100439608 | 3300005354 | Archaea | 1168 |
| 128 | Ga0070675_100539788 | 3300005354 | Unclassified | 1054 |
| 129 | Ga0070671_100034834 | 3300005355 | Bacteria | 4169 |
| 130 | Ga0070671_100048508 | 3300005355 | Bacteria | 3531 |
| 131 | Ga0070671_100320519 | 3300005355 | Bacteria | 1321 |
| 132 | Ga0070671_100354947 | 3300005355 | Bacteria | 1252 |
| 133 | Ga0070671_100782269 | 3300005355 | Bacteria | 830 |
| 134 | Ga0070674_100021951 | 3300005356 | Bacteria | 4110 |
| 135 | Ga0070674_100044223 | 3300005356 | Bacteria | 3035 |
| 136 | Ga0070674_100140019 | 3300005356 | Unclassified | 1815 |
| 137 | Ga0070674_100241008 | 3300005356 | Unclassified | 1416 |
| 138 | Ga0070674_100519194 | 3300005356 | Unclassified | 995 |
| 139 | Ga0070674_100674351 | 3300005356 | Bacteria | 881 |
| 140 | Ga0070674_100779800 | 3300005356 | Unclassified | 824 |
| 141 | Ga0070674_101006082 | 3300005356 | Unclassified | 732 |
| 142 | Ga0070674_101255596 | 3300005356 | Unclassified | 659 |
| 143 | Ga0070674_101265879 | 3300005356 | Unclassified | 657 |
| 144 | Ga0070674_101447295 | 3300005356 | Unclassified | 616 |
| 145 | Ga0070673_100003132 | 3300005364 | Bacteria | 10234 |
| 146 | Ga0070673_100043274 | 3300005364 | Unclassified | 3478 |
| 147 | Ga0070673_100050178 | 3300005364 | Bacteria | 3261 |
| 148 | Ga0070673_100058513 | 3300005364 | Unclassified | 3047 |
| 149 | Ga0070673_100137316 | 3300005364 | Unclassified | 2059 |
| 150 | Ga0070673_100171940 | 3300005364 | Bacteria | 1850 |
| 151 | Ga0070673_100183156 | 3300005364 | Unclassified | 1794 |
| 152 | Ga0070673_100196196 | 3300005364 | Bacteria | 1736 |
| 153 | Ga0070673_100208212 | 3300005364 | Unclassified | 1687 |
| 154 | Ga0070673_100549318 | 3300005364 | Bacteria | 1049 |
| 155 | Ga0070673_100635366 | 3300005364 | Bacteria | 976 |
| 156 | Ga0070688_100060927 | 3300005365 | Bacteria | 2384 |
| 157 | Ga0070688_100098261 | 3300005365 | Unclassified | 1925 |
| 158 | Ga0070688_100216235 | 3300005365 | Unclassified | 1348 |
| 159 | Ga0070688_100476940 | 3300005365 | Unclassified | 937 |
| 160 | Ga0070688_101083333 | 3300005365 | Unclassified | 640 |
| 161 | Ga0070659_100197547 | 3300005366 | Bacteria | 1655 |
| 162 | Ga0070667_100179209 | 3300005367 | Unclassified | 1873 |
| 163 | Ga0070667_100414741 | 3300005367 | Bacteria | 1227 |
| 164 | Ga0070667_100587289 | 3300005367 | Unclassified | 1026 |
| 165 | Ga0070709_10007316 | 3300005434 | Bacteria | 6051 |
| 166 | Ga0070709_10759539 | 3300005434 | Bacteria | 758 |
| 167 | Ga0070714_100003070 | 3300005435 | Bacteria | 12391 |
| 168 | Ga0070713_100004893 | 3300005436 | Bacteria | 9089 |
| 169 | Ga0070713_100193518 | 3300005436 | Bacteria | 1834 |
| 170 | Ga0070713_100900072 | 3300005436 | Unclassified | 851 |
| 171 | Ga0070713_101253314 | 3300005436 | Unclassified | 718 |
| 172 | Ga0070713_101716902 | 3300005436 | Unclassified | 609 |
| 173 | Ga0070701_10080120 | 3300005438 | Bacteria | 1765 |
| 174 | Ga0070701_10102714 | 3300005438 | Unclassified | 1586 |
| 175 | Ga0070705_100001404 | 3300005440 | Bacteria | 12773 |
| 176 | Ga0070705_100014875 | 3300005440 | Bacteria | 4013 |
| 177 | Ga0070705_100053659 | 3300005440 | Bacteria | 2361 |
| 178 | Ga0070705_100135726 | 3300005440 | Bacteria | 1611 |
| 179 | Ga0070700_100000788 | 3300005441 | Bacteria | 15603 |
| 180 | Ga0070700_100006082 | 3300005441 | Bacteria | 6427 |
| 181 | Ga0070700_100059550 | 3300005441 | Unclassified | 2404 |
| 182 | Ga0070700_100068953 | 3300005441 | Unclassified | 2250 |
| 183 | Ga0070700_100274394 | 3300005441 | Bacteria | 1220 |
| 184 | Ga0070700_100906779 | 3300005441 | Bacteria | 718 |
| 185 | Ga0070694_100002894 | 3300005444 | Bacteria | 10201 |
| 186 | Ga0070694_100005858 | 3300005444 | Bacteria | 7456 |
| 187 | Ga0070694_100007026 | 3300005444 | Bacteria | 6848 |
| 188 | Ga0070694_100172110 | 3300005444 | Bacteria | 1596 |
| 189 | Ga0070694_100379711 | 3300005444 | Bacteria | 1102 |
| 190 | Ga0070694_100502706 | 3300005444 | Unclassified | 965 |
| 191 | Ga0070694_100802159 | 3300005444 | Bacteria | 772 |
| 192 | Ga0070708_100032111 | 3300005445 | Bacteria | 4551 |
| 193 | Ga0070708_100519664 | 3300005445 | Bacteria | 1123 |
| 194 | Ga0070708_100607625 | 3300005445 | Unclassified | 1031 |
| 195 | Ga0070708_100868844 | 3300005445 | Bacteria | 847 |
| 196 | Ga0070663_100037019 | 3300005455 | Bacteria | 3394 |
| 197 | Ga0070663_100878596 | 3300005455 | Unclassified | 773 |
| 198 | Ga0070678_100109353 | 3300005456 | Bacteria | 2159 |
| 199 | Ga0070678_100116947 | 3300005456 | Bacteria | 2096 |
| 200 | Ga0070678_100130775 | 3300005456 | Bacteria | 1994 |
| 201 | Ga0070678_100140021 | 3300005456 | Bacteria | 1935 |
| 202 | Ga0070678_100494754 | 3300005456 | Unclassified | 1078 |
| 203 | Ga0070678_100653885 | 3300005456 | Unclassified | 943 |
| 204 | Ga0070678_100709470 | 3300005456 | Bacteria | 907 |
| 205 | Ga0070662_100073576 | 3300005457 | Bacteria | 2525 |
| 206 | Ga0070662_100203340 | 3300005457 | Unclassified | 1573 |
| 207 | Ga0070662_100380504 | 3300005457 | Bacteria | 1162 |
| 208 | Ga0070662_100593270 | 3300005457 | Unclassified | 931 |
| 209 | Ga0070662_100874882 | 3300005457 | Unclassified | 766 |
| 210 | Ga0070662_101063022 | 3300005457 | Bacteria | 694 |
| 211 | Ga0070681_10386081 | 3300005458 | Bacteria | 1311 |
| 212 | Ga0070681_11157304 | 3300005458 | Bacteria | 695 |
| 213 | Ga0068867_100000380 | 3300005459 | Bacteria | 29556 |
| 214 | Ga0068867_100115369 | 3300005459 | Bacteria | 2069 |
| 215 | Ga0068867_100138704 | 3300005459 | Bacteria | 1898 |
| 216 | Ga0068867_100139519 | 3300005459 | Unclassified | 1893 |
| 217 | Ga0068867_100686917 | 3300005459 | Bacteria | 902 |
| 218 | Ga0068867_100709371 | 3300005459 | Bacteria | 888 |
| 219 | Ga0068867_100713581 | 3300005459 | Unclassified | 886 |
| 220 | Ga0068867_100944408 | 3300005459 | Unclassified | 779 |
| 221 | Ga0068867_101063118 | 3300005459 | Bacteria | 737 |
| 222 | Ga0068867_101672557 | 3300005459 | Bacteria | 596 |
| 223 | Ga0068867_101710127 | 3300005459 | Unclassified | 590 |
| 224 | Ga0070685_10047159 | 3300005466 | Bacteria | 2477 |
| 225 | Ga0070685_10050222 | 3300005466 | Unclassified | 2409 |
| 226 | Ga0070685_10106243 | 3300005466 | Bacteria | 1722 |
| 227 | Ga0070685_10197670 | 3300005466 | Unclassified | 1305 |
| 228 | Ga0070685_10545954 | 3300005466 | Unclassified | 826 |
| 229 | Ga0070706_100186401 | 3300005467 | Bacteria | 1939 |
| 230 | Ga0070706_100236430 | 3300005467 | Bacteria | 1706 |
| 231 | Ga0070706_100286210 | 3300005467 | Bacteria | 1538 |
| 232 | Ga0070706_100774035 | 3300005467 | Bacteria | 889 |
| 233 | Ga0070706_101121435 | 3300005467 | Unclassified | 724 |
| 234 | Ga0070706_101226546 | 3300005467 | Unclassified | 689 |
| 235 | Ga0070707_100442076 | 3300005468 | Bacteria | 1261 |
| 236 | Ga0070707_100657285 | 3300005468 | Bacteria | 1011 |
| 237 | Ga0070707_101094705 | 3300005468 | Unclassified | 763 |
| 238 | Ga0070707_101286300 | 3300005468 | Unclassified | 698 |
| 239 | Ga0070698_100003115 | 3300005471 | Bacteria | 18284 |
| 240 | Ga0070698_100006640 | 3300005471 | Bacteria | 12545 |
| 241 | Ga0070698_100011223 | 3300005471 | Bacteria | 9517 |
| 242 | Ga0070698_100072413 | 3300005471 | Bacteria | 3454 |
| 243 | Ga0070698_100138182 | 3300005471 | Unclassified | 2390 |
| 244 | Ga0070698_100394572 | 3300005471 | Bacteria | 1317 |
| 245 | Ga0070699_100003719 | 3300005518 | Bacteria | 13483 |
| 246 | Ga0070699_100006814 | 3300005518 | Bacteria | 9942 |
| 247 | Ga0070699_100100290 | 3300005518 | Bacteria | 2538 |
| 248 | Ga0070699_100123199 | 3300005518 | Unclassified | 2281 |
| 249 | Ga0070679_100010050 | 3300005530 | Bacteria | 8963 |
| 250 | Ga0070679_100127817 | 3300005530 | Unclassified | 2523 |
| 251 | Ga0070679_100548131 | 3300005530 | Bacteria | 1100 |
| 252 | Ga0070679_100776591 | 3300005530 | Unclassified | 901 |
| 253 | Ga0070684_100076110 | 3300005535 | Bacteria | 2962 |
| 254 | Ga0070684_100179696 | 3300005535 | Bacteria | 1924 |
| 255 | Ga0070684_100519127 | 3300005535 | Bacteria | 1104 |
| 256 | Ga0070684_101199138 | 3300005535 | Bacteria | 714 |
| 257 | Ga0068853_100611029 | 3300005539 | Unclassified | 1036 |
| 258 | Ga0070672_100004404 | 3300005543 | Bacteria | 9223 |
| 259 | Ga0070672_100005217 | 3300005543 | Bacteria | 8597 |
| 260 | Ga0070672_100062004 | 3300005543 | Bacteria | 2950 |
| 261 | Ga0070672_100157158 | 3300005543 | Unclassified | 1884 |
| 262 | Ga0070672_100196808 | 3300005543 | Bacteria | 1684 |
| 263 | Ga0070672_100213036 | 3300005543 | Unclassified | 1618 |
| 264 | Ga0070672_100617737 | 3300005543 | Bacteria | 945 |
| 265 | Ga0070672_100692814 | 3300005543 | Bacteria | 892 |
| 266 | Ga0070672_100729197 | 3300005543 | Unclassified | 869 |
| 267 | Ga0070672_101137246 | 3300005543 | Unclassified | 694 |
| 268 | Ga0070686_100000153 | 3300005544 | Bacteria | 47434 |
| 269 | Ga0070686_100030299 | 3300005544 | Unclassified | 3299 |
| 270 | Ga0070686_100084274 | 3300005544 | Bacteria | 2111 |
| 271 | Ga0070686_100188159 | 3300005544 | Bacteria | 1472 |
| 272 | Ga0070686_100218647 | 3300005544 | Bacteria | 1376 |
| 273 | Ga0070686_100313655 | 3300005544 | Unclassified | 1167 |
| 274 | Ga0070686_100375621 | 3300005544 | Unclassified | 1075 |
| 275 | Ga0070686_100537386 | 3300005544 | Unclassified | 912 |
| 276 | Ga0070695_100016291 | 3300005545 | Bacteria | 4496 |
| 277 | Ga0070695_100027664 | 3300005545 | Bacteria | 3515 |
| 278 | Ga0070695_100170257 | 3300005545 | Bacteria | 1536 |
| 279 | Ga0070695_100502552 | 3300005545 | Unclassified | 938 |
| 280 | Ga0070695_100826694 | 3300005545 | Unclassified | 744 |
| 281 | Ga0070695_100954808 | 3300005545 | Unclassified | 695 |
| 282 | Ga0070696_100018169 | 3300005546 | Bacteria | 4750 |
| 283 | Ga0070696_100039612 | 3300005546 | Bacteria | 3253 |
| 284 | Ga0070696_100112265 | 3300005546 | Unclassified | 1964 |
| 285 | Ga0070696_100552454 | 3300005546 | Unclassified | 923 |
| 286 | Ga0070696_100587157 | 3300005546 | Bacteria | 897 |
| 287 | Ga0070693_100169522 | 3300005547 | Bacteria | 1397 |
| 288 | Ga0070693_100720868 | 3300005547 | Bacteria | 732 |
| 289 | Ga0070693_100759909 | 3300005547 | Unclassified | 715 |
| 290 | Ga0070693_100836877 | 3300005547 | Unclassified | 685 |
| 291 | Ga0070665_100002502 | 3300005548 | Bacteria | 20209 |
| 292 | Ga0070665_100010631 | 3300005548 | Bacteria | 9316 |
| 293 | Ga0070665_100020086 | 3300005548 | Bacteria | 6706 |
| 294 | Ga0070665_100078682 | 3300005548 | Bacteria | 3304 |
| 295 | Ga0070665_100195381 | 3300005548 | Unclassified | 2024 |
| 296 | Ga0070665_100950167 | 3300005548 | Unclassified | 872 |
| 297 | Ga0070704_100000089 | 3300005549 | Bacteria | 31704 |
| 298 | Ga0070704_100026609 | 3300005549 | Unclassified | 3825 |
| 299 | Ga0070704_100032604 | 3300005549 | Unclassified | 3516 |
| 300 | Ga0070704_100074989 | 3300005549 | Bacteria | 2469 |
| 301 | Ga0070704_100134456 | 3300005549 | Bacteria | 1922 |
| 302 | Ga0070704_100631855 | 3300005549 | Unclassified | 944 |
| 303 | Ga0070704_100700314 | 3300005549 | Unclassified | 898 |
| 304 | Ga0070704_101267826 | 3300005549 | Unclassified | 674 |
| 305 | Ga0070704_101301510 | 3300005549 | Unclassified | 665 |
| 306 | Ga0068855_100020680 | 3300005563 | Bacteria | 7892 |
| 307 | Ga0068855_100238478 | 3300005563 | Bacteria | 2033 |
| 308 | Ga0068855_100450881 | 3300005563 | Unclassified | 1404 |
| 309 | Ga0068855_100492643 | 3300005563 | Unclassified | 1333 |
| 310 | Ga0068855_100652639 | 3300005563 | Bacteria | 1130 |
| 311 | Ga0068855_100798835 | 3300005563 | Bacteria | 1003 |
| 312 | Ga0070664_100009603 | 3300005564 | Bacteria | 7847 |
| 313 | Ga0070664_100097790 | 3300005564 | Bacteria | 2549 |
| 314 | Ga0070664_100236671 | 3300005564 | Bacteria | 1638 |
| 315 | Ga0070664_100346288 | 3300005564 | Unclassified | 1351 |
| 316 | Ga0068857_100136211 | 3300005577 | Unclassified | 2217 |
| 317 | Ga0068857_100358762 | 3300005577 | Bacteria | 1351 |
| 318 | Ga0068857_100522165 | 3300005577 | Bacteria | 1116 |
| 319 | Ga0068857_100639122 | 3300005577 | Bacteria | 1008 |
| 320 | Ga0068854_100163499 | 3300005578 | Unclassified | 1726 |
| 321 | Ga0068854_101120050 | 3300005578 | Unclassified | 702 |
| 322 | Ga0068856_101833176 | 3300005614 | Bacteria | 618 |
| 323 | Ga0068856_101950599 | 3300005614 | Unclassified | 598 |
| 324 | Ga0070702_100003228 | 3300005615 | Bacteria | 7254 |
| 325 | Ga0070702_100053993 | 3300005615 | Unclassified | 2310 |
| 326 | Ga0070702_100357397 | 3300005615 | Unclassified | 1031 |
| 327 | Ga0070702_100962764 | 3300005615 | Bacteria | 673 |
| 328 | Ga0068852_100377942 | 3300005616 | Bacteria | 1389 |
| 329 | Ga0068852_100746608 | 3300005616 | Bacteria | 991 |
| 330 | Ga0068852_101897063 | 3300005616 | Unclassified | 618 |
| 331 | Ga0068859_100025246 | 3300005617 | Bacteria | 5963 |
| 332 | Ga0068859_100137975 | 3300005617 | Bacteria | 2512 |
| 333 | Ga0068859_100191448 | 3300005617 | Unclassified | 2130 |
| 334 | Ga0068859_100208366 | 3300005617 | Bacteria | 2041 |
| 335 | Ga0068859_100504379 | 3300005617 | Bacteria | 1305 |
| 336 | Ga0068859_100506815 | 3300005617 | Bacteria | 1302 |
| 337 | Ga0068859_100714266 | 3300005617 | Unclassified | 1092 |
| 338 | Ga0068859_100759169 | 3300005617 | Bacteria | 1059 |
| 339 | Ga0068859_101723599 | 3300005617 | Unclassified | 692 |
| 340 | Ga0068864_100002939 | 3300005618 | Bacteria | 14090 |
| 341 | Ga0068864_100099244 | 3300005618 | Unclassified | 2579 |
| 342 | Ga0068864_100201604 | 3300005618 | Viruses | 1828 |
| 343 | Ga0068864_100207644 | 3300005618 | Unclassified | 1802 |
| 344 | Ga0068864_100234303 | 3300005618 | Bacteria | 1699 |
| 345 | Ga0068864_100234644 | 3300005618 | Bacteria | 1698 |
| 346 | Ga0068864_100313810 | 3300005618 | Unclassified | 1471 |
| 347 | Ga0068864_100391631 | 3300005618 | Unclassified | 1319 |
| 348 | Ga0068864_100975212 | 3300005618 | Bacteria | 840 |
| 349 | Ga0068866_10009441 | 3300005718 | Bacteria | 4142 |
| 350 | Ga0068866_10024941 | 3300005718 | Unclassified | 2805 |
| 351 | Ga0068866_10084161 | 3300005718 | Unclassified | 1716 |
| 352 | Ga0068866_10085221 | 3300005718 | Bacteria | 1707 |
| 353 | Ga0068861_100010565 | 3300005719 | Bacteria | 6410 |
| 354 | Ga0068861_100079028 | 3300005719 | Viruses | 2571 |
| 355 | Ga0068861_100091306 | 3300005719 | Unclassified | 2404 |
| 356 | Ga0068861_100093769 | 3300005719 | Bacteria | 2374 |
| 357 | Ga0068861_100129925 | 3300005719 | Bacteria | 2044 |
| 358 | Ga0068861_100164360 | 3300005719 | Unclassified | 1834 |
| 359 | Ga0068861_100253110 | 3300005719 | Bacteria | 1504 |
| 360 | Ga0068861_100488257 | 3300005719 | Unclassified | 1111 |
| 361 | Ga0068861_100823788 | 3300005719 | Unclassified | 873 |
| 362 | Ga0068861_101454819 | 3300005719 | Unclassified | 671 |
| 363 | Ga0068851_10033637 | 3300005834 | Bacteria | 2556 |
| 364 | Ga0068851_10150437 | 3300005834 | Unclassified | 1272 |
| 365 | Ga0068870_10002891 | 3300005840 | Bacteria | 7236 |
| 366 | Ga0068870_10032435 | 3300005840 | Bacteria | 2656 |
| 367 | Ga0068870_10034344 | 3300005840 | Bacteria | 2595 |
| 368 | Ga0068870_10234070 | 3300005840 | Bacteria | 1131 |
| 369 | Ga0068870_10616965 | 3300005840 | Bacteria | 739 |
| 370 | Ga0068863_100062464 | 3300005841 | Bacteria | 3523 |
| 371 | Ga0068863_100143458 | 3300005841 | Unclassified | 2283 |
| 372 | Ga0068863_100184236 | 3300005841 | Bacteria | 2005 |
| 373 | Ga0068863_100199173 | 3300005841 | Unclassified | 1926 |
| 374 | Ga0068863_100300972 | 3300005841 | Bacteria | 1556 |
| 375 | Ga0068863_100313525 | 3300005841 | Unclassified | 1523 |
| 376 | Ga0068863_100650258 | 3300005841 | Unclassified | 1046 |
| 377 | Ga0068863_101144537 | 3300005841 | Unclassified | 783 |
| 378 | Ga0068858_100003255 | 3300005842 | Bacteria | 16182 |
| 379 | Ga0068858_100017044 | 3300005842 | Bacteria | 6819 |
| 380 | Ga0068858_100039216 | 3300005842 | Bacteria | 4393 |
| 381 | Ga0068858_100075256 | 3300005842 | Bacteria | 3136 |
| 382 | Ga0068858_100130019 | 3300005842 | Bacteria | 2360 |
| 383 | Ga0068858_100206865 | 3300005842 | Bacteria | 1857 |
| 384 | Ga0068858_100559154 | 3300005842 | Unclassified | 1108 |
| 385 | Ga0068858_101037450 | 3300005842 | Unclassified | 804 |
| 386 | Ga0068860_100017193 | 3300005843 | Bacteria | 7050 |
| 387 | Ga0068860_100034523 | 3300005843 | Unclassified | 4852 |
| 388 | Ga0068860_100219487 | 3300005843 | Bacteria | 1846 |
| 389 | Ga0068860_100271636 | 3300005843 | Unclassified | 1655 |
| 390 | Ga0068860_100347516 | 3300005843 | Bacteria | 1459 |
| 391 | Ga0068860_100354361 | 3300005843 | Unclassified | 1445 |
| 392 | Ga0068860_100356221 | 3300005843 | Unclassified | 1441 |
| 393 | Ga0068860_100392211 | 3300005843 | Bacteria | 1372 |
| 394 | Ga0068862_100021517 | 3300005844 | Bacteria | 5389 |
| 395 | Ga0068862_100024869 | 3300005844 | Bacteria | 5025 |
| 396 | Ga0068862_100040092 | 3300005844 | Unclassified | 3980 |
| 397 | Ga0068862_100053094 | 3300005844 | Bacteria | 3469 |
| 398 | Ga0068862_100260760 | 3300005844 | Bacteria | 1582 |
| 399 | Ga0068862_100384271 | 3300005844 | Bacteria | 1310 |
| 400 | Ga0068862_100429973 | 3300005844 | Bacteria | 1241 |
| 401 | Ga0068862_100594903 | 3300005844 | Bacteria | 1061 |
| 402 | Ga0068862_100636813 | 3300005844 | Unclassified | 1027 |
| 403 | Ga0068862_100657343 | 3300005844 | Bacteria | 1011 |
| 404 | Ga0068862_100746979 | 3300005844 | Unclassified | 951 |
| 405 | Ga0081455_10008971 | 3300005937 | Bacteria | 10330 |
| 406 | Ga0081455_10047875 | 3300005937 | Bacteria | 3698 |
| 407 | Ga0081539_10002012 | 3300005985 | Bacteria | 30795 |
| 408 | Ga0070717_11361300 | 3300006028 | Bacteria | 645 |
| 409 | Ga0075365_10059942 | 3300006038 | Bacteria | 2538 |
| 410 | Ga0070715_10045399 | 3300006163 | Unclassified | 1863 |
| 411 | Ga0070715_10059729 | 3300006163 | Unclassified | 1669 |
| 412 | Ga0070715_10370458 | 3300006163 | Bacteria | 788 |
| 413 | Ga0070716_100007561 | 3300006173 | Bacteria | 5360 |
| 414 | Ga0070716_100112531 | 3300006173 | Bacteria | 1690 |
