F494744

General Info

Members Datasets Scaffolds Average Seq Length
1557 543 1529 290

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0378170|Ga0436360_0378170_100_1134
Length 344
Sequence MLARPRRSVLYMPGSNLKALAKAASLTADALILDLEDSVAPDAKVLARAQVIEAVRGDFGGREVVIRVNGPHTPWGPEDLVAAAKAGPDAILLPKVDGAGAVMLAARILRENGAPERTRLWAMMETPNAILNAGQIAAVAADSASRLAVMVMGLNDLAKETRARLTPGRPTMIAWLAGCAVAARAHGIDIIDGVYNDIKDLDGFRAECVQGRDLGLDGKTLIHPSQIDICNEVFAPTRTEVESARAIIDAFALPENAGRGVIQLNGKMVELLHADMARRTLAIADAITGSLRSPSPGLSRGLRGEEPAAGTRPGADGSGRALAGQGDPPVAQAKDGSKREGLGL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2626541554 Frankia sp. AvcI.1 Isolate Nodule
5 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
6 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
7 2643221711 Terrabacter sp. Root85 Isolate Unclassified
8 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
9 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
10 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
11 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
12 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
13 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
14 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
15 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
16 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
17 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
18 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
19 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
20 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
21 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
22 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
23 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
24 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
25 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
26 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
27 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
28 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
29 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
30 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
31 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
32 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
33 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
34 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
35 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
36 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
37 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
41 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
42 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
43 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
44 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
45 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
46 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
47 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
48 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
49 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
52 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
57 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
73 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
86 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
87 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
88 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
89 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
90 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
91 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
92 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
93 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
94 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
95 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
100 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
101 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
102 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
103 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
104 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
107 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
108 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
109 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
110 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
111 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
112 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
113 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
114 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
119 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
120 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
121 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
122 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
123 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
124 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
125 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
126 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
127 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
133 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
134 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
135 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
136 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
137 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
138 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
139 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
140 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
141 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
142 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
143 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
144 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
145 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
146 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
147 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
149 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
150 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
151 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
152 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
153 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
154 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
155 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
156 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
157 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
160 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
161 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
162 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
168 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
169 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
170 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
177 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
178 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
179 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
190 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
191 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
192 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
193 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
197 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
198 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
269 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
271 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
275 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
276 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
277 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
278 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
279 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
280 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
281 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
282 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
283 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
284 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
285 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
286 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
287 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
288 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
289 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
290 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
291 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
292 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
293 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
294 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
295 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
298 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
299 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
300 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
301 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
302 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
303 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
304 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
305 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
306 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
307 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
308 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
309 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
310 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
311 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
312 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
313 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
314 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
316 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
317 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
318 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
319 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
320 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
321 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
322 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
323 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
324 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
325 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
326 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
327 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
328 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
329 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
330 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
331 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
332 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
333 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
334 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
335 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
336 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
337 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
340 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
342 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
343 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
344 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
345 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
348 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
349 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
350 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
351 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
352 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
353 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
354 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
355 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
356 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
357 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
358 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
359 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
360 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
361 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
362 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
363 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
364 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