| 415 | Ga0070716_100520649 | 3300006173 | Bacteria | 881 |
| 416 | Ga0070716_100865244 | 3300006173 | Unclassified | 705 |
| 417 | Ga0070712_100031176 | 3300006175 | Bacteria | 3590 |
| 418 | Ga0070712_100416201 | 3300006175 | Unclassified | 1113 |
| 419 | Ga0097621_100000125 | 3300006237 | Bacteria | 44370 |
| 420 | Ga0097621_100014893 | 3300006237 | Bacteria | 5835 |
| 421 | Ga0097621_100017310 | 3300006237 | Bacteria | 5470 |
| 422 | Ga0097621_100039658 | 3300006237 | Bacteria | 3784 |
| 423 | Ga0097621_100069253 | 3300006237 | Bacteria | 2913 |
| 424 | Ga0097621_100113414 | 3300006237 | Unclassified | 2293 |
| 425 | Ga0097621_100126207 | 3300006237 | Bacteria | 2174 |
| 426 | Ga0097621_100378715 | 3300006237 | Bacteria | 1263 |
| 427 | Ga0097621_100616551 | 3300006237 | Bacteria | 993 |
| 428 | Ga0097621_100643048 | 3300006237 | Unclassified | 973 |
| 429 | Ga0097621_100724582 | 3300006237 | Unclassified | 917 |
| 430 | Ga0097621_101182064 | 3300006237 | Unclassified | 720 |
| 431 | Ga0068871_100000134 | 3300006358 | Bacteria | 47412 |
| 432 | Ga0068871_100005587 | 3300006358 | Bacteria | 8816 |
| 433 | Ga0068871_100039886 | 3300006358 | Unclassified | 3759 |
| 434 | Ga0068871_100063808 | 3300006358 | Bacteria | 3014 |
| 435 | Ga0068871_100069169 | 3300006358 | Bacteria | 2899 |
| 436 | Ga0068871_100077391 | 3300006358 | Bacteria | 2749 |
| 437 | Ga0068871_100146031 | 3300006358 | Unclassified | 2014 |
| 438 | Ga0068871_100149927 | 3300006358 | Bacteria | 1988 |
| 439 | Ga0068871_100193434 | 3300006358 | Bacteria | 1753 |
| 440 | Ga0068871_100291605 | 3300006358 | Bacteria | 1430 |
| 441 | Ga0068871_100497971 | 3300006358 | Bacteria | 1098 |
| 442 | Ga0068871_100649783 | 3300006358 | Bacteria | 963 |
| 443 | Ga0068871_100695008 | 3300006358 | Unclassified | 931 |
| 444 | Ga0075428_100000497 | 3300006844 | Bacteria | 39844 |
| 445 | Ga0075428_100006846 | 3300006844 | Bacteria | 12668 |
| 446 | Ga0075428_100009506 | 3300006844 | Bacteria | 10796 |
| 447 | Ga0075428_100026808 | 3300006844 | Bacteria | 6380 |
| 448 | Ga0075428_100031650 | 3300006844 | Bacteria | 5845 |
| 449 | Ga0075428_100057506 | 3300006844 | Bacteria | 4257 |
| 450 | Ga0075428_100089732 | 3300006844 | Bacteria | 3352 |
| 451 | Ga0075428_100121569 | 3300006844 | Unclassified | 2843 |
| 452 | Ga0075428_100245232 | 3300006844 | Bacteria | 1932 |
| 453 | Ga0075428_100310045 | 3300006844 | Bacteria | 1696 |
| 454 | Ga0075428_100429732 | 3300006844 | Unclassified | 1415 |
| 455 | Ga0075428_100602931 | 3300006844 | Bacteria | 1173 |
| 456 | Ga0075428_101084827 | 3300006844 | Bacteria | 846 |
| 457 | Ga0075428_101635840 | 3300006844 | Bacteria | 673 |
| 458 | Ga0075430_100001681 | 3300006846 | Bacteria | 18091 |
| 459 | Ga0075430_100002096 | 3300006846 | Bacteria | 16500 |
| 460 | Ga0075430_100013822 | 3300006846 | Bacteria | 6877 |
| 461 | Ga0075430_100019140 | 3300006846 | Bacteria | 5823 |
| 462 | Ga0075430_100025839 | 3300006846 | Bacteria | 4997 |
| 463 | Ga0075430_100028057 | 3300006846 | Bacteria | 4782 |
| 464 | Ga0075430_100054894 | 3300006846 | Unclassified | 3351 |
| 465 | Ga0075431_100001219 | 3300006847 | Bacteria | 23281 |
| 466 | Ga0075431_100003323 | 3300006847 | Bacteria | 15578 |
| 467 | Ga0075431_100023672 | 3300006847 | Bacteria | 6287 |
| 468 | Ga0075431_100069493 | 3300006847 | Unclassified | 3633 |
| 469 | Ga0075431_100079466 | 3300006847 | Bacteria | 3385 |
| 470 | Ga0075431_100199916 | 3300006847 | Bacteria | 2045 |
| 471 | Ga0075431_100215703 | 3300006847 | Bacteria | 1959 |
| 472 | Ga0075431_100241070 | 3300006847 | Bacteria | 1839 |
| 473 | Ga0075431_100486414 | 3300006847 | Unclassified | 1226 |
| 474 | Ga0075431_100830336 | 3300006847 | Bacteria | 896 |
| 475 | Ga0075433_10000157 | 3300006852 | Bacteria | 36577 |
| 476 | Ga0075433_10116506 | 3300006852 | Bacteria | 2370 |
| 477 | Ga0075433_10146790 | 3300006852 | Bacteria | 2097 |
| 478 | Ga0075433_10177266 | 3300006852 | Unclassified | 1896 |
| 479 | Ga0075433_10323195 | 3300006852 | Bacteria | 1365 |
| 480 | Ga0075433_10336636 | 3300006852 | Unclassified | 1334 |
| 481 | Ga0075433_10467641 | 3300006852 | Bacteria | 1111 |
| 482 | Ga0075433_10615587 | 3300006852 | Unclassified | 953 |
| 483 | Ga0075433_10789605 | 3300006852 | Bacteria | 830 |
| 484 | Ga0075433_10835721 | 3300006852 | Bacteria | 804 |
| 485 | Ga0075433_11039815 | 3300006852 | Unclassified | 713 |
| 486 | Ga0075433_11078459 | 3300006852 | Bacteria | 699 |
| 487 | Ga0075434_100002504 | 3300006871 | Bacteria | 16204 |
| 488 | Ga0075434_100005743 | 3300006871 | Bacteria | 11328 |
| 489 | Ga0075434_100006773 | 3300006871 | Bacteria | 10532 |
| 490 | Ga0075434_100011771 | 3300006871 | Bacteria | 8264 |
| 491 | Ga0075434_100017244 | 3300006871 | Bacteria | 6954 |
| 492 | Ga0075434_100029295 | 3300006871 | Bacteria | 5414 |
| 493 | Ga0075434_100065080 | 3300006871 | Unclassified | 3631 |
| 494 | Ga0075434_100082673 | 3300006871 | Bacteria | 3209 |
| 495 | Ga0075434_100151742 | 3300006871 | Bacteria | 2337 |
| 496 | Ga0075434_100192229 | 3300006871 | Bacteria | 2061 |
| 497 | Ga0075434_100302147 | 3300006871 | Bacteria | 1621 |
| 498 | Ga0075434_100453363 | 3300006871 | Bacteria | 1304 |
| 499 | Ga0075434_100476073 | 3300006871 | Bacteria | 1270 |
| 500 | Ga0075434_100489240 | 3300006871 | Bacteria | 1251 |
| 501 | Ga0075434_100524690 | 3300006871 | Unclassified | 1205 |
| 502 | Ga0075429_100004479 | 3300006880 | Bacteria | 12017 |
| 503 | Ga0075429_100005139 | 3300006880 | Bacteria | 11253 |
| 504 | Ga0075429_100008026 | 3300006880 | Bacteria | 9173 |
| 505 | Ga0075429_100019963 | 3300006880 | Bacteria | 5812 |
| 506 | Ga0075429_100096081 | 3300006880 | Bacteria | 2584 |
| 507 | Ga0075429_100122343 | 3300006880 | Unclassified | 2275 |
| 508 | Ga0075429_100126374 | 3300006880 | Bacteria | 2236 |
| 509 | Ga0075429_100239199 | 3300006880 | Unclassified | 1590 |
| 510 | Ga0075429_100266863 | 3300006880 | Bacteria | 1499 |
| 511 | Ga0075429_100314822 | 3300006880 | Bacteria | 1370 |
| 512 | Ga0075429_100319622 | 3300006880 | Unclassified | 1359 |
| 513 | Ga0068865_100002757 | 3300006881 | Bacteria | 10443 |
| 514 | Ga0068865_100030248 | 3300006881 | Bacteria | 3601 |
| 515 | Ga0068865_100076131 | 3300006881 | Bacteria | 2394 |
| 516 | Ga0068865_100145708 | 3300006881 | Bacteria | 1791 |
| 517 | Ga0068865_100189475 | 3300006881 | Unclassified | 1589 |
| 518 | Ga0068865_100576003 | 3300006881 | Unclassified | 948 |
| 519 | Ga0068865_100760792 | 3300006881 | Unclassified | 833 |
| 520 | Ga0068865_100834735 | 3300006881 | Bacteria | 797 |
| 521 | Ga0075436_100004813 | 3300006914 | Bacteria | 9275 |
| 522 | Ga0075436_100017704 | 3300006914 | Bacteria | 4877 |
| 523 | Ga0075436_100017749 | 3300006914 | Bacteria | 4872 |
| 524 | Ga0075436_100084710 | 3300006914 | Unclassified | 2200 |
| 525 | Ga0075436_100104286 | 3300006914 | Unclassified | 1976 |
| 526 | Ga0075436_100132881 | 3300006914 | Bacteria | 1746 |
| 527 | Ga0075436_100241247 | 3300006914 | Bacteria | 1285 |
| 528 | Ga0097620_100025246 | 3300006931 | Bacteria | 5963 |
| 529 | Ga0097620_100137972 | 3300006931 | Bacteria | 2512 |
| 530 | Ga0097620_100191442 | 3300006931 | Unclassified | 2130 |
| 531 | Ga0097620_100208383 | 3300006931 | Bacteria | 2041 |
| 532 | Ga0097620_100504446 | 3300006931 | Bacteria | 1305 |
| 533 | Ga0097620_100506803 | 3300006931 | Bacteria | 1302 |
| 534 | Ga0097620_100714267 | 3300006931 | Unclassified | 1092 |
| 535 | Ga0097620_100759135 | 3300006931 | Bacteria | 1059 |
| 536 | Ga0097620_100837173 | 3300006931 | Bacteria | 1006 |
| 537 | Ga0097620_101723800 | 3300006931 | Unclassified | 692 |
| 538 | Ga0075435_100000204 | 3300007076 | Bacteria | 35933 |
| 539 | Ga0075435_100007928 | 3300007076 | Bacteria | 7601 |
| 540 | Ga0075435_100015754 | 3300007076 | Bacteria | 5688 |
| 541 | Ga0075435_100027042 | 3300007076 | Bacteria | 4484 |
| 542 | Ga0075435_100065934 | 3300007076 | Bacteria | 2944 |
| 543 | Ga0075435_100177038 | 3300007076 | Bacteria | 1801 |
| 544 | Ga0075435_100212697 | 3300007076 | Bacteria | 1641 |
| 545 | Ga0075435_100310333 | 3300007076 | Bacteria | 1350 |
| 546 | Ga0075435_100494082 | 3300007076 | Bacteria | 1058 |
| 547 | Ga0075435_100509157 | 3300007076 | Bacteria | 1041 |
| 548 | Ga0105251_10096311 | 3300009011 | Bacteria | 1356 |
| 549 | Ga0105244_10445466 | 3300009036 | Unclassified | 596 |
| 550 | Ga0105240_10037691 | 3300009093 | Bacteria | 6211 |
| 551 | Ga0105240_10170233 | 3300009093 | Bacteria | 2581 |
| 552 | Ga0105240_10311990 | 3300009093 | Unclassified | 1796 |
| 553 | Ga0105240_10450127 | 3300009093 | Unclassified | 1441 |
| 554 | Ga0105240_10794797 | 3300009093 | Bacteria | 1025 |
| 555 | Ga0105240_11465595 | 3300009093 | Unclassified | 716 |
| 556 | Ga0111539_10000014 | 3300009094 | Bacteria | 307501 |
| 557 | Ga0111539_10000134 | 3300009094 | Bacteria | 84765 |
| 558 | Ga0111539_10001078 | 3300009094 | Bacteria | 36028 |
| 559 | Ga0111539_10002632 | 3300009094 | Bacteria | 23770 |
| 560 | Ga0111539_10004027 | 3300009094 | Bacteria | 19292 |
| 561 | Ga0111539_10010143 | 3300009094 | Bacteria | 11870 |
| 562 | Ga0111539_10015933 | 3300009094 | Bacteria | 9339 |
| 563 | Ga0111539_10018505 | 3300009094 | Bacteria | 8629 |
| 564 | Ga0111539_10066788 | 3300009094 | Bacteria | 4248 |
| 565 | Ga0111539_10097678 | 3300009094 | Bacteria | 3450 |
| 566 | Ga0111539_10187478 | 3300009094 | Bacteria | 2415 |
| 567 | Ga0111539_10291782 | 3300009094 | Unclassified | 1898 |
| 568 | Ga0111539_10321189 | 3300009094 | Bacteria | 1802 |
| 569 | Ga0111539_10426199 | 3300009094 | Bacteria | 1545 |
| 570 | Ga0111539_10510089 | 3300009094 | Bacteria | 1401 |
| 571 | Ga0111539_10661077 | 3300009094 | Bacteria | 1217 |
| 572 | Ga0111539_10806024 | 3300009094 | Bacteria | 1093 |
| 573 | Ga0111539_11242735 | 3300009094 | Unclassified | 865 |
| 574 | Ga0111539_11566589 | 3300009094 | Unclassified | 764 |
| 575 | Ga0105245_10018654 | 3300009098 | Bacteria | 6068 |
| 576 | Ga0105245_10046562 | 3300009098 | Bacteria | 3876 |
| 577 | Ga0105245_10266120 | 3300009098 | Bacteria | 1670 |
| 578 | Ga0105245_10518549 | 3300009098 | Bacteria | 1210 |
| 579 | Ga0105245_10832324 | 3300009098 | Unclassified | 962 |
| 580 | Ga0105245_11922539 | 3300009098 | Unclassified | 645 |
| 581 | Ga0105247_10058133 | 3300009101 | Bacteria | 2392 |
| 582 | Ga0105247_10159725 | 3300009101 | Bacteria | 1491 |
| 583 | Ga0105247_10271953 | 3300009101 | Bacteria | 1166 |
| 584 | Ga0114129_10000426 | 3300009147 | Bacteria | 50026 |
| 585 | Ga0114129_10001213 | 3300009147 | Bacteria | 34237 |
| 586 | Ga0114129_10004137 | 3300009147 | Bacteria | 20495 |
| 587 | Ga0114129_10009181 | 3300009147 | Bacteria | 14099 |
| 588 | Ga0114129_10009385 | 3300009147 | Bacteria | 13946 |
| 589 | Ga0114129_10011201 | 3300009147 | Bacteria | 12784 |
| 590 | Ga0114129_10016744 | 3300009147 | Bacteria | 10441 |
| 591 | Ga0114129_10016919 | 3300009147 | Bacteria | 10383 |
| 592 | Ga0114129_10029055 | 3300009147 | Bacteria | 7831 |
| 593 | Ga0114129_10048963 | 3300009147 | Bacteria | 5939 |
| 594 | Ga0114129_10051960 | 3300009147 | Bacteria | 5753 |
| 595 | Ga0114129_10057730 | 3300009147 | Bacteria | 5430 |
| 596 | Ga0114129_10064329 | 3300009147 | Bacteria | 5118 |
| 597 | Ga0114129_10067793 | 3300009147 | Bacteria | 4975 |
| 598 | Ga0114129_10072643 | 3300009147 | Bacteria | 4795 |
| 599 | Ga0114129_10073868 | 3300009147 | Bacteria | 4750 |
| 600 | Ga0114129_10095042 | 3300009147 | Unclassified | 4128 |
| 601 | Ga0114129_10109022 | 3300009147 | Bacteria | 3822 |
| 602 | Ga0114129_10143188 | 3300009147 | Bacteria | 3276 |
| 603 | Ga0114129_10295970 | 3300009147 | Bacteria | 2159 |
| 604 | Ga0114129_10566980 | 3300009147 | Bacteria | 1475 |
| 605 | Ga0114129_11160523 | 3300009147 | Bacteria | 964 |
| 606 | Ga0114129_11692215 | 3300009147 | Unclassified | 772 |
| 607 | Ga0114129_12487459 | 3300009147 | Unclassified | 619 |
| 608 | Ga0114129_12703291 | 3300009147 | Unclassified | 591 |
| 609 | Ga0105243_10006934 | 3300009148 | Bacteria | 8724 |
| 610 | Ga0105243_10010791 | 3300009148 | Bacteria | 6914 |
| 611 | Ga0105243_10089689 | 3300009148 | Bacteria | 2529 |
| 612 | Ga0105243_10175709 | 3300009148 | Bacteria | 1858 |
| 613 | Ga0105243_10506248 | 3300009148 | Bacteria | 1145 |
| 614 | Ga0105243_10771100 | 3300009148 | Unclassified | 945 |
| 615 | Ga0105243_10923197 | 3300009148 | Unclassified | 870 |
| 616 | Ga0105243_11471236 | 3300009148 | Bacteria | 704 |
| 617 | Ga0105243_11608999 | 3300009148 | Unclassified | 676 |
| 618 | Ga0105241_10026107 | 3300009174 | Bacteria | 4345 |
| 619 | Ga0105241_10568860 | 3300009174 | Bacteria | 1020 |
| 620 | Ga0105241_11039566 | 3300009174 | Bacteria | 768 |
| 621 | Ga0105241_11892246 | 3300009174 | Unclassified | 584 |
| 622 | Ga0105242_10022412 | 3300009176 | Bacteria | 4966 |
| 623 | Ga0105242_10026817 | 3300009176 | Unclassified | 4569 |
| 624 | Ga0105242_10268432 | 3300009176 | Unclassified | 1544 |
| 625 | Ga0105242_10328003 | 3300009176 | Bacteria | 1406 |
| 626 | Ga0105242_10366387 | 3300009176 | Bacteria | 1335 |
| 627 | Ga0105242_10665893 | 3300009176 | Bacteria | 1014 |
| 628 | Ga0105242_11024614 | 3300009176 | Bacteria | 835 |
| 629 | Ga0105248_10002172 | 3300009177 | Bacteria | 21714 |
| 630 | Ga0105248_10007536 | 3300009177 | Bacteria | 11949 |
| 631 | Ga0105248_10043045 | 3300009177 | Bacteria | 5064 |
| 632 | Ga0105248_10052710 | 3300009177 | Bacteria | 4565 |
| 633 | Ga0105248_10059992 | 3300009177 | Bacteria | 4272 |
| 634 | Ga0105248_10068556 | 3300009177 | Bacteria | 3982 |
| 635 | Ga0105248_10107031 | 3300009177 | Bacteria | 3153 |
| 636 | Ga0105248_10162200 | 3300009177 | Unclassified | 2521 |
| 637 | Ga0105248_10200910 | 3300009177 | Unclassified | 2246 |
| 638 | Ga0105248_10231761 | 3300009177 | Unclassified | 2079 |
| 639 | Ga0105248_10320423 | 3300009177 | Unclassified | 1746 |
| 640 | Ga0105248_10411347 | 3300009177 | Unclassified | 1523 |
| 641 | Ga0105248_10495834 | 3300009177 | Unclassified | 1377 |
| 642 | Ga0105248_11356672 | 3300009177 | Bacteria | 804 |
| 643 | Ga0105248_12175856 | 3300009177 | Unclassified | 631 |
| 644 | Ga0105237_10709398 | 3300009545 | Bacteria | 1012 |
| 645 | Ga0105237_11273509 | 3300009545 | Bacteria | 742 |
| 646 | Ga0105238_10036372 | 3300009551 | Bacteria | 5005 |
| 647 | Ga0105238_10251909 | 3300009551 | Unclassified | 1744 |
| 648 | Ga0105238_11837913 | 3300009551 | Bacteria | 638 |
| 649 | Ga0105249_10025255 | 3300009553 | Bacteria | 5347 |
| 650 | Ga0105249_10081617 | 3300009553 | Bacteria | 3006 |
| 651 | Ga0105249_10272878 | 3300009553 | Unclassified | 1685 |
| 652 | Ga0105249_10293297 | 3300009553 | Unclassified | 1629 |
| 653 | Ga0105249_10350611 | 3300009553 | Unclassified | 1495 |
| 654 | Ga0105249_10455199 | 3300009553 | Unclassified | 1319 |
| 655 | Ga0105249_10867528 | 3300009553 | Unclassified | 969 |
| 656 | Ga0105249_11977180 | 3300009553 | Unclassified | 656 |
| 657 | Ga0105249_12262412 | 3300009553 | Unclassified | 616 |
| 658 | Ga0105239_10699477 | 3300010375 | Bacteria | 1159 |
| 659 | Ga0105239_10713110 | 3300010375 | Bacteria | 1147 |
| 660 | Ga0105239_10815702 | 3300010375 | Unclassified | 1069 |
| 661 | Ga0105246_10105238 | 3300011119 | Unclassified | 2062 |
| 662 | Ga0105246_10467635 | 3300011119 | Bacteria | 1064 |
| 663 | Ga0105246_10868449 | 3300011119 | Unclassified | 806 |
| 664 | Ga0157373_11108636 | 3300013100 | Unclassified | 594 |
| 665 | Ga0157370_10733794 | 3300013104 | Unclassified | 900 |
| 666 | Ga0157374_10083773 | 3300013296 | Bacteria | 3030 |
| 667 | Ga0157374_10104979 | 3300013296 | Unclassified | 2713 |
| 668 | Ga0157374_10443606 | 3300013296 | Bacteria | 1299 |
| 669 | Ga0157374_11656934 | 3300013296 | Unclassified | 664 |
| 670 | Ga0157378_10009109 | 3300013297 | Bacteria | 8639 |
| 671 | Ga0157378_10144928 | 3300013297 | Bacteria | 2208 |
| 672 | Ga0157378_10561950 | 3300013297 | Bacteria | 1148 |
| 673 | Ga0163162_10186185 | 3300013306 | Unclassified | 2203 |
| 674 | Ga0163162_10549926 | 3300013306 | Bacteria | 1283 |
| 675 | Ga0163162_10559856 | 3300013306 | Bacteria | 1271 |
| 676 | Ga0163162_10609618 | 3300013306 | Bacteria | 1217 |
| 677 | Ga0163162_11769678 | 3300013306 | Bacteria | 706 |
| 678 | Ga0157372_10454180 | 3300013307 | Bacteria | 1493 |
| 679 | Ga0157375_10055322 | 3300013308 | Bacteria | 3912 |
| 680 | Ga0157375_10265853 | 3300013308 | Unclassified | 1877 |
| 681 | Ga0157375_10340654 | 3300013308 | Unclassified | 1665 |
| 682 | Ga0157375_10374552 | 3300013308 | Unclassified | 1590 |
| 683 | Ga0157375_10587096 | 3300013308 | Unclassified | 1274 |
| 684 | Ga0157375_10658352 | 3300013308 | Unclassified | 1203 |
| 685 | Ga0157375_11224686 | 3300013308 | Bacteria | 881 |
| 686 | Ga0163163_10006091 | 3300014325 | Bacteria | 10498 |
| 687 | Ga0163163_10024951 | 3300014325 | Bacteria | 5693 |
| 688 | Ga0163163_10033095 | 3300014325 | Bacteria | 4999 |
| 689 | Ga0163163_10044334 | 3300014325 | Bacteria | 4363 |
| 690 | Ga0163163_10049145 | 3300014325 | Bacteria | 4150 |
| 691 | Ga0163163_10457893 | 3300014325 | Unclassified | 1336 |
| 692 | Ga0163163_10662976 | 3300014325 | Unclassified | 1107 |
| 693 | Ga0163163_11872649 | 3300014325 | Bacteria | 660 |
| 694 | Ga0163163_12172974 | 3300014325 | Unclassified | 614 |
| 695 | Ga0157380_10002946 | 3300014326 | Bacteria | 11577 |
| 696 | Ga0157380_10008813 | 3300014326 | Bacteria | 7207 |
| 697 | Ga0157380_10018744 | 3300014326 | Bacteria | 5145 |
| 698 | Ga0157380_10048867 | 3300014326 | Unclassified | 3334 |
| 699 | Ga0157380_10078622 | 3300014326 | Unclassified | 2692 |
| 700 | Ga0157380_10088271 | 3300014326 | Bacteria | 2551 |
| 701 | Ga0157380_10279419 | 3300014326 | Bacteria | 1527 |
| 702 | Ga0157380_10417166 | 3300014326 | Unclassified | 1279 |
| 703 | Ga0157380_10691176 | 3300014326 | Unclassified | 1024 |
| 704 | Ga0157380_11418633 | 3300014326 | Unclassified | 745 |
| 705 | Ga0157380_11524746 | 3300014326 | Bacteria | 722 |
| 706 | Ga0157380_11547105 | 3300014326 | Unclassified | 717 |
| 707 | Ga0157380_11772989 | 3300014326 | Unclassified | 676 |
| 708 | Ga0182008_10291273 | 3300014497 | Bacteria | 852 |
| 709 | Ga0157377_10066174 | 3300014745 | Unclassified | 2077 |
| 710 | Ga0157377_10095762 | 3300014745 | Bacteria | 1760 |
| 711 | Ga0157377_10155723 | 3300014745 | Unclassified | 1417 |
| 712 | Ga0157377_10275103 | 3300014745 | Bacteria | 1101 |
| 713 | Ga0157377_10331777 | 3300014745 | Unclassified | 1014 |
| 714 | Ga0157377_10550822 | 3300014745 | Unclassified | 815 |
| 715 | Ga0157379_10007040 | 3300014968 | Bacteria | 9721 |
| 716 | Ga0157379_10007133 | 3300014968 | Bacteria | 9664 |
| 717 | Ga0157379_10030765 | 3300014968 | Bacteria | 4780 |
| 718 | Ga0157379_10037871 | 3300014968 | Bacteria | 4302 |
| 719 | Ga0157379_10222767 | 3300014968 | Bacteria | 1709 |
| 720 | Ga0157379_10304951 | 3300014968 | Bacteria | 1452 |
| 721 | Ga0157379_10328355 | 3300014968 | Bacteria | 1397 |
| 722 | Ga0157379_10640056 | 3300014968 | Bacteria | 995 |
| 723 | Ga0157376_10024569 | 3300014969 | Unclassified | 4734 |
| 724 | Ga0157376_10024693 | 3300014969 | Bacteria | 4724 |
| 725 | Ga0157376_10086620 | 3300014969 | Unclassified | 2701 |
| 726 | Ga0157376_10189607 | 3300014969 | Bacteria | 1885 |
| 727 | Ga0157376_10366170 | 3300014969 | Unclassified | 1384 |
| 728 | Ga0157376_10823342 | 3300014969 | Bacteria | 942 |
| 729 | Ga0157376_11082052 | 3300014969 | Unclassified | 827 |
| 730 | Ga0163161_10279799 | 3300017792 | Bacteria | 1308 |
| 731 | Ga0163161_10379530 | 3300017792 | Bacteria | 1129 |
| 732 | Ga0163161_10965245 | 3300017792 | Unclassified | 726 |
| 733 | Ga0213876_10074971 | 3300021384 | Bacteria | 1787 |
| 734 | Ga0207697_10024138 | 3300025315 | Unclassified | 2490 |
| 735 | Ga0207697_10072296 | 3300025315 | Bacteria | 1446 |
| 736 | Ga0207697_10274146 | 3300025315 | Bacteria | 747 |
| 737 | Ga0207697_10357179 | 3300025315 | Unclassified | 649 |
| 738 | Ga0207656_10097732 | 3300025321 | Unclassified | 1342 |
| 739 | Ga0207653_10093372 | 3300025885 | Unclassified | 1056 |
| 740 | Ga0207682_10004207 | 3300025893 | Bacteria | 6079 |
| 741 | Ga0207682_10045366 | 3300025893 | Unclassified | 1803 |
| 742 | Ga0207682_10048222 | 3300025893 | Bacteria | 1756 |
| 743 | Ga0207682_10052586 | 3300025893 | Unclassified | 1688 |
| 744 | Ga0207682_10064298 | 3300025893 | Bacteria | 1542 |
| 745 | Ga0207682_10089494 | 3300025893 | Unclassified | 1332 |
| 746 | Ga0207682_10093133 | 3300025893 | Unclassified | 1309 |
| 747 | Ga0207682_10327128 | 3300025893 | Unclassified | 720 |
| 748 | Ga0207692_10397454 | 3300025898 | Bacteria | 859 |
| 749 | Ga0207642_10036643 | 3300025899 | Bacteria | 2107 |
| 750 | Ga0207642_10101553 | 3300025899 | Unclassified | 1445 |
| 751 | Ga0207710_10082088 | 3300025900 | Bacteria | 1497 |
| 752 | Ga0207688_10348566 | 3300025901 | Unclassified | 912 |
| 753 | Ga0207680_10023105 | 3300025903 | Bacteria | 3391 |
| 754 | Ga0207680_10049583 | 3300025903 | Unclassified | 2500 |
| 755 | Ga0207680_10132754 | 3300025903 | Bacteria | 1643 |
| 756 | Ga0207680_10318152 | 3300025903 | Unclassified | 1088 |
| 757 | Ga0207680_10792231 | 3300025903 | Unclassified | 679 |
| 758 | Ga0207685_10174223 | 3300025905 | Bacteria | 992 |
| 759 | Ga0207699_10026366 | 3300025906 | Bacteria | 3203 |
| 760 | Ga0207699_10257100 | 3300025906 | Bacteria | 1206 |
| 761 | Ga0207645_10001406 | 3300025907 | Bacteria | 19717 |
| 762 | Ga0207645_10002286 | 3300025907 | Bacteria | 15200 |
| 763 | Ga0207645_10065309 | 3300025907 | Bacteria | 2325 |
| 764 | Ga0207645_10142585 | 3300025907 | Unclassified | 1561 |
| 765 | Ga0207645_10148909 | 3300025907 | Unclassified | 1527 |
| 766 | Ga0207643_10003202 | 3300025908 | Bacteria | 8817 |
| 767 | Ga0207643_10042613 | 3300025908 | Bacteria | 2559 |
| 768 | Ga0207643_10057393 | 3300025908 | Bacteria | 2216 |
| 769 | Ga0207643_10077467 | 3300025908 | Bacteria | 1922 |
| 770 | Ga0207643_10549995 | 3300025908 | Unclassified | 741 |
| 771 | Ga0207684_10180841 | 3300025910 | Unclassified | 1818 |
| 772 | Ga0207684_10189929 | 3300025910 | Bacteria | 1772 |
| 773 | Ga0207684_10228661 | 3300025910 | Bacteria | 1605 |
| 774 | Ga0207654_10301123 | 3300025911 | Unclassified | 1090 |
| 775 | Ga0207707_10331947 | 3300025912 | Bacteria | 1312 |
| 776 | Ga0207695_10151584 | 3300025913 | Unclassified | 2257 |
| 777 | Ga0207695_10360308 | 3300025913 | Unclassified | 1341 |
| 778 | Ga0207695_10428856 | 3300025913 | Bacteria | 1206 |
| 779 | Ga0207695_10757082 | 3300025913 | Bacteria | 851 |
| 780 | Ga0207671_10227660 | 3300025914 | Bacteria | 1462 |
| 781 | Ga0207671_11049257 | 3300025914 | Bacteria | 641 |
| 782 | Ga0207693_10139612 | 3300025915 | Bacteria | 1906 |
| 783 | Ga0207693_10488325 | 3300025915 | Unclassified | 962 |
| 784 | Ga0207693_10738222 | 3300025915 | Unclassified | 761 |
| 785 | Ga0207663_10226206 | 3300025916 | Unclassified | 1364 |
| 786 | Ga0207660_10085009 | 3300025917 | Unclassified | 2333 |
| 787 | Ga0207660_10096368 | 3300025917 | Bacteria | 2202 |
| 788 | Ga0207660_10165751 | 3300025917 | Unclassified | 1707 |
| 789 | Ga0207660_10247169 | 3300025917 | Bacteria | 1407 |
| 790 | Ga0207662_10007637 | 3300025918 | Bacteria | 5894 |
| 791 | Ga0207662_10015889 | 3300025918 | Bacteria | 4241 |
| 792 | Ga0207662_10099277 | 3300025918 | Bacteria | 1802 |
| 793 | Ga0207662_10131006 | 3300025918 | Unclassified | 1581 |
| 794 | Ga0207657_10006096 | 3300025919 | Bacteria | 12536 |
| 795 | Ga0207657_10144559 | 3300025919 | Bacteria | 1941 |
| 796 | Ga0207649_10073295 | 3300025920 | Unclassified | 2193 |
| 797 | Ga0207649_10075530 | 3300025920 | Unclassified | 2166 |
| 798 | Ga0207649_10727068 | 3300025920 | Bacteria | 771 |
| 799 | Ga0207649_10857902 | 3300025920 | Unclassified | 711 |
| 800 | Ga0207652_10052515 | 3300025921 | Bacteria | 3499 |
| 801 | Ga0207652_10360643 | 3300025921 | Unclassified | 1312 |
| 802 | Ga0207652_10399292 | 3300025921 | Bacteria | 1240 |
| 803 | Ga0207652_10697637 | 3300025921 | Unclassified | 906 |
| 804 | Ga0207652_10727255 | 3300025921 | Bacteria | 884 |
| 805 | Ga0207646_10067972 | 3300025922 | Bacteria | 3182 |
| 806 | Ga0207646_10146933 | 3300025922 | Unclassified | 2124 |
| 807 | Ga0207646_10167580 | 3300025922 | Bacteria | 1983 |
| 808 | Ga0207646_10658221 | 3300025922 | Unclassified | 938 |
| 809 | Ga0207646_10771753 | 3300025922 | Unclassified | 857 |
| 810 | Ga0207646_10980208 | 3300025922 | Bacteria | 747 |
| 811 | Ga0207681_10009178 | 3300025923 | Bacteria | 6042 |
| 812 | Ga0207681_10022038 | 3300025923 | Bacteria | 4059 |
| 813 | Ga0207681_10025121 | 3300025923 | Bacteria | 3829 |
| 814 | Ga0207681_10036364 | 3300025923 | Bacteria | 3248 |
| 815 | Ga0207681_10051798 | 3300025923 | Unclassified | 2782 |
| 816 | Ga0207681_10146109 | 3300025923 | Bacteria | 1767 |
| 817 | Ga0207681_10438186 | 3300025923 | Bacteria | 1061 |
| 818 | Ga0207694_10142401 | 3300025924 | Unclassified | 1929 |
| 819 | Ga0207650_10002374 | 3300025925 | Bacteria | 13100 |
| 820 | Ga0207650_10084901 | 3300025925 | Bacteria | 2407 |
| 821 | Ga0207650_10121252 | 3300025925 | Unclassified | 2036 |
| 822 | Ga0207650_10295594 | 3300025925 | Unclassified | 1322 |
| 823 | Ga0207650_10549731 | 3300025925 | Unclassified | 968 |
| 824 | Ga0207650_10801154 | 3300025925 | Unclassified | 798 |
| 825 | Ga0207659_10000079 | 3300025926 | Bacteria | 60790 |
| 826 | Ga0207659_10001272 | 3300025926 | Bacteria | 15110 |
| 827 | Ga0207659_10001629 | 3300025926 | Bacteria | 13323 |
| 828 | Ga0207659_10012585 | 3300025926 | Bacteria | 5389 |
| 829 | Ga0207659_10029655 | 3300025926 | Bacteria | 3731 |
| 830 | Ga0207659_10058294 | 3300025926 | Bacteria | 2772 |
| 831 | Ga0207659_10097120 | 3300025926 | Bacteria | 2212 |
| 832 | Ga0207659_10136365 | 3300025926 | Bacteria | 1900 |
| 833 | Ga0207659_10163907 | 3300025926 | Bacteria | 1748 |
| 834 | Ga0207659_10193963 | 3300025926 | Bacteria | 1618 |
| 835 | Ga0207659_10235224 | 3300025926 | Bacteria | 1479 |
| 836 | Ga0207659_10581384 | 3300025926 | Bacteria | 954 |
| 837 | Ga0207687_10124628 | 3300025927 | Bacteria | 1932 |
| 838 | Ga0207687_10136073 | 3300025927 | Viruses | 1858 |
| 839 | Ga0207687_10263500 | 3300025927 | Bacteria | 1375 |
| 840 | Ga0207687_11381762 | 3300025927 | Unclassified | 605 |
| 841 | Ga0207700_10005583 | 3300025928 | Bacteria | 7549 |
| 842 | Ga0207700_10006132 | 3300025928 | Bacteria | 7239 |
| 843 | Ga0207700_10279505 | 3300025928 | Bacteria | 1436 |
| 844 | Ga0207700_10438202 | 3300025928 | Bacteria | 1150 |
| 845 | Ga0207700_11121973 | 3300025928 | Bacteria | 703 |
| 846 | Ga0207664_10139643 | 3300025929 | Bacteria | 2048 |
| 847 | Ga0207644_10098430 | 3300025931 | Bacteria | 2192 |
| 848 | Ga0207644_10103306 | 3300025931 | Bacteria | 2144 |
| 849 | Ga0207644_10464392 | 3300025931 | Bacteria | 1041 |
| 850 | Ga0207644_11140984 | 3300025931 | Unclassified | 655 |
| 851 | Ga0207690_10116446 | 3300025932 | Bacteria | 1933 |
| 852 | Ga0207690_10159647 | 3300025932 | Bacteria | 1680 |
| 853 | Ga0207706_10006050 | 3300025933 | Bacteria | 11253 |
| 854 | Ga0207706_10101857 | 3300025933 | Unclassified | 2527 |
| 855 | Ga0207706_10129500 | 3300025933 | Unclassified | 2219 |
| 856 | Ga0207706_10134783 | 3300025933 | Bacteria | 2172 |
| 857 | Ga0207706_10164552 | 3300025933 | Bacteria | 1949 |
| 858 | Ga0207706_10167166 | 3300025933 | Bacteria | 1933 |
| 859 | Ga0207706_10388096 | 3300025933 | Unclassified | 1211 |
| 860 | Ga0207706_10418896 | 3300025933 | Unclassified | 1160 |
| 861 | Ga0207706_10902198 | 3300025933 | Unclassified | 746 |
| 862 | Ga0207686_10012850 | 3300025934 | Bacteria | 4615 |
| 863 | Ga0207686_10020581 | 3300025934 | Bacteria | 3771 |
| 864 | Ga0207686_10049693 | 3300025934 | Bacteria | 2604 |
| 865 | Ga0207686_10238381 | 3300025934 | Bacteria | 1322 |
| 866 | Ga0207686_10242409 | 3300025934 | Bacteria | 1313 |
| 867 | Ga0207686_10647968 | 3300025934 | Bacteria | 835 |
| 868 | Ga0207686_11249943 | 3300025934 | Bacteria | 609 |
| 869 | Ga0207709_10004795 | 3300025935 | Bacteria | 7750 |
| 870 | Ga0207709_10006292 | 3300025935 | Bacteria | 6666 |
| 871 | Ga0207709_10194962 | 3300025935 | Unclassified | 1442 |
| 872 | Ga0207709_10307838 | 3300025935 | Bacteria | 1181 |
| 873 | Ga0207670_10002109 | 3300025936 | Bacteria | 10392 |
| 874 | Ga0207670_10093752 | 3300025936 | Unclassified | 2128 |
| 875 | Ga0207670_10163474 | 3300025936 | Bacteria | 1664 |
| 876 | Ga0207670_10250581 | 3300025936 | Bacteria | 1368 |
| 877 | Ga0207670_10341404 | 3300025936 | Bacteria | 1184 |
| 878 | Ga0207670_10496198 | 3300025936 | Bacteria | 991 |
| 879 | Ga0207670_10639302 | 3300025936 | Bacteria | 876 |
| 880 | Ga0207670_10803123 | 3300025936 | Unclassified | 784 |
| 881 | Ga0207669_10029033 | 3300025937 | Bacteria | 3052 |
| 882 | Ga0207669_10322202 | 3300025937 | Bacteria | 1183 |
| 883 | Ga0207669_10380953 | 3300025937 | Unclassified | 1099 |
| 884 | Ga0207669_10612134 | 3300025937 | Bacteria | 886 |
| 885 | Ga0207669_10702761 | 3300025937 | Bacteria | 831 |
| 886 | Ga0207669_10807414 | 3300025937 | Unclassified | 778 |
| 887 | Ga0207669_10889369 | 3300025937 | Unclassified | 743 |
| 888 | Ga0207669_11210408 | 3300025937 | Unclassified | 640 |
| 889 | Ga0207704_10001806 | 3300025938 | Bacteria | 9595 |
| 890 | Ga0207704_10022964 | 3300025938 | Bacteria | 3353 |
| 891 | Ga0207704_10095293 | 3300025938 | Bacteria | 1967 |
| 892 | Ga0207704_10101794 | 3300025938 | Bacteria | 1917 |
| 893 | Ga0207704_10141205 | 3300025938 | Unclassified | 1685 |
| 894 | Ga0207704_10668633 | 3300025938 | Bacteria | 857 |
| 895 | Ga0207665_10090888 | 3300025939 | Unclassified | 2116 |
| 896 | Ga0207665_10553627 | 3300025939 | Bacteria | 894 |
| 897 | Ga0207665_10852006 | 3300025939 | Unclassified | 722 |
| 898 | Ga0207691_10018862 | 3300025940 | Bacteria | 6533 |
| 899 | Ga0207691_10045113 | 3300025940 | Bacteria | 4054 |
| 900 | Ga0207691_10070189 | 3300025940 | Bacteria | 3164 |
| 901 | Ga0207691_10122904 | 3300025940 | Bacteria | 2298 |
| 902 | Ga0207691_10176973 | 3300025940 | Bacteria | 1866 |
| 903 | Ga0207691_10353247 | 3300025940 | Bacteria | 1257 |
| 904 | Ga0207691_10428238 | 3300025940 | Unclassified | 1127 |
| 905 | Ga0207691_10538456 | 3300025940 | Bacteria | 990 |
| 906 | Ga0207691_10642074 | 3300025940 | Unclassified | 897 |
| 907 | Ga0207691_10649339 | 3300025940 | Unclassified | 891 |
| 908 | Ga0207711_10006268 | 3300025941 | Bacteria | 10036 |
| 909 | Ga0207711_10027728 | 3300025941 | Bacteria | 4759 |
| 910 | Ga0207711_10036902 | 3300025941 | Bacteria | 4148 |
| 911 | Ga0207711_10057589 | 3300025941 | Bacteria | 3341 |
| 912 | Ga0207711_10082424 | 3300025941 | Bacteria | 2811 |
| 913 | Ga0207711_10141424 | 3300025941 | Bacteria | 2166 |
| 914 | Ga0207711_10379055 | 3300025941 | Bacteria | 1312 |
| 915 | Ga0207711_10584376 | 3300025941 | Unclassified | 1042 |
| 916 | Ga0207711_10589809 | 3300025941 | Bacteria | 1037 |
| 917 | Ga0207711_10821846 | 3300025941 | Unclassified | 865 |
| 918 | Ga0207711_10920258 | 3300025941 | Bacteria | 813 |
| 919 | Ga0207711_11097910 | 3300025941 | Unclassified | 736 |
| 920 | Ga0207689_10000032 | 3300025942 | Bacteria | 96794 |
| 921 | Ga0207689_10045085 | 3300025942 | Bacteria | 3647 |
| 922 | Ga0207689_10081837 | 3300025942 | Bacteria | 2654 |
| 923 | Ga0207689_10125401 | 3300025942 | Bacteria | 2112 |
| 924 | Ga0207689_10228789 | 3300025942 | Bacteria | 1537 |
| 925 | Ga0207689_10240049 | 3300025942 | Bacteria | 1498 |
| 926 | Ga0207689_10323548 | 3300025942 | Unclassified | 1280 |
| 927 | Ga0207661_10098786 | 3300025944 | Viruses | 2447 |
| 928 | Ga0207661_10106732 | 3300025944 | Unclassified | 2361 |
| 929 | Ga0207661_10334552 | 3300025944 | Bacteria | 1364 |
| 930 | Ga0207661_10342356 | 3300025944 | Bacteria | 1348 |
| 931 | Ga0207661_10396865 | 3300025944 | Bacteria | 1250 |
| 932 | Ga0207661_10795048 | 3300025944 | Bacteria | 871 |
| 933 | Ga0207679_10073204 | 3300025945 | Bacteria | 2591 |
| 934 | Ga0207679_10686495 | 3300025945 | Bacteria | 928 |
| 935 | Ga0207679_10744666 | 3300025945 | Unclassified | 891 |
| 936 | Ga0207679_10801763 | 3300025945 | Unclassified | 858 |
| 937 | Ga0207679_11371468 | 3300025945 | Bacteria | 649 |
| 938 | Ga0207667_10104283 | 3300025949 | Bacteria | 2925 |
| 939 | Ga0207667_10451829 | 3300025949 | Bacteria | 1306 |
| 940 | Ga0207667_10866185 | 3300025949 | Unclassified | 897 |
| 941 | Ga0207667_11025418 | 3300025949 | Bacteria | 811 |
| 942 | Ga0207651_10010999 | 3300025960 | Bacteria | 5043 |
| 943 | Ga0207651_10048187 | 3300025960 | Unclassified | 2878 |
| 944 | Ga0207651_10110003 | 3300025960 | Bacteria | 2066 |
| 945 | Ga0207651_10185688 | 3300025960 | Bacteria | 1654 |
| 946 | Ga0207651_10342397 | 3300025960 | Unclassified | 1256 |
| 947 | Ga0207651_10524791 | 3300025960 | Bacteria | 1027 |
| 948 | Ga0207712_10073047 | 3300025961 | Unclassified | 2472 |
| 949 | Ga0207712_10260004 | 3300025961 | Bacteria | 1407 |
| 950 | Ga0207712_11240747 | 3300025961 | Unclassified | 666 |
| 951 | Ga0207712_11279341 | 3300025961 | Unclassified | 655 |
| 952 | Ga0207668_10085374 | 3300025972 | Bacteria | 2303 |
| 953 | Ga0207668_10730246 | 3300025972 | Bacteria | 872 |
| 954 | Ga0207668_11564651 | 3300025972 | Unclassified | 595 |
| 955 | Ga0207640_10873542 | 3300025981 | Unclassified | 784 |
| 956 | Ga0207640_10910496 | 3300025981 | Unclassified | 769 |
| 957 | Ga0207640_11062493 | 3300025981 | Unclassified | 715 |
| 958 | Ga0207677_10065710 | 3300026023 | Unclassified | 2532 |
| 959 | Ga0207677_10201274 | 3300026023 | Unclassified | 1583 |
| 960 | Ga0207677_10270975 | 3300026023 | Bacteria | 1389 |
| 961 | Ga0207677_10331780 | 3300026023 | Bacteria | 1268 |
| 962 | Ga0207677_10557228 | 3300026023 | Unclassified | 1000 |
| 963 | Ga0207703_10008882 | 3300026035 | Bacteria | 7918 |
| 964 | Ga0207703_10018977 | 3300026035 | Bacteria | 5372 |
| 965 | Ga0207703_10045404 | 3300026035 | Bacteria | 3534 |
| 966 | Ga0207703_10049674 | 3300026035 | Bacteria | 3392 |
| 967 | Ga0207703_10065358 | 3300026035 | Bacteria | 2989 |
| 968 | Ga0207703_10167253 | 3300026035 | Unclassified | 1931 |
| 969 | Ga0207703_10227604 | 3300026035 | Bacteria | 1670 |
| 970 | Ga0207703_10838593 | 3300026035 | Bacteria | 879 |
| 971 | Ga0207703_10888294 | 3300026035 | Unclassified | 853 |
| 972 | Ga0207703_11245904 | 3300026035 | Unclassified | 715 |
| 973 | Ga0207639_10200242 | 3300026041 | Bacteria | 1712 |
| 974 | Ga0207678_10054360 | 3300026067 | Bacteria | 3448 |
| 975 | Ga0207678_10292250 | 3300026067 | Bacteria | 1400 |
| 976 | Ga0207708_10004043 | 3300026075 | Bacteria | 10785 |
| 977 | Ga0207708_10004337 | 3300026075 | Bacteria | 10446 |
| 978 | Ga0207708_10102480 | 3300026075 | Unclassified | 2216 |
| 979 | Ga0207708_10115449 | 3300026075 | Unclassified | 2088 |
| 980 | Ga0207708_10132107 | 3300026075 | Bacteria | 1953 |
| 981 | Ga0207708_10227810 | 3300026075 | Bacteria | 1495 |
| 982 | Ga0207708_10231410 | 3300026075 | Bacteria | 1484 |
| 983 | Ga0207708_10289983 | 3300026075 | Bacteria | 1328 |
| 984 | Ga0207708_10419909 | 3300026075 | Bacteria | 1109 |
| 985 | Ga0207702_10314643 | 3300026078 | Unclassified | 1489 |
| 986 | Ga0207641_10000955 | 3300026088 | Bacteria | 29716 |
| 987 | Ga0207641_10106423 | 3300026088 | Bacteria | 2479 |
| 988 | Ga0207641_10329613 | 3300026088 | Bacteria | 1450 |
| 989 | Ga0207641_10341335 | 3300026088 | Unclassified | 1425 |
| 990 | Ga0207641_10790080 | 3300026088 | Bacteria | 938 |
| 991 | Ga0207641_11598577 | 3300026088 | Unclassified | 654 |
| 992 | Ga0207648_10001379 | 3300026089 | Bacteria | 26764 |
| 993 | Ga0207648_10002536 | 3300026089 | Bacteria | 19594 |
| 994 | Ga0207648_10053012 | 3300026089 | Bacteria | 3546 |
| 995 | Ga0207648_10092785 | 3300026089 | Bacteria | 2640 |
| 996 | Ga0207648_10099685 | 3300026089 | Unclassified | 2544 |
| 997 | Ga0207648_10139264 | 3300026089 | Bacteria | 2138 |