365 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
366 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
367 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
368 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
369 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
370 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
371 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
372 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
373 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
374 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
375 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
376 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
377 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
378 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
379 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
380 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
381 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
382 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
383 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
384 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
385 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
386 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
387 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
388 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
389 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
390 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
391 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
392 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
393 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
394 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
395 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
396 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
397 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
398 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
399 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
400 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
401 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
402 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
403 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
404 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
405 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
406 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
407 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
408 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
409 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
410 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
411 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
412 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
413 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
414 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
415 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
416 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
417 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
418 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
419 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
420 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
423 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
424 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
425 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
426 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
427 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
428 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
429 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
430 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
431 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
434 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
435 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
436 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
437 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
438 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
439 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
440 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
441 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
442 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
443 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
444 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
445 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
446 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
447 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
448 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
449 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
450 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
451 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
452 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
453 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
454 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
455 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
456 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
457 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
458 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
459 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
472 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
473 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
474 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
475 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
476 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
477 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
478 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
479 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
480 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
481 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
482 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
483 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
484 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
485 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
486 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
489 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
490 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
491 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
492 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
493 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
494 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
495 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
496 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
497 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
498 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
499 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
500 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
501 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
502 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
503 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
504 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
505 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
506 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
507 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
508 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
509 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
510 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
511 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
512 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
513 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
514 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
515 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
516 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
517 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
518 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
519 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
520 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
521 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
522 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
523 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
524 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
525 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
526 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
527 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
528 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
529 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
530 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
531 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
532 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
533 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
534 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
535 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
536 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
537 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
538 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
539 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
540 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
541 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
542 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
543 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 0.19
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.27
Nodule 0.9
Rhizoplane 5.2
Rhizosphere 86.19
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745207 2209111006 Bacteria 15420
2 ARcpr5oldR_c000007 3300000041 Bacteria 41749
3 ARSoilYngRDRAFT_c00111 3300000042 Bacteria 13938
4 ARcpr5yngRDRAFT_c000090 3300000043 Bacteria 14724
5 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
6 ARCol0yngRDRAFT_1000074 3300000652 Bacteria 18636
7 JGI24736J21556_1007414 3300001904 Bacteria 1844
8 JGI24741J21665_1000480 3300001915 Bacteria 12218
9 JGI24752J21851_1000640 3300001976 Bacteria 4666
10 JGI24746J21847_1000605 3300001977 Bacteria 5447
11 JGI24739J22299_10000119 3300001989 Bacteria 24437
12 JGI24739J22299_10035979 3300001989 Bacteria 1675
13 JGI24737J22298_10000258 3300001990 Bacteria 17613
14 JGI24737J22298_10004381 3300001990 Bacteria 4928
15 JGI24737J22298_10004460 3300001990 Bacteria 4877
16 JGI24735J21928_10012687 3300002067 Bacteria 2661
17 JGI24750J21931_1000164 3300002070 Bacteria 11020
18 JGI24745J21846_1000018 3300002073 Bacteria 10266
19 JGI24745J21846_1000103 3300002073 Bacteria 6407
20 JGI24738J21930_10000155 3300002075 Bacteria 17211
21 JGI24738J21930_10000169 3300002075 Bacteria 16633
22 JGI24749J21850_1000093 3300002076 Bacteria 15913
23 JGI24749J21850_1004421 3300002076 Bacteria 1964
24 JGI24744J21845_10006890 3300002077 Bacteria 2349
25 JGI24035J26624_1000048 3300002126 Bacteria 9152
26 JGI24034J26672_10003984 3300002239 Bacteria 2081
27 JGI24742J22300_10000595 3300002244 Bacteria 5438
28 JGI24751J29686_10004452 3300002459 Bacteria 2845
29 JGI25153J46596_10001652 3300003215 Bacteria 13208
30 Ga0006562J51391_1047206 3300003578 Bacteria 2140
31 Ga0006562J51391_1190565 3300003578 Bacteria 2073
32 JGI25404J52841_10015611 3300003659 Bacteria 1648
33 JGI25405J52794_10012973 3300003911 Bacteria 1611
34 Ga0055543_1027913 3300004625 Bacteria 997
35 Ga0065704_10077166 3300005289 Bacteria 4833
36 Ga0065712_10006793 3300005290 Bacteria 5842
37 Ga0065712_10068351 3300005290 Bacteria 11462
38 Ga0065715_10002722 3300005293 Bacteria 4528
39 Ga0065715_10088946 3300005293 Bacteria 21692
40 Ga0065715_10156332 3300005293 Bacteria 1673
41 Ga0065707_10200617 3300005295 Bacteria 1312
42 Ga0070658_10019947 3300005327 Bacteria 5370
43 Ga0070658_10085242 3300005327 Bacteria 2598
44 Ga0070658_10102707 3300005327 Bacteria 2364
45 Ga0070658_10485780 3300005327 Bacteria 1066
46 Ga0070676_10000514 3300005328 Bacteria 18558
47 Ga0070676_10023508 3300005328 Bacteria 3464
48 Ga0070676_10235693 3300005328 Bacteria 1215
49 Ga0070683_100005318 3300005329 Bacteria 10729
50 Ga0070683_100028872 3300005329 Bacteria 5017
51 Ga0070683_100107174 3300005329 Bacteria 2634
52 Ga0070683_100118808 3300005329 Bacteria 2496
53 Ga0070690_100005935 3300005330 Bacteria 6894
54 Ga0070690_100008454 3300005330 Bacteria 5929