| 998 | Ga0207648_10211164 | 3300026089 | Bacteria | 1723 |
| 999 | Ga0207648_10254914 | 3300026089 | Unclassified | 1565 |
| 1000 | Ga0207648_10281533 | 3300026089 | Unclassified | 1487 |
| 1001 | Ga0207648_10334651 | 3300026089 | Unclassified | 1362 |
| 1002 | Ga0207648_11322834 | 3300026089 | Bacteria | 677 |
| 1003 | Ga0207648_11467147 | 3300026089 | Bacteria | 641 |
| 1004 | Ga0207676_10014812 | 3300026095 | Bacteria | 5618 |
| 1005 | Ga0207676_10032483 | 3300026095 | Bacteria | 3934 |
| 1006 | Ga0207676_10034193 | 3300026095 | Bacteria | 3847 |
| 1007 | Ga0207676_10109644 | 3300026095 | Unclassified | 2307 |
| 1008 | Ga0207676_10150793 | 3300026095 | Bacteria | 2002 |
| 1009 | Ga0207676_10180475 | 3300026095 | Viruses | 1848 |
| 1010 | Ga0207676_10307813 | 3300026095 | Unclassified | 1449 |
| 1011 | Ga0207676_10525687 | 3300026095 | Bacteria | 1127 |
| 1012 | Ga0207674_10061584 | 3300026116 | Bacteria | 3792 |
| 1013 | Ga0207674_10592894 | 3300026116 | Bacteria | 1070 |
| 1014 | Ga0207674_10656898 | 3300026116 | Bacteria | 1013 |
| 1015 | Ga0207674_10707475 | 3300026116 | Unclassified | 972 |
| 1016 | Ga0207675_100087094 | 3300026118 | Unclassified | 2933 |
| 1017 | Ga0207675_100088170 | 3300026118 | Bacteria | 2914 |
| 1018 | Ga0207675_100115838 | 3300026118 | Unclassified | 2532 |
| 1019 | Ga0207675_100116172 | 3300026118 | Bacteria | 2529 |
| 1020 | Ga0207675_100230505 | 3300026118 | Bacteria | 1787 |
| 1021 | Ga0207675_100254408 | 3300026118 | Bacteria | 1701 |
| 1022 | Ga0207675_100278637 | 3300026118 | Bacteria | 1624 |
| 1023 | Ga0207675_100347885 | 3300026118 | Unclassified | 1452 |
| 1024 | Ga0207675_100385732 | 3300026118 | Bacteria | 1378 |
| 1025 | Ga0207675_100595480 | 3300026118 | Bacteria | 1108 |
| 1026 | Ga0207675_100618544 | 3300026118 | Bacteria | 1087 |
| 1027 | Ga0207675_100857438 | 3300026118 | Unclassified | 923 |
| 1028 | Ga0207675_101042915 | 3300026118 | Bacteria | 837 |
| 1029 | Ga0207683_10033044 | 3300026121 | Bacteria | 4493 |
| 1030 | Ga0207683_10157417 | 3300026121 | Bacteria | 2052 |
| 1031 | Ga0207683_10206224 | 3300026121 | Bacteria | 1788 |
| 1032 | Ga0207683_10313072 | 3300026121 | Unclassified | 1437 |
| 1033 | Ga0207683_10414536 | 3300026121 | Bacteria | 1240 |
| 1034 | Ga0207683_10433160 | 3300026121 | Bacteria | 1212 |
| 1035 | Ga0207683_10558342 | 3300026121 | Bacteria | 1059 |
| 1036 | Ga0207683_10688106 | 3300026121 | Unclassified | 948 |
| 1037 | Ga0207683_10800358 | 3300026121 | Bacteria | 875 |
| 1038 | Ga0207683_11067291 | 3300026121 | Unclassified | 749 |
| 1039 | Ga0207683_11146007 | 3300026121 | Bacteria | 721 |
| 1040 | Ga0207698_10400208 | 3300026142 | Unclassified | 1312 |
| 1041 | Ga0209983_1106675 | 3300027665 | Unclassified | 636 |
| 1042 | Ga0209971_1026227 | 3300027682 | Unclassified | 1393 |
| 1043 | Ga0209974_10063480 | 3300027876 | Bacteria | 1252 |
| 1044 | Ga0207428_10000005 | 3300027907 | Bacteria | 520045 |
| 1045 | Ga0207428_10000156 | 3300027907 | Bacteria | 93294 |
| 1046 | Ga0207428_10003214 | 3300027907 | Bacteria | 15966 |
| 1047 | Ga0207428_10006617 | 3300027907 | Bacteria | 10661 |
| 1048 | Ga0207428_10007795 | 3300027907 | Bacteria | 9748 |
| 1049 | Ga0207428_10017798 | 3300027907 | Bacteria | 6093 |
| 1050 | Ga0207428_10032828 | 3300027907 | Bacteria | 4269 |
| 1051 | Ga0207428_10035587 | 3300027907 | Bacteria | 4069 |
| 1052 | Ga0207428_10331834 | 3300027907 | Unclassified | 1121 |
| 1053 | Ga0207428_10630272 | 3300027907 | Bacteria | 771 |
| 1054 | Ga0268266_10076315 | 3300028379 | Bacteria | 2912 |
| 1055 | Ga0268266_10148463 | 3300028379 | Bacteria | 2110 |
| 1056 | Ga0268266_10204191 | 3300028379 | Bacteria | 1810 |
| 1057 | Ga0268266_10400322 | 3300028379 | Unclassified | 1298 |
| 1058 | Ga0268265_10007655 | 3300028380 | Bacteria | 7289 |
| 1059 | Ga0268265_10080399 | 3300028380 | Bacteria | 2570 |
| 1060 | Ga0268265_10151383 | 3300028380 | Unclassified | 1957 |
| 1061 | Ga0268265_10192637 | 3300028380 | Bacteria | 1762 |
| 1062 | Ga0268265_10221870 | 3300028380 | Unclassified | 1655 |
| 1063 | Ga0268265_10533288 | 3300028380 | Bacteria | 1111 |
| 1064 | Ga0268265_10595829 | 3300028380 | Unclassified | 1055 |
| 1065 | Ga0268264_10023300 | 3300028381 | Bacteria | 5051 |
| 1066 | Ga0268264_10035080 | 3300028381 | Bacteria | 4130 |
| 1067 | Ga0268264_10148355 | 3300028381 | Bacteria | 2100 |
| 1068 | Ga0268264_10278405 | 3300028381 | Bacteria | 1566 |
| 1069 | Ga0268264_10282422 | 3300028381 | Unclassified | 1556 |
| 1070 | Ga0268264_10334699 | 3300028381 | Unclassified | 1436 |
| 1071 | Ga0268264_10473607 | 3300028381 | Unclassified | 1217 |
| 1072 | Ga0265316_10444674 | 3300031344 | Bacteria | 930 |
| 1073 | Ga0307408_100078365 | 3300031548 | Bacteria | 2463 |
| 1074 | Ga0307408_100081459 | 3300031548 | Bacteria | 2420 |
| 1075 | Ga0307408_100392206 | 3300031548 | Bacteria | 1190 |
| 1076 | Ga0307408_100803021 | 3300031548 | Bacteria | 854 |
| 1077 | Ga0265314_10033286 | 3300031711 | Bacteria | 3782 |
| 1078 | Ga0307405_10079173 | 3300031731 | Unclassified | 2141 |
| 1079 | Ga0307405_10112523 | 3300031731 | Unclassified | 1847 |
| 1080 | Ga0307405_10133043 | 3300031731 | Bacteria | 1722 |
| 1081 | Ga0307405_10482364 | 3300031731 | Unclassified | 990 |
| 1082 | Ga0307405_10597284 | 3300031731 | Unclassified | 900 |
| 1083 | Ga0307413_10100156 | 3300031824 | Unclassified | 1912 |
| 1084 | Ga0307413_10463454 | 3300031824 | Unclassified | 1009 |
| 1085 | Ga0307413_10927710 | 3300031824 | Unclassified | 741 |
| 1086 | Ga0307410_10051926 | 3300031852 | Unclassified | 2766 |
| 1087 | Ga0307410_10079408 | 3300031852 | Bacteria | 2299 |
| 1088 | Ga0307410_10116868 | 3300031852 | Unclassified | 1939 |
| 1089 | Ga0307410_10124814 | 3300031852 | Bacteria | 1883 |
| 1090 | Ga0307410_10835309 | 3300031852 | Unclassified | 785 |
| 1091 | Ga0307406_10343830 | 3300031901 | Bacteria | 1163 |
| 1092 | Ga0307407_10084019 | 3300031903 | Unclassified | 1933 |
| 1093 | Ga0307412_10194730 | 3300031911 | Bacteria | 1535 |
| 1094 | Ga0307412_10542345 | 3300031911 | Bacteria | 975 |
| 1095 | Ga0307409_100074356 | 3300031995 | Unclassified | 2715 |
| 1096 | Ga0307409_100300793 | 3300031995 | Bacteria | 1492 |
| 1097 | Ga0307416_100028056 | 3300032002 | Bacteria | 4180 |
| 1098 | Ga0307416_100038313 | 3300032002 | Bacteria | 3698 |
| 1099 | Ga0307416_100059664 | 3300032002 | Bacteria | 3101 |
| 1100 | Ga0307416_100300829 | 3300032002 | Bacteria | 1594 |
| 1101 | Ga0307416_100374617 | 3300032002 | Unclassified | 1451 |
| 1102 | Ga0307416_100707017 | 3300032002 | Bacteria | 1097 |
| 1103 | Ga0307414_10097706 | 3300032004 | Bacteria | 2201 |
| 1104 | Ga0307414_10129721 | 3300032004 | Bacteria | 1955 |
| 1105 | Ga0307414_10349360 | 3300032004 | Bacteria | 1269 |
| 1106 | Ga0307414_10615760 | 3300032004 | Unclassified | 975 |
| 1107 | Ga0307414_10640988 | 3300032004 | Unclassified | 957 |
| 1108 | Ga0307414_11121239 | 3300032004 | Bacteria | 727 |
| 1109 | Ga0307411_10114535 | 3300032005 | Unclassified | 1937 |
| 1110 | Ga0307411_10117822 | 3300032005 | Unclassified | 1914 |
| 1111 | Ga0307411_10202710 | 3300032005 | Bacteria | 1525 |
| 1112 | Ga0307411_10435962 | 3300032005 | Bacteria | 1092 |
| 1113 | Ga0307411_10460682 | 3300032005 | Unclassified | 1066 |
| 1114 | Ga0307415_100010673 | 3300032126 | Bacteria | 5213 |
| 1115 | Ga0307415_100154027 | 3300032126 | Bacteria | 1773 |
| 1116 | Ga0307415_100668424 | 3300032126 | Unclassified | 933 |
| 1117 | Ga0307415_101172548 | 3300032126 | Unclassified | 722 |
| 1118 | Ga0373930_0002854 | 3300034816 | Bacteria | 2711 |
| 1119 | Ga0373948_0018575 | 3300034817 | Unclassified | 1307 |
| 1120 | Ga0373950_0000492 | 3300034818 | Bacteria | 4841 |
| 1121 | Ga0373958_0024338 | 3300034819 | Bacteria | 1145 |
| 1122 | Ga0373928_0006977 | 3300035084 | Bacteria | 2177 |
| 1123 | Ga0373929_0000407 | 3300035085 | Bacteria | 8103 |
| 1124 | Ga0373949_0000966 | 3300035090 | Bacteria | 8928 |
| 1125 | Ga0373952_0000798 | 3300035092 | Bacteria | 5659 |
| 1126 | Ga0373923_0079124 | 3300035111 | Unclassified | 1424 |
| 1127 | Ga0373939_0030625 | 3300035114 | Bacteria | 1549 |
| 1128 | Ga0373939_0109649 | 3300035114 | Unclassified | 959 |
| 1129 | Ga0373941_0013295 | 3300035115 | Bacteria | 2173 |
| 1130 | Ga0373941_0183910 | 3300035115 | Unclassified | 786 |
| 1131 | Ga0373953_0220071 | 3300035117 | Bacteria | 822 |
| 1132 | Ga0373954_0051964 | 3300035118 | Bacteria | 1926 |
| 1133 | Ga0373954_0184461 | 3300035118 | Bacteria | 1024 |
| 1134 | Ga0373960_0217085 | 3300035121 | Unclassified | 683 |
| 1135 | Ga0373943_0021226 | 3300035170 | Bacteria | 2997 |
| 1136 | Ga0373943_0185733 | 3300035170 | Bacteria | 1145 |
| 1137 | Ga0373943_0217615 | 3300035170 | Unclassified | 1063 |
| 1138 | Ga0373943_0224021 | 3300035170 | Bacteria | 1048 |
| 1139 | Ga0373946_0029315 | 3300035171 | Bacteria | 2190 |
| 1140 | Ga0373946_0318098 | 3300035171 | Bacteria | 773 |
| 1141 | Ga0373955_0003019 | 3300035172 | Bacteria | 7378 |
| 1142 | Ga0373955_0046443 | 3300035172 | Unclassified | 2348 |
| 1143 | Ga0373955_0076519 | 3300035172 | Bacteria | 1883 |
| 1144 | Ga0373955_0442855 | 3300035172 | Unclassified | 791 |
| 1145 | Ga0373955_0842861 | 3300035172 | Unclassified | 564 |
| 1146 | Ga0373942_0001566 | 3300035207 | Bacteria | 5861 |
| 1147 | Ga0373924_0021449 | 3300035410 | Unclassified | 2520 |
| 1148 | Ga0373924_0140817 | 3300035410 | Unclassified | 1052 |
| 1149 | Ga0373931_0007480 | 3300035691 | Bacteria | 5143 |
| 1150 | Ga0373935_0083599 | 3300035692 | Bacteria | 2078 |
| 1151 | Ga0373935_0134413 | 3300035692 | Bacteria | 1665 |
| 1152 | Ga0373935_0164017 | 3300035692 | Unclassified | 1516 |
| 1153 | Ga0373935_0185751 | 3300035692 | Bacteria | 1429 |
| 1154 | Ga0373927_0155381 | 3300035695 | Unclassified | 1498 |
| 1155 | Ga0373933_0418322 | 3300035724 | Bacteria | 875 |
| 1156 | Ga0373933_0740285 | 3300035724 | Unclassified | 647 |
| 1157 | Ga0373947_0003818 | 3300035725 | Bacteria | 8873 |
| 1158 | Ga0373937_0012405 | 3300036401 | Bacteria | 7495 |
| 1159 | Ga0373937_0176206 | 3300036401 | Bacteria | 2007 |
| 1160 | Ga0373937_0381356 | 3300036401 | Bacteria | 1337 |
| 1161 | Ga0373937_0393320 | 3300036401 | Unclassified | 1315 |
| 1162 | Ga0373937_0608866 | 3300036401 | Unclassified | 1037 |
| 1163 | Ga0373937_1823949 | 3300036401 | Bacteria | 555 |
| 1164 | Ga0373925_0266622 | 3300037068 | Bacteria | 1377 |
| 1165 | Ga0373925_0482653 | 3300037068 | Bacteria | 1017 |
| 1166 | Ga0373925_0542746 | 3300037068 | Bacteria | 956 |
| 1167 | Ga0373925_1199410 | 3300037068 | Bacteria | 624 |
| 1168 | Ga0395900_0459263 | 3300037418 | Unclassified | 1229 |
| 1169 | Ga0395905_0197773 | 3300037471 | Bacteria | 1885 |
| 1170 | Ga0242420_027094 | 3300038996 | Unclassified | 1049 |
| 1171 | Ga0436365_0956175 | 3300039437 | Bacteria | 2742 |
| 1172 | Ga0436365_1732685 | 3300039437 | Bacteria | 2188 |
| 1173 | Ga0439439_0093016 | 3300041406 | Bacteria | 825 |
| 1174 | Ga0439453_0017767 | 3300041408 | Bacteria | 1252 |
| 1175 | Ga0439453_0026277 | 3300041408 | Bacteria | 1078 |
| 1176 | Ga0439431_0006753 | 3300041997 | Unclassified | 2547 |
| 1177 | Ga0439433_0001889 | 3300041999 | Bacteria | 4381 |
| 1178 | Ga0439437_014446 | 3300042000 | Unclassified | 923 |
| 1179 | Ga0439462_0051606 | 3300042015 | Bacteria | 1106 |
| 1180 | Ga0450892_007492 | 3300042130 | Bacteria | 921 |
| 1181 | Ga0439446_0028655 | 3300042156 | Bacteria | 1604 |
| 1182 | Ga0439446_0095397 | 3300042156 | Unclassified | 935 |
| 1183 | Ga0439446_0251776 | 3300042156 | Bacteria | 609 |
| 1184 | Ga0439458_0092357 | 3300042157 | Bacteria | 780 |
| 1185 | Ga0439434_0099914 | 3300042435 | Bacteria | 934 |
| 1186 | Ga0439435_0052341 | 3300042436 | Bacteria | 1172 |
| 1187 | Ga0439435_0069724 | 3300042436 | Bacteria | 1039 |
| 1188 | Ga0439464_0061668 | 3300042439 | Bacteria | 1098 |
| 1189 | Ga0439460_0040424 | 3300042461 | Bacteria | 1366 |
| 1190 | Ga0439460_0063976 | 3300042461 | Bacteria | 1128 |
| 1191 | Ga0439460_0123444 | 3300042461 | Bacteria | 849 |
| 1192 | Ga0450916_034769 | 3300042530 | Bacteria | 747 |
| 1193 | Ga0451577_0424665 | 3300042876 | Unclassified | 1207 |
| 1194 | Ga0439440_0033118 | 3300042993 | Bacteria | 1230 |
| 1195 | Ga0439440_0098351 | 3300042993 | Unclassified | 793 |
| 1196 | Ga0466963_0184194 | 3300044694 | Bacteria | 1458 |
| 1197 | Ga0466963_0239302 | 3300044694 | Bacteria | 1273 |
| 1198 | Ga0466957_0155932 | 3300044842 | Bacteria | 1480 |
| 1199 | Ga0451576_0003703 | 3300045051 | Bacteria | 20672 |
| 1200 | Ga0451576_0301734 | 3300045051 | Bacteria | 1675 |
| 1201 | Ga0466967_0493469 | 3300045976 | Bacteria | 1201 |
| 1202 | Ga0495592_0025040 | 3300046454 | Bacteria | 4532 |
| 1203 | Ga0495592_0139872 | 3300046454 | Bacteria | 1685 |
| 1204 | Ga0495603_0028319 | 3300046455 | Unclassified | 3379 |
| 1205 | Ga0495603_0042909 | 3300046455 | Unclassified | 2702 |
| 1206 | Ga0495603_0358636 | 3300046455 | Bacteria | 836 |
| 1207 | Ga0495629_0085053 | 3300046459 | Unclassified | 2207 |
| 1208 | Ga0495629_0206389 | 3300046459 | Unclassified | 1358 |
| 1209 | Ga0495580_0316248 | 3300046472 | Viruses | 1061 |
| 1210 | Ga0495582_0181798 | 3300046473 | Bacteria | 1198 |
| 1211 | Ga0495582_0472333 | 3300046473 | Bacteria | 725 |
| 1212 | Ga0495639_0076786 | 3300046475 | Unclassified | 1550 |
| 1213 | Ga0495664_0171598 | 3300046477 | Bacteria | 1316 |
| 1214 | Ga0495664_0296679 | 3300046477 | Bacteria | 976 |
| 1215 | Ga0495584_0025210 | 3300046491 | Bacteria | 3014 |
| 1216 | Ga0495584_0410163 | 3300046491 | Unclassified | 689 |
| 1217 | Ga0495594_0029180 | 3300046499 | Unclassified | 2981 |
| 1218 | Ga0495594_0066860 | 3300046499 | Bacteria | 1994 |
| 1219 | Ga0495594_0252872 | 3300046499 | Bacteria | 1004 |
| 1220 | Ga0495594_0353963 | 3300046499 | Bacteria | 836 |
| 1221 | Ga0495608_0003942 | 3300046511 | Bacteria | 10667 |
| 1222 | Ga0495618_0086045 | 3300046514 | Bacteria | 2010 |
| 1223 | Ga0495618_0617134 | 3300046514 | Bacteria | 644 |
| 1224 | Ga0495630_0009709 | 3300046517 | Bacteria | 6922 |
| 1225 | Ga0495630_1022797 | 3300046517 | Unclassified | 628 |
| 1226 | Ga0495643_0009097 | 3300046522 | Bacteria | 6222 |
| 1227 | Ga0495644_0096332 | 3300046523 | Unclassified | 1118 |
| 1228 | Ga0495663_0017329 | 3300046525 | Bacteria | 2043 |
| 1229 | Ga0495652_0245893 | 3300046529 | Unclassified | 1328 |
| 1230 | Ga0495652_0635473 | 3300046529 | Unclassified | 724 |
| 1231 | Ga0495654_0322069 | 3300046530 | Unclassified | 627 |
| 1232 | Ga0495665_0483848 | 3300046531 | Bacteria | 624 |
| 1233 | Ga0495640_0047607 | 3300046533 | Bacteria | 2967 |
| 1234 | Ga0495640_0078023 | 3300046533 | Unclassified | 2207 |
| 1235 | Ga0495640_0416169 | 3300046533 | Bacteria | 824 |
| 1236 | Ga0495587_0051732 | 3300046536 | Bacteria | 2427 |
| 1237 | Ga0495587_0176508 | 3300046536 | Bacteria | 1212 |
| 1238 | Ga0495598_0012654 | 3300046537 | Unclassified | 2076 |
| 1239 | Ga0495598_0117596 | 3300046537 | Bacteria | 898 |
| 1240 | Ga0495598_0146081 | 3300046537 | Unclassified | 822 |
| 1241 | Ga0495609_0019629 | 3300046538 | Bacteria | 3125 |
| 1242 | Ga0495621_0003364 | 3300046539 | Bacteria | 4412 |
| 1243 | Ga0495621_0037939 | 3300046539 | Bacteria | 1678 |
| 1244 | Ga0495621_0109503 | 3300046539 | Unclassified | 1058 |
| 1245 | Ga0495621_0116445 | 3300046539 | Unclassified | 1029 |
| 1246 | Ga0495645_0000450 | 3300046543 | Bacteria | 28247 |
| 1247 | Ga0495633_0093088 | 3300046558 | Unclassified | 1401 |
| 1248 | Ga0495667_0040064 | 3300046559 | Bacteria | 3112 |
| 1249 | Ga0495634_0081249 | 3300046642 | Bacteria | 2120 |
| 1250 | Ga0495634_0326616 | 3300046642 | Bacteria | 923 |
| 1251 | Ga0495634_0422055 | 3300046642 | Bacteria | 790 |
| 1252 | Ga0495611_0197354 | 3300046648 | Bacteria | 939 |
| 1253 | Ga0495635_0053736 | 3300046663 | Bacteria | 2775 |
| 1254 | Ga0495635_0088667 | 3300046663 | Bacteria | 2117 |
| 1255 | Ga0495659_0015579 | 3300046664 | Bacteria | 2501 |
| 1256 | Ga0495659_0191227 | 3300046664 | Unclassified | 836 |
| 1257 | Ga0495588_0057859 | 3300046674 | Bacteria | 2003 |
| 1258 | Ga0495657_0311723 | 3300046675 | Bacteria | 937 |
| 1259 | Ga0495623_0047499 | 3300046679 | Unclassified | 2725 |
| 1260 | Ga0495647_0214209 | 3300046681 | Bacteria | 848 |
| 1261 | Ga0495658_0025322 | 3300046683 | Bacteria | 3170 |
| 1262 | Ga0495658_0090500 | 3300046683 | Bacteria | 1811 |
| 1263 | Ga0495658_0168637 | 3300046683 | Unclassified | 1354 |
| 1264 | Ga0495658_0580717 | 3300046683 | Bacteria | 718 |
| 1265 | Ga0495669_0004081 | 3300046684 | Bacteria | 6006 |
| 1266 | Ga0495669_0007347 | 3300046684 | Bacteria | 4616 |
| 1267 | Ga0495669_0103649 | 3300046684 | Unclassified | 1323 |
| 1268 | Ga0495669_0333198 | 3300046684 | Unclassified | 733 |
| 1269 | Ga0495613_0001676 | 3300046689 | Bacteria | 16870 |
| 1270 | Ga0495670_0077989 | 3300046691 | Bacteria | 1685 |
| 1271 | Ga0495600_0092987 | 3300046809 | Unclassified | 1967 |
| 1272 | Ga0495600_0332280 | 3300046809 | Bacteria | 954 |
| 1273 | Ga0495636_0043766 | 3300047318 | Bacteria | 1863 |
| 1274 | Ga0495674_0082858 | 3300047319 | Unclassified | 2750 |
| 1275 | Ga0495674_0091091 | 3300047319 | Bacteria | 2605 |
| 1276 | Ga0495674_0233224 | 3300047319 | Unclassified | 1518 |
| 1277 | Ga0495676_0071461 | 3300047321 | Unclassified | 2668 |
| 1278 | Ga0495675_0452837 | 3300047444 | Unclassified | 742 |
| 1279 | Ga0495675_0476815 | 3300047444 | Bacteria | 719 |
| 1280 | Ga0495677_0021678 | 3300047445 | Bacteria | 2329 |
| 1281 | Ga0495685_063483 | 3300047447 | Unclassified | 1243 |
| 1282 | Ga0495684_0002679 | 3300047471 | Bacteria | 14108 |
| 1283 | Ga0495684_0025447 | 3300047471 | Unclassified | 4548 |
| 1284 | Ga0495593_0174023 | 3300047673 | Bacteria | 1085 |
| 1285 | Ga0495602_0401247 | 3300048088 | Unclassified | 978 |
| 1286 | Ga0496100_0005315 | 3300048903 | Bacteria | 6921 |
| 1287 | Ga0496100_1547020 | 3300048903 | Unclassified | 524 |
| 1288 | Ga0496101_0000338 | 3300048904 | Bacteria | 31903 |
| 1289 | Ga0496101_0163598 | 3300048904 | Bacteria | 1708 |
| 1290 | Ga0496101_0504818 | 3300048904 | Bacteria | 955 |
| 1291 | Ga0496102_0120104 | 3300048905 | Unclassified | 2454 |
| 1292 | Ga0496102_0365200 | 3300048905 | Bacteria | 1359 |
| 1293 | Ga0496104_0011885 | 3300048907 | Bacteria | 7814 |
| 1294 | Ga0496104_0063755 | 3300048907 | Bacteria | 3496 |
| 1295 | Ga0496104_0116270 | 3300048907 | Bacteria | 2567 |
| 1296 | Ga0496104_0641105 | 3300048907 | Bacteria | 971 |
| 1297 | Ga0496104_0791916 | 3300048907 | Unclassified | 854 |
| 1298 | Ga0496105_0027444 | 3300048908 | Bacteria | 4652 |
| 1299 | Ga0496105_0263662 | 3300048908 | Bacteria | 1393 |
| 1300 | Ga0496105_0522093 | 3300048908 | Bacteria | 930 |
| 1301 | Ga0496105_0534097 | 3300048908 | Unclassified | 917 |
| 1302 | Ga0496106_0080483 | 3300048909 | Unclassified | 2502 |
| 1303 | Ga0496107_0007329 | 3300048910 | Bacteria | 7605 |
| 1304 | Ga0496108_0228402 | 3300048911 | Bacteria | 1618 |
| 1305 | Ga0496108_0685751 | 3300048911 | Bacteria | 889 |
| 1306 | Ga0496108_0934304 | 3300048911 | Bacteria | 743 |
| 1307 | Ga0496109_0079029 | 3300048912 | Bacteria | 3030 |
| 1308 | Ga0496109_0165002 | 3300048912 | Bacteria | 2076 |
| 1309 | Ga0496109_0585075 | 3300048912 | Bacteria | 1052 |
| 1310 | Ga0496109_0689410 | 3300048912 | Bacteria | 959 |
| 1311 | Ga0496110_0659312 | 3300048913 | Unclassified | 947 |
| 1312 | Ga0496111_0221188 | 3300048914 | Bacteria | 1407 |
| 1313 | Ga0496111_1030007 | 3300048914 | Bacteria | 589 |
| 1314 | Ga0496112_0002810 | 3300048915 | Bacteria | 14131 |
| 1315 | Ga0496112_0086620 | 3300048915 | Bacteria | 3099 |
| 1316 | Ga0496112_0167090 | 3300048915 | Bacteria | 2166 |
| 1317 | Ga0496112_0216587 | 3300048915 | Bacteria | 1871 |
| 1318 | Ga0496112_0242980 | 3300048915 | Bacteria | 1753 |
| 1319 | Ga0496112_0422774 | 3300048915 | Bacteria | 1271 |
| 1320 | Ga0496112_0456036 | 3300048915 | Unclassified | 1216 |
| 1321 | Ga0496112_0741276 | 3300048915 | Bacteria | 909 |
| 1322 | Ga0496113_0379672 | 3300048916 | Bacteria | 1134 |
| 1323 | Ga0496114_0001212 | 3300048917 | Bacteria | 19503 |
| 1324 | Ga0496114_0050503 | 3300048917 | Bacteria | 3462 |
| 1325 | Ga0496114_0084214 | 3300048917 | Bacteria | 2692 |
| 1326 | Ga0496114_0124083 | 3300048917 | Bacteria | 2224 |
| 1327 | Ga0496114_0198014 | 3300048917 | Bacteria | 1759 |
| 1328 | Ga0496114_0222524 | 3300048917 | Unclassified | 1657 |
| 1329 | Ga0496114_0357960 | 3300048917 | Bacteria | 1291 |
| 1330 | Ga0496114_0508159 | 3300048917 | Unclassified | 1066 |
| 1331 | Ga0496115_0125497 | 3300048918 | Bacteria | 2114 |
| 1332 | Ga0501299_060055 | 3300049522 | Unclassified | 804 |
| 1333 | Ga0501031_0169692 | 3300049568 | Bacteria | 1426 |
| 1334 | Ga0501031_0245236 | 3300049568 | Bacteria | 1164 |
| 1335 | Ga0501031_0281248 | 3300049568 | Bacteria | 1079 |
| 1336 | Ga0501034_0158536 | 3300049571 | Bacteria | 2236 |
| 1337 | Ga0501036_0258953 | 3300049572 | Bacteria | 1457 |
| 1338 | Ga0501036_0316407 | 3300049572 | Bacteria | 1304 |
| 1339 | Ga0501036_0355452 | 3300049572 | Bacteria | 1223 |
| 1340 | Ga0501036_0632035 | 3300049572 | Unclassified | 887 |
| 1341 | Ga0501037_0177620 | 3300049573 | Bacteria | 1512 |
| 1342 | Ga0501037_0531813 | 3300049573 | Bacteria | 795 |
| 1343 | Ga0501038_0043210 | 3300049574 | Bacteria | 3920 |
| 1344 | Ga0501038_0134017 | 3300049574 | Bacteria | 2031 |
| 1345 | Ga0501039_0005083 | 3300049575 | Bacteria | 9967 |
| 1346 | Ga0501040_0009144 | 3300049576 | Bacteria | 6452 |
| 1347 | Ga0501040_0021727 | 3300049576 | Bacteria | 4290 |
| 1348 | Ga0501040_0049618 | 3300049576 | Bacteria | 2870 |
| 1349 | Ga0501040_0422137 | 3300049576 | Bacteria | 959 |
| 1350 | Ga0501040_0617110 | 3300049576 | Bacteria | 784 |
| 1351 | Ga0501041_0080818 | 3300049577 | Bacteria | 2001 |
| 1352 | Ga0501041_0944903 | 3300049577 | Unclassified | 554 |
| 1353 | Ga0501042_0003809 | 3300049578 | Bacteria | 9538 |
| 1354 | Ga0501042_0085038 | 3300049578 | Bacteria | 2268 |
| 1355 | Ga0501043_0038916 | 3300049579 | Bacteria | 3739 |
| 1356 | Ga0501046_0047476 | 3300049580 | Bacteria | 3404 |
| 1357 | Ga0501046_0054245 | 3300049580 | Bacteria | 3154 |
| 1358 | Ga0501047_0453613 | 3300049581 | Bacteria | 1111 |
| 1359 | Ga0501048_0049799 | 3300049582 | Bacteria | 2985 |
| 1360 | Ga0501048_0279882 | 3300049582 | Unclassified | 1186 |
| 1361 | Ga0501048_1149577 | 3300049582 | Bacteria | 558 |
| 1362 | Ga0501068_0082561 | 3300049584 | Bacteria | 1974 |
| 1363 | Ga0501068_0511945 | 3300049584 | Bacteria | 779 |
| 1364 | Ga0501071_0015832 | 3300049587 | Bacteria | 5179 |
| 1365 | Ga0501071_0192495 | 3300049587 | Bacteria | 1530 |
| 1366 | Ga0501071_0934381 | 3300049587 | Bacteria | 669 |
| 1367 | Ga0501072_0006572 | 3300049588 | Bacteria | 8854 |
| 1368 | Ga0501072_0026593 | 3300049588 | Bacteria | 4511 |
| 1369 | Ga0501073_0326630 | 3300049589 | Bacteria | 1059 |
| 1370 | Ga0501075_0023042 | 3300049591 | Bacteria | 4555 |
| 1371 | Ga0501075_0110545 | 3300049591 | Bacteria | 2089 |
| 1372 | Ga0501075_0468852 | 3300049591 | Unclassified | 960 |
| 1373 | Ga0501076_0040773 | 3300049592 | Bacteria | 3650 |
| 1374 | Ga0501076_0136177 | 3300049592 | Bacteria | 1994 |
| 1375 | Ga0501076_0423239 | 3300049592 | Bacteria | 1096 |
| 1376 | Ga0501076_0656617 | 3300049592 | Bacteria | 865 |
| 1377 | Ga0501077_0047177 | 3300049593 | Bacteria | 2737 |
| 1378 | Ga0501077_0072533 | 3300049593 | Bacteria | 2182 |
| 1379 | Ga0501216_072708 | 3300049660 | Unclassified | 714 |
| 1380 | Ga0501221_035984 | 3300049704 | Unclassified | 1059 |
| 1381 | Ga0501079_0005197 | 3300049741 | Bacteria | 9676 |
| 1382 | Ga0501079_0087472 | 3300049741 | Bacteria | 2412 |
| 1383 | Ga0501079_0669540 | 3300049741 | Bacteria | 817 |
| 1384 | Ga0501080_0425907 | 3300049742 | Bacteria | 1192 |
| 1385 | Ga0501081_0008696 | 3300049743 | Bacteria | 6598 |
| 1386 | Ga0501081_0041776 | 3300049743 | Bacteria | 3141 |
| 1387 | Ga0501081_0588644 | 3300049743 | Unclassified | 832 |
| 1388 | Ga0501083_0073605 | 3300049744 | Bacteria | 2271 |
| 1389 | Ga0501035_0192170 | 3300049822 | Bacteria | 1755 |
| 1390 | Ga0501035_0933073 | 3300049822 | Unclassified | 686 |
| 1391 | Ga0501035_0961356 | 3300049822 | Bacteria | 673 |
| 1392 | Ga0501044_0092948 | 3300049823 | Bacteria | 3042 |
| 1393 | Ga0501044_1290198 | 3300049823 | Unclassified | 597 |
| 1394 | Ga0501045_0004657 | 3300049824 | Bacteria | 9472 |
| 1395 | Ga0501045_0241444 | 3300049824 | Unclassified | 1345 |
| 1396 | Ga0501045_0264909 | 3300049824 | Bacteria | 1279 |
| 1397 | nmdc:mga03683_1149_c1 | 3300050489 | Bacteria | 7787 |
| 1398 | nmdc:mga00v17_7255_c1 | 3300050491 | Bacteria | 5906 |
| 1399 | nmdc:mga0yw44_555493_c1 | 3300050492 | Unclassified | 780 |
| 1400 | nmdc:mga05p37_11071_c1 | 3300050507 | Bacteria | 10716 |
| 1401 | nmdc:mga05p37_138803_c1 | 3300050507 | Bacteria | 2979 |
| 1402 | nmdc:mga05p37_139331_c1 | 3300050507 | Unclassified | 2973 |
| 1403 | nmdc:mga05p37_158861_c1 | 3300050507 | Bacteria | 2761 |
| 1404 | nmdc:mga05p37_1965492_c1 | 3300050507 | Unclassified | 555 |
| 1405 | nmdc:mga05p37_1997_c1 | 3300050507 | Bacteria | 23815 |
| 1406 | nmdc:mga05p37_20363_c1 | 3300050507 | Bacteria | 8026 |
| 1407 | nmdc:mga05p37_23209_c1 | 3300050507 | Bacteria | 7526 |
| 1408 | nmdc:mga05p37_24698_c1 | 3300050507 | Bacteria | 7305 |
| 1409 | nmdc:mga05p37_25595_c1 | 3300050507 | Bacteria | 7178 |
| 1410 | nmdc:mga05p37_26118_c2 | 3300050507 | Bacteria | 5344 |
| 1411 | nmdc:mga05p37_34921_c1 | 3300050507 | Bacteria | 6162 |
| 1412 | nmdc:mga05p37_37736_c1 | 3300050507 | Bacteria | 5926 |
| 1413 | nmdc:mga05p37_43651_c1 | 3300050507 | Bacteria | 5516 |
| 1414 | nmdc:mga05p37_44023_c1 | 3300050507 | Bacteria | 5492 |
| 1415 | nmdc:mga05p37_48901_c1 | 3300050507 | Bacteria | 5200 |
| 1416 | nmdc:mga05p37_5217_c1 | 3300050507 | Bacteria | 15249 |
| 1417 | nmdc:mga05p37_73083_c1 | 3300050507 | Bacteria | 4220 |
| 1418 | nmdc:mga05p37_91576_c1 | 3300050507 | Bacteria | 3747 |
| 1419 | nmdc:mga05p37_967626_c1 | 3300050507 | Bacteria | 909 |
| 1420 | nmdc:mga09592_1189676_c1 | 3300050508 | Bacteria | 630 |
| 1421 | nmdc:mga09592_13559_c1 | 3300050508 | Bacteria | 6657 |
| 1422 | nmdc:mga09592_139923_c1 | 3300050508 | Unclassified | 2086 |
| 1423 | nmdc:mga09592_149535_c1 | 3300050508 | Unclassified | 2014 |
| 1424 | nmdc:mga09592_19921_c1 | 3300050508 | Bacteria | 5511 |
| 1425 | nmdc:mga09592_201873_c1 | 3300050508 | Bacteria | 1722 |
| 1426 | nmdc:mga09592_23513_c1 | 3300050508 | Bacteria | 5090 |
| 1427 | nmdc:mga09592_26276_c1 | 3300050508 | Bacteria | 4822 |
| 1428 | nmdc:mga09592_38159_c1 | 3300050508 | Bacteria | 4031 |
| 1429 | nmdc:mga09592_456600_c1 | 3300050508 | Bacteria | 1102 |
| 1430 | nmdc:mga09592_68792_c1 | 3300050508 | Bacteria | 3003 |
| 1431 | nmdc:mga0qj67_194295_c1 | 3300050509 | Bacteria | 1649 |
| 1432 | nmdc:mga0qj67_245188_c1 | 3300050509 | Bacteria | 1454 |
| 1433 | nmdc:mga0qj67_255819_c1 | 3300050509 | Bacteria | 1421 |
| 1434 | nmdc:mga0qj67_27328_c1 | 3300050509 | Bacteria | 4422 |
| 1435 | nmdc:mga0qj67_7153_c1 | 3300050509 | Bacteria | 8234 |
| 1436 | nmdc:mga0qj67_7629_c1 | 3300050509 | Bacteria | 7992 |
| 1437 | nmdc:mga06r32_1076344_c1 | 3300050510 | Bacteria | 754 |
| 1438 | nmdc:mga06r32_132439_c1 | 3300050510 | Bacteria | 2466 |
| 1439 | nmdc:mga06r32_14936_c1 | 3300050510 | Bacteria | 7048 |
| 1440 | nmdc:mga06r32_270474_c1 | 3300050510 | Unclassified | 1687 |
| 1441 | nmdc:mga06r32_29574_c1 | 3300050510 | Bacteria | 5137 |
| 1442 | nmdc:mga06r32_616343_c1 | 3300050510 | Unclassified | 1055 |
| 1443 | nmdc:mga06r32_655429_c1 | 3300050510 | Unclassified | 1018 |
| 1444 | nmdc:mga06r32_86132_c1 | 3300050510 | Bacteria | 3064 |
| 1445 | nmdc:mga06r32_9476_c1 | 3300050510 | Bacteria | 8790 |
| 1446 | nmdc:mga08y16_108808_c1 | 3300050511 | Bacteria | 2886 |
| 1447 | nmdc:mga08y16_116259_c1 | 3300050511 | Unclassified | 2784 |
| 1448 | nmdc:mga08y16_1178584_c1 | 3300050511 | Bacteria | 738 |
| 1449 | nmdc:mga08y16_1367_c1 | 3300050511 | Bacteria | 24369 |
| 1450 | nmdc:mga08y16_1568_c1 | 3300050511 | Bacteria | 23067 |
| 1451 | nmdc:mga08y16_227293_c1 | 3300050511 | Unclassified | 1931 |
| 1452 | nmdc:mga08y16_2507_c1 | 3300050511 | Bacteria | 18886 |
| 1453 | nmdc:mga08y16_2643_c1 | 3300050511 | Bacteria | 18424 |
| 1454 | nmdc:mga08y16_266469_c1 | 3300050511 | Bacteria | 1769 |
| 1455 | nmdc:mga08y16_273804_c1 | 3300050511 | Unclassified | 1742 |
| 1456 | nmdc:mga08y16_2862_c1 | 3300050511 | Bacteria | 17748 |
| 1457 | nmdc:mga08y16_352547_c1 | 3300050511 | Bacteria | 1511 |
| 1458 | nmdc:mga08y16_390387_c1 | 3300050511 | Bacteria | 1426 |
| 1459 | nmdc:mga08y16_449722_c1 | 3300050511 | Bacteria | 1314 |
| 1460 | nmdc:mga08y16_4998_c1 | 3300050511 | Bacteria | 13866 |
| 1461 | nmdc:mga08y16_658_c1 | 3300050511 | Bacteria | 32511 |
| 1462 | nmdc:mga08y16_67477_c1 | 3300050511 | Unclassified | 3731 |
| 1463 | nmdc:mga08y16_9_c1 | 3300050511 | Bacteria | 566088 |
| 1464 | nmdc:mga0n895_1037810_c1 | 3300050512 | Unclassified | 799 |
| 1465 | nmdc:mga0n895_13596_c1 | 3300050512 | Bacteria | 7353 |
| 1466 | nmdc:mga0n895_141_c1 | 3300050512 | Bacteria | 43611 |
| 1467 | nmdc:mga0n895_166078_c1 | 3300050512 | Bacteria | 2239 |
| 1468 | nmdc:mga0n895_19824_c1 | 3300050512 | Bacteria | 6259 |
| 1469 | nmdc:mga0n895_267490_c1 | 3300050512 | Bacteria | 1734 |
| 1470 | nmdc:mga0n895_304759_c1 | 3300050512 | Bacteria | 1615 |
| 1471 | nmdc:mga0n895_343217_c1 | 3300050512 | Unclassified | 1512 |
| 1472 | nmdc:mga0n895_35782_c1 | 3300050512 | Bacteria | 4790 |
| 1473 | nmdc:mga0n895_472679_c1 | 3300050512 | Bacteria | 1265 |
| 1474 | nmdc:mga0n895_476418_c1 | 3300050512 | Bacteria | 1259 |
| 1475 | nmdc:mga0n895_546195_c1 | 3300050512 | Unclassified | 1165 |
| 1476 | nmdc:mga0n895_58404_c1 | 3300050512 | Bacteria | 3804 |
| 1477 | nmdc:mga0n895_602783_c1 | 3300050512 | Bacteria | 1100 |
| 1478 | nmdc:mga0n895_72372_c1 | 3300050512 | Bacteria | 3420 |
| 1479 | nmdc:mga0n895_737660_c1 | 3300050512 | Bacteria | 979 |
| 1480 | nmdc:mga0n895_81880_c1 | 3300050512 | Unclassified | 3217 |
| 1481 | nmdc:mga0rr50_1006114_c1 | 3300050513 | Bacteria | 710 |
| 1482 | nmdc:mga0rr50_12990_c1 | 3300050513 | Bacteria | 5404 |
| 1483 | nmdc:mga0rr50_14183_c1 | 3300050513 | Bacteria | 5218 |
| 1484 | nmdc:mga0rr50_176227_c1 | 3300050513 | Bacteria | 1745 |
| 1485 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 1486 | nmdc:mga0rr50_316066_c1 | 3300050513 | Bacteria | 1309 |
| 1487 | nmdc:mga0rr50_398071_c1 | 3300050513 | Bacteria | 1163 |
| 1488 | nmdc:mga0rr50_539301_c1 | 3300050513 | Unclassified | 993 |
| 1489 | nmdc:mga0rr50_560727_c1 | 3300050513 | Unclassified | 973 |
| 1490 | nmdc:mga0rr50_682119_c1 | 3300050513 | Bacteria | 877 |
| 1491 | nmdc:mga0rr50_761091_c1 | 3300050513 | Bacteria | 827 |
| 1492 | nmdc:mga0rr50_8550_c1 | 3300050513 | Bacteria | 6378 |
| 1493 | nmdc:mga0rr50_8679_c1 | 3300050513 | Bacteria | 6338 |
| 1494 | nmdc:mga08x19_148053_c1 | 3300050514 | Unclassified | 1589 |
| 1495 | nmdc:mga08x19_153311_c1 | 3300050514 | Bacteria | 1562 |
| 1496 | nmdc:mga08x19_191333_c1 | 3300050514 | Bacteria | 1400 |
| 1497 | nmdc:mga08x19_3155_c1 | 3300050514 | Bacteria | 9893 |
| 1498 | nmdc:mga08x19_34798_c1 | 3300050514 | Unclassified | 3185 |
| 1499 | nmdc:mga08x19_416343_c1 | 3300050514 | Unclassified | 944 |
| 1500 | nmdc:mga08x19_92_c1 | 3300050514 | Bacteria | 80986 |
| 1501 | nmdc:mga0a205_112707_c2 | 3300050515 | Bacteria | 2158 |
| 1502 | nmdc:mga0a205_120196_c1 | 3300050515 | Unclassified | 2526 |
| 1503 | nmdc:mga0a205_12067_c2 | 3300050515 | Bacteria | 5976 |
| 1504 | nmdc:mga0a205_1225776_c1 | 3300050515 | Bacteria | 598 |
| 1505 | nmdc:mga0a205_131663_c1 | 3300050515 | Bacteria | 2401 |
| 1506 | nmdc:mga0a205_132875_c1 | 3300050515 | Unclassified | 2389 |
| 1507 | nmdc:mga0a205_151535_c1 | 3300050515 | Unclassified | 2218 |
| 1508 | nmdc:mga0a205_167404_c1 | 3300050515 | Unclassified | 2094 |
| 1509 | nmdc:mga0a205_219892_c1 | 3300050515 | Bacteria | 1785 |
| 1510 | nmdc:mga0a205_2573_c1 | 3300050515 | Bacteria | 15998 |
| 1511 | nmdc:mga0a205_281542_c1 | 3300050515 | Unclassified | 1538 |
| 1512 | nmdc:mga0a205_370522_c1 | 3300050515 | Bacteria | 1298 |
| 1513 | nmdc:mga0a205_394862_c1 | 3300050515 | Bacteria | 1247 |
| 1514 | nmdc:mga0a205_532506_c1 | 3300050515 | Bacteria | 1031 |
| 1515 | nmdc:mga0a205_649189_c1 | 3300050515 | Bacteria | 907 |
| 1516 | nmdc:mga0a205_676287_c1 | 3300050515 | Bacteria | 883 |
| 1517 | nmdc:mga0sz30_222545_c1 | 3300050516 | Bacteria | 839 |
| 1518 | Ga0495601_0003730 | 3300053077 | Bacteria | 8770 |
| 1519 | Ga0495601_0068407 | 3300053077 | Bacteria | 2264 |
| 1520 | Ga0495601_0135362 | 3300053077 | Bacteria | 1606 |
| 1521 | Ga0495595_0012548 | 3300053084 | Bacteria | 3564 |
| 1522 | Ga0495595_0405849 | 3300053084 | Bacteria | 691 |
| 1523 | Ga0495619_0006567 | 3300053085 | Bacteria | 7357 |
| 1524 | Ga0495619_0280366 | 3300053085 | Bacteria | 1155 |
| 1525 | Ga0495619_0433888 | 3300053085 | Bacteria | 906 |
| 1526 | Ga0495619_0769263 | 3300053085 | Unclassified | 652 |
| 1527 | Ga0500628_043052 | 3300053129 | Bacteria | 1040 |
| 1528 | Ga0501084_0009574 | 3300054114 | Bacteria | 8018 |
| 1529 | Ga0501084_0043281 | 3300054114 | Bacteria | 3767 |
| 1530 | Ga0501084_0359012 | 3300054114 | Unclassified | 1231 |
| 1531 | Ga0501084_1006567 | 3300054114 | Unclassified | 700 |
| 1532 | Ga0590071_000739 | 3300059421 | Bacteria | 9160 |
| 1533 | Ga0590071_005043 | 3300059421 | Bacteria | 3187 |
| 1534 | Ga0590074_003587 | 3300059423 | Bacteria | 2570 |
| 1535 | Ga0590074_042319 | 3300059423 | Unclassified | 821 |
| 1536 | Ga0590075_001312 | 3300059424 | Bacteria | 6243 |
| 1537 | Ga0590075_002211 | 3300059424 | Bacteria | 4679 |
| 1538 | Ga0590075_057765 | 3300059424 | Unclassified | 999 |
| 1539 | Ga0590075_113661 | 3300059424 | Bacteria | 707 |
| 1540 | Ga0590077_000747 | 3300059426 | Bacteria | 8520 |
| 1541 | Ga0587091_100514 | 3300059511 | Bacteria | 678 |
| 1542 | Ga0587114_031768 | 3300059655 | Unclassified | 811 |
| 1543 | Ga0501082_0163480 | 3300060353 | Bacteria | 1934 |
| 1544 | Ga0501082_0444785 | 3300060353 | Unclassified | 1132 |
| 1545 | Ga0501082_0818939 | 3300060353 | Bacteria | 814 |
| 1546 | Ga0530510_0009184 | 3300061734 | Bacteria | 6928 |
| 1547 | Ga0530510_0062078 | 3300061734 | Bacteria | 2705 |
| 1548 | Ga0530510_0289552 | 3300061734 | Unclassified | 1224 |
| 1549 | Ga0163162_10947929 | |||
| 1550 | JGI24033J26618_1016701 | |||
| 1551 | JGI24751J29686_10013893 | |||
| 1552 | JGI25406J46586_10097873 | |||
| 1553 | Ga0065714_10083408 | |||
| 1554 | Ga0065704_10148721 | |||
| 1555 | Ga0065704_10537012 | |||
| 1556 | Ga0065712_10002622 | |||
| 1557 | Ga0065712_10067818 | |||
| 1558 | Ga0065712_10099576 | |||
| 1559 | Ga0065712_10149758 | |||
| 1560 | Ga0065712_10162315 | |||
| 1561 | Ga0065712_10319358 | |||
| 1562 | Ga0065715_10103959 | |||
| 1563 | Ga0065715_10146880 | |||
| 1564 | Ga0065715_10147926 | |||
| 1565 | Ga0065715_10158966 | |||
| 1566 | Ga0065715_10168749 | |||
| 1567 | Ga0065715_10236028 | |||
| 1568 | Ga0065715_10279735 | |||
| 1569 | Ga0065715_10408396 | |||
| 1570 | Ga0065707_10247239 | |||
| 1571 | Ga0065707_10289450 | |||
| 1572 | Ga0065707_10302678 | |||
| 1573 | Ga0065707_10412332 | |||
| 1574 | Ga0065707_10484671 | |||
| 1575 | Ga0070676_10026241 | |||
| 1576 | Ga0070676_10199862 | |||
| 1577 | Ga0070676_10297952 | |||
| 1578 | Ga0070676_10331366 | |||
| 1579 | Ga0070676_10357983 | |||
| 1580 | Ga0070676_10438005 | |||
| 1581 | Ga0070676_10832927 | |||
| 1582 | Ga0070683_100024470 | |||
| 1583 | Ga0070683_100338820 | |||
| 1584 | Ga0070690_100000920 | |||
| 1585 | Ga0070690_100166363 | |||
| 1586 | Ga0070690_100197332 | |||
| 1587 | Ga0070690_100922612 | |||
| 1588 | Ga0070690_100946779 | |||
| 1589 | Ga0070690_101430069 | |||
| 1590 | Ga0070670_100015640 | |||
| 1591 | Ga0070670_100026375 | |||