55 Ga0070690_100051987 3300005330 Bacteria 2618
56 Ga0070670_100029103 3300005331 Bacteria 4753
57 Ga0070670_100031842 3300005331 Bacteria 4541
58 Ga0070670_100053768 3300005331 Bacteria 3457
59 Ga0070670_100290350 3300005331 Bacteria 1429
60 Ga0070677_10000023 3300005333 Bacteria 44929
61 Ga0068869_100000153 3300005334 Bacteria 34191
62 Ga0068869_100443697 3300005334 Bacteria 1075
63 Ga0070666_10003393 3300005335 Bacteria 9651
64 Ga0070666_10026307 3300005335 Bacteria 3799
65 Ga0070666_10090311 3300005335 Bacteria 2104
66 Ga0070680_100000814 3300005336 Bacteria 21982
67 Ga0070680_100021932 3300005336 Bacteria 5079
68 Ga0070680_100023637 3300005336 Bacteria 4904
69 Ga0070680_100023840 3300005336 Bacteria 4884
70 Ga0070680_100034181 3300005336 Bacteria 4099
71 Ga0070680_100055430 3300005336 Bacteria 3239
72 Ga0070680_100065394 3300005336 Bacteria 2980
73 Ga0070680_100081528 3300005336 Bacteria 2669
74 Ga0070680_100095019 3300005336 Bacteria 2470
75 Ga0070680_100144148 3300005336 Bacteria 1998
76 Ga0070680_100231403 3300005336 Bacteria 1561
77 Ga0070682_100000445 3300005337 Bacteria 26505
78 Ga0070682_100034266 3300005337 Bacteria 3091
79 Ga0070682_100045759 3300005337 Bacteria 2714
80 Ga0068868_100036011 3300005338 Bacteria 3828
81 Ga0070660_100001480 3300005339 Bacteria 16083
82 Ga0070660_100009730 3300005339 Bacteria 6776
83 Ga0070660_100016064 3300005339 Bacteria 5424
84 Ga0070660_100044698 3300005339 Bacteria 3389
85 Ga0070660_100062581 3300005339 Bacteria 2891
86 Ga0070689_100000880 3300005340 Bacteria 18718
87 Ga0070689_100014559 3300005340 Bacteria 5717
88 Ga0070689_100016659 3300005340 Bacteria 5380
89 Ga0070689_100019999 3300005340 Bacteria 4961
90 Ga0070689_100102900 3300005340 Bacteria 2263
91 Ga0070689_100303013 3300005340 Bacteria 1330
92 Ga0070691_10000320 3300005341 Bacteria 17013
93 Ga0070691_10020941 3300005341 Bacteria 3024
94 Ga0070687_100000187 3300005343 Bacteria 21513
95 Ga0070687_100052972 3300005343 Bacteria 2108
96 Ga0070661_100001011 3300005344 Bacteria 19919
97 Ga0070661_100121125 3300005344 Bacteria 1960
98 Ga0070661_100185723 3300005344 Bacteria 1584
99 Ga0070692_10005354 3300005345 Bacteria 5461
100 Ga0070692_10010362 3300005345 Bacteria 4238
101 Ga0070668_100000610 3300005347 Bacteria 23961
102 Ga0070668_100002838 3300005347 Bacteria 12766
103 Ga0070668_100015020 3300005347 Bacteria 5783
104 Ga0070668_100463953 3300005347 Bacteria 1091
105 Ga0070669_100000501 3300005353 Bacteria 29467
106 Ga0070669_100014047 3300005353 Bacteria 5694
107 Ga0070669_100073177 3300005353 Bacteria 2538
108 Ga0070675_100001136 3300005354 Bacteria 19211
109 Ga0070675_100112684 3300005354 Bacteria 2303
110 Ga0070675_100398912 3300005354 Bacteria 1227
111 Ga0070671_100000595 3300005355 Bacteria 25844
112 Ga0070671_100010004 3300005355 Bacteria 7615
113 Ga0070671_100094911 3300005355 Bacteria 2500
114 Ga0070671_100296233 3300005355 Bacteria 1377
115 Ga0070674_100000249 3300005356 Bacteria 26766
116 Ga0070674_100036352 3300005356 Bacteria 3305
117 Ga0070674_100154908 3300005356 Bacteria 1733
118 Ga0070673_100000233 3300005364 Bacteria 27866
119 Ga0070673_100009233 3300005364 Bacteria 6613
120 Ga0070673_100157333 3300005364 Bacteria 1929
121 Ga0070688_100000432 3300005365 Bacteria 21144
122 Ga0070688_100007072 3300005365 Bacteria 6037
123 Ga0070688_100013313 3300005365 Bacteria 4633
124 Ga0070659_100000746 3300005366 Bacteria 23656
125 Ga0070659_100004201 3300005366 Bacteria 10281
126 Ga0070659_100032594 3300005366 Bacteria 4042
127 Ga0070659_100103054 3300005366 Bacteria 2298
128 Ga0070659_100423969 3300005366 Bacteria 1125
129 Ga0070667_100001881 3300005367 Bacteria 18641
130 Ga0070667_100009149 3300005367 Bacteria 8198
131 Ga0070667_100024040 3300005367 Bacteria 5060
132 Ga0070667_100047305 3300005367 Bacteria 3619
133 Ga0070667_100150390 3300005367 Bacteria 2045
134 Ga0070667_100596193 3300005367 Bacteria 1018
135 Ga0070703_10001482 3300005406 Bacteria 7053
136 Ga0070703_10011260 3300005406 Bacteria 2525
137 Ga0070709_10005407 3300005434 Bacteria 6918
138 Ga0070709_10015617 3300005434 Bacteria 4324
139 Ga0070709_10099473 3300005434 Bacteria 1934
140 Ga0070709_10277308 3300005434 Bacteria 1217
141 Ga0070714_100026730 3300005435 Bacteria 4772
142 Ga0070714_100386758 3300005435 Bacteria 1320
143 Ga0070713_100071321 3300005436 Bacteria 2935
144 Ga0070710_10239969 3300005437 Bacteria 1161
145 Ga0070701_10000164 3300005438 Bacteria 20655
146 Ga0070701_10027546 3300005438 Bacteria 2785
147 Ga0070711_100052667 3300005439 Bacteria 2801
148 Ga0070711_100154905 3300005439 Bacteria 1731
149 Ga0070711_100193775 3300005439 Bacteria 1563
150 Ga0070705_100000361 3300005440 Bacteria 26716
151 Ga0070705_100400224 3300005440 Bacteria 1016
152 Ga0070700_100000357 3300005441 Bacteria 23494
153 Ga0070700_100028226 3300005441 Bacteria 3335
154 Ga0070694_100009629 3300005444 Bacteria 5929
155 Ga0070694_100016773 3300005444 Bacteria 4615
156 Ga0070708_100011297 3300005445 Bacteria 7260
157 Ga0070663_100000582 3300005455 Bacteria 19491
158 Ga0070663_100001457 3300005455 Bacteria 12998
159 Ga0070663_100020266 3300005455 Bacteria 4400
160 Ga0070663_100072831 3300005455 Bacteria 2504
161 Ga0070663_100107595 3300005455 Bacteria 2090
162 Ga0070663_100115033 3300005455 Bacteria 2026
163 Ga0070678_100000438 3300005456 Bacteria 19678
164 Ga0070678_100071597 3300005456 Bacteria 2596
165 Ga0070678_100293356 3300005456 Bacteria 1379
166 Ga0070678_100575000 3300005456 Bacteria 1003
167 Ga0070662_100119108 3300005457 Bacteria 2021
168 Ga0070681_10007036 3300005458 Bacteria 10953
169 Ga0070681_10009671 3300005458 Bacteria 9485
170 Ga0070681_10009946 3300005458 Bacteria 9373
171 Ga0070681_10035954 3300005458 Bacteria 4975
172 Ga0070681_10062881 3300005458 Bacteria 3684
173 Ga0070681_10162517 3300005458 Bacteria 2157
174 Ga0070681_10195401 3300005458 Bacteria 1942
175 Ga0070681_10250967 3300005458 Bacteria 1682
176 Ga0070681_10305118 3300005458 Bacteria 1501
177 Ga0068867_100001099 3300005459 Bacteria 18474
178 Ga0068867_100025161 3300005459 Bacteria 4269
179 Ga0068867_100313540 3300005459 Bacteria 1297
180 Ga0070685_10005188 3300005466 Bacteria 6605
181 Ga0070685_10006230 3300005466 Bacteria 6074
182 Ga0070685_10030426 3300005466 Bacteria 3008
183 Ga0070707_100245854 3300005468 Bacteria 1741
184 Ga0070699_100204893 3300005518 Bacteria 1755
185 Ga0070679_100002503 3300005530 Bacteria 16646
186 Ga0070679_100011322 3300005530 Bacteria 8505
187 Ga0070679_100019056 3300005530 Bacteria 6666
188 Ga0070679_100020075 3300005530 Bacteria 6512
189 Ga0070679_100048159 3300005530 Bacteria 4248
190 Ga0070679_100051793 3300005530 Bacteria 4089
191 Ga0070679_100052714 3300005530 Bacteria 4050
192 Ga0070679_100174880 3300005530 Bacteria 2119
193 Ga0070679_100337418 3300005530 Bacteria 1455
194 Ga0070684_100000101 3300005535 Bacteria 55960
195 Ga0070684_100007076 3300005535 Bacteria 8722
196 Ga0070684_100013001 3300005535 Bacteria 6697
197 Ga0070684_100075904 3300005535 Bacteria 2965
198 Ga0070684_100164515 3300005535 Bacteria 2013
199 Ga0070684_100226488 3300005535 Bacteria 1706
200 Ga0070697_100101634 3300005536 Bacteria 2388
201 Ga0070697_100136920 3300005536 Bacteria 2057
202 Ga0068853_100003127 3300005539 Bacteria 12655
203 Ga0068853_100014280 3300005539 Bacteria 6501
204 Ga0068853_100122729 3300005539 Bacteria 2319
205 Ga0068853_100142226 3300005539 Bacteria 2154
206 Ga0068853_100244036 3300005539 Bacteria 1647
207 Ga0070672_100017991 3300005543 Bacteria 5099
208 Ga0070672_100242750 3300005543 Bacteria 1515
209 Ga0070672_100324630 3300005543 Bacteria 1309
210 Ga0070686_100000532 3300005544 Bacteria 22792
211 Ga0070686_100019991 3300005544 Bacteria 3957
212 Ga0070686_100063377 3300005544 Bacteria 2394
213 Ga0070695_100010023 3300005545 Bacteria 5651
214 Ga0070696_100004177 3300005546 Bacteria 9623
215 Ga0070696_100061565 3300005546 Bacteria 2625
216 Ga0070693_100003380 3300005547 Bacteria 7425
217 Ga0070665_100000157 3300005548 Bacteria 124344
218 Ga0070665_100001531 3300005548 Bacteria 26744
219 Ga0070665_100073456 3300005548 Bacteria 3426
220 Ga0070665_100120439 3300005548 Bacteria 2626
221 Ga0070665_100229913 3300005548 Bacteria 1854
222 Ga0070665_100260502 3300005548 Bacteria 1735
223 Ga0070665_100742754 3300005548 Bacteria 994
224 Ga0070704_100009296 3300005549 Bacteria 5929
225 Ga0070704_100100285 3300005549 Bacteria 2180
226 Ga0068855_100000419 3300005563 Bacteria 52708
227 Ga0068855_100055123 3300005563 Bacteria 4670
228 Ga0068855_100055244 3300005563 Bacteria 4665
229 Ga0068855_100082985 3300005563 Bacteria 3713
230 Ga0068855_100097234 3300005563 Bacteria 3391
231 Ga0068855_100111871 3300005563 Bacteria 3134
232 Ga0068855_100131923 3300005563 Bacteria 2853
233 Ga0068855_100205696 3300005563 Bacteria 2214
234 Ga0068855_100267708 3300005563 Bacteria 1901
235 Ga0068855_100304463 3300005563 Bacteria 1764
236 Ga0070664_100020910 3300005564 Bacteria 5392
237 Ga0070664_100038658 3300005564 Bacteria 4018
238 Ga0070664_100050840 3300005564 Bacteria 3509
239 Ga0070664_100150501 3300005564 Bacteria 2054
240 Ga0070664_100662440 3300005564 Bacteria 970
241 Ga0068857_100001072 3300005577 Bacteria 21170
242 Ga0068857_100071907 3300005577 Bacteria 3083
243 Ga0068857_100161399 3300005577 Bacteria 2034
244 Ga0068857_100230593 3300005577 Bacteria 1693
245 Ga0068857_100436762 3300005577 Bacteria 1222
246 Ga0068854_100000794 3300005578 Bacteria 18790
247 Ga0068854_100318226 3300005578 Bacteria 1264
248 Ga0068856_100001903 3300005614 Bacteria 21771
249 Ga0068856_100006877 3300005614 Bacteria 11126
250 Ga0068856_100013958 3300005614 Bacteria 7767
251 Ga0068856_100135592 3300005614 Bacteria 2467
252 Ga0068856_100273432 3300005614 Bacteria 1705
253 Ga0068856_100416284 3300005614 Bacteria 1364
254 Ga0070702_100038337 3300005615 Bacteria 2668
255 Ga0070702_100213865 3300005615 Bacteria 1285
256 Ga0068852_100000713 3300005616 Bacteria 21734
257 Ga0068852_100017184 3300005616 Bacteria 5670
258 Ga0068852_100086835 3300005616 Bacteria 2789
259 Ga0068852_100184148 3300005616 Bacteria 1966
260 Ga0068859_100001523 3300005617 Bacteria 23646
261 Ga0068859_100002128 3300005617 Bacteria 20159
262 Ga0068859_100054307 3300005617 Bacteria 4028
263 Ga0068859_100069759 3300005617 Bacteria 3550
264 Ga0068859_100082804 3300005617 Bacteria 3251
265 Ga0068859_100104020 3300005617 Bacteria 2898
266 Ga0068859_100145521 3300005617 Bacteria 2444
267 Ga0068864_100000715 3300005618 Bacteria 27854
268 Ga0068864_100001593 3300005618 Bacteria 18693
269 Ga0068864_100054297 3300005618 Bacteria 3458
270 Ga0068864_100159548 3300005618 Bacteria 2049
271 Ga0068866_10000861 3300005718 Bacteria 13443
272 Ga0068866_10008505 3300005718 Bacteria 4330
273 Ga0068866_10046359 3300005718 Bacteria 2186
274 Ga0068861_100000574 3300005719 Bacteria 21775
275 Ga0068861_100184939 3300005719 Bacteria 1737
276 Ga0068861_100191918 3300005719 Bacteria 1708
277 Ga0068851_10005669 3300005834 Bacteria 5674
278 Ga0068870_10000009 3300005840 Bacteria 70353
279 Ga0068863_100000262 3300005841 Bacteria 55027
280 Ga0068863_100001272 3300005841 Bacteria 25149
281 Ga0068863_100005675 3300005841 Bacteria 12256
282 Ga0068863_100013621 3300005841 Bacteria 7844
283 Ga0068863_100099993 3300005841 Bacteria 2756
284 Ga0068863_100142437 3300005841 Bacteria 2291
285 Ga0068858_100001087 3300005842 Bacteria 28118
286 Ga0068858_100003620 3300005842 Bacteria 15288
287 Ga0068858_100008506 3300005842 Bacteria 9862
288 Ga0068858_100053433 3300005842 Bacteria 3737
289 Ga0068858_100062407 3300005842 Bacteria 3445
290 Ga0068860_100000571 3300005843 Bacteria 44338
291 Ga0068860_100001758 3300005843 Bacteria 23120
292 Ga0068860_100011314 3300005843 Bacteria 8793
293 Ga0068860_100089794 3300005843 Bacteria 2926
294 Ga0068860_100183724 3300005843 Bacteria 2021
295 Ga0068862_100012556 3300005844 Bacteria 7012
296 Ga0068862_100031143 3300005844 Bacteria 4500
297 Ga0081455_10000002 3300005937 Bacteria 460472
298 Ga0081455_10016728 3300005937 Bacteria 7064
299 Ga0081455_10023057 3300005937 Bacteria 5800
300 Ga0081455_10328335 3300005937 Bacteria 1087
301 Ga0081538_10022500 3300005981 Bacteria 4565
302 Ga0081540_1000315 3300005983 Bacteria 50137
303 Ga0081539_10010883 3300005985 Bacteria 7306
304 Ga0070717_10001112 3300006028 Bacteria 18150