| 1592 | Ga0070670_100052956 | |||
| 1593 | Ga0070670_100161978 | |||
| 1594 | Ga0070670_100300500 | |||
| 1595 | Ga0070670_100901418 | |||
| 1596 | Ga0070677_10013312 | |||
| 1597 | Ga0070677_10044554 | |||
| 1598 | Ga0070677_10049012 | |||
| 1599 | Ga0070677_10279774 | |||
| 1600 | Ga0070677_10284896 | |||
| 1601 | Ga0070677_10422995 | |||
| 1602 | Ga0068869_100002153 | |||
| 1603 | Ga0068869_100048862 | |||
| 1604 | Ga0068869_100092460 | |||
| 1605 | Ga0068869_100103497 | |||
| 1606 | Ga0068869_100174532 | |||
| 1607 | Ga0068869_100280507 | |||
| 1608 | Ga0068869_100536026 | |||
| 1609 | Ga0068869_101215174 | |||
| 1610 | Ga0070666_10196882 | |||
| 1611 | Ga0070666_10198726 | |||
| 1612 | Ga0070666_10729581 | |||
| 1613 | Ga0070680_100025422 | |||
| 1614 | Ga0070680_100153630 | |||
| 1615 | Ga0070680_100630050 | |||
| 1616 | Ga0070680_100866206 | |||
| 1617 | Ga0070682_100900612 | |||
| 1618 | Ga0070682_101072323 | |||
| 1619 | Ga0070682_101249949 | |||
| 1620 | Ga0068868_100034955 | |||
| 1621 | Ga0068868_100064048 | |||
| 1622 | Ga0068868_100291802 | |||
| 1623 | Ga0068868_100330401 | |||
| 1624 | Ga0068868_100352495 | |||
| 1625 | Ga0068868_100639711 | |||
| 1626 | Ga0068868_100741312 | |||
| 1627 | Ga0068868_101181271 | |||
| 1628 | Ga0070660_100001092 | |||
| 1629 | Ga0070660_100441529 | |||
| 1630 | Ga0070689_100043202 | |||
| 1631 | Ga0070689_100065174 | |||
| 1632 | Ga0070689_100199760 | |||
| 1633 | Ga0070689_100215050 | |||
| 1634 | Ga0070689_100327105 | |||
| 1635 | Ga0070689_100340128 | |||
| 1636 | Ga0070689_100586620 | |||
| 1637 | Ga0070689_100740161 | |||
| 1638 | Ga0070691_10000892 | |||
| 1639 | Ga0070691_10043112 | |||
| 1640 | Ga0070691_10149628 | |||
| 1641 | Ga0070687_100038743 | |||
| 1642 | Ga0070687_100095286 | |||
| 1643 | Ga0070661_100265127 | |||
| 1644 | Ga0070661_100414251 | |||
| 1645 | Ga0070661_100608875 | |||
| 1646 | Ga0070661_101372584 | |||
| 1647 | Ga0070692_10035812 | |||
| 1648 | Ga0070692_10458705 | |||
| 1649 | Ga0070668_100105729 | |||
| 1650 | Ga0070668_100454436 | |||
| 1651 | Ga0070668_100735908 | |||
| 1652 | Ga0070669_100003474 | |||
| 1653 | Ga0070669_100031310 | |||
| 1654 | Ga0070669_100038193 | |||
| 1655 | Ga0070669_100092083 | |||
| 1656 | Ga0070669_100162925 | |||
| 1657 | Ga0070669_100313428 | |||
| 1658 | Ga0070669_100339396 | |||
| 1659 | Ga0070669_100423022 | |||
| 1660 | Ga0070669_100548837 | |||
| 1661 | Ga0070669_100615765 | |||
| 1662 | Ga0070669_100669953 | |||
| 1663 | Ga0070669_100678850 | |||
| 1664 | Ga0070675_100000433 | |||
| 1665 | Ga0070675_100001643 | |||
| 1666 | Ga0070675_100003018 | |||
| 1667 | Ga0070675_100007486 | |||
| 1668 | Ga0070675_100007803 | |||
| 1669 | Ga0070675_100022727 | |||
| 1670 | Ga0070675_100036669 | |||
| 1671 | Ga0070675_100205743 | |||
| 1672 | Ga0070675_100217685 | |||
| 1673 | Ga0070675_100313845 | |||
| 1674 | Ga0070675_100344667 | |||
| 1675 | Ga0070675_100439608 | |||
| 1676 | Ga0070675_100539788 | |||
| 1677 | Ga0070671_100034834 | |||
| 1678 | Ga0070671_100048508 | |||
| 1679 | Ga0070671_100320519 | |||
| 1680 | Ga0070671_100354947 | |||
| 1681 | Ga0070671_100782269 | |||
| 1682 | Ga0070674_100021951 | |||
| 1683 | Ga0070674_100044223 | |||
| 1684 | Ga0070674_100140019 | |||
| 1685 | Ga0070674_100241008 | |||
| 1686 | Ga0070674_100519194 | |||
| 1687 | Ga0070674_100674351 | |||
| 1688 | Ga0070674_100779800 | |||
| 1689 | Ga0070674_101006082 | |||
| 1690 | Ga0070674_101255596 | |||
| 1691 | Ga0070674_101265879 | |||
| 1692 | Ga0070674_101447295 | |||
| 1693 | Ga0070673_100003132 | |||
| 1694 | Ga0070673_100043274 | |||
| 1695 | Ga0070673_100050178 | |||
| 1696 | Ga0070673_100058513 | |||
| 1697 | Ga0070673_100137316 | |||
| 1698 | Ga0070673_100171940 | |||
| 1699 | Ga0070673_100183156 | |||
| 1700 | Ga0070673_100196196 | |||
| 1701 | Ga0070673_100208212 | |||
| 1702 | Ga0070673_100549318 | |||
| 1703 | Ga0070673_100635366 | |||
| 1704 | Ga0070688_100060927 | |||
| 1705 | Ga0070688_100098261 | |||
| 1706 | Ga0070688_100216235 | |||
| 1707 | Ga0070688_100476940 | |||
| 1708 | Ga0070688_101083333 | |||
| 1709 | Ga0070659_100197547 | |||
| 1710 | Ga0070667_100179209 | |||
| 1711 | Ga0070667_100414741 | |||
| 1712 | Ga0070667_100587289 | |||
| 1713 | Ga0070709_10007316 | |||
| 1714 | Ga0070709_10759539 | |||
| 1715 | Ga0070714_100003070 | |||
| 1716 | Ga0070713_100004893 | |||
| 1717 | Ga0070713_100193518 | |||
| 1718 | Ga0070713_100900072 | |||
| 1719 | Ga0070713_101253314 | |||
| 1720 | Ga0070713_101716902 | |||
| 1721 | Ga0070701_10080120 | |||
| 1722 | Ga0070701_10102714 | |||
| 1723 | Ga0070705_100001404 | |||
| 1724 | Ga0070705_100014875 | |||
| 1725 | Ga0070705_100053659 | |||
| 1726 | Ga0070705_100135726 | |||
| 1727 | Ga0070700_100000788 | |||
| 1728 | Ga0070700_100006082 | |||
| 1729 | Ga0070700_100059550 | |||
| 1730 | Ga0070700_100068953 | |||
| 1731 | Ga0070700_100274394 | |||
| 1732 | Ga0070700_100906779 | |||
| 1733 | Ga0070694_100002894 | |||
| 1734 | Ga0070694_100005858 | |||
| 1735 | Ga0070694_100007026 | |||
| 1736 | Ga0070694_100172110 | |||
| 1737 | Ga0070694_100379711 | |||
| 1738 | Ga0070694_100502706 | |||
| 1739 | Ga0070694_100802159 | |||
| 1740 | Ga0070708_100032111 | |||
| 1741 | Ga0070708_100519664 | |||
| 1742 | Ga0070708_100607625 | |||
| 1743 | Ga0070708_100868844 | |||
| 1744 | Ga0070663_100037019 | |||
| 1745 | Ga0070663_100878596 | |||
| 1746 | Ga0070678_100109353 | |||
| 1747 | Ga0070678_100116947 | |||
| 1748 | Ga0070678_100130775 | |||
| 1749 | Ga0070678_100140021 | |||
| 1750 | Ga0070678_100494754 | |||
| 1751 | Ga0070678_100653885 | |||
| 1752 | Ga0070678_100709470 | |||
| 1753 | Ga0070662_100073576 | |||
| 1754 | Ga0070662_100203340 | |||
| 1755 | Ga0070662_100380504 | |||
| 1756 | Ga0070662_100593270 | |||
| 1757 | Ga0070662_100874882 | |||
| 1758 | Ga0070662_101063022 | |||
| 1759 | Ga0070681_10386081 | |||
| 1760 | Ga0070681_11157304 | |||
| 1761 | Ga0068867_100000380 | |||
| 1762 | Ga0068867_100115369 | |||
| 1763 | Ga0068867_100138704 | |||
| 1764 | Ga0068867_100139519 | |||
| 1765 | Ga0068867_100686917 | |||
| 1766 | Ga0068867_100709371 | |||
| 1767 | Ga0068867_100713581 | |||
| 1768 | Ga0068867_100944408 | |||
| 1769 | Ga0068867_101063118 | |||
| 1770 | Ga0068867_101672557 | |||
| 1771 | Ga0068867_101710127 | |||
| 1772 | Ga0070685_10047159 | |||
| 1773 | Ga0070685_10050222 | |||
| 1774 | Ga0070685_10106243 | |||
| 1775 | Ga0070685_10197670 | |||
| 1776 | Ga0070685_10545954 | |||
| 1777 | Ga0070706_100186401 | |||
| 1778 | Ga0070706_100236430 | |||
| 1779 | Ga0070706_100286210 | |||
| 1780 | Ga0070706_100774035 | |||
| 1781 | Ga0070706_101121435 | |||
| 1782 | Ga0070706_101226546 | |||
| 1783 | Ga0070707_100442076 | |||
| 1784 | Ga0070707_100657285 | |||
| 1785 | Ga0070707_101094705 | |||
| 1786 | Ga0070707_101286300 | |||
| 1787 | Ga0070698_100003115 | |||
| 1788 | Ga0070698_100006640 | |||
| 1789 | Ga0070698_100011223 | |||
| 1790 | Ga0070698_100072413 | |||
| 1791 | Ga0070698_100138182 | |||
| 1792 | Ga0070698_100394572 | |||
| 1793 | Ga0070699_100003719 | |||
| 1794 | Ga0070699_100006814 | |||
| 1795 | Ga0070699_100100290 | |||
| 1796 | Ga0070699_100123199 | |||
| 1797 | Ga0070679_100010050 | |||
| 1798 | Ga0070679_100127817 | |||
| 1799 | Ga0070679_100548131 | |||
| 1800 | Ga0070679_100776591 | |||
| 1801 | Ga0070684_100076110 | |||
| 1802 | Ga0070684_100179696 | |||
| 1803 | Ga0070684_100519127 | |||
| 1804 | Ga0070684_101199138 | |||
| 1805 | Ga0068853_100611029 | |||
| 1806 | Ga0070672_100004404 | |||
| 1807 | Ga0070672_100005217 | |||
| 1808 | Ga0070672_100062004 | |||
| 1809 | Ga0070672_100157158 | |||
| 1810 | Ga0070672_100196808 | |||
| 1811 | Ga0070672_100213036 | |||
| 1812 | Ga0070672_100617737 | |||
| 1813 | Ga0070672_100692814 | |||
| 1814 | Ga0070672_100729197 | |||
| 1815 | Ga0070672_101137246 | |||
| 1816 | Ga0070686_100000153 | |||
| 1817 | Ga0070686_100030299 | |||
| 1818 | Ga0070686_100084274 | |||
| 1819 | Ga0070686_100188159 | |||
| 1820 | Ga0070686_100218647 | |||
| 1821 | Ga0070686_100313655 | |||
| 1822 | Ga0070686_100375621 | |||
| 1823 | Ga0070686_100537386 | |||
| 1824 | Ga0070695_100016291 | |||
| 1825 | Ga0070695_100027664 | |||
| 1826 | Ga0070695_100170257 | |||
| 1827 | Ga0070695_100502552 | |||
| 1828 | Ga0070695_100826694 | |||
| 1829 | Ga0070695_100954808 | |||
| 1830 | Ga0070696_100018169 | |||
| 1831 | Ga0070696_100039612 | |||
| 1832 | Ga0070696_100112265 | |||
| 1833 | Ga0070696_100552454 | |||
| 1834 | Ga0070696_100587157 | |||
| 1835 | Ga0070693_100169522 | |||
| 1836 | Ga0070693_100720868 | |||
| 1837 | Ga0070693_100759909 | |||
| 1838 | Ga0070693_100836877 | |||
| 1839 | Ga0070665_100002502 | |||
| 1840 | Ga0070665_100010631 | |||
| 1841 | Ga0070665_100020086 | |||
| 1842 | Ga0070665_100078682 | |||
| 1843 | Ga0070665_100195381 | |||
| 1844 | Ga0070665_100950167 | |||
| 1845 | Ga0070704_100000089 | |||
| 1846 | Ga0070704_100026609 | |||
| 1847 | Ga0070704_100032604 | |||
| 1848 | Ga0070704_100074989 | |||
| 1849 | Ga0070704_100134456 | |||
| 1850 | Ga0070704_100631855 | |||
| 1851 | Ga0070704_100700314 | |||
| 1852 | Ga0070704_101267826 | |||
| 1853 | Ga0070704_101301510 | |||
| 1854 | Ga0068855_100020680 | |||
| 1855 | Ga0068855_100238478 | |||
| 1856 | Ga0068855_100450881 | |||
| 1857 | Ga0068855_100492643 | |||
| 1858 | Ga0068855_100652639 | |||
| 1859 | Ga0068855_100798835 | |||
| 1860 | Ga0070664_100009603 | |||
| 1861 | Ga0070664_100097790 | |||
| 1862 | Ga0070664_100236671 | |||
| 1863 | Ga0070664_100346288 | |||
| 1864 | Ga0068857_100136211 | |||
| 1865 | Ga0068857_100358762 | |||
| 1866 | Ga0068857_100522165 | |||
| 1867 | Ga0068857_100639122 | |||
| 1868 | Ga0068854_100163499 | |||
| 1869 | Ga0068854_101120050 | |||
| 1870 | Ga0068856_101833176 | |||
| 1871 | Ga0068856_101950599 | |||
| 1872 | Ga0070702_100003228 | |||
| 1873 | Ga0070702_100053993 | |||
| 1874 | Ga0070702_100357397 | |||
| 1875 | Ga0070702_100962764 | |||
| 1876 | Ga0068852_100377942 | |||
| 1877 | Ga0068852_100746608 | |||
| 1878 | Ga0068852_101897063 | |||
| 1879 | Ga0068859_100025246 | |||
| 1880 | Ga0068859_100137975 | |||
| 1881 | Ga0068859_100191448 | |||
| 1882 | Ga0068859_100208366 | |||
| 1883 | Ga0068859_100504379 | |||
| 1884 | Ga0068859_100506815 | |||
| 1885 | Ga0068859_100714266 | |||
| 1886 | Ga0068859_100759169 | |||
| 1887 | Ga0068859_101723599 | |||
| 1888 | Ga0068864_100002939 | |||
| 1889 | Ga0068864_100099244 | |||
| 1890 | Ga0068864_100201604 | |||
| 1891 | Ga0068864_100207644 | |||
| 1892 | Ga0068864_100234303 | |||
| 1893 | Ga0068864_100234644 | |||
| 1894 | Ga0068864_100313810 | |||
| 1895 | Ga0068864_100391631 | |||
| 1896 | Ga0068864_100975212 | |||
| 1897 | Ga0068866_10009441 | |||
| 1898 | Ga0068866_10024941 | |||
| 1899 | Ga0068866_10084161 | |||
| 1900 | Ga0068866_10085221 | |||
| 1901 | Ga0068861_100010565 | |||
| 1902 | Ga0068861_100079028 | |||
| 1903 | Ga0068861_100091306 | |||
| 1904 | Ga0068861_100093769 | |||
| 1905 | Ga0068861_100129925 | |||
| 1906 | Ga0068861_100164360 | |||
| 1907 | Ga0068861_100253110 | |||
| 1908 | Ga0068861_100488257 | |||
| 1909 | Ga0068861_100823788 | |||
| 1910 | Ga0068861_101454819 | |||
| 1911 | Ga0068851_10033637 | |||
| 1912 | Ga0068851_10150437 | |||
| 1913 | Ga0068870_10002891 | |||
| 1914 | Ga0068870_10032435 | |||
| 1915 | Ga0068870_10034344 | |||
| 1916 | Ga0068870_10234070 | |||
| 1917 | Ga0068870_10616965 | |||
| 1918 | Ga0068863_100062464 | |||
| 1919 | Ga0068863_100143458 | |||
| 1920 | Ga0068863_100184236 | |||
| 1921 | Ga0068863_100199173 | |||
| 1922 | Ga0068863_100300972 | |||
| 1923 | Ga0068863_100313525 | |||
| 1924 | Ga0068863_100650258 | |||
| 1925 | Ga0068863_101144537 | |||
| 1926 | Ga0068858_100003255 | |||
| 1927 | Ga0068858_100017044 | |||
| 1928 | Ga0068858_100039216 | |||
| 1929 | Ga0068858_100075256 | |||
| 1930 | Ga0068858_100130019 | |||
| 1931 | Ga0068858_100206865 | |||
| 1932 | Ga0068858_100559154 | |||
| 1933 | Ga0068858_101037450 | |||
| 1934 | Ga0068860_100017193 | |||
| 1935 | Ga0068860_100034523 | |||
| 1936 | Ga0068860_100219487 | |||
| 1937 | Ga0068860_100271636 | |||
| 1938 | Ga0068860_100347516 | |||
| 1939 | Ga0068860_100354361 | |||
| 1940 | Ga0068860_100356221 | |||
| 1941 | Ga0068860_100392211 | |||
| 1942 | Ga0068862_100021517 | |||
| 1943 | Ga0068862_100024869 | |||
| 1944 | Ga0068862_100040092 | |||
| 1945 | Ga0068862_100053094 | |||
| 1946 | Ga0068862_100260760 | |||
| 1947 | Ga0068862_100384271 | |||
| 1948 | Ga0068862_100429973 | |||
| 1949 | Ga0068862_100594903 | |||
| 1950 | Ga0068862_100636813 | |||
| 1951 | Ga0068862_100657343 | |||
| 1952 | Ga0068862_100746979 | |||
| 1953 | Ga0081455_10008971 | |||
| 1954 | Ga0081455_10047875 | |||
| 1955 | Ga0081539_10002012 | |||
| 1956 | Ga0070717_11361300 | |||
| 1957 | Ga0075365_10059942 | |||
| 1958 | Ga0070715_10045399 | |||
| 1959 | Ga0070715_10059729 | |||
| 1960 | Ga0070715_10370458 | |||
| 1961 | Ga0070716_100007561 | |||
| 1962 | Ga0070716_100112531 | |||
| 1963 | Ga0070716_100520649 | |||
| 1964 | Ga0070716_100865244 | |||
| 1965 | Ga0070712_100031176 | |||
| 1966 | Ga0070712_100416201 | |||
| 1967 | Ga0097621_100000125 | |||
| 1968 | Ga0097621_100014893 | |||
| 1969 | Ga0097621_100017310 | |||
| 1970 | Ga0097621_100039658 | |||
| 1971 | Ga0097621_100069253 | |||
| 1972 | Ga0097621_100113414 | |||
| 1973 | Ga0097621_100126207 | |||
| 1974 | Ga0097621_100378715 | |||
| 1975 | Ga0097621_100616551 | |||
| 1976 | Ga0097621_100643048 | |||
| 1977 | Ga0097621_100724582 | |||
| 1978 | Ga0097621_101182064 | |||
| 1979 | Ga0068871_100000134 | |||
| 1980 | Ga0068871_100005587 | |||
| 1981 | Ga0068871_100039886 | |||
| 1982 | Ga0068871_100063808 | |||
| 1983 | Ga0068871_100069169 | |||
| 1984 | Ga0068871_100077391 | |||
| 1985 | Ga0068871_100146031 | |||
| 1986 | Ga0068871_100149927 | |||
| 1987 | Ga0068871_100193434 | |||
| 1988 | Ga0068871_100291605 | |||
| 1989 | Ga0068871_100497971 | |||
| 1990 | Ga0068871_100649783 | |||
| 1991 | Ga0068871_100695008 | |||
| 1992 | Ga0075428_100000497 | |||
| 1993 | Ga0075428_100006846 | |||
| 1994 | Ga0075428_100009506 | |||
| 1995 | Ga0075428_100026808 | |||
| 1996 | Ga0075428_100031650 | |||
| 1997 | Ga0075428_100057506 | |||
| 1998 | Ga0075428_100089732 | |||
| 1999 | Ga0075428_100121569 | |||
| 2000 | Ga0075428_100245232 | |||
| 2001 | Ga0075428_100310045 | |||
| 2002 | Ga0075428_100429732 | |||
| 2003 | Ga0075428_100602931 | |||
| 2004 | Ga0075428_101084827 | |||
| 2005 | Ga0075428_101635840 | |||
| 2006 | Ga0075430_100001681 | |||
| 2007 | Ga0075430_100002096 | |||
| 2008 | Ga0075430_100013822 | |||
| 2009 | Ga0075430_100019140 | |||
| 2010 | Ga0075430_100025839 | |||
| 2011 | Ga0075430_100028057 | |||
| 2012 | Ga0075430_100054894 | |||
| 2013 | Ga0075431_100001219 | |||
| 2014 | Ga0075431_100003323 | |||
| 2015 | Ga0075431_100023672 | |||
| 2016 | Ga0075431_100069493 | |||
| 2017 | Ga0075431_100079466 | |||
| 2018 | Ga0075431_100199916 | |||
| 2019 | Ga0075431_100215703 | |||
| 2020 | Ga0075431_100241070 | |||
| 2021 | Ga0075431_100486414 | |||
| 2022 | Ga0075431_100830336 | |||
| 2023 | Ga0075433_10000157 | |||
| 2024 | Ga0075433_10116506 | |||
| 2025 | Ga0075433_10146790 | |||
| 2026 | Ga0075433_10177266 | |||
| 2027 | Ga0075433_10323195 | |||
| 2028 | Ga0075433_10336636 | |||
| 2029 | Ga0075433_10467641 | |||
| 2030 | Ga0075433_10615587 | |||
| 2031 | Ga0075433_10789605 | |||
| 2032 | Ga0075433_10835721 | |||
| 2033 | Ga0075433_11039815 | |||
| 2034 | Ga0075433_11078459 | |||
| 2035 | Ga0075434_100002504 | |||
| 2036 | Ga0075434_100005743 | |||
| 2037 | Ga0075434_100006773 | |||
| 2038 | Ga0075434_100011771 | |||
| 2039 | Ga0075434_100017244 | |||
| 2040 | Ga0075434_100029295 | |||
| 2041 | Ga0075434_100065080 | |||
| 2042 | Ga0075434_100082673 | |||
| 2043 | Ga0075434_100151742 | |||
| 2044 | Ga0075434_100192229 | |||
| 2045 | Ga0075434_100302147 | |||
| 2046 | Ga0075434_100453363 | |||
| 2047 | Ga0075434_100476073 | |||
| 2048 | Ga0075434_100489240 | |||
| 2049 | Ga0075434_100524690 | |||
| 2050 | Ga0075429_100004479 | |||
| 2051 | Ga0075429_100005139 | |||
| 2052 | Ga0075429_100008026 | |||
| 2053 | Ga0075429_100019963 | |||
| 2054 | Ga0075429_100096081 | |||
| 2055 | Ga0075429_100122343 | |||
| 2056 | Ga0075429_100126374 | |||
| 2057 | Ga0075429_100239199 | |||
| 2058 | Ga0075429_100266863 | |||
| 2059 | Ga0075429_100314822 | |||
| 2060 | Ga0075429_100319622 | |||
| 2061 | Ga0068865_100002757 | |||
| 2062 | Ga0068865_100030248 | |||
| 2063 | Ga0068865_100076131 | |||
| 2064 | Ga0068865_100145708 | |||
| 2065 | Ga0068865_100189475 | |||
| 2066 | Ga0068865_100576003 | |||
| 2067 | Ga0068865_100760792 | |||
| 2068 | Ga0068865_100834735 | |||
| 2069 | Ga0075436_100004813 | |||
| 2070 | Ga0075436_100017704 | |||
| 2071 | Ga0075436_100017749 | |||
| 2072 | Ga0075436_100084710 | |||
| 2073 | Ga0075436_100104286 | |||
| 2074 | Ga0075436_100132881 | |||
| 2075 | Ga0075436_100241247 | |||
| 2076 | Ga0097620_100025246 | |||
| 2077 | Ga0097620_100137972 | |||
| 2078 | Ga0097620_100191442 | |||
| 2079 | Ga0097620_100208383 | |||
| 2080 | Ga0097620_100504446 | |||
| 2081 | Ga0097620_100506803 | |||
| 2082 | Ga0097620_100714267 | |||
| 2083 | Ga0097620_100759135 | |||
| 2084 | Ga0097620_100837173 | |||
| 2085 | Ga0097620_101723800 | |||
| 2086 | Ga0075435_100000204 | |||
| 2087 | Ga0075435_100007928 | |||
| 2088 | Ga0075435_100015754 | |||
| 2089 | Ga0075435_100027042 | |||
| 2090 | Ga0075435_100065934 | |||
| 2091 | Ga0075435_100177038 | |||
| 2092 | Ga0075435_100212697 | |||
| 2093 | Ga0075435_100310333 | |||
| 2094 | Ga0075435_100494082 | |||
| 2095 | Ga0075435_100509157 | |||
| 2096 | Ga0105251_10096311 | |||
| 2097 | Ga0105244_10445466 | |||
| 2098 | Ga0105240_10037691 | |||
| 2099 | Ga0105240_10170233 | |||
| 2100 | Ga0105240_10311990 | |||
| 2101 | Ga0105240_10450127 | |||
| 2102 | Ga0105240_10794797 | |||
| 2103 | Ga0105240_11465595 | |||
| 2104 | Ga0111539_10000014 | |||
| 2105 | Ga0111539_10000134 | |||
| 2106 | Ga0111539_10001078 | |||
| 2107 | Ga0111539_10002632 | |||
| 2108 | Ga0111539_10004027 | |||
| 2109 | Ga0111539_10010143 | |||
| 2110 | Ga0111539_10015933 | |||
| 2111 | Ga0111539_10018505 | |||
| 2112 | Ga0111539_10066788 | |||
| 2113 | Ga0111539_10097678 | |||
| 2114 | Ga0111539_10187478 | |||
| 2115 | Ga0111539_10291782 | |||
| 2116 | Ga0111539_10321189 | |||
| 2117 | Ga0111539_10426199 | |||
| 2118 | Ga0111539_10510089 | |||
| 2119 | Ga0111539_10661077 | |||
| 2120 | Ga0111539_10806024 | |||
| 2121 | Ga0111539_11242735 | |||
| 2122 | Ga0111539_11566589 | |||
| 2123 | Ga0105245_10018654 | |||
| 2124 | Ga0105245_10046562 | |||
| 2125 | Ga0105245_10266120 | |||
| 2126 | Ga0105245_10518549 | |||
| 2127 | Ga0105245_10832324 | |||
| 2128 | Ga0105245_11922539 | |||
| 2129 | Ga0105247_10058133 | |||
| 2130 | Ga0105247_10159725 | |||
| 2131 | Ga0105247_10271953 | |||
| 2132 | Ga0114129_10000426 | |||
| 2133 | Ga0114129_10001213 | |||
| 2134 | Ga0114129_10004137 | |||
| 2135 | Ga0114129_10009181 | |||
| 2136 | Ga0114129_10009385 | |||
| 2137 | Ga0114129_10011201 | |||
| 2138 | Ga0114129_10016744 | |||
| 2139 | Ga0114129_10016919 | |||
| 2140 | Ga0114129_10029055 | |||
| 2141 | Ga0114129_10048963 | |||
| 2142 | Ga0114129_10051960 | |||
| 2143 | Ga0114129_10057730 | |||
| 2144 | Ga0114129_10064329 | |||
| 2145 | Ga0114129_10067793 | |||
| 2146 | Ga0114129_10072643 | |||
| 2147 | Ga0114129_10073868 | |||
| 2148 | Ga0114129_10095042 | |||
| 2149 | Ga0114129_10109022 | |||
| 2150 | Ga0114129_10143188 | |||
| 2151 | Ga0114129_10295970 | |||
| 2152 | Ga0114129_10566980 | |||
| 2153 | Ga0114129_11160523 | |||
| 2154 | Ga0114129_11692215 | |||
| 2155 | Ga0114129_12487459 | |||
| 2156 | Ga0114129_12703291 | |||
| 2157 | Ga0105243_10006934 | |||
| 2158 | Ga0105243_10010791 | |||
| 2159 | Ga0105243_10089689 | |||
| 2160 | Ga0105243_10175709 | |||
| 2161 | Ga0105243_10506248 | |||
| 2162 | Ga0105243_10771100 | |||
| 2163 | Ga0105243_10923197 | |||
| 2164 | Ga0105243_11471236 | |||
| 2165 | Ga0105243_11608999 | |||
| 2166 | Ga0105241_10026107 | |||
| 2167 | Ga0105241_10568860 | |||
| 2168 | Ga0105241_11039566 | |||
| 2169 | Ga0105241_11892246 | |||
| 2170 | Ga0105242_10022412 | |||
| 2171 | Ga0105242_10026817 | |||
| 2172 | Ga0105242_10268432 | |||
| 2173 | Ga0105242_10328003 | |||
| 2174 | Ga0105242_10366387 | |||
| 2175 | Ga0105242_10665893 | |||
| 2176 | Ga0105242_11024614 | |||
| 2177 | Ga0105248_10002172 | |||
| 2178 | Ga0105248_10007536 | |||
| 2179 | Ga0105248_10043045 | |||
| 2180 | Ga0105248_10052710 | |||
| 2181 | Ga0105248_10059992 | |||
| 2182 | Ga0105248_10068556 | |||
| 2183 | Ga0105248_10107031 | |||
| 2184 | Ga0105248_10162200 | |||
| 2185 | Ga0105248_10200910 | |||
| 2186 | Ga0105248_10231761 | |||
| 2187 | Ga0105248_10320423 | |||
| 2188 | Ga0105248_10411347 | |||
| 2189 | Ga0105248_10495834 | |||
| 2190 | Ga0105248_11356672 | |||
| 2191 | Ga0105248_12175856 | |||
| 2192 | Ga0105237_10709398 | |||
| 2193 | Ga0105237_11273509 | |||
| 2194 | Ga0105238_10036372 | |||
| 2195 | Ga0105238_10251909 | |||
| 2196 | Ga0105238_11837913 | |||
| 2197 | Ga0105249_10025255 | |||
| 2198 | Ga0105249_10081617 | |||
| 2199 | Ga0105249_10272878 | |||
| 2200 | Ga0105249_10293297 | |||
| 2201 | Ga0105249_10350611 | |||
| 2202 | Ga0105249_10455199 | |||
| 2203 | Ga0105249_10867528 | |||
| 2204 | Ga0105249_11977180 | |||
| 2205 | Ga0105249_12262412 | |||
| 2206 | Ga0105239_10699477 | |||
| 2207 | Ga0105239_10713110 | |||
| 2208 | Ga0105239_10815702 | |||
| 2209 | Ga0105246_10105238 | |||
| 2210 | Ga0105246_10467635 | |||
| 2211 | Ga0105246_10868449 | |||
| 2212 | Ga0157373_11108636 | |||
| 2213 | Ga0157370_10733794 | |||
| 2214 | Ga0157374_10083773 | |||
| 2215 | Ga0157374_10104979 | |||
| 2216 | Ga0157374_10443606 | |||
| 2217 | Ga0157374_11656934 | |||
| 2218 | Ga0157378_10009109 | |||
| 2219 | Ga0157378_10144928 | |||
| 2220 | Ga0157378_10561950 | |||
| 2221 | Ga0163162_10186185 | |||
| 2222 | Ga0163162_10549926 | |||
| 2223 | Ga0163162_10559856 | |||
| 2224 | Ga0163162_10609618 | |||
| 2225 | Ga0163162_11769678 | |||
| 2226 | Ga0157372_10454180 | |||
| 2227 | Ga0157375_10055322 | |||
| 2228 | Ga0157375_10265853 | |||
| 2229 | Ga0157375_10340654 | |||
| 2230 | Ga0157375_10374552 | |||
| 2231 | Ga0157375_10587096 | |||
| 2232 | Ga0157375_10658352 | |||
| 2233 | Ga0157375_11224686 | |||
| 2234 | Ga0163163_10006091 | |||
| 2235 | Ga0163163_10024951 | |||
| 2236 | Ga0163163_10033095 | |||
| 2237 | Ga0163163_10044334 | |||
| 2238 | Ga0163163_10049145 | |||
| 2239 | Ga0163163_10457893 | |||
| 2240 | Ga0163163_10662976 | |||
| 2241 | Ga0163163_11872649 | |||
| 2242 | Ga0163163_12172974 | |||
| 2243 | Ga0157380_10002946 | |||
| 2244 | Ga0157380_10008813 | |||
| 2245 | Ga0157380_10018744 | |||
| 2246 | Ga0157380_10048867 | |||
| 2247 | Ga0157380_10078622 | |||
| 2248 | Ga0157380_10088271 | |||
| 2249 | Ga0157380_10279419 | |||
| 2250 | Ga0157380_10417166 | |||
| 2251 | Ga0157380_10691176 | |||
| 2252 | Ga0157380_11418633 | |||
| 2253 | Ga0157380_11524746 | |||
| 2254 | Ga0157380_11547105 | |||
| 2255 | Ga0157380_11772989 | |||
| 2256 | Ga0182008_10291273 | |||
| 2257 | Ga0157377_10066174 | |||
| 2258 | Ga0157377_10095762 | |||
| 2259 | Ga0157377_10155723 | |||
| 2260 | Ga0157377_10275103 | |||
| 2261 | Ga0157377_10331777 | |||
| 2262 | Ga0157377_10550822 | |||
| 2263 | Ga0157379_10007040 | |||
| 2264 | Ga0157379_10007133 | |||
| 2265 | Ga0157379_10030765 | |||
| 2266 | Ga0157379_10037871 | |||
| 2267 | Ga0157379_10222767 | |||
| 2268 | Ga0157379_10304951 | |||
| 2269 | Ga0157379_10328355 | |||
| 2270 | Ga0157379_10640056 | |||
| 2271 | Ga0157376_10024569 | |||
| 2272 | Ga0157376_10024693 | |||
| 2273 | Ga0157376_10086620 | |||
| 2274 | Ga0157376_10189607 | |||
| 2275 | Ga0157376_10366170 | |||
| 2276 | Ga0157376_10823342 | |||
| 2277 | Ga0157376_11082052 | |||
| 2278 | Ga0163161_10279799 | |||
| 2279 | Ga0163161_10379530 | |||
| 2280 | Ga0163161_10965245 | |||
| 2281 | Ga0213876_10074971 | |||
| 2282 | Ga0207697_10024138 | |||
| 2283 | Ga0207697_10072296 | |||
| 2284 | Ga0207697_10274146 | |||
| 2285 | Ga0207697_10357179 | |||
| 2286 | Ga0207656_10097732 | |||
| 2287 | Ga0207653_10093372 | |||
| 2288 | Ga0207682_10004207 | |||
| 2289 | Ga0207682_10045366 | |||
| 2290 | Ga0207682_10048222 | |||
| 2291 | Ga0207682_10052586 | |||
| 2292 | Ga0207682_10064298 | |||
| 2293 | Ga0207682_10089494 | |||
| 2294 | Ga0207682_10093133 | |||
| 2295 | Ga0207682_10327128 | |||
| 2296 | Ga0207692_10397454 | |||
| 2297 | Ga0207642_10036643 | |||
| 2298 | Ga0207642_10101553 | |||
| 2299 | Ga0207710_10082088 | |||
| 2300 | Ga0207688_10348566 | |||
| 2301 | Ga0207680_10023105 | |||
| 2302 | Ga0207680_10049583 | |||
| 2303 | Ga0207680_10132754 | |||
| 2304 | Ga0207680_10318152 | |||
| 2305 | Ga0207680_10792231 | |||
| 2306 | Ga0207685_10174223 | |||
| 2307 | Ga0207699_10026366 | |||
| 2308 | Ga0207699_10257100 | |||
| 2309 | Ga0207645_10001406 | |||
| 2310 | Ga0207645_10002286 | |||
| 2311 | Ga0207645_10065309 | |||
| 2312 | Ga0207645_10142585 | |||
| 2313 | Ga0207645_10148909 | |||
| 2314 | Ga0207643_10003202 | |||
| 2315 | Ga0207643_10042613 | |||
| 2316 | Ga0207643_10057393 | |||
| 2317 | Ga0207643_10077467 | |||
| 2318 | Ga0207643_10549995 | |||
| 2319 | Ga0207684_10180841 | |||
| 2320 | Ga0207684_10189929 | |||
| 2321 | Ga0207684_10228661 | |||
| 2322 | Ga0207654_10301123 | |||
| 2323 | Ga0207707_10331947 | |||
| 2324 | Ga0207695_10151584 | |||
| 2325 | Ga0207695_10360308 | |||
| 2326 | Ga0207695_10428856 | |||
| 2327 | Ga0207695_10757082 | |||
| 2328 | Ga0207671_10227660 | |||
| 2329 | Ga0207671_11049257 | |||
| 2330 | Ga0207693_10139612 | |||
| 2331 | Ga0207693_10488325 | |||
| 2332 | Ga0207693_10738222 | |||
| 2333 | Ga0207663_10226206 | |||
| 2334 | Ga0207660_10085009 | |||
| 2335 | Ga0207660_10096368 | |||
| 2336 | Ga0207660_10165751 | |||
| 2337 | Ga0207660_10247169 | |||
| 2338 | Ga0207662_10007637 | |||
| 2339 | Ga0207662_10015889 | |||
| 2340 | Ga0207662_10099277 | |||
| 2341 | Ga0207662_10131006 | |||
| 2342 | Ga0207657_10006096 | |||
| 2343 | Ga0207657_10144559 | |||
| 2344 | Ga0207649_10073295 | |||
| 2345 | Ga0207649_10075530 | |||
| 2346 | Ga0207649_10727068 | |||
| 2347 | Ga0207649_10857902 | |||
| 2348 | Ga0207652_10052515 | |||
| 2349 | Ga0207652_10360643 | |||
| 2350 | Ga0207652_10399292 | |||
| 2351 | Ga0207652_10697637 | |||
| 2352 | Ga0207652_10727255 | |||
| 2353 | Ga0207646_10067972 | |||
| 2354 | Ga0207646_10146933 | |||
| 2355 | Ga0207646_10167580 | |||
| 2356 | Ga0207646_10658221 | |||
| 2357 | Ga0207646_10771753 | |||
| 2358 | Ga0207646_10980208 | |||
| 2359 | Ga0207681_10009178 | |||
| 2360 | Ga0207681_10022038 | |||
| 2361 | Ga0207681_10025121 | |||
| 2362 | Ga0207681_10036364 | |||
| 2363 | Ga0207681_10051798 | |||
| 2364 | Ga0207681_10146109 | |||
| 2365 | Ga0207681_10438186 | |||
| 2366 | Ga0207694_10142401 | |||
| 2367 | Ga0207650_10002374 | |||
| 2368 | Ga0207650_10084901 | |||
| 2369 | Ga0207650_10121252 | |||
| 2370 | Ga0207650_10295594 | |||
| 2371 | Ga0207650_10549731 | |||
| 2372 | Ga0207650_10801154 | |||
| 2373 | Ga0207659_10000079 | |||
| 2374 | Ga0207659_10001272 | |||
| 2375 | Ga0207659_10001629 | |||
| 2376 | Ga0207659_10012585 | |||
| 2377 | Ga0207659_10029655 | |||
| 2378 | Ga0207659_10058294 | |||
| 2379 | Ga0207659_10097120 | |||
| 2380 | Ga0207659_10136365 | |||
| 2381 | Ga0207659_10163907 | |||
| 2382 | Ga0207659_10193963 | |||
| 2383 | Ga0207659_10235224 | |||
| 2384 | Ga0207659_10581384 | |||
| 2385 | Ga0207687_10124628 | |||
| 2386 | Ga0207687_10136073 | |||
| 2387 | Ga0207687_10263500 | |||
| 2388 | Ga0207687_11381762 | |||
| 2389 | Ga0207700_10005583 | |||
| 2390 | Ga0207700_10006132 | |||
| 2391 | Ga0207700_10279505 | |||
| 2392 | Ga0207700_10438202 | |||
| 2393 | Ga0207700_11121973 | |||
| 2394 | Ga0207664_10139643 | |||
| 2395 | Ga0207644_10098430 | |||
| 2396 | Ga0207644_10103306 | |||
| 2397 | Ga0207644_10464392 | |||
| 2398 | Ga0207644_11140984 | |||
| 2399 | Ga0207690_10116446 | |||
| 2400 | Ga0207690_10159647 | |||
| 2401 | Ga0207706_10006050 | |||
| 2402 | Ga0207706_10101857 | |||
| 2403 | Ga0207706_10129500 | |||
| 2404 | Ga0207706_10134783 | |||
| 2405 | Ga0207706_10164552 | |||
| 2406 | Ga0207706_10167166 | |||
| 2407 | Ga0207706_10388096 | |||
| 2408 | Ga0207706_10418896 | |||
| 2409 | Ga0207706_10902198 | |||
| 2410 | Ga0207686_10012850 | |||
| 2411 | Ga0207686_10020581 | |||
| 2412 | Ga0207686_10049693 | |||
| 2413 | Ga0207686_10238381 | |||
| 2414 | Ga0207686_10242409 | |||
| 2415 | Ga0207686_10647968 | |||
| 2416 | Ga0207686_11249943 | |||
| 2417 | Ga0207709_10004795 | |||
| 2418 | Ga0207709_10006292 | |||
| 2419 | Ga0207709_10194962 | |||
| 2420 | Ga0207709_10307838 | |||
| 2421 | Ga0207670_10002109 | |||
| 2422 | Ga0207670_10093752 | |||
| 2423 | Ga0207670_10163474 | |||
| 2424 | Ga0207670_10250581 | |||
| 2425 | Ga0207670_10341404 | |||
| 2426 | Ga0207670_10496198 | |||
| 2427 | Ga0207670_10639302 | |||
| 2428 | Ga0207670_10803123 | |||
| 2429 | Ga0207669_10029033 | |||
| 2430 | Ga0207669_10322202 | |||
| 2431 | Ga0207669_10380953 | |||
| 2432 | Ga0207669_10612134 | |||
| 2433 | Ga0207669_10702761 | |||
| 2434 | Ga0207669_10807414 | |||
| 2435 | Ga0207669_10889369 | |||
| 2436 | Ga0207669_11210408 | |||
| 2437 | Ga0207704_10001806 | |||
| 2438 | Ga0207704_10022964 | |||
| 2439 | Ga0207704_10095293 | |||
| 2440 | Ga0207704_10101794 | |||
| 2441 | Ga0207704_10141205 | |||
| 2442 | Ga0207704_10668633 | |||
| 2443 | Ga0207665_10090888 | |||
| 2444 | Ga0207665_10553627 | |||
| 2445 | Ga0207665_10852006 | |||
| 2446 | Ga0207691_10018862 | |||
| 2447 | Ga0207691_10045113 | |||
| 2448 | Ga0207691_10070189 | |||
| 2449 | Ga0207691_10122904 | |||
| 2450 | Ga0207691_10176973 | |||
| 2451 | Ga0207691_10353247 | |||
| 2452 | Ga0207691_10428238 | |||
| 2453 | Ga0207691_10538456 | |||
| 2454 | Ga0207691_10642074 | |||
| 2455 | Ga0207691_10649339 | |||
| 2456 | Ga0207711_10006268 | |||
| 2457 | Ga0207711_10027728 | |||
| 2458 | Ga0207711_10036902 | |||
| 2459 | Ga0207711_10057589 | |||
| 2460 | Ga0207711_10082424 | |||
| 2461 | Ga0207711_10141424 | |||
| 2462 | Ga0207711_10379055 | |||
| 2463 | Ga0207711_10584376 | |||
| 2464 | Ga0207711_10589809 | |||
| 2465 | Ga0207711_10821846 | |||
| 2466 | Ga0207711_10920258 | |||
| 2467 | Ga0207711_11097910 | |||
| 2468 | Ga0207689_10000032 | |||
| 2469 | Ga0207689_10045085 | |||
| 2470 | Ga0207689_10081837 | |||
| 2471 | Ga0207689_10125401 | |||
| 2472 | Ga0207689_10228789 | |||
| 2473 | Ga0207689_10240049 | |||
| 2474 | Ga0207689_10323548 | |||
| 2475 | Ga0207661_10098786 | |||
| 2476 | Ga0207661_10106732 | |||
| 2477 | Ga0207661_10334552 | |||
| 2478 | Ga0207661_10342356 | |||
| 2479 | Ga0207661_10396865 | |||
| 2480 | Ga0207661_10795048 | |||
| 2481 | Ga0207679_10073204 | |||
| 2482 | Ga0207679_10686495 | |||
| 2483 | Ga0207679_10744666 | |||
| 2484 | Ga0207679_10801763 | |||
| 2485 | Ga0207679_11371468 | |||
| 2486 | Ga0207667_10104283 | |||
| 2487 | Ga0207667_10451829 | |||
| 2488 | Ga0207667_10866185 | |||
| 2489 | Ga0207667_11025418 | |||
| 2490 | Ga0207651_10010999 | |||
| 2491 | Ga0207651_10048187 | |||
| 2492 | Ga0207651_10110003 | |||
| 2493 | Ga0207651_10185688 | |||
| 2494 | Ga0207651_10342397 | |||
| 2495 | Ga0207651_10524791 | |||
| 2496 | Ga0207712_10073047 | |||
| 2497 | Ga0207712_10260004 | |||
| 2498 | Ga0207712_11240747 | |||
| 2499 | Ga0207712_11279341 | |||
| 2500 | Ga0207668_10085374 | |||
| 2501 | Ga0207668_10730246 | |||
| 2502 | Ga0207668_11564651 | |||
| 2503 | Ga0207640_10873542 | |||
| 2504 | Ga0207640_10910496 | |||
| 2505 | Ga0207640_11062493 | |||
| 2506 | Ga0207677_10065710 | |||
| 2507 | Ga0207677_10201274 | |||
| 2508 | Ga0207677_10270975 | |||
| 2509 | Ga0207677_10331780 | |||
| 2510 | Ga0207677_10557228 | |||
| 2511 | Ga0207703_10008882 | |||
| 2512 | Ga0207703_10018977 | |||
| 2513 | Ga0207703_10045404 | |||
| 2514 | Ga0207703_10049674 | |||
| 2515 | Ga0207703_10065358 | |||
| 2516 | Ga0207703_10167253 | |||
| 2517 | Ga0207703_10227604 | |||
| 2518 | Ga0207703_10838593 | |||
| 2519 | Ga0207703_10888294 | |||
| 2520 | Ga0207703_11245904 | |||
| 2521 | Ga0207639_10200242 | |||
| 2522 | Ga0207678_10054360 | |||
| 2523 | Ga0207678_10292250 | |||
| 2524 | Ga0207708_10004043 | |||
| 2525 | Ga0207708_10004337 | |||
| 2526 | Ga0207708_10102480 | |||
| 2527 | Ga0207708_10115449 | |||
| 2528 | Ga0207708_10132107 | |||
| 2529 | Ga0207708_10227810 | |||
| 2530 | Ga0207708_10231410 | |||
| 2531 | Ga0207708_10289983 | |||
| 2532 | Ga0207708_10419909 | |||
| 2533 | Ga0207702_10314643 | |||
| 2534 | Ga0207641_10000955 | |||
| 2535 | Ga0207641_10106423 | |||
| 2536 | Ga0207641_10329613 | |||
| 2537 | Ga0207641_10341335 | |||
| 2538 | Ga0207641_10790080 | |||
| 2539 | Ga0207641_11598577 | |||
| 2540 | Ga0207648_10001379 | |||
| 2541 | Ga0207648_10002536 | |||
| 2542 | Ga0207648_10053012 | |||
| 2543 | Ga0207648_10092785 | |||
| 2544 | Ga0207648_10099685 | |||
| 2545 | Ga0207648_10139264 | |||
| 2546 | Ga0207648_10211164 | |||
| 2547 | Ga0207648_10254914 | |||
| 2548 | Ga0207648_10281533 | |||
| 2549 | Ga0207648_10334651 | |||
| 2550 | Ga0207648_11322834 | |||
| 2551 | Ga0207648_11467147 | |||
| 2552 | Ga0207676_10014812 | |||
| 2553 | Ga0207676_10032483 | |||
| 2554 | Ga0207676_10034193 | |||
| 2555 | Ga0207676_10109644 | |||
| 2556 | Ga0207676_10150793 | |||
| 2557 | Ga0207676_10180475 | |||
| 2558 | Ga0207676_10307813 | |||
| 2559 | Ga0207676_10525687 | |||
| 2560 | Ga0207674_10061584 | |||
| 2561 | Ga0207674_10592894 | |||
| 2562 | Ga0207674_10656898 | |||
| 2563 | Ga0207674_10707475 | |||
| 2564 | Ga0207675_100087094 | |||
| 2565 | Ga0207675_100088170 | |||
| 2566 | Ga0207675_100115838 | |||
| 2567 | Ga0207675_100116172 | |||
| 2568 | Ga0207675_100230505 | |||
| 2569 | Ga0207675_100254408 | |||
| 2570 | Ga0207675_100278637 | |||
| 2571 | Ga0207675_100347885 | |||
| 2572 | Ga0207675_100385732 | |||
| 2573 | Ga0207675_100595480 | |||
| 2574 | Ga0207675_100618544 | |||
| 2575 | Ga0207675_100857438 | |||
| 2576 | Ga0207675_101042915 | |||
| 2577 | Ga0207683_10033044 | |||
| 2578 | Ga0207683_10157417 | |||
| 2579 | Ga0207683_10206224 | |||
| 2580 | Ga0207683_10313072 | |||
| 2581 | Ga0207683_10414536 | |||
| 2582 | Ga0207683_10433160 | |||
| 2583 | Ga0207683_10558342 | |||
| 2584 | Ga0207683_10688106 | |||
| 2585 | Ga0207683_10800358 | |||
| 2586 | Ga0207683_11067291 | |||
| 2587 | Ga0207683_11146007 | |||
| 2588 | Ga0207698_10400208 | |||
| 2589 | Ga0209983_1106675 | |||
| 2590 | Ga0209971_1026227 | |||
| 2591 | Ga0209974_10063480 | |||
| 2592 | Ga0207428_10000005 | |||
| 2593 | Ga0207428_10000156 | |||
| 2594 | Ga0207428_10003214 | |||
| 2595 | Ga0207428_10006617 | |||
| 2596 | Ga0207428_10007795 | |||
| 2597 | Ga0207428_10017798 | |||
| 2598 | Ga0207428_10032828 | |||
| 2599 | Ga0207428_10035587 | |||
| 2600 | Ga0207428_10331834 | |||
| 2601 | Ga0207428_10630272 | |||
| 2602 | Ga0268266_10076315 | |||
| 2603 | Ga0268266_10148463 | |||
| 2604 | Ga0268266_10204191 | |||
| 2605 | Ga0268266_10400322 | |||
| 2606 | Ga0268265_10007655 | |||
| 2607 | Ga0268265_10080399 | |||
| 2608 | Ga0268265_10151383 | |||
| 2609 | Ga0268265_10192637 | |||
| 2610 | Ga0268265_10221870 | |||
| 2611 | Ga0268265_10533288 | |||
| 2612 | Ga0268265_10595829 | |||
| 2613 | Ga0268264_10023300 | |||
| 2614 | Ga0268264_10035080 | |||
| 2615 | Ga0268264_10148355 | |||
| 2616 | Ga0268264_10278405 | |||
| 2617 | Ga0268264_10282422 | |||
| 2618 | Ga0268264_10334699 | |||
| 2619 | Ga0268264_10473607 | |||
| 2620 | Ga0265316_10444674 | |||
| 2621 | Ga0307408_100078365 | |||
| 2622 | Ga0307408_100081459 | |||
| 2623 | Ga0307408_100392206 | |||
| 2624 | Ga0307408_100803021 | |||
| 2625 | Ga0265314_10033286 | |||
| 2626 | Ga0307405_10079173 | |||
| 2627 | Ga0307405_10112523 | |||
| 2628 | Ga0307405_10133043 | |||
| 2629 | Ga0307405_10482364 | |||
| 2630 | Ga0307405_10597284 | |||