305 Ga0070717_10019559 3300006028 Bacteria 5313
306 Ga0075365_10031262 3300006038 Bacteria 3415
307 Ga0075365_10077587 3300006038 Bacteria 2245
308 Ga0075368_10001941 3300006042 Bacteria 6657
309 Ga0075368_10097878 3300006042 Bacteria 1203
310 Ga0075363_100043794 3300006048 Bacteria 2368
311 Ga0075363_100060338 3300006048 Bacteria 2042
312 Ga0075363_100104572 3300006048 Bacteria 1570
313 Ga0075363_100257885 3300006048 Bacteria 1005
314 Ga0075364_10001878 3300006051 Bacteria 11665
315 Ga0075364_10010261 3300006051 Bacteria 5652
316 Ga0075364_10016442 3300006051 Bacteria 4603
317 Ga0075364_10023768 3300006051 Bacteria 3883
318 Ga0075364_10065414 3300006051 Bacteria 2387
319 Ga0075432_10042421 3300006058 Bacteria 1592
320 Ga0070716_100044143 3300006173 Bacteria 2496
321 Ga0070712_100050955 3300006175 Bacteria 2882
322 Ga0070712_100329441 3300006175 Bacteria 1244
323 Ga0075362_10000822 3300006177 Bacteria 9288
324 Ga0075362_10142203 3300006177 Bacteria 1147
325 Ga0075367_10000927 3300006178 Bacteria 11877
326 Ga0075367_10027428 3300006178 Bacteria 3240
327 Ga0075367_10131897 3300006178 Bacteria 1544
328 Ga0075366_10001911 3300006195 Bacteria 10534
329 Ga0075366_10006442 3300006195 Bacteria 6432
330 Ga0075366_10063716 3300006195 Bacteria 2191
331 Ga0097621_100001018 3300006237 Bacteria 19728
332 Ga0097621_100066291 3300006237 Bacteria 2973
333 Ga0097621_100072805 3300006237 Bacteria 2843
334 Ga0075370_10014466 3300006353 Bacteria 4210
335 Ga0075370_10071682 3300006353 Bacteria 1982
336 Ga0075370_10098868 3300006353 Bacteria 1687
337 Ga0068871_100000012 3300006358 Bacteria 105267
338 Ga0068871_100027675 3300006358 Bacteria 4435
339 Ga0068871_100057342 3300006358 Bacteria 3168
340 Ga0075428_100001200 3300006844 Bacteria 27756
341 Ga0075428_100186579 3300006844 Bacteria 2244
342 Ga0075428_100604667 3300006844 Bacteria 1171
343 Ga0075430_100000032 3300006846 Bacteria 72679
344 Ga0075430_100139668 3300006846 Bacteria 2018
345 Ga0075431_100009024 3300006847 Bacteria 9998
346 Ga0075433_10000072 3300006852 Bacteria 45390
347 Ga0075433_10005026 3300006852 Bacteria 10365
348 Ga0075433_10018903 3300006852 Bacteria 5736
349 Ga0075433_10061737 3300006852 Bacteria 3283
350 Ga0075434_100000341 3300006871 Bacteria 33666
351 Ga0075434_100001937 3300006871 Bacteria 17946
352 Ga0075434_100018020 3300006871 Bacteria 6813
353 Ga0075434_100197526 3300006871 Bacteria 2031
354 Ga0075429_100000631 3300006880 Bacteria 27160
355 Ga0068865_100000328 3300006881 Bacteria 26279
356 Ga0068865_100169816 3300006881 Bacteria 1671
357 Ga0075436_100081950 3300006914 Bacteria 2237
358 Ga0075436_100323244 3300006914 Bacteria 1108
359 Ga0097620_100001523 3300006931 Bacteria 23646
360 Ga0097620_100002128 3300006931 Bacteria 20159
361 Ga0097620_100054305 3300006931 Bacteria 4028
362 Ga0097620_100069758 3300006931 Bacteria 3550
363 Ga0097620_100082799 3300006931 Bacteria 3251
364 Ga0097620_100104023 3300006931 Bacteria 2898
365 Ga0097620_100145522 3300006931 Bacteria 2444
366 Ga0075435_100031353 3300007076 Bacteria 4187
367 Ga0075435_100061717 3300007076 Bacteria 3041
368 Ga0075435_100251199 3300007076 Bacteria 1505
369 Ga0105251_10029935 3300009011 Bacteria 2738
370 Ga0105244_10093869 3300009036 Bacteria 1474
371 Ga0105250_10004815 3300009092 Bacteria 6148
372 Ga0105240_10049890 3300009093 Bacteria 5279
373 Ga0105240_10070502 3300009093 Bacteria 4324
374 Ga0105240_10076962 3300009093 Bacteria 4111
375 Ga0105240_10099394 3300009093 Bacteria 3541
376 Ga0105240_10126637 3300009093 Bacteria 3068
377 Ga0105240_10159656 3300009093 Bacteria 2679
378 Ga0105240_10221581 3300009093 Bacteria 2203
379 Ga0105240_10272352 3300009093 Bacteria 1948
380 Ga0105240_10350234 3300009093 Bacteria 1676
381 Ga0105240_10350484 3300009093 Bacteria 1675
382 Ga0105240_10360082 3300009093 Bacteria 1648
383 Ga0105240_10528020 3300009093 Bacteria 1309
384 Ga0111539_10000915 3300009094 Bacteria 38573
385 Ga0111539_10001908 3300009094 Bacteria 27756
386 Ga0111539_10002936 3300009094 Bacteria 22607
387 Ga0111539_10025579 3300009094 Bacteria 7235
388 Ga0111539_10070815 3300009094 Bacteria 4116
389 Ga0111539_10082296 3300009094 Bacteria 3786
390 Ga0111539_10820795 3300009094 Bacteria 1082
391 Ga0105245_10001404 3300009098 Bacteria 21834
392 Ga0105245_10032714 3300009098 Bacteria 4604
393 Ga0105245_10404154 3300009098 Bacteria 1366
394 Ga0105247_10000881 3300009101 Bacteria 22689
395 Ga0105247_10028905 3300009101 Bacteria 3355
396 Ga0105247_10052704 3300009101 Bacteria 2509
397 Ga0114129_10001035 3300009147 Bacteria 36374
398 Ga0114129_10001551 3300009147 Bacteria 31169
399 Ga0114129_10012887 3300009147 Bacteria 11899
400 Ga0114129_10165065 3300009147 Bacteria 3023
401 Ga0105243_10001028 3300009148 Bacteria 25704
402 Ga0105243_10057738 3300009148 Bacteria 3091
403 Ga0105243_10230806 3300009148 Bacteria 1642
404 Ga0105241_10002538 3300009174 Bacteria 13699
405 Ga0105241_10002719 3300009174 Bacteria 13247
406 Ga0105242_10000607 3300009176 Bacteria 28041
407 Ga0105242_10014532 3300009176 Bacteria 6099
408 Ga0105242_10037770 3300009176 Bacteria 3881
409 Ga0105248_10000309 3300009177 Bacteria 58008
410 Ga0105248_10005542 3300009177 Bacteria 13869
411 Ga0105248_10011832 3300009177 Bacteria 9626
412 Ga0105248_10054667 3300009177 Bacteria 4478
413 Ga0105248_10092991 3300009177 Bacteria 3396
414 Ga0105248_10262071 3300009177 Bacteria 1946
415 Ga0105248_10574620 3300009177 Bacteria 1272
416 Ga0105237_10044704 3300009545 Bacteria 4459
417 Ga0105237_10148701 3300009545 Bacteria 2338
418 Ga0105237_10183757 3300009545 Bacteria 2091
419 Ga0105237_10216877 3300009545 Bacteria 1913
420 Ga0105238_10012601 3300009551 Bacteria 8535
421 Ga0105238_10047188 3300009551 Bacteria 4345
422 Ga0105238_10070269 3300009551 Bacteria 3500
423 Ga0105238_10158553 3300009551 Bacteria 2238
424 Ga0105238_10163350 3300009551 Bacteria 2203
425 Ga0105238_10256270 3300009551 Bacteria 1729
426 Ga0105238_10418350 3300009551 Bacteria 1335
427 Ga0105238_10681190 3300009551 Bacteria 1040
428 Ga0105249_10000486 3300009553 Bacteria 36821
429 Ga0105249_10025434 3300009553 Bacteria 5329
430 Ga0105249_10150182 3300009553 Bacteria 2242
431 Ga0105239_10006677 3300010375 Bacteria 13327
432 Ga0105239_10044405 3300010375 Bacteria 4872
433 Ga0105239_10398934 3300010375 Bacteria 1556
434 Ga0105239_10418387 3300010375 Bacteria 1518
435 Ga0105239_10608082 3300010375 Bacteria 1247
436 Ga0105239_10718658 3300010375 Bacteria 1142
437 Ga0105239_10742448 3300010375 Bacteria 1123
438 Ga0105246_10000696 3300011119 Bacteria 18957
439 Ga0105246_10028766 3300011119 Bacteria 3653
440 Ga0105246_10069057 3300011119 Bacteria 2480
441 Ga0105246_10078191 3300011119 Bacteria 2349
442 Ga0105246_10271685 3300011119 Bacteria 1355
443 Ga0157335_1000803 3300012492 Bacteria 1558
444 Ga0157373_10022136 3300013100 Bacteria 4612
445 Ga0157373_10032188 3300013100 Bacteria 3775
446 Ga0157373_10123940 3300013100 Bacteria 1817
447 Ga0157373_10164895 3300013100 Bacteria 1559
448 Ga0157373_10207712 3300013100 Bacteria 1380
449 Ga0157371_10006574 3300013102 Bacteria 9555
450 Ga0157370_10025628 3300013104 Bacteria 5836
451 Ga0157370_10096435 3300013104 Bacteria 2775
452 Ga0157370_10171597 3300013104 Bacteria 2016
453 Ga0157370_10221246 3300013104 Bacteria 1753
454 Ga0157369_10070663 3300013105 Bacteria 3750
455 Ga0157369_10108742 3300013105 Bacteria 2948
456 Ga0157369_10131872 3300013105 Bacteria 2647
457 Ga0157374_10001864 3300013296 Bacteria 17741
458 Ga0157374_10062732 3300013296 Bacteria 3484
459 Ga0157374_10095251 3300013296 Bacteria 2846
460 Ga0157374_10117339 3300013296 Bacteria 2565
461 Ga0157378_10006042 3300013297 Bacteria 10605
462 Ga0157378_10013393 3300013297 Bacteria 7168
463 Ga0157378_10089040 3300013297 Bacteria 2802
464 Ga0157378_10404076 3300013297 Bacteria 1346
465 Ga0163162_10000992 3300013306 Bacteria 26439
466 Ga0163162_10043846 3300013306 Bacteria 4478
467 Ga0163162_10068960 3300013306 Bacteria 3588
468 Ga0163162_10115482 3300013306 Bacteria 2784
469 Ga0157372_10021474 3300013307 Bacteria 6975
470 Ga0157372_10369355 3300013307 Bacteria 1672
471 Ga0157372_10458241 3300013307 Bacteria 1486
472 Ga0157372_10632191 3300013307 Bacteria 1247
473 Ga0157375_10002320 3300013308 Bacteria 16428
474 Ga0157375_10055552 3300013308 Bacteria 3905
475 Ga0157375_10063691 3300013308 Bacteria 3669
476 Ga0157375_10159046 3300013308 Bacteria 2400
477 Ga0163163_10000824 3300014325 Bacteria 26424
478 Ga0163163_10016154 3300014325 Bacteria 6929
479 Ga0163163_10025580 3300014325 Bacteria 5627
480 Ga0163163_10079548 3300014325 Bacteria 3276
481 Ga0163163_10293711 3300014325 Bacteria 1677
482 Ga0157380_10000711 3300014326 Bacteria 20809
483 Ga0157380_10130679 3300014326 Bacteria 2142
484 Ga0182008_10061091 3300014497 Bacteria 1857
485 Ga0157377_10000336 3300014745 Bacteria 21014
486 Ga0157377_10175723 3300014745 Bacteria 1343
487 Ga0157379_10000678 3300014968 Bacteria 27608
488 Ga0157379_10002722 3300014968 Bacteria 14925
489 Ga0157379_10004025 3300014968 Bacteria 12524
490 Ga0157379_10026862 3300014968 Bacteria 5124
491 Ga0157379_10041333 3300014968 Bacteria 4116
492 Ga0157379_10043686 3300014968 Bacteria 4001
493 Ga0157379_10142800 3300014968 Bacteria 2158
494 Ga0157376_10019841 3300014969 Bacteria 5189
495 Ga0157376_10087282 3300014969 Bacteria 2692
496 Ga0182005_1006295 3300015265 Bacteria 3640
497 Ga0163161_10000534 3300017792 Bacteria 31044
498 Ga0163161_10039860 3300017792 Bacteria 3373
499 Ga0206353_11098713 3300020082 Bacteria 2147
500 Ga0213876_10022439 3300021384 Bacteria 3337
501 Ga0213876_10046715 3300021384 Bacteria 2289
502 Ga0213876_10073753 3300021384 Bacteria 1802
503 Ga0213875_10000036 3300021388 Bacteria 166707
504 Ga0209677_102931 3300025253 Bacteria 5964
505 Ga0209148_1018161 3300025254 Bacteria 1185
506 Ga0207666_1000177 3300025271 Bacteria 9685
507 Ga0207666_1001810 3300025271 Bacteria 2539
508 Ga0209758_1000469 3300025297 Bacteria 66568
509 Ga0209758_1039044 3300025297 Bacteria 1811
510 Ga0207697_10000374 3300025315 Bacteria 25123
511 Ga0207697_10008005 3300025315 Bacteria 4666
512 Ga0207656_10002415 3300025321 Bacteria 6288
513 Ga0207653_10012113 3300025885 Bacteria 2691
514 Ga0207682_10000011 3300025893 Bacteria 85533
515 Ga0207692_10052034 3300025898 Bacteria 2079
516 Ga0207692_10064081 3300025898 Bacteria 1912
517 Ga0207692_10194555 3300025898 Bacteria 1189
518 Ga0207642_10014960 3300025899 Bacteria 2878
519 Ga0207710_10000805 3300025900 Bacteria 16991
520 Ga0207710_10009874 3300025900 Bacteria 4013
521 Ga0207710_10010652 3300025900 Bacteria 3871
522 Ga0207688_10000020 3300025901 Bacteria 51200
523 Ga0207688_10017255 3300025901 Bacteria 3922
524 Ga0207680_10002333 3300025903 Bacteria 8832
525 Ga0207680_10099046 3300025903 Bacteria 1870
526 Ga0207647_10002391 3300025904 Bacteria 14250
527 Ga0207647_10021814 3300025904 Bacteria 4265
528 Ga0207699_10005583 3300025906 Bacteria 6034
529 Ga0207699_10034519 3300025906 Bacteria 2870
530 Ga0207645_10000108 3300025907 Bacteria 61630
531 Ga0207645_10039054 3300025907 Bacteria 3042
532 Ga0207645_10055277 3300025907 Bacteria 2534
533 Ga0207645_10231683 3300025907 Bacteria 1219
534 Ga0207643_10000685 3300025908 Bacteria 21167
535 Ga0207705_10002453 3300025909 Bacteria 14300
536 Ga0207705_10026788 3300025909 Bacteria 4109
537 Ga0207705_10067910 3300025909 Bacteria 2580
538 Ga0207654_10000818 3300025911 Bacteria 17142
539 Ga0207654_10003291 3300025911 Bacteria 8166
540 Ga0207654_10047320 3300025911 Bacteria 2457
541 Ga0207707_10000689 3300025912 Bacteria 33589
542 Ga0207707_10001947 3300025912 Bacteria 18789
543 Ga0207707_10023475 3300025912 Bacteria 5395
544 Ga0207707_10088365 3300025912 Bacteria 2707
545 Ga0207707_10163304 3300025912 Bacteria 1947
546 Ga0207707_10194073 3300025912 Bacteria 1771
547 Ga0207707_10282125 3300025912 Bacteria 1439
548 Ga0207695_10017396 3300025913 Bacteria 8366
549 Ga0207695_10026897 3300025913 Bacteria 6413
550 Ga0207695_10160418 3300025913 Bacteria 2181
551 Ga0207695_10204870 3300025913 Bacteria 1886
552 Ga0207695_10254239 3300025913 Bacteria 1656
553 Ga0207695_10257203 3300025913 Bacteria 1644
554 Ga0207695_10319731 3300025913 Bacteria 1442
555 Ga0207695_10324923 3300025913 Bacteria 1428
556 Ga0207671_10022076 3300025914 Bacteria 4818
557 Ga0207671_10024759 3300025914 Bacteria 4509
558 Ga0207671_10065984 3300025914 Bacteria 2693
559 Ga0207671_10187523 3300025914 Bacteria 1611
560 Ga0207693_10006663 3300025915 Bacteria 9540
561 Ga0207693_10055219 3300025915 Bacteria 3116
562 Ga0207693_10357480 3300025915 Bacteria 1142
563 Ga0207663_10098314 3300025916 Bacteria 1959
564 Ga0207663_10131692 3300025916 Bacteria 1729
565 Ga0207660_10000442 3300025917 Bacteria 27342
566 Ga0207660_10009386 3300025917 Bacteria 6333
567 Ga0207660_10016403 3300025917 Bacteria 4902
568 Ga0207660_10023083 3300025917 Bacteria 4197
569 Ga0207660_10051713 3300025917 Bacteria 2922
570 Ga0207660_10053393 3300025917 Bacteria 2880
571 Ga0207660_10131525 3300025917 Bacteria 1905
572 Ga0207660_10180595 3300025917 Bacteria 1639
573 Ga0207660_10212301 3300025917 Bacteria 1516
574 Ga0207660_10219231 3300025917 Bacteria 1492
575 Ga0207662_10000249 3300025918 Bacteria 24950
576 Ga0207662_10008544 3300025918 Bacteria 5612
577 Ga0207662_10042261 3300025918 Bacteria 2686
578 Ga0207657_10002726 3300025919 Bacteria 19014
579 Ga0207657_10003879 3300025919 Bacteria 15867
580 Ga0207657_10004180 3300025919 Bacteria 15299
581 Ga0207657_10005961 3300025919 Bacteria 12679
582 Ga0207657_10012139 3300025919 Bacteria 8512
583 Ga0207657_10068686 3300025919 Bacteria 3009
584 Ga0207657_10103443 3300025919 Bacteria 2360
585 Ga0207649_10000057 3300025920 Bacteria 102314
586 Ga0207649_10046622 3300025920 Bacteria 2664
587 Ga0207649_10199071 3300025920 Bacteria 1414
588 Ga0207652_10005483 3300025921 Bacteria 10292
589 Ga0207652_10008473 3300025921 Bacteria 8274
590 Ga0207652_10010411 3300025921 Bacteria 7487
591 Ga0207652_10053598 3300025921 Bacteria 3464
592 Ga0207652_10087914 3300025921 Bacteria 2725
593 Ga0207652_10097400 3300025921 Bacteria 2592
594 Ga0207652_10106353 3300025921 Bacteria 2483
595 Ga0207652_10139161 3300025921 Bacteria 2169
596 Ga0207652_10467563 3300025921 Bacteria 1136
597 Ga0207652_10675722 3300025921 Bacteria 922
598 Ga0207681_10000181 3300025923 Bacteria 51755
599 Ga0207694_10026270 3300025924 Bacteria 4428
600 Ga0207694_10044793 3300025924 Bacteria 3416
601 Ga0207694_10046766 3300025924 Bacteria 3345
602 Ga0207694_10087855 3300025924 Bacteria 2450
603 Ga0207694_10118101 3300025924 Bacteria 2115
604 Ga0207694_10157910 3300025924 Bacteria 1830
605 Ga0207694_10256174 3300025924 Bacteria 1433
606 Ga0207650_10001609 3300025925 Bacteria 16125
607 Ga0207650_10066713 3300025925 Bacteria 2699
608 Ga0207650_10229813 3300025925 Bacteria 1496
609 Ga0207650_10317613 3300025925 Bacteria 1275
610 Ga0207659_10000028 3300025926 Bacteria 130804
611 Ga0207659_10446023 3300025926 Bacteria 1089
612 Ga0207687_10000061 3300025927 Bacteria 84113
613 Ga0207687_10116271 3300025927 Bacteria 1993
614 Ga0207687_10130962 3300025927 Bacteria 1891
615 Ga0207700_10056101 3300025928 Bacteria 2964
616 Ga0207700_10389075 3300025928 Bacteria 1220
617 Ga0207664_10041548 3300025929 Bacteria 3583
618 Ga0207664_10064704 3300025929 Bacteria 2926
619 Ga0207664_10150667 3300025929 Bacteria 1975
620 Ga0207664_10398235 3300025929 Bacteria 1224
621 Ga0207664_10460966 3300025929 Bacteria 1135
622 Ga0207644_10000315 3300025931 Bacteria 31527
623 Ga0207644_10004323 3300025931 Bacteria 9212
624 Ga0207644_10006403 3300025931 Bacteria 7672
625 Ga0207644_10138885 3300025931 Bacteria 1869
626 Ga0207644_10158306 3300025931 Bacteria 1758
627 Ga0207690_10000445 3300025932 Bacteria 26765
628 Ga0207690_10001364 3300025932 Bacteria 15338
629 Ga0207690_10045665 3300025932 Bacteria 2896
630 Ga0207690_10377307 3300025932 Bacteria 1126
631 Ga0207706_10002206 3300025933 Bacteria 18992
632 Ga0207706_10020104 3300025933 Bacteria 6000
633 Ga0207706_10024556 3300025933 Bacteria 5402
634 Ga0207706_10196840 3300025933 Bacteria 1768
635 Ga0207706_10207692 3300025933 Bacteria 1717
636 Ga0207686_10005349 3300025934 Bacteria 6885
637 Ga0207686_10219377 3300025934 Bacteria 1372
638 Ga0207709_10000539 3300025935 Bacteria 32486
639 Ga0207709_10009571 3300025935 Bacteria 5333
640 Ga0207709_10161220 3300025935 Bacteria 1564
641 Ga0207709_10280019 3300025935 Bacteria 1231
642 Ga0207670_10000217 3300025936 Bacteria 37598
643 Ga0207670_10001702 3300025936 Bacteria 11475
644 Ga0207670_10288595 3300025936 Bacteria 1281
645 Ga0207669_10000147 3300025937 Bacteria 34031
646 Ga0207669_10157528 3300025937 Bacteria 1599
647 Ga0207669_10198807 3300025937 Bacteria 1453
648 Ga0207704_10000299 3300025938 Bacteria 23415
649 Ga0207704_10009342 3300025938 Bacteria 4727
650 Ga0207704_10029713 3300025938 Bacteria 3052
651 Ga0207704_10045682 3300025938 Bacteria 2604
652 Ga0207704_10245760 3300025938 Bacteria 1340
653 Ga0207665_10003176 3300025939 Bacteria 11002
654 Ga0207665_10477320 3300025939 Bacteria 960
655 Ga0207691_10002033 3300025940 Bacteria 19787
656 Ga0207691_10022424 3300025940 Bacteria 5954
657 Ga0207691_10046867 3300025940 Bacteria 3970
658 Ga0207711_10005870 3300025941 Bacteria 10364
659 Ga0207711_10020025 3300025941 Bacteria 5576
660 Ga0207711_10021540 3300025941 Bacteria 5385
661 Ga0207711_10037787 3300025941 Bacteria 4104
662 Ga0207711_10063266 3300025941 Bacteria 3194
663 Ga0207711_10475288 3300025941 Bacteria 1164
664 Ga0207689_10001029 3300025942 Bacteria 26794
665 Ga0207689_10259596 3300025942 Bacteria 1437
666 Ga0207661_10000215 3300025944 Bacteria 37435
667 Ga0207661_10005672 3300025944 Bacteria 8808
668 Ga0207661_10011706 3300025944 Bacteria 6367
669 Ga0207661_10086764 3300025944 Bacteria 2598
670 Ga0207661_10142306 3300025944 Bacteria 2065
671 Ga0207661_10417547 3300025944 Bacteria 1218
672 Ga0207661_10568626 3300025944 Bacteria 1039
673 Ga0207679_10000026 3300025945 Bacteria 200073
674 Ga0207679_10077903 3300025945 Bacteria 2524
675 Ga0207679_10094405 3300025945 Bacteria 2322
676 Ga0207679_10341445 3300025945 Bacteria 1302
677 Ga0207667_10071293 3300025949 Bacteria 3613
678 Ga0207667_10077487 3300025949 Bacteria 3447
679 Ga0207667_10150202 3300025949 Bacteria 2398
680 Ga0207667_10235382 3300025949 Bacteria 1875
681 Ga0207667_10323748 3300025949 Bacteria 1574
682 Ga0207667_10534054 3300025949 Bacteria 1187
683 Ga0207651_10000342 3300025960 Bacteria 19828
684 Ga0207651_10018758 3300025960 Bacteria 4127
685 Ga0207651_10196427 3300025960 Bacteria 1613
686 Ga0207712_10000686 3300025961 Bacteria 26195
687 Ga0207712_10145500 3300025961 Bacteria 1824
688 Ga0207712_10252179 3300025961 Bacteria 1427
689 Ga0207668_10000013 3300025972 Bacteria 167989
690 Ga0207668_10000242 3300025972 Bacteria 36700
691 Ga0207668_10003367 3300025972 Bacteria 9365
692 Ga0207668_10170737 3300025972 Bacteria 1705
693 Ga0207668_10239032 3300025972 Bacteria 1468
694 Ga0207668_10255285 3300025972 Bacteria 1426
695 Ga0207640_10000833 3300025981 Bacteria 17545
696 Ga0207640_10023305 3300025981 Bacteria 3718
697 Ga0207658_10036817 3300025986 Bacteria 3510
698 Ga0207658_10068883 3300025986 Bacteria 2671
699 Ga0207658_10104023 3300025986 Bacteria 2230
700 Ga0207658_10235644 3300025986 Bacteria 1547
701 Ga0207658_10243072 3300025986 Bacteria 1526
702 Ga0207677_10066237 3300026023 Bacteria 2524
703 Ga0207703_10000051 3300026035 Bacteria 145390
704 Ga0207703_10004423 3300026035 Bacteria 11548
705 Ga0207703_10015235 3300026035 Bacteria 5998
706 Ga0207703_10022281 3300026035 Bacteria 4967
707 Ga0207703_10052613 3300026035 Bacteria 3308
708 Ga0207639_10000438 3300026041 Bacteria 28804
709 Ga0207639_10061852 3300026041 Bacteria 2893
710 Ga0207639_10309162 3300026041 Bacteria 1400
711 Ga0207678_10000022 3300026067 Bacteria 129767
712 Ga0207678_10001079 3300026067 Bacteria 24988
713 Ga0207678_10024480 3300026067 Bacteria 5273
714 Ga0207678_10100420 3300026067 Bacteria 2472
715 Ga0207678_10145554 3300026067 Bacteria 2022
716 Ga0207708_10000805 3300026075 Bacteria 23614
717 Ga0207708_10020125 3300026075 Bacteria 5032
718 Ga0207702_10002121 3300026078 Bacteria 19082
719 Ga0207702_10004744 3300026078 Bacteria 12004
720 Ga0207702_10010411 3300026078 Bacteria 7783
721 Ga0207702_10182280 3300026078 Bacteria 1935
722 Ga0207702_10183561 3300026078 Bacteria 1928
723 Ga0207702_10376173 3300026078 Bacteria 1365
724 Ga0207702_10632175 3300026078 Bacteria 1052
725 Ga0207641_10000003 3300026088 Bacteria 496984
726 Ga0207641_10005860 3300026088 Bacteria 10427
727 Ga0207641_10042539 3300026088 Bacteria 3811
728 Ga0207641_10175789 3300026088 Bacteria 1957
729 Ga0207641_10225659 3300026088 Bacteria 1739
730 Ga0207648_10000731 3300026089 Bacteria 36792
731 Ga0207648_10041487 3300026089 Bacteria 4040
732 Ga0207648_10052588 3300026089 Bacteria 3562
733 Ga0207676_10000361 3300026095 Bacteria 38795
734 Ga0207676_10004164 3300026095 Bacteria 10225
735 Ga0207676_10005133 3300026095 Bacteria 9268
736 Ga0207676_10007303 3300026095 Bacteria 7835
737 Ga0207674_10002121 3300026116 Bacteria 25067
738 Ga0207674_10051030 3300026116 Bacteria 4223
739 Ga0207674_10254153 3300026116 Bacteria 1704
740 Ga0207675_100001489 3300026118 Bacteria 23488
741 Ga0207675_100322011 3300026118 Bacteria 1509
742 Ga0207675_100370336 3300026118 Bacteria 1407
743 Ga0207683_10000034 3300026121 Bacteria 101817
744 Ga0207683_10006107 3300026121 Bacteria 10314
745 Ga0207683_10139000 3300026121 Bacteria 2188
746 Ga0207683_10239543 3300026121 Bacteria 1655
747 Ga0207698_10000304 3300026142 Bacteria 29523
748 Ga0207698_10021020 3300026142 Bacteria 4507
749 Ga0207698_10117313 3300026142 Bacteria 2245
750 Ga0207698_10285768 3300026142 Bacteria 1528
751 Ga0207698_10507791 3300026142 Bacteria 1174
752 Ga0209966_1003327 3300027695 Bacteria 2701
753 Ga0209813_10001761 3300027866 Bacteria 4873
754 Ga0209974_10004638 3300027876 Bacteria 4887
755 Ga0209974_10013408 3300027876 Bacteria 2730
756 Ga0207428_10000082 3300027907 Bacteria 133684
757 Ga0207428_10000352 3300027907 Bacteria 59444
758 Ga0207428_10001078 3300027907 Bacteria 29769
759 Ga0268266_10000003 3300028379 Bacteria 1701703
760 Ga0268266_10006868 3300028379 Bacteria 10361
761 Ga0268266_10021877 3300028379 Bacteria 5448
762 Ga0268266_10057499 3300028379 Bacteria 3347
763 Ga0268266_10059017 3300028379 Bacteria 3305
764 Ga0268266_10165456 3300028379 Bacteria 2003
765 Ga0268266_10378526 3300028379 Bacteria 1335
766 Ga0268266_10550687 3300028379 Bacteria 1105
767 Ga0268265_10001338 3300028380 Bacteria 21019
768 Ga0268265_10020285 3300028380 Bacteria 4637
769 Ga0268265_10171882 3300028380 Bacteria 1853
770 Ga0268265_10431767 3300028380 Bacteria 1226
771 Ga0268265_10545916 3300028380 Bacteria 1099
772 Ga0268264_10000573 3300028381 Bacteria 44555
773 Ga0268264_10002557 3300028381 Bacteria 15953
774 Ga0268264_10016328 3300028381 Bacteria 6080
775 Ga0268264_10052830 3300028381 Bacteria 3389
776 Ga0268264_10171882 3300028381 Bacteria 1961
777 Ga0265337_1000392 3300028556 Bacteria 23495
778 Ga0265337_1004168 3300028556 Bacteria 6062
779 Ga0265334_10007257 3300028573 Bacteria 4754
780 Ga0265338_10281651 3300028800 Bacteria 1214
781 Ga0265330_10029201 3300031235 Bacteria 2481
782 Ga0265332_10037530 3300031238 Bacteria 2101
783 Ga0265328_10055500 3300031239 Bacteria 1454
784 Ga0265320_10000219 3300031240 Bacteria 46488
785 Ga0265325_10000141 3300031241 Bacteria 50291
786 Ga0265325_10008050 3300031241 Bacteria 6249
787 Ga0265325_10028133 3300031241 Bacteria 3033
788 Ga0265340_10013101 3300031247 Bacteria 4364
789 Ga0265339_10017617 3300031249 Bacteria 4226
790 Ga0265339_10031136 3300031249 Bacteria 3017
791 Ga0265331_10000250 3300031250 Bacteria 63883
792 Ga0265331_10036168 3300031250 Bacteria 2426
793 Ga0265327_10000007 3300031251 Bacteria 678515
794 Ga0265316_10029512 3300031344 Bacteria 4508
795 Ga0265316_10075798 3300031344 Bacteria 2586
796 Ga0265316_10113144 3300031344 Bacteria 2054
797 Ga0307513_10079026 3300031456 Bacteria 3400
798 Ga0265313_10000008 3300031595 Bacteria 173405
799 Ga0265313_10001334 3300031595 Bacteria 23230
800 Ga0265313_10011824 3300031595 Bacteria 5396
801 Ga0265313_10075758 3300031595 Bacteria 1539
802 Ga0307508_10421101 3300031616 Bacteria 927
803 Ga0265314_10003712 3300031711 Bacteria 14625
804 Ga0265314_10019730 3300031711 Bacteria 5215
805 Ga0265314_10049826 3300031711 Bacteria 2929
806 Ga0265314_10122643 3300031711 Bacteria 1633
807 Ga0265342_10000149 3300031712 Bacteria 79177
808 Ga0265342_10039073 3300031712 Bacteria 2885
809 Ga0307405_10059396 3300031731 Bacteria 2409
810 Ga0307406_10001856 3300031901 Bacteria 11522
811 Ga0307406_10228315 3300031901 Bacteria 1388
812 Ga0307412_10434065 3300031911 Bacteria 1078
813 Ga0307409_100262777 3300031995 Bacteria 1585
814 Ga0307416_100249482 3300032002 Bacteria 1726
815 Ga0307414_10012015 3300032004 Bacteria 5105
816 Ga0307411_10084642 3300032005 Bacteria 2194
817 Ga0316583_10001264 3300032133 Bacteria 8343
818 Ga0373930_0000071 3300034816 Bacteria 9894
819 Ga0373930_0012311 3300034816 Bacteria 1559
820 Ga0373948_0000973 3300034817 Bacteria 3841
821 Ga0373950_0000552 3300034818 Bacteria 4581
822 Ga0373958_0000121 3300034819 Bacteria 8561
823 Ga0373958_0006748 3300034819 Bacteria 1802
824 Ga0373959_0000829 3300034820 Bacteria 5275
825 Ga0373959_0005700 3300034820 Bacteria 2047
826 Ga0373938_0000045 3300034957 Bacteria 16308
827 Ga0373938_0000596 3300034957 Bacteria 5820
828 Ga0373926_0004776 3300035083 Bacteria 4455
829 Ga0373928_0003774 3300035084 Bacteria 2891
830 Ga0373929_0002006 3300035085 Bacteria 3799
831 Ga0373940_0003018 3300035088 Bacteria 3372
832 Ga0373944_0018155 3300035089 Bacteria 2007
833 Ga0373949_0002498 3300035090 Bacteria 4702
834 Ga0373949_0005152 3300035090 Bacteria 2933
835 Ga0373949_0006059 3300035090 Bacteria 2674
836 Ga0373951_0000695 3300035091 Bacteria 9241
837 Ga0373951_0001161 3300035091 Bacteria 6967
838 Ga0373951_0001863 3300035091 Bacteria 5432
839 Ga0373952_0000221 3300035092 Bacteria 9091
840 Ga0373952_0004057 3300035092 Bacteria 2645
841 Ga0373923_0005448 3300035111 Bacteria 4320
842 Ga0373923_0008412 3300035111 Bacteria 3677
843 Ga0373923_0099578 3300035111 Bacteria 1280
844 Ga0373932_0001446 3300035112 Bacteria 6643
845 Ga0373932_0002183 3300035112 Bacteria 5050
846 Ga0373932_0003396 3300035112 Bacteria 3835
847 Ga0373936_0025479 3300035113 Bacteria 2313
848 Ga0373936_0119635 3300035113 Bacteria 1124
849 Ga0373939_0000875 3300035114 Bacteria 7460
850 Ga0373939_0001280 3300035114 Bacteria 6125
851 Ga0373939_0016634 3300035114 Bacteria 1942
852 Ga0373941_0001970 3300035115 Bacteria 4455
853 Ga0373941_0039828 3300035115 Bacteria 1446
854 Ga0373945_0000864 3300035116 Bacteria 8930
855 Ga0373945_0032988 3300035116 Bacteria 1837
856 Ga0373945_0062734 3300035116 Bacteria 1390
857 Ga0373953_0002911 3300035117 Bacteria 5227
858 Ga0373953_0004191 3300035117 Bacteria 4576
859 Ga0373953_0077569 3300035117 Bacteria 1377
860 Ga0373954_0008274 3300035118 Bacteria 4562
861 Ga0373954_0010833 3300035118 Bacteria 4031
862 Ga0373954_0013777 3300035118 Bacteria 3603
863 Ga0373954_0020248 3300035118 Bacteria 3007
864 Ga0373954_0177716 3300035118 Bacteria 1043
865 Ga0373956_0022522 3300035119 Bacteria 2697
866 Ga0373956_0139478 3300035119 Bacteria 1138
867 Ga0373957_0021058 3300035120 Bacteria 2310
868 Ga0373957_0029774 3300035120 Bacteria 1996
869 Ga0373957_0059724 3300035120 Bacteria 1475
870 Ga0373960_0000083 3300035121 Bacteria 14021
871 Ga0373960_0000603 3300035121 Bacteria 7339
872 Ga0373943_0002515 3300035170 Bacteria 8335
873 Ga0373943_0005818 3300035170 Bacteria 5538
874 Ga0373943_0037844 3300035170 Bacteria 2317
875 Ga0373943_0048885 3300035170 Bacteria 2074
876 Ga0373946_0019286 3300035171 Bacteria 2627
877 Ga0373946_0020505 3300035171 Bacteria 2555
878 Ga0373946_0035678 3300035171 Bacteria 2014
879 Ga0373946_0041764 3300035171 Bacteria 1882
880 Ga0373946_0200360 3300035171 Bacteria 956
881 Ga0373955_0000946 3300035172 Bacteria 12419
882 Ga0373955_0002872 3300035172 Bacteria 7553
883 Ga0373955_0030959 3300035172 Bacteria 2799
884 Ga0373955_0059881 3300035172 Bacteria 2098
885 Ga0373955_0083091 3300035172 Bacteria 1813
886 Ga0373942_0000535 3300035207 Bacteria 10652
887 Ga0373942_0010093 3300035207 Bacteria 2217
888 Ga0373942_0021137 3300035207 Bacteria 1640
889 Ga0373942_0053975 3300035207 Bacteria 1134
890 Ga0373961_0000559 3300035241 Bacteria 14060
891 Ga0373961_0003591 3300035241 Bacteria 3819
892 Ga0373961_0003814 3300035241 Bacteria 3685
893 Ga0373962_0000468 3300035242 Bacteria 8934
894 Ga0373962_0001431 3300035242 Bacteria 5631
895 Ga0373962_0024476 3300035242 Bacteria 1614
896 Ga0316574_0038631 3300035398 Bacteria 2931
897 Ga0316574_0385230 3300035398 Bacteria 884
898 Ga0373924_0009408 3300035410 Bacteria 3581
899 Ga0373924_0047956 3300035410 Bacteria 1763
900 Ga0373924_0105219 3300035410 Bacteria 1216
901 Ga0373931_0000179 3300035691 Bacteria 27558
902 Ga0373931_0003177 3300035691 Bacteria 7329
903 Ga0373931_0004682 3300035691 Bacteria 6260
904 Ga0373931_0103179 3300035691 Bacteria 1607
905 Ga0373935_0011857 3300035692 Bacteria 5236
906 Ga0373935_0031532 3300035692 Bacteria 3290
907 Ga0373935_0038533 3300035692 Bacteria 2993
908 Ga0373935_0046661 3300035692 Bacteria 2737
909 Ga0373935_0056911 3300035692 Bacteria 2494
910 Ga0373927_0000580 3300035695 Bacteria 27840
911 Ga0373927_0010444 3300035695 Bacteria 6189
912 Ga0373927_0024375 3300035695 Bacteria 3958
913 Ga0373927_0040612 3300035695 Bacteria 3018
914 Ga0373927_0040730 3300035695 Bacteria 3013
915 Ga0373927_0050471 3300035695 Bacteria 2690
916 Ga0373927_0068391 3300035695 Bacteria 2298
917 Ga0373933_0000068 3300035724 Bacteria 63195
918 Ga0373933_0016187 3300035724 Bacteria 4167
919 Ga0373933_0041178 3300035724 Bacteria 2726
920 Ga0373933_0042197 3300035724 Bacteria 2696
921 Ga0373947_0006073 3300035725 Bacteria 7039
922 Ga0373947_0018586 3300035725 Bacteria 4003
923 Ga0373947_0030405 3300035725 Bacteria 3173
924 Ga0373947_0580804 3300035725 Bacteria 763
925 Ga0373937_0000879 3300036401 Bacteria 25733
926 Ga0373937_0048840 3300036401 Bacteria 3874
927 Ga0373937_0082824 3300036401 Bacteria 2968
928 Ga0373937_0098375 3300036401 Bacteria 2713
929 Ga0373937_0107310 3300036401 Bacteria 2596
930 Ga0373937_0137425 3300036401 Bacteria 2285
931 Ga0373937_0189276 3300036401 Bacteria 1933
932 Ga0373937_0261364 3300036401 Bacteria 1632
933 Ga0373937_0537571 3300036401 Bacteria 1110
934 Ga0316584_0032111 3300036712 Bacteria 3885
935 Ga0373925_0000173 3300037068 Bacteria 69877
936 Ga0373925_0006666 3300037068 Bacteria 8472
937 Ga0373925_0022396 3300037068 Bacteria 4607
938 Ga0373925_0028815 3300037068 Bacteria 4071
939 Ga0373925_0032491 3300037068 Bacteria 3842
940 Ga0373925_0079559 3300037068 Bacteria 2491
941 Ga0373925_0137223 3300037068 Bacteria 1912
942 Ga0373925_0211408 3300037068 Bacteria 1545
943 Ga0373925_0229302 3300037068 Bacteria 1485
944 Ga0395899_0000190 3300037312 Bacteria 90356
945 Ga0395899_0196780 3300037312 Bacteria 1408
946 Ga0395900_0000002 3300037418 Bacteria 671103
947 Ga0395900_0002835 3300037418 Bacteria 18922
948 Ga0395900_0017776 3300037418 Bacteria 7259
949 Ga0395900_0028650 3300037418 Bacteria 5708
950 Ga0395900_0030079 3300037418 Bacteria 5574
951 Ga0395900_0165043 3300037418 Bacteria 2257
952 Ga0395900_0540983 3300037418 Bacteria 1110
953 Ga0395898_0020711 3300037466 Bacteria 6676
954 Ga0395898_0033914 3300037466 Bacteria 5091
955 Ga0395898_0177943 3300037466 Bacteria 2033
956 Ga0395905_0004637 3300037471 Bacteria 14218
957 Ga0395905_0056626 3300037471 Bacteria 3667
958 Ga0395905_0075030 3300037471 Bacteria 3169
959 Ga0436364_1103433 3300037853 Bacteria 2093
960 Ga0395901_0000013 3300038443 Bacteria 375733
961 Ga0395901_0006379 3300038443 Bacteria 11952
962 Ga0395901_0207924 3300038443 Bacteria 2049
963 Ga0395901_0603556 3300038443 Bacteria 1106
964 Ga0436365_0148237 3300039437 Bacteria 20919
965 Ga0436365_0377120 3300039437 Bacteria 2768
966 Ga0436365_0741954 3300039437 Bacteria 3316
967 Ga0436365_0794414 3300039437 Bacteria 2903
968 Ga0436365_0880454 3300039437 Bacteria 3346
969 Ga0436365_1128037 3300039437 Bacteria 14747
970 Ga0436365_1362947 3300039437 Bacteria 3519
971 Ga0436360_0378170 3300039438 Bacteria 1912
972 Ga0436360_0455427 3300039438 Bacteria 4115
973 Ga0436360_0495895 3300039438 Bacteria 2259
974 Ga0436360_1012588 3300039438 Bacteria 1008
975 Ga0436360_1250910 3300039438 Bacteria 1527
976 Ga0436361_0249575 3300039447 Bacteria 1014
977 Ga0436361_0418088 3300039447 Bacteria 1079
978 Ga0436361_0429651 3300039447 Bacteria 2360
979 Ga0436361_0435056 3300039447 Bacteria 2891
980 Ga0439453_0001316 3300041408 Bacteria 3157
981 Ga0439443_002112 3300042003 Bacteria 2332
982 Ga0439455_0004911 3300042012 Bacteria 2683
983 Ga0439434_0012297 3300042435 Bacteria 2533
984 Ga0439459_0023277 3300042438 Bacteria 1206
985 Ga0451577_0017275 3300042876 Bacteria 6667
986 Ga0466969_0138235 3300044656 Bacteria 1127
987 Ga0466965_0031305 3300044683 Bacteria 2594
988 Ga0466965_0040669 3300044683 Bacteria 2289
989 Ga0466966_0032527 3300044684 Bacteria 3380
990 Ga0466966_0051085 3300044684 Bacteria 2629
991 Ga0466961_0012092 3300044693 Bacteria 5518
992 Ga0466961_0119613 3300044693 Bacteria 1654
993 Ga0466961_0120183 3300044693 Bacteria 1650
994 Ga0466961_0212109 3300044693 Bacteria 1195
995 Ga0466963_0152771 3300044694 Bacteria 1604
996 Ga0466963_0298246 3300044694 Bacteria 1133
997 Ga0466963_0359712 3300044694 Bacteria 1025
998 Ga0466971_0018122 3300044719 Bacteria 3119
999 Ga0466971_0070610 3300044719 Bacteria 1586
1000 Ga0466971_0173241 3300044719 Bacteria 1013
1001 Ga0466968_0124408 3300044735 Bacteria 1169
1002 Ga0466970_0005989 3300044765 Bacteria 6058
1003 Ga0466957_0037744 3300044842 Bacteria 2909
1004 Ga0466957_0058735 3300044842 Bacteria 2357
1005 Ga0466957_0154813 3300044842 Bacteria 1485
1006 Ga0466960_0004155 3300044901 Bacteria 5635
1007 Ga0466960_0007952 3300044901 Bacteria 4330
1008 Ga0466960_0218885 3300044901 Bacteria 1047
1009 Ga0451576_0004698 3300045051 Bacteria 17570
1010 Ga0466958_0071195 3300045836 Bacteria 2129
1011 Ga0466958_0185002 3300045836 Bacteria 1323
1012 Ga0466967_0008743 3300045976 Bacteria 7460
1013 Ga0466967_0265613 3300045976 Bacteria 1643
1014 Ga0466967_0397855 3300045976 Bacteria 1340
1015 Ga0495592_0002436 3300046454 Bacteria 13110
1016 Ga0495592_0077436 3300046454 Bacteria 2411
1017 Ga0495592_0096460 3300046454 Bacteria 2113
1018 Ga0495603_0052856 3300046455 Bacteria 2411
1019 Ga0495603_0061621 3300046455 Bacteria 2215
1020 Ga0495603_0071235 3300046455 Bacteria 2043
1021 Ga0495603_0090066 3300046455 Bacteria 1794
1022 Ga0495629_0000062 3300046459 Bacteria 97169
1023 Ga0495629_0041665 3300046459 Bacteria 3230
1024 Ga0495629_0071272 3300046459 Bacteria 2425
1025 Ga0495629_0080870 3300046459 Bacteria 2268
1026 Ga0495629_0085166 3300046459 Bacteria 2205
1027 Ga0495638_0015263 3300046460 Bacteria 5162
1028 Ga0495638_0078272 3300046460 Bacteria 2012
1029 Ga0495641_0019496 3300046461 Bacteria 3468
1030 Ga0495641_0080364 3300046461 Bacteria 1461
1031 Ga0495641_0084125 3300046461 Bacteria 1425
1032 Ga0495651_0000910 3300046462 Bacteria 22944
1033 Ga0495651_0024994 3300046462 Bacteria 4647
1034 Ga0495651_0056241 3300046462 Bacteria 3023
1035 Ga0495651_0063535 3300046462 Bacteria 2822
1036 Ga0495653_0007557 3300046463 Bacteria 8883
1037 Ga0495653_0014042 3300046463 Bacteria 6530
1038 Ga0495580_0022982 3300046472 Bacteria 4585
1039 Ga0495580_0132482 3300046472 Bacteria 1728
1040 Ga0495580_0198008 3300046472 Bacteria 1385
1041 Ga0495582_0015124 3300046473 Bacteria 4244
1042 Ga0495582_0015348 3300046473 Bacteria 4208
1043 Ga0495582_0162472 3300046473 Bacteria 1270
1044 Ga0495639_0002473 3300046475 Bacteria 8064
1045 Ga0495662_0051975 3300046476 Bacteria 1978
1046 Ga0495662_0080819 3300046476 Bacteria 1580
1047 Ga0495664_0006101 3300046477 Bacteria 6651
1048 Ga0495664_0006433 3300046477 Bacteria 6488
1049 Ga0495664_0039349 3300046477 Bacteria 2793
1050 Ga0495584_0054271 3300046491 Bacteria 2017
1051 Ga0495585_0000389 3300046492 Bacteria 42431
1052 Ga0495594_0012681 3300046499 Bacteria 4396
1053 Ga0495594_0016941 3300046499 Bacteria 3844
1054 Ga0495583_0076395 3300046506 Bacteria 1463
1055 Ga0495608_0000129 3300046511 Bacteria 53862
1056 Ga0495608_0009967 3300046511 Bacteria 6634
1057 Ga0495608_0020973 3300046511 Bacteria 4488
1058 Ga0495618_0003211 3300046514 Bacteria 10242
1059 Ga0495618_0014425 3300046514 Bacteria 4815
1060 Ga0495618_0017692 3300046514 Bacteria 4374
1061 Ga0495620_0029469 3300046515 Bacteria 2539
1062 Ga0495628_0004609 3300046516 Bacteria 12184
1063 Ga0495628_0018229 3300046516 Bacteria 5819
1064 Ga0495628_0173995 3300046516 Bacteria 1631
1065 Ga0495628_0201512 3300046516 Bacteria 1499
1066 Ga0495630_0097260 3300046517 Bacteria 2226
1067 Ga0495630_0102387 3300046517 Bacteria 2166
1068 Ga0495631_0042051 3300046518 Bacteria 2020
1069 Ga0495637_0026461 3300046520 Bacteria 2604
1070 Ga0495643_0004797 3300046522 Bacteria 9327
1071 Ga0495644_0008150 3300046523 Bacteria 4030
1072 Ga0495652_0020765 3300046529 Bacteria 5836
1073 Ga0495652_0092131 3300046529 Bacteria 2476
1074 Ga0495665_0012108 3300046531 Bacteria 4670
1075 Ga0495665_0022232 3300046531 Bacteria 3409
1076 Ga0495665_0098903 3300046531 Bacteria 1532
1077 Ga0495640_0005586 3300046533 Bacteria 9999
1078 Ga0495640_0039588 3300046533 Bacteria 3306
1079 Ga0495640_0059593 3300046533 Bacteria 2599
1080 Ga0495586_0001909 3300046535 Bacteria 11352
1081 Ga0495586_0027483 3300046535 Bacteria 3044
1082 Ga0495587_0001060 3300046536 Bacteria 18094
1083 Ga0495587_0002945 3300046536 Bacteria 11379
1084 Ga0495587_0004785 3300046536 Bacteria 8891
1085 Ga0495598_0000638 3300046537 Bacteria 6595
1086 Ga0495621_0006729 3300046539 Bacteria 3370
1087 Ga0495597_0001137 3300046542 Bacteria 20065
1088 Ga0495645_0000974 3300046543 Bacteria 19495
1089 Ga0495645_0008141 3300046543 Bacteria 7311
1090 Ga0495645_0131658 3300046543 Bacteria 1752
1091 Ga0495622_0005195 3300046557 Bacteria 6034
1092 Ga0495622_0010569 3300046557 Bacteria 4260
1093 Ga0495633_0021496 3300046558 Bacteria 3226
1094 Ga0495667_0007026 3300046559 Bacteria 7639
1095 Ga0495667_0016191 3300046559 Bacteria 5037
1096 Ga0495667_0065659 3300046559 Bacteria 2373
1097 Ga0495667_0078084 3300046559 Bacteria 2152
1098 Ga0495656_0001231 3300046615 Bacteria 8323
1099 Ga0495668_0029565 3300046616 Bacteria 3095
1100 Ga0495634_0017126 3300046642 Bacteria 5175
1101 Ga0495634_0060805 3300046642 Bacteria 2513
1102 Ga0495634_0144305 3300046642 Bacteria 1509
1103 Ga0495634_0164195 3300046642 Bacteria 1398
1104 Ga0495635_0011298 3300046663 Bacteria 6263
1105 Ga0495635_0017949 3300046663 Bacteria 4942
1106 Ga0495635_0024646 3300046663 Bacteria 4192
1107 Ga0495635_0123468 3300046663 Bacteria 1766
1108 Ga0495659_0004677 3300046664 Bacteria 4309
1109 Ga0495588_0083699 3300046674 Bacteria 1666
1110 Ga0495657_0044613 3300046675 Bacteria 3015
1111 Ga0495657_0047044 3300046675 Bacteria 2919
1112 Ga0495657_0064200 3300046675 Bacteria 2420
1113 Ga0495599_0000294 3300046678 Bacteria 30376
1114 Ga0495599_0002371 3300046678 Bacteria 10951
1115 Ga0495599_0033590 3300046678 Bacteria 3224
1116 Ga0495623_0001158 3300046679 Bacteria 17853
1117 Ga0495646_0010253 3300046680 Bacteria 5959
1118 Ga0495646_0055026 3300046680 Bacteria 2391
1119 Ga0495646_0098572 3300046680 Bacteria 1678
1120 Ga0495647_0016344 3300046681 Bacteria 2612
1121 Ga0495647_0039545 3300046681 Bacteria 1788
1122 Ga0495658_0000109 3300046683 Bacteria 43760
1123 Ga0495658_0046865 3300046683 Bacteria 2432
1124 Ga0495669_0005388 3300046684 Bacteria 5336
1125 Ga0495669_0032487 3300046684 Bacteria 2294
1126 Ga0495613_0035806 3300046689 Bacteria 3682
1127 Ga0495624_0018920 3300046690 Bacteria 4602
1128 Ga0495624_0116763 3300046690 Bacteria 1639
1129 Ga0495670_0000106 3300046691 Bacteria 37100
1130 Ga0495600_0000977 3300046809 Bacteria 15417
1131 Ga0495600_0001906 3300046809 Bacteria 11717
1132 Ga0495600_0056840 3300046809 Bacteria 2557
1133 Ga0495581_0107467 3300047315 Bacteria 1622
1134 Ga0495581_0155462 3300047315 Bacteria 1336
1135 Ga0495604_0001139 3300047317 Bacteria 22028
1136 Ga0495604_0007197 3300047317 Bacteria 8815
1137 Ga0495604_0016220 3300047317 Bacteria 5952
1138 Ga0495604_0081771 3300047317 Bacteria 2417
1139 Ga0495636_0107321 3300047318 Bacteria 1226
1140 Ga0495674_0010157 3300047319 Bacteria 8918
1141 Ga0495674_0076422 3300047319 Bacteria 2880
1142 Ga0495674_0160820 3300047319 Bacteria 1879
1143 Ga0495674_0178030 3300047319 Bacteria 1772
1144 Ga0495674_0249032 3300047319 Bacteria 1462
1145 Ga0495672_0097941 3300047320 Bacteria 1596
1146 Ga0495676_0019809 3300047321 Bacteria 5913
1147 Ga0495676_0057669 3300047321 Bacteria 3060
1148 Ga0495680_0003174 3300047322 Bacteria 16366
1149 Ga0495680_0006975 3300047322 Bacteria 10420
1150 Ga0495680_0026107 3300047322 Bacteria 4822
1151 Ga0495680_0039105 3300047322 Bacteria 3786
1152 Ga0495680_0046219 3300047322 Bacteria 3434
1153 Ga0495675_0000190 3300047444 Bacteria 44968
1154 Ga0495675_0015935 3300047444 Bacteria 4753
1155 Ga0495679_022071 3300047446 Bacteria 2185
1156 Ga0495684_0012906 3300047471 Bacteria 6449
1157 Ga0495684_0016579 3300047471 Bacteria 5675
1158 Ga0495684_0050907 3300047471 Bacteria 3161
1159 Ga0495684_0052229 3300047471 Bacteria 3119
1160 Ga0495593_0001596 3300047673 Bacteria 13393
1161 Ga0495593_0182912 3300047673 Bacteria 1055
1162 Ga0495602_0013848 3300048088 Bacteria 8223
1163 Ga0495602_0018144 3300048088 Bacteria 7038
1164 Ga0495602_0057244 3300048088 Bacteria 3421
1165 Ga0495602_0258265 3300048088 Bacteria 1294
1166 Ga0495614_0004512 3300048089 Bacteria 6280
1167 Ga0496100_0001014 3300048903 Bacteria 13552
1168 Ga0496100_0035966 3300048903 Bacteria 3119
1169 Ga0496100_0198379 3300048903 Bacteria 1461
1170 Ga0496101_0001110 3300048904 Bacteria 16020
1171 Ga0496101_0010552 3300048904 Bacteria 6102
1172 Ga0496101_0027611 3300048904 Bacteria 3955
1173 Ga0496101_0071080 3300048904 Bacteria 2550
1174 Ga0496101_0273320 3300048904 Bacteria 1319
1175 Ga0496102_0008594 3300048905 Bacteria 8760
1176 Ga0496102_0028624 3300048905 Bacteria 4978
1177 Ga0496102_0144315 3300048905 Bacteria 2233
1178 Ga0496102_0219292 3300048905 Bacteria 1793
1179 Ga0496102_0631123 3300048905 Bacteria 994
1180 Ga0496102_0710477 3300048905 Bacteria 928
1181 Ga0496103_0000582 3300048906 Bacteria 28897
1182 Ga0496103_0005721 3300048906 Bacteria 7428
1183 Ga0496103_0020761 3300048906 Bacteria 3949
1184 Ga0496103_0064663 3300048906 Bacteria 2280
1185 Ga0496104_0000067 3300048907 Bacteria 108556
1186 Ga0496104_0035483 3300048907 Bacteria 4655
1187 Ga0496104_0042135 3300048907 Bacteria 4283
1188 Ga0496104_0048360 3300048907 Bacteria 4010
1189 Ga0496104_0053787 3300048907 Bacteria 3805
1190 Ga0496104_0058571 3300048907 Bacteria 3646
1191 Ga0496104_0138383 3300048907 Bacteria 2339
1192 Ga0496105_0078777 3300048908 Bacteria 2720
1193 Ga0496105_0098348 3300048908 Bacteria 2416
1194 Ga0496105_0125137 3300048908 Bacteria 2119
1195 Ga0496106_0002154 3300048909 Bacteria 14716
1196 Ga0496106_0023714 3300048909 Bacteria 4559
1197 Ga0496106_0042860 3300048909 Bacteria 3394
1198 Ga0496106_0086149 3300048909 Bacteria 2419
1199 Ga0496106_0098478 3300048909 Bacteria 2266
1200 Ga0496106_0135524 3300048909 Bacteria 1934
1201 Ga0496106_0166723 3300048909 Bacteria 1744
1202 Ga0496107_0007065 3300048910 Bacteria 7734
1203 Ga0496107_0010170 3300048910 Bacteria 6525
1204 Ga0496107_0096601 3300048910 Bacteria 2162
1205 Ga0496107_0158316 3300048910 Bacteria 1677
1206 Ga0496108_0006074 3300048911 Bacteria 9765
1207 Ga0496108_0091254 3300048911 Bacteria 2589
1208 Ga0496108_0153148 3300048911 Bacteria 1990
1209 Ga0496108_0314201 3300048911 Bacteria 1365
1210 Ga0496108_0636157 3300048911 Bacteria 928
1211 Ga0496109_0000384 3300048912 Bacteria 40091
1212 Ga0496109_0000736 3300048912 Bacteria 27218
1213 Ga0496109_0154855 3300048912 Bacteria 2146
1214 Ga0496109_0205336 3300048912 Bacteria 1852
1215 Ga0496110_0033018 3300048913 Bacteria 4474
1216 Ga0496110_0051084 3300048913 Bacteria 3632
1217 Ga0496110_0064338 3300048913 Bacteria 3241
1218 Ga0496110_0102678 3300048913 Bacteria 2564
1219 Ga0496110_0531537 3300048913 Bacteria 1069
1220 Ga0496111_0014758 3300048914 Bacteria 5346
1221 Ga0496111_0085720 3300048914 Bacteria 2303
1222 Ga0496111_0094683 3300048914 Bacteria 2190
1223 Ga0496111_0241509 3300048914 Bacteria 1341
1224 Ga0496111_0259885 3300048914 Bacteria 1288
1225 Ga0496111_0300416 3300048914 Bacteria 1190
1226 Ga0496112_0002196 3300048915 Bacteria 15539
1227 Ga0496112_0010330 3300048915 Bacteria 8466
1228 Ga0496112_0027921 3300048915 Bacteria 5444
1229 Ga0496112_0047972 3300048915 Bacteria 4189
1230 Ga0496112_0130643 3300048915 Bacteria 2482
1231 Ga0496112_0145818 3300048915 Bacteria 2336
1232 Ga0496112_0214038 3300048915 Bacteria 1884
1233 Ga0496113_0000688 3300048916 Bacteria 17242
1234 Ga0496113_0018382 3300048916 Bacteria 4867
1235 Ga0496113_0050817 3300048916 Bacteria 3092
1236 Ga0496113_0088113 3300048916 Bacteria 2387
1237 Ga0496113_0134941 3300048916 Bacteria 1938
1238 Ga0496113_0156781 3300048916 Bacteria 1799
1239 Ga0496113_0251447 3300048916 Bacteria 1411
1240 Ga0496114_0015565 3300048917 Bacteria 6114
1241 Ga0496114_0018669 3300048917 Bacteria 5610
1242 Ga0496114_0051872 3300048917 Bacteria 3416
1243 Ga0496115_0002409 3300048918 Bacteria 13422
1244 Ga0496115_0017321 3300048918 Bacteria 5505
1245 Ga0496115_0029698 3300048918 Bacteria 4295
1246 Ga0496115_0053029 3300048918 Bacteria 3254
1247 Ga0496115_0155786 3300048918 Bacteria 1887
1248 Ga0496118_0021165 3300048921 Bacteria 5735
1249 Ga0496119_0000861 3300048922 Bacteria 40083
1250 Ga0496119_0065300 3300048922 Bacteria 2156
1251 Ga0496121_0000654 3300048924 Bacteria 64945
1252 Ga0496121_0080084 3300048924 Bacteria 2591
1253 Ga0496122_0038369 3300048925 Bacteria 3840
1254 Ga0496123_0007659 3300048926 Bacteria 10100
1255 Ga0496125_0059875 3300048928 Bacteria 3065
1256 Ga0496126_0003347 3300048929 Bacteria 20346
1257 Ga0496126_0044377 3300048929 Bacteria 4094
1258 Ga0501032_0026118 3300049569 Bacteria 4022
1259 Ga0501032_0075612 3300049569 Bacteria 2243
1260 Ga0501032_0097925 3300049569 Bacteria 1944
1261 Ga0501032_0117088 3300049569 Bacteria 1761
1262 Ga0501032_0140018 3300049569 Bacteria 1593
1263 Ga0501033_0010487 3300049570 Bacteria 7108
1264 Ga0501033_0068615 3300049570 Bacteria 2606
1265 Ga0501033_0073687 3300049570 Bacteria 2507
1266 Ga0501033_0083065 3300049570 Bacteria 2348
1267 Ga0501034_0000339 3300049571 Bacteria 81769
1268 Ga0501034_0000374 3300049571 Bacteria 76280
1269 Ga0501034_0000607 3300049571 Bacteria 56502
1270 Ga0501034_0009431 3300049571 Bacteria 10215
1271 Ga0501034_0049353 3300049571 Bacteria 4246
1272 Ga0501034_0057101 3300049571 Bacteria 3925
1273 Ga0501034_0063086 3300049571 Bacteria 3719
1274 Ga0501034_0106715 3300049571 Bacteria 2793
1275 Ga0501034_0111260 3300049571 Bacteria 2729
1276 Ga0501034_0149883 3300049571 Bacteria 2309
1277 Ga0501034_0193603 3300049571 Bacteria 1994
1278 Ga0501034_0350272 3300049571 Bacteria 1405
1279 Ga0501034_0399030 3300049571 Bacteria 1298
1280 Ga0501034_0531090 3300049571 Bacteria 1087
1281 Ga0501034_0635238 3300049571 Bacteria 970
1282 Ga0501036_0001435 3300049572 Bacteria 18318
1283 Ga0501036_0007758 3300049572 Bacteria 8774
1284 Ga0501036_0014849 3300049572 Bacteria 6497
1285 Ga0501036_0042684 3300049572 Bacteria 3839
1286 Ga0501036_0061483 3300049572 Bacteria 3181
1287 Ga0501036_0115555 3300049572 Bacteria 2267
1288 Ga0501036_0130914 3300049572 Bacteria 2118
1289 Ga0501036_0207371 3300049572 Bacteria 1647
1290 Ga0501036_0358943 3300049572 Bacteria 1217
1291 Ga0501036_0404162 3300049572 Bacteria 1139
1292 Ga0501037_0014097 3300049573 Bacteria 5888
1293 Ga0501037_0015640 3300049573 Bacteria 5586
1294 Ga0501037_0022523 3300049573 Bacteria 4660
1295 Ga0501037_0048324 3300049573 Bacteria 3119
1296 Ga0501037_0049189 3300049573 Bacteria 3087
1297 Ga0501037_0055344 3300049573 Bacteria 2900
1298 Ga0501037_0065159 3300049573 Bacteria 2655
1299 Ga0501037_0102288 3300049573 Bacteria 2066
1300 Ga0501037_0173481 3300049573 Bacteria 1532
1301 Ga0501038_0022202 3300049574 Bacteria 5687
1302 Ga0501038_0023734 3300049574 Bacteria 5480
1303 Ga0501038_0035664 3300049574 Bacteria 4366
1304 Ga0501038_0186510 3300049574 Bacteria 1671
1305 Ga0501038_0440435 3300049574 Bacteria 1003
1306 Ga0501039_0007451 3300049575 Bacteria 8352
1307 Ga0501039_0091560 3300049575 Bacteria 2370
1308 Ga0501039_0272035 3300049575 Bacteria 1331
1309 Ga0501039_0304596 3300049575 Bacteria 1253
1310 Ga0501039_0398431 3300049575 Bacteria 1081
1311 Ga0501042_0003820 3300049578 Bacteria 9520
1312 Ga0501043_0002453 3300049579 Bacteria 15684
1313 Ga0501043_0041164 3300049579 Bacteria 3630
1314 Ga0501043_0059551 3300049579 Bacteria 2997
1315 Ga0501046_0012653 3300049580 Bacteria 7175
1316 Ga0501046_0012773 3300049580 Bacteria 7143
1317 Ga0501046_0019149 3300049580 Bacteria 5679
1318 Ga0501046_0047578 3300049580 Bacteria 3400
1319 Ga0501046_0293919 3300049580 Bacteria 1188
1320 Ga0501047_0000234 3300049581 Bacteria 65759
1321 Ga0501047_0030818 3300049581 Bacteria 5170
1322 Ga0501047_0075258 3300049581 Bacteria 3249
1323 Ga0501047_0085579 3300049581 Bacteria 3029
1324 Ga0501047_0089188 3300049581 Bacteria 2961
1325 Ga0501047_0091048 3300049581 Bacteria 2927
1326 Ga0501047_0100284 3300049581 Bacteria 2775
1327 Ga0501047_0102242 3300049581 Bacteria 2745
1328 Ga0501047_0106205 3300049581 Bacteria 2688
1329 Ga0501047_0168527 3300049581 Bacteria 2059
1330 Ga0501047_0191945 3300049581 Bacteria 1905
1331 Ga0501047_0240551 3300049581 Bacteria 1661
1332 Ga0501047_0463480 3300049581 Bacteria 1096
1333 Ga0501048_0000051 3300049582 Bacteria 57320
1334 Ga0501048_0085030 3300049582 Bacteria 2231
1335 Ga0501048_0093299 3300049582 Bacteria 2123
1336 Ga0501048_0099287 3300049582 Bacteria 2054
1337 Ga0501048_0116956 3300049582 Bacteria 1883
1338 Ga0501067_0026359 3300049583 Bacteria 3219
1339 Ga0501067_0029161 3300049583 Bacteria 3058
1340 Ga0501067_0168700 3300049583 Bacteria 1219
1341 Ga0501068_0002377 3300049584 Bacteria 10007
1342 Ga0501068_0004896 3300049584 Bacteria 7295
1343 Ga0501068_0009625 3300049584 Bacteria 5411
1344 Ga0501068_0024705 3300049584 Bacteria 3529
1345 Ga0501068_0034380 3300049584 Bacteria 3022
1346 Ga0501068_0075067 3300049584 Bacteria 2067
1347 Ga0501069_0002651 3300049585 Bacteria 9129
1348 Ga0501069_0026062 3300049585 Bacteria 3201
1349 Ga0501070_0001845 3300049586 Bacteria 18698
1350 Ga0501070_0009447 3300049586 Bacteria 8242
1351 Ga0501070_0036105 3300049586 Bacteria 4127
1352 Ga0501070_0038326 3300049586 Bacteria 3999
1353 Ga0501070_0042185 3300049586 Bacteria 3800
1354 Ga0501070_0047792 3300049586 Bacteria 3555
1355 Ga0501070_0058892 3300049586 Bacteria 3183
1356 Ga0501070_0072076 3300049586 Bacteria 2860
1357 Ga0501070_0294160 3300049586 Bacteria 1323
1358 Ga0501070_0303877 3300049586 Bacteria 1299
1359 Ga0501070_0305052 3300049586 Bacteria 1296
1360 Ga0501071_0330925 3300049587 Bacteria 1158
1361 Ga0501072_0000782 3300049588 Bacteria 23297
1362 Ga0501072_0058420 3300049588 Bacteria 3040
1363 Ga0501072_0065812 3300049588 Bacteria 2858
1364 Ga0501073_0002353 3300049589 Bacteria 14145
1365 Ga0501073_0031696 3300049589 Bacteria 3771
1366 Ga0501073_0037303 3300049589 Bacteria 3451
1367 Ga0501073_0040533 3300049589 Bacteria 3295
1368 Ga0501073_0085012 3300049589 Bacteria 2201
1369 Ga0501073_0101909 3300049589 Bacteria 1993
1370 Ga0501073_0119946 3300049589 Bacteria 1823
1371 Ga0501073_0122143 3300049589 Bacteria 1805
1372 Ga0501074_0016150 3300049590 Bacteria 5425
1373 Ga0501074_0307941 3300049590 Bacteria 1125
1374 Ga0501075_0147723 3300049591 Bacteria 1792
1375 Ga0501075_0170507 3300049591 Bacteria 1661
1376 Ga0501076_0085736 3300049592 Bacteria 2531
1377 Ga0501076_0163696 3300049592 Bacteria 1813
1378 Ga0501076_0175554 3300049592 Bacteria 1746
1379 Ga0501077_0010133 3300049593 Bacteria 5869
1380 Ga0501077_0308039 3300049593 Bacteria 1009
1381 Ga0501079_0070996 3300049741 Bacteria 2690
1382 Ga0501079_0154778 3300049741 Bacteria 1787
1383 Ga0501080_0000383 3300049742 Bacteria 34102
1384 Ga0501080_0001302 3300049742 Bacteria 20769
1385 Ga0501080_0008942 3300049742 Bacteria 9106
1386 Ga0501080_0016226 3300049742 Bacteria 6875
1387 Ga0501080_0077843 3300049742 Bacteria 3084
1388 Ga0501080_0150646 3300049742 Bacteria 2150
1389 Ga0501080_0496066 3300049742 Bacteria 1091
1390 Ga0501080_0498609 3300049742 Unclassified 1088
1391 Ga0501081_0138048 3300049743 Bacteria 1746
1392 Ga0501083_0002191 3300049744 Bacteria 13355
1393 Ga0501083_0005799 3300049744 Bacteria 8748
1394 Ga0501083_0010875 3300049744 Bacteria 6401
1395 Ga0501083_0015328 3300049744 Bacteria 5369
1396 Ga0501083_0052270 3300049744 Bacteria 2745
1397 Ga0501083_0246846 3300049744 Bacteria 1162
1398 Ga0501083_0284775 3300049744 Bacteria 1075
1399 Ga0501035_0008488 3300049822 Bacteria 9567
1400 Ga0501035_0015144 3300049822 Bacteria 7117
1401 Ga0501035_0018523 3300049822 Bacteria 6414
1402 Ga0501035_0023250 3300049822 Bacteria 5684
1403 Ga0501035_0072716 3300049822 Bacteria 3043
1404 Ga0501035_0078217 3300049822 Bacteria 2922
1405 Ga0501035_0093105 3300049822 Bacteria 2652
1406 Ga0501044_0000398 3300049823 Bacteria 53733
1407 Ga0501044_0005993 3300049823 Bacteria 13431
1408 Ga0501044_0088471 3300049823 Bacteria 3126
1409 Ga0501044_0094283 3300049823 Bacteria 3018
1410 Ga0501044_0117488 3300049823 Bacteria 2663
1411 Ga0501044_0130602 3300049823 Bacteria 2506
1412 Ga0501044_0182312 3300049823 Bacteria 2066
1413 Ga0501044_0263106 3300049823 Bacteria 1663
1414 Ga0501044_0298640 3300049823 Bacteria 1540
1415 Ga0501044_0370716 3300049823 Bacteria 1348
1416 Ga0501044_0371164 3300049823 Bacteria 1347
1417 Ga0501045_0476771 3300049824 Bacteria 927
1418 nmdc:mga03683_109042_c1 3300050489 Bacteria 1222
1419 nmdc:mga03683_3736_c1 3300050489 Bacteria 4964
1420 nmdc:mga03n38_67178_c1 3300050490 Bacteria 1649
1421 nmdc:mga00v17_167557_c1 3300050491 Bacteria 1415
1422 nmdc:mga00v17_38016_c1 3300050491 Bacteria 2876
1423 nmdc:mga00v17_4271_c1 3300050491 Bacteria 7421
1424 nmdc:mga00v17_57556_c1 3300050491 Bacteria 2378
1425 nmdc:mga0yw44_265032_c1 3300050492 Bacteria 1146
1426 nmdc:mga0yw44_3033_c1 3300050492 Bacteria 7342
1427 nmdc:mga0yw44_67116_c1 3300050492 Bacteria 2216
1428 nmdc:mga0k408_19359_c1 3300050493 Bacteria 3803
1429 nmdc:mga0k408_40804_c1 3300050493 Bacteria 2672
1430 nmdc:mga0k408_9222_c1 3300050493 Bacteria 5316
1431 nmdc:mga06z11_5823_c1 3300050494 Bacteria 4973
1432 nmdc:mga06z11_8923_c1 3300050494 Bacteria 4205
1433 nmdc:mga04h51_1904_c1 3300050495 Bacteria 4873
1434 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
1435 nmdc:mga05p37_406884_c1 3300050507 Bacteria 1587
1436 nmdc:mga05p37_5389_c1 3300050507 Bacteria 15038
1437 nmdc:mga05p37_6624_c1 3300050507 Bacteria 13657
1438 nmdc:mga09592_238_c1 3300050508 Bacteria 40013
1439 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
1440 nmdc:mga06r32_183979_c1 3300050510 Bacteria 2076
1441 nmdc:mga06r32_2023_c1 3300050510 Bacteria 18128
1442 nmdc:mga08y16_189432_c1 3300050511 Bacteria 2134
1443 nmdc:mga08y16_2548_c1 3300050511 Bacteria 18740
1444 nmdc:mga08y16_2735_c1 3300050511 Bacteria 18090
1445 nmdc:mga0n895_125265_c1 3300050512 Bacteria 2593
1446 nmdc:mga0n895_1651_c1 3300050512 Bacteria 16871
1447 nmdc:mga0n895_394_c1 3300050512 Bacteria 29311
1448 nmdc:mga0n895_7279_c1 3300050512 Bacteria 9482
1449 nmdc:mga0n895_9070_c1 3300050512 Bacteria 8677
1450 nmdc:mga0rr50_22766_c1 3300050513 Bacteria 4307
1451 nmdc:mga0rr50_400416_c1 3300050513 Bacteria 1159
1452 nmdc:mga0rr50_48999_c1 3300050513 Bacteria 3126
1453 nmdc:mga0rr50_72450_c1 3300050513 Bacteria 2631
1454 nmdc:mga0a205_1167_c2 3300050515 Bacteria 15903
1455 nmdc:mga0a205_22640_c1 3300050515 Bacteria 5955
1456 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
1457 nmdc:mga0a205_27060_c1 3300050515 Bacteria 5475
1458 nmdc:mga0sz30_53095_c1 3300050516 Bacteria 1721
1459 Ga0495601_0000711 3300053077 Bacteria 17861
1460 Ga0495601_0001346 3300053077 Bacteria 13508
1461 Ga0495601_0002495 3300053077 Bacteria 10465
1462 Ga0495601_0006979 3300053077 Bacteria 6614
1463 Ga0495601_0019854 3300053077 Bacteria 4101
1464 Ga0495601_0071638 3300053077 Bacteria 2213
1465 Ga0495612_0005592 3300053078 Bacteria 5196
1466 Ga0495612_0008868 3300053078 Bacteria 4074
1467 Ga0495612_0010155 3300053078 Bacteria 3808
1468 Ga0495612_0024637 3300053078 Bacteria 2415
1469 Ga0500635_0000061 3300053080 Bacteria 71946
1470 Ga0495595_0000305 3300053084 Bacteria 19108
1471 Ga0495595_0000463 3300053084 Bacteria 15390
1472 Ga0495595_0000952 3300053084 Bacteria 11135
1473 Ga0495595_0003252 3300053084 Bacteria 6451
1474 Ga0495595_0005742 3300053084 Bacteria 5027
1475 Ga0495595_0072278 3300053084 Bacteria 1632
1476 Ga0495619_0000052 3300053085 Bacteria 98882
1477 Ga0495619_0000078 3300053085 Bacteria 72749
1478 Ga0495619_0001206 3300053085 Bacteria 16974
1479 Ga0495619_0007134 3300053085 Bacteria 7074
1480 Ga0495619_0008359 3300053085 Bacteria 6543
1481 Ga0495619_0014971 3300053085 Bacteria 4900
1482 Ga0495619_0031610 3300053085 Bacteria 3430
1483 Ga0495619_0117573 3300053085 Bacteria 1821
1484 Ga0500644_0004418 3300053088 Bacteria 3517
1485 Ga0500646_0022472 3300053090 Bacteria 1687
1486 Ga0500651_0028788 3300053093 Bacteria 3492
1487 Ga0500566_0008723 3300053094 Bacteria 5995
1488 Ga0500566_0103966 3300053094 Bacteria 1553
1489 Ga0500641_0015505 3300053096 Bacteria 2831
1490 Ga0500555_001801 3300053103 Bacteria 6393
1491 Ga0500556_0001403 3300053104 Bacteria 10485
1492 Ga0500562_029326 3300053108 Bacteria 1448
1493 Ga0500569_015539 3300053109 Bacteria 1908
1494 Ga0500572_044253 3300053111 Bacteria 1304
1495 Ga0500592_000426 3300053116 Bacteria 7038
1496 Ga0500595_000001 3300053119 Bacteria 1088438
1497 Ga0500608_000234 3300053122 Bacteria 21842
1498 Ga0500614_003889 3300053123 Bacteria 3189
1499 Ga0500642_0013219 3300053130 Bacteria 3026
1500 Ga0500652_001890 3300053131 Bacteria 6307
1501 Ga0500559_0021867 3300053136 Bacteria 2713
1502 Ga0500590_030044 3300053148 Bacteria 2819
1503 Ga0500603_074155 3300053150 Bacteria 974
1504 Ga0500616_0000001 3300053153 Bacteria 1986011
1505 Ga0500619_025718 3300053154 Bacteria 1746
1506 Ga0500624_025403 3300053157 Bacteria 985
1507 Ga0500627_0030433 3300053158 Bacteria 2260
1508 Ga0500638_020014 3300053162 Bacteria 3145
1509 Ga0500636_0009704 3300053177 Bacteria 5605
1510 Ga0500636_0127979 3300053177 Bacteria 1418
1511 Ga0500637_0001793 3300053178 Bacteria 9273
1512 Ga0500637_0016243 3300053178 Bacteria 3965
1513 Ga0500611_000857 3300053727 Bacteria 3163
1514 Ga0500645_000225 3300053730 Bacteria 43052
1515 Ga0500645_030270 3300053730 Bacteria 1629
1516 Ga0501084_0063865 3300054114 Bacteria 3083
1517 Ga0501084_0094862 3300054114 Bacteria 2505
1518 Ga0501084_0121018 3300054114 Bacteria 2201
1519 Ga0500661_009014 3300055283 Bacteria 1832
1520 Ga0501082_0000006 3300060353 Bacteria 127786
1521 Ga0501082_0023050 3300060353 Bacteria 5367
1522 Ga0501082_0070490 3300060353 Bacteria 3009
1523 Ga0501082_0108915 3300060353 Bacteria 2398
1524 Ga0501082_0121469 3300060353 Bacteria 2264
1525 Ga0501082_0378487 3300060353 Bacteria 1235
1526 Ga0501082_0497901 3300060353 Bacteria 1065
1527 Ga0466962_0043694 3300061719 Bacteria 2144
1528 Ga0530510_0092418 3300061734 Bacteria 2208
1529 Ga0530510_0321437 3300061734 Bacteria 1160

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0046661 Ga0373935_0046661_1999_2727 241
2 3300035725 Ga0373947_0580804 Ga0373947_0580804_19_744 241
3 3300048909 Ga0496106_0098478 Ga0496106_0098478_1066_1854 261
4 3300048916 Ga0496113_0251447 Ga0496113_0251447_15_803 262
5 3300060353 Ga0501082_0378487 Ga0501082_0378487_432_1220 262
6 3300049571 Ga0501034_0063086 Ga0501034_0063086_513_1349 265
7 3300053080 Ga0500635_0000061 Ga0500635_0000061_17850_18677 265
8 3300053111 Ga0500572_044253 Ga0500572_044253_116_943 265
9 3300053150 Ga0500603_074155 Ga0500603_074155_55_882 265
10 3300053157 Ga0500624_025403 Ga0500624_025403_98_925 265
11 3300053177 Ga0500636_0009704 Ga0500636_0009704_3271_4098 265
12 3300053178 Ga0500637_0001793 Ga0500637_0001793_2323_3150 265
13 3300028380 Ga0268265_10171882 Ga0268265_101718823 267
14 3300039447 Ga0436361_0435056 Ga0436361_0435056_569_1456 269
15 3300045976 Ga0466967_0265613 Ga0466967_0265613_733_1614 269
16 3300005336 Ga0070680_100034181 Ga0070680_1000341815 273
17 3300005563 Ga0068855_100055123 Ga0068855_1000551236 273
18 3300005616 Ga0068852_100184148 Ga0068852_1001841483 273
19 3300009093 Ga0105240_10076962 Ga0105240_100769625 273
20 3300025913 Ga0207695_10017396 Ga0207695_100173966 273
21 3300025917 Ga0207660_10023083 Ga0207660_100230833 273
22 3300025949 Ga0207667_10150202 Ga0207667_101502022 273
23 3300009177 Ga0105248_10005542 Ga0105248_100055426 274
24 3300035695 Ga0373927_0000580 Ga0373927_0000580_26240_27067 274
25 3300037068 Ga0373925_0000173 Ga0373925_0000173_8359_9186 274
26 3300037068 Ga0373925_0032491 Ga0373925_0032491_1882_2712 274
27 3300037312 Ga0395899_0000190 Ga0395899_0000190_64686_65513 274
28 3300037312 Ga0395899_0196780 Ga0395899_0196780_402_1229 274
29 3300037418 Ga0395900_0000002 Ga0395900_0000002_449894_450721 274
30 3300037418 Ga0395900_0017776 Ga