| 2631 | Ga0307413_10100156 | |||
| 2632 | Ga0307413_10463454 | |||
| 2633 | Ga0307413_10927710 | |||
| 2634 | Ga0307410_10051926 | |||
| 2635 | Ga0307410_10079408 | |||
| 2636 | Ga0307410_10116868 | |||
| 2637 | Ga0307410_10124814 | |||
| 2638 | Ga0307410_10835309 | |||
| 2639 | Ga0307406_10343830 | |||
| 2640 | Ga0307407_10084019 | |||
| 2641 | Ga0307412_10194730 | |||
| 2642 | Ga0307412_10542345 | |||
| 2643 | Ga0307409_100074356 | |||
| 2644 | Ga0307409_100300793 | |||
| 2645 | Ga0307416_100028056 | |||
| 2646 | Ga0307416_100038313 | |||
| 2647 | Ga0307416_100059664 | |||
| 2648 | Ga0307416_100300829 | |||
| 2649 | Ga0307416_100374617 | |||
| 2650 | Ga0307416_100707017 | |||
| 2651 | Ga0307414_10097706 | |||
| 2652 | Ga0307414_10129721 | |||
| 2653 | Ga0307414_10349360 | |||
| 2654 | Ga0307414_10615760 | |||
| 2655 | Ga0307414_10640988 | |||
| 2656 | Ga0307414_11121239 | |||
| 2657 | Ga0307411_10114535 | |||
| 2658 | Ga0307411_10117822 | |||
| 2659 | Ga0307411_10202710 | |||
| 2660 | Ga0307411_10435962 | |||
| 2661 | Ga0307411_10460682 | |||
| 2662 | Ga0307415_100010673 | |||
| 2663 | Ga0307415_100154027 | |||
| 2664 | Ga0307415_100668424 | |||
| 2665 | Ga0307415_101172548 | |||
| 2666 | Ga0373930_0002854 | |||
| 2667 | Ga0373948_0018575 | |||
| 2668 | Ga0373950_0000492 | |||
| 2669 | Ga0373958_0024338 | |||
| 2670 | Ga0373928_0006977 | |||
| 2671 | Ga0373929_0000407 | |||
| 2672 | Ga0373949_0000966 | |||
| 2673 | Ga0373952_0000798 | |||
| 2674 | Ga0373923_0079124 | |||
| 2675 | Ga0373939_0030625 | |||
| 2676 | Ga0373939_0109649 | |||
| 2677 | Ga0373941_0013295 | |||
| 2678 | Ga0373941_0183910 | |||
| 2679 | Ga0373953_0220071 | |||
| 2680 | Ga0373954_0051964 | |||
| 2681 | Ga0373954_0184461 | |||
| 2682 | Ga0373960_0217085 | |||
| 2683 | Ga0373943_0021226 | |||
| 2684 | Ga0373943_0185733 | |||
| 2685 | Ga0373943_0217615 | |||
| 2686 | Ga0373943_0224021 | |||
| 2687 | Ga0373946_0029315 | |||
| 2688 | Ga0373946_0318098 | |||
| 2689 | Ga0373955_0003019 | |||
| 2690 | Ga0373955_0046443 | |||
| 2691 | Ga0373955_0076519 | |||
| 2692 | Ga0373955_0442855 | |||
| 2693 | Ga0373955_0842861 | |||
| 2694 | Ga0373942_0001566 | |||
| 2695 | Ga0373924_0021449 | |||
| 2696 | Ga0373924_0140817 | |||
| 2697 | Ga0373931_0007480 | |||
| 2698 | Ga0373935_0083599 | |||
| 2699 | Ga0373935_0134413 | |||
| 2700 | Ga0373935_0164017 | |||
| 2701 | Ga0373935_0185751 | |||
| 2702 | Ga0373927_0155381 | |||
| 2703 | Ga0373933_0418322 | |||
| 2704 | Ga0373933_0740285 | |||
| 2705 | Ga0373947_0003818 | |||
| 2706 | Ga0373937_0012405 | |||
| 2707 | Ga0373937_0176206 | |||
| 2708 | Ga0373937_0381356 | |||
| 2709 | Ga0373937_0393320 | |||
| 2710 | Ga0373937_0608866 | |||
| 2711 | Ga0373937_1823949 | |||
| 2712 | Ga0373925_0266622 | |||
| 2713 | Ga0373925_0482653 | |||
| 2714 | Ga0373925_0542746 | |||
| 2715 | Ga0373925_1199410 | |||
| 2716 | Ga0395900_0459263 | |||
| 2717 | Ga0395905_0197773 | |||
| 2718 | Ga0242420_027094 | |||
| 2719 | Ga0436365_0956175 | |||
| 2720 | Ga0436365_1732685 | |||
| 2721 | Ga0439439_0093016 | |||
| 2722 | Ga0439453_0017767 | |||
| 2723 | Ga0439453_0026277 | |||
| 2724 | Ga0439431_0006753 | |||
| 2725 | Ga0439433_0001889 | |||
| 2726 | Ga0439437_014446 | |||
| 2727 | Ga0439462_0051606 | |||
| 2728 | Ga0450892_007492 | |||
| 2729 | Ga0439446_0028655 | |||
| 2730 | Ga0439446_0095397 | |||
| 2731 | Ga0439446_0251776 | |||
| 2732 | Ga0439458_0092357 | |||
| 2733 | Ga0439434_0099914 | |||
| 2734 | Ga0439435_0052341 | |||
| 2735 | Ga0439435_0069724 | |||
| 2736 | Ga0439464_0061668 | |||
| 2737 | Ga0439460_0040424 | |||
| 2738 | Ga0439460_0063976 | |||
| 2739 | Ga0439460_0123444 | |||
| 2740 | Ga0450916_034769 | |||
| 2741 | Ga0451577_0424665 | |||
| 2742 | Ga0439440_0033118 | |||
| 2743 | Ga0439440_0098351 | |||
| 2744 | Ga0466963_0184194 | |||
| 2745 | Ga0466963_0239302 | |||
| 2746 | Ga0466957_0155932 | |||
| 2747 | Ga0451576_0003703 | |||
| 2748 | Ga0451576_0301734 | |||
| 2749 | Ga0466967_0493469 | |||
| 2750 | Ga0495592_0025040 | |||
| 2751 | Ga0495592_0139872 | |||
| 2752 | Ga0495603_0028319 | |||
| 2753 | Ga0495603_0042909 | |||
| 2754 | Ga0495603_0358636 | |||
| 2755 | Ga0495629_0085053 | |||
| 2756 | Ga0495629_0206389 | |||
| 2757 | Ga0495580_0316248 | |||
| 2758 | Ga0495582_0181798 | |||
| 2759 | Ga0495582_0472333 | |||
| 2760 | Ga0495639_0076786 | |||
| 2761 | Ga0495664_0171598 | |||
| 2762 | Ga0495664_0296679 | |||
| 2763 | Ga0495584_0025210 | |||
| 2764 | Ga0495584_0410163 | |||
| 2765 | Ga0495594_0029180 | |||
| 2766 | Ga0495594_0066860 | |||
| 2767 | Ga0495594_0252872 | |||
| 2768 | Ga0495594_0353963 | |||
| 2769 | Ga0495608_0003942 | |||
| 2770 | Ga0495618_0086045 | |||
| 2771 | Ga0495618_0617134 | |||
| 2772 | Ga0495630_0009709 | |||
| 2773 | Ga0495630_1022797 | |||
| 2774 | Ga0495643_0009097 | |||
| 2775 | Ga0495644_0096332 | |||
| 2776 | Ga0495663_0017329 | |||
| 2777 | Ga0495652_0245893 | |||
| 2778 | Ga0495652_0635473 | |||
| 2779 | Ga0495654_0322069 | |||
| 2780 | Ga0495665_0483848 | |||
| 2781 | Ga0495640_0047607 | |||
| 2782 | Ga0495640_0078023 | |||
| 2783 | Ga0495640_0416169 | |||
| 2784 | Ga0495587_0051732 | |||
| 2785 | Ga0495587_0176508 | |||
| 2786 | Ga0495598_0012654 | |||
| 2787 | Ga0495598_0117596 | |||
| 2788 | Ga0495598_0146081 | |||
| 2789 | Ga0495609_0019629 | |||
| 2790 | Ga0495621_0003364 | |||
| 2791 | Ga0495621_0037939 | |||
| 2792 | Ga0495621_0109503 | |||
| 2793 | Ga0495621_0116445 | |||
| 2794 | Ga0495645_0000450 | |||
| 2795 | Ga0495633_0093088 | |||
| 2796 | Ga0495667_0040064 | |||
| 2797 | Ga0495634_0081249 | |||
| 2798 | Ga0495634_0326616 | |||
| 2799 | Ga0495634_0422055 | |||
| 2800 | Ga0495611_0197354 | |||
| 2801 | Ga0495635_0053736 | |||
| 2802 | Ga0495635_0088667 | |||
| 2803 | Ga0495659_0015579 | |||
| 2804 | Ga0495659_0191227 | |||
| 2805 | Ga0495588_0057859 | |||
| 2806 | Ga0495657_0311723 | |||
| 2807 | Ga0495623_0047499 | |||
| 2808 | Ga0495647_0214209 | |||
| 2809 | Ga0495658_0025322 | |||
| 2810 | Ga0495658_0090500 | |||
| 2811 | Ga0495658_0168637 | |||
| 2812 | Ga0495658_0580717 | |||
| 2813 | Ga0495669_0004081 | |||
| 2814 | Ga0495669_0007347 | |||
| 2815 | Ga0495669_0103649 | |||
| 2816 | Ga0495669_0333198 | |||
| 2817 | Ga0495613_0001676 | |||
| 2818 | Ga0495670_0077989 | |||
| 2819 | Ga0495600_0092987 | |||
| 2820 | Ga0495600_0332280 | |||
| 2821 | Ga0495636_0043766 | |||
| 2822 | Ga0495674_0082858 | |||
| 2823 | Ga0495674_0091091 | |||
| 2824 | Ga0495674_0233224 | |||
| 2825 | Ga0495676_0071461 | |||
| 2826 | Ga0495675_0452837 | |||
| 2827 | Ga0495675_0476815 | |||
| 2828 | Ga0495677_0021678 | |||
| 2829 | Ga0495685_063483 | |||
| 2830 | Ga0495684_0002679 | |||
| 2831 | Ga0495684_0025447 | |||
| 2832 | Ga0495593_0174023 | |||
| 2833 | Ga0495602_0401247 | |||
| 2834 | Ga0496100_0005315 | |||
| 2835 | Ga0496100_1547020 | |||
| 2836 | Ga0496101_0000338 | |||
| 2837 | Ga0496101_0163598 | |||
| 2838 | Ga0496101_0504818 | |||
| 2839 | Ga0496102_0120104 | |||
| 2840 | Ga0496102_0365200 | |||
| 2841 | Ga0496104_0011885 | |||
| 2842 | Ga0496104_0063755 | |||
| 2843 | Ga0496104_0116270 | |||
| 2844 | Ga0496104_0641105 | |||
| 2845 | Ga0496104_0791916 | |||
| 2846 | Ga0496105_0027444 | |||
| 2847 | Ga0496105_0263662 | |||
| 2848 | Ga0496105_0522093 | |||
| 2849 | Ga0496105_0534097 | |||
| 2850 | Ga0496106_0080483 | |||
| 2851 | Ga0496107_0007329 | |||
| 2852 | Ga0496108_0228402 | |||
| 2853 | Ga0496108_0685751 | |||
| 2854 | Ga0496108_0934304 | |||
| 2855 | Ga0496109_0079029 | |||
| 2856 | Ga0496109_0165002 | |||
| 2857 | Ga0496109_0585075 | |||
| 2858 | Ga0496109_0689410 | |||
| 2859 | Ga0496110_0659312 | |||
| 2860 | Ga0496111_0221188 | |||
| 2861 | Ga0496111_1030007 | |||
| 2862 | Ga0496112_0002810 | |||
| 2863 | Ga0496112_0086620 | |||
| 2864 | Ga0496112_0167090 | |||
| 2865 | Ga0496112_0216587 | |||
| 2866 | Ga0496112_0242980 | |||
| 2867 | Ga0496112_0422774 | |||
| 2868 | Ga0496112_0456036 | |||
| 2869 | Ga0496112_0741276 | |||
| 2870 | Ga0496113_0379672 | |||
| 2871 | Ga0496114_0001212 | |||
| 2872 | Ga0496114_0050503 | |||
| 2873 | Ga0496114_0084214 | |||
| 2874 | Ga0496114_0124083 | |||
| 2875 | Ga0496114_0198014 | |||
| 2876 | Ga0496114_0222524 | |||
| 2877 | Ga0496114_0357960 | |||
| 2878 | Ga0496114_0508159 | |||
| 2879 | Ga0496115_0125497 | |||
| 2880 | Ga0501299_060055 | |||
| 2881 | Ga0501031_0169692 | |||
| 2882 | Ga0501031_0245236 | |||
| 2883 | Ga0501031_0281248 | |||
| 2884 | Ga0501034_0158536 | |||
| 2885 | Ga0501036_0258953 | |||
| 2886 | Ga0501036_0316407 | |||
| 2887 | Ga0501036_0355452 | |||
| 2888 | Ga0501036_0632035 | |||
| 2889 | Ga0501037_0177620 | |||
| 2890 | Ga0501037_0531813 | |||
| 2891 | Ga0501038_0043210 | |||
| 2892 | Ga0501038_0134017 | |||
| 2893 | Ga0501039_0005083 | |||
| 2894 | Ga0501040_0009144 | |||
| 2895 | Ga0501040_0021727 | |||
| 2896 | Ga0501040_0049618 | |||
| 2897 | Ga0501040_0422137 | |||
| 2898 | Ga0501040_0617110 | |||
| 2899 | Ga0501041_0080818 | |||
| 2900 | Ga0501041_0944903 | |||
| 2901 | Ga0501042_0003809 | |||
| 2902 | Ga0501042_0085038 | |||
| 2903 | Ga0501043_0038916 | |||
| 2904 | Ga0501046_0047476 | |||
| 2905 | Ga0501046_0054245 | |||
| 2906 | Ga0501047_0453613 | |||
| 2907 | Ga0501048_0049799 | |||
| 2908 | Ga0501048_0279882 | |||
| 2909 | Ga0501048_1149577 | |||
| 2910 | Ga0501068_0082561 | |||
| 2911 | Ga0501068_0511945 | |||
| 2912 | Ga0501071_0015832 | |||
| 2913 | Ga0501071_0192495 | |||
| 2914 | Ga0501071_0934381 | |||
| 2915 | Ga0501072_0006572 | |||
| 2916 | Ga0501072_0026593 | |||
| 2917 | Ga0501073_0326630 | |||
| 2918 | Ga0501075_0023042 | |||
| 2919 | Ga0501075_0110545 | |||
| 2920 | Ga0501075_0468852 | |||
| 2921 | Ga0501076_0040773 | |||
| 2922 | Ga0501076_0136177 | |||
| 2923 | Ga0501076_0423239 | |||
| 2924 | Ga0501076_0656617 | |||
| 2925 | Ga0501077_0047177 | |||
| 2926 | Ga0501077_0072533 | |||
| 2927 | Ga0501216_072708 | |||
| 2928 | Ga0501221_035984 | |||
| 2929 | Ga0501079_0005197 | |||
| 2930 | Ga0501079_0087472 | |||
| 2931 | Ga0501079_0669540 | |||
| 2932 | Ga0501080_0425907 | |||
| 2933 | Ga0501081_0008696 | |||
| 2934 | Ga0501081_0041776 | |||
| 2935 | Ga0501081_0588644 | |||
| 2936 | Ga0501083_0073605 | |||
| 2937 | Ga0501035_0192170 | |||
| 2938 | Ga0501035_0933073 | |||
| 2939 | Ga0501035_0961356 | |||
| 2940 | Ga0501044_0092948 | |||
| 2941 | Ga0501044_1290198 | |||
| 2942 | Ga0501045_0004657 | |||
| 2943 | Ga0501045_0241444 | |||
| 2944 | Ga0501045_0264909 | |||
| 2945 | nmdc:mga03683_1149_c1 | |||
| 2946 | nmdc:mga00v17_7255_c1 | |||
| 2947 | nmdc:mga0yw44_555493_c1 | |||
| 2948 | nmdc:mga05p37_11071_c1 | |||
| 2949 | nmdc:mga05p37_138803_c1 | |||
| 2950 | nmdc:mga05p37_139331_c1 | |||
| 2951 | nmdc:mga05p37_158861_c1 | |||
| 2952 | nmdc:mga05p37_1965492_c1 | |||
| 2953 | nmdc:mga05p37_1997_c1 | |||
| 2954 | nmdc:mga05p37_20363_c1 | |||
| 2955 | nmdc:mga05p37_23209_c1 | |||
| 2956 | nmdc:mga05p37_24698_c1 | |||
| 2957 | nmdc:mga05p37_25595_c1 | |||
| 2958 | nmdc:mga05p37_26118_c2 | |||
| 2959 | nmdc:mga05p37_34921_c1 | |||
| 2960 | nmdc:mga05p37_37736_c1 | |||
| 2961 | nmdc:mga05p37_43651_c1 | |||
| 2962 | nmdc:mga05p37_44023_c1 | |||
| 2963 | nmdc:mga05p37_48901_c1 | |||
| 2964 | nmdc:mga05p37_5217_c1 | |||
| 2965 | nmdc:mga05p37_73083_c1 | |||
| 2966 | nmdc:mga05p37_91576_c1 | |||
| 2967 | nmdc:mga05p37_967626_c1 | |||
| 2968 | nmdc:mga09592_1189676_c1 | |||
| 2969 | nmdc:mga09592_13559_c1 | |||
| 2970 | nmdc:mga09592_139923_c1 | |||
| 2971 | nmdc:mga09592_149535_c1 | |||
| 2972 | nmdc:mga09592_19921_c1 | |||
| 2973 | nmdc:mga09592_201873_c1 | |||
| 2974 | nmdc:mga09592_23513_c1 | |||
| 2975 | nmdc:mga09592_26276_c1 | |||
| 2976 | nmdc:mga09592_38159_c1 | |||
| 2977 | nmdc:mga09592_456600_c1 | |||
| 2978 | nmdc:mga09592_68792_c1 | |||
| 2979 | nmdc:mga0qj67_194295_c1 | |||
| 2980 | nmdc:mga0qj67_245188_c1 | |||
| 2981 | nmdc:mga0qj67_255819_c1 | |||
| 2982 | nmdc:mga0qj67_27328_c1 | |||
| 2983 | nmdc:mga0qj67_7153_c1 | |||
| 2984 | nmdc:mga0qj67_7629_c1 | |||
| 2985 | nmdc:mga06r32_1076344_c1 | |||
| 2986 | nmdc:mga06r32_132439_c1 | |||
| 2987 | nmdc:mga06r32_14936_c1 | |||
| 2988 | nmdc:mga06r32_270474_c1 | |||
| 2989 | nmdc:mga06r32_29574_c1 | |||
| 2990 | nmdc:mga06r32_616343_c1 | |||
| 2991 | nmdc:mga06r32_655429_c1 | |||
| 2992 | nmdc:mga06r32_86132_c1 | |||
| 2993 | nmdc:mga06r32_9476_c1 | |||
| 2994 | nmdc:mga08y16_108808_c1 | |||
| 2995 | nmdc:mga08y16_116259_c1 | |||
| 2996 | nmdc:mga08y16_1178584_c1 | |||
| 2997 | nmdc:mga08y16_1367_c1 | |||
| 2998 | nmdc:mga08y16_1568_c1 | |||
| 2999 | nmdc:mga08y16_227293_c1 | |||
| 3000 | nmdc:mga08y16_2507_c1 | |||
| 3001 | nmdc:mga08y16_2643_c1 | |||
| 3002 | nmdc:mga08y16_266469_c1 | |||
| 3003 | nmdc:mga08y16_273804_c1 | |||
| 3004 | nmdc:mga08y16_2862_c1 | |||
| 3005 | nmdc:mga08y16_352547_c1 | |||
| 3006 | nmdc:mga08y16_390387_c1 | |||
| 3007 | nmdc:mga08y16_449722_c1 | |||
| 3008 | nmdc:mga08y16_4998_c1 | |||
| 3009 | nmdc:mga08y16_658_c1 | |||
| 3010 | nmdc:mga08y16_67477_c1 | |||
| 3011 | nmdc:mga08y16_9_c1 | |||
| 3012 | nmdc:mga0n895_1037810_c1 | |||
| 3013 | nmdc:mga0n895_13596_c1 | |||
| 3014 | nmdc:mga0n895_141_c1 | |||
| 3015 | nmdc:mga0n895_166078_c1 | |||
| 3016 | nmdc:mga0n895_19824_c1 | |||
| 3017 | nmdc:mga0n895_267490_c1 | |||
| 3018 | nmdc:mga0n895_304759_c1 | |||
| 3019 | nmdc:mga0n895_343217_c1 | |||
| 3020 | nmdc:mga0n895_35782_c1 | |||
| 3021 | nmdc:mga0n895_472679_c1 | |||
| 3022 | nmdc:mga0n895_476418_c1 | |||
| 3023 | nmdc:mga0n895_546195_c1 | |||
| 3024 | nmdc:mga0n895_58404_c1 | |||
| 3025 | nmdc:mga0n895_602783_c1 | |||
| 3026 | nmdc:mga0n895_72372_c1 | |||
| 3027 | nmdc:mga0n895_737660_c1 | |||
| 3028 | nmdc:mga0n895_81880_c1 | |||
| 3029 | nmdc:mga0rr50_1006114_c1 | |||
| 3030 | nmdc:mga0rr50_12990_c1 | |||
| 3031 | nmdc:mga0rr50_14183_c1 | |||
| 3032 | nmdc:mga0rr50_176227_c1 | |||
| 3033 | nmdc:mga0rr50_1_c1 | |||
| 3034 | nmdc:mga0rr50_316066_c1 | |||
| 3035 | nmdc:mga0rr50_398071_c1 | |||
| 3036 | nmdc:mga0rr50_539301_c1 | |||
| 3037 | nmdc:mga0rr50_560727_c1 | |||
| 3038 | nmdc:mga0rr50_682119_c1 | |||
| 3039 | nmdc:mga0rr50_761091_c1 | |||
| 3040 | nmdc:mga0rr50_8550_c1 | |||
| 3041 | nmdc:mga0rr50_8679_c1 | |||
| 3042 | nmdc:mga08x19_148053_c1 | |||
| 3043 | nmdc:mga08x19_153311_c1 | |||
| 3044 | nmdc:mga08x19_191333_c1 | |||
| 3045 | nmdc:mga08x19_3155_c1 | |||
| 3046 | nmdc:mga08x19_34798_c1 | |||
| 3047 | nmdc:mga08x19_416343_c1 | |||
| 3048 | nmdc:mga08x19_92_c1 | |||
| 3049 | nmdc:mga0a205_112707_c2 | |||
| 3050 | nmdc:mga0a205_120196_c1 | |||
| 3051 | nmdc:mga0a205_12067_c2 | |||
| 3052 | nmdc:mga0a205_1225776_c1 | |||
| 3053 | nmdc:mga0a205_131663_c1 | |||
| 3054 | nmdc:mga0a205_132875_c1 | |||
| 3055 | nmdc:mga0a205_151535_c1 | |||
| 3056 | nmdc:mga0a205_167404_c1 | |||
| 3057 | nmdc:mga0a205_219892_c1 | |||
| 3058 | nmdc:mga0a205_2573_c1 | |||
| 3059 | nmdc:mga0a205_281542_c1 | |||
| 3060 | nmdc:mga0a205_370522_c1 | |||
| 3061 | nmdc:mga0a205_394862_c1 | |||
| 3062 | nmdc:mga0a205_532506_c1 | |||
| 3063 | nmdc:mga0a205_649189_c1 | |||
| 3064 | nmdc:mga0a205_676287_c1 | |||
| 3065 | nmdc:mga0sz30_222545_c1 | |||
| 3066 | Ga0495601_0003730 | |||
| 3067 | Ga0495601_0068407 | |||
| 3068 | Ga0495601_0135362 | |||
| 3069 | Ga0495595_0012548 | |||
| 3070 | Ga0495595_0405849 | |||
| 3071 | Ga0495619_0006567 | |||
| 3072 | Ga0495619_0280366 | |||
| 3073 | Ga0495619_0433888 | |||
| 3074 | Ga0495619_0769263 | |||
| 3075 | Ga0500628_043052 | |||
| 3076 | Ga0501084_0009574 | |||
| 3077 | Ga0501084_0043281 | |||
| 3078 | Ga0501084_0359012 | |||
| 3079 | Ga0501084_1006567 | |||
| 3080 | Ga0590071_000739 | |||
| 3081 | Ga0590071_005043 | |||
| 3082 | Ga0590074_003587 | |||
| 3083 | Ga0590074_042319 | |||
| 3084 | Ga0590075_001312 | |||
| 3085 | Ga0590075_002211 | |||
| 3086 | Ga0590075_057765 | |||
| 3087 | Ga0590075_113661 | |||
| 3088 | Ga0590077_000747 | |||
| 3089 | Ga0587091_100514 | |||
| 3090 | Ga0587114_031768 | |||
| 3091 | Ga0501082_0163480 | |||
| 3092 | Ga0501082_0444785 | |||
| 3093 | Ga0501082_0818939 | |||
| 3094 | Ga0530510_0009184 | |||
| 3095 | Ga0530510_0062078 | |||
| 3096 | Ga0530510_0289552 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ej3-assembly1.cif.gz_G | m. tuberculosis rnap pause escaped complex with bacillus subtilis nusg and gmpcpp | 0.8273 | 4 | 97 |
| 6c6t-assembly1.cif.gz_D | cryoem structure of e.coli rna polymerase elongation complex bound with rfah | 0.8099 | 4 | 93 |
| 2oug-assembly4.cif.gz_D | crystal structure of the rfah transcription factor at 2.1a resolution | 0.7971 | 4 | 93 |
| 5ond-assembly1.cif.gz_A | rfah from escherichia coli in complex with ops dna | 0.7917 | 3 | 95 |
| 8exy-assembly1.cif.gz_G | m. tuberculosis rnap paused complex with b. subtilis nusg and gmpcpp | 0.782 | 4 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIU9_43_152_3.30.70.940 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.8525 | 3 | 93 | 3.30.70.940 |
| af_O13936_718_779_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.803 | 114 | 163 | 2.30.30.30 |
| af_I1J750_105_222_3.30.70.940 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.8002 | 4 | 101 | 3.30.70.940 |
| 2ougC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.7995 | 4 | 93 | 3.30.70.940 |
| af_P0AFG0_1_117_3.30.70.940 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.7717 | 2 | 101 | 3.30.70.940 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U3QDJ7-F1-model_v4 | Transcription termination factor NusG domain protein | 0.9505 | 2 | 163 |
GO:0031564
GO:0140673 |
| AF-A0A2H6FC29-F1-model_v4 | Transcriptional activator RfaH | 0.9485 | 2 | 163 |
GO:0031564
GO:0140673 |
| AF-A0A6N6S5U6-F1-model_v4 | UpxY family transcription antiterminator | 0.9394 | 1 | 163 |
GO:0031564
GO:0140673 |
| AF-A0A2U3QDJ7-F1-model_v4 | Transcription termination factor NusG domain protein | 0.9393 | 2 | 163 |
GO:0031564
GO:0140673 |
| AF-A0A2H6FC29-F1-model_v4 | Transcriptional activator RfaH | 0.9374 | 2 | 163 |
GO:0031564
GO:0140673 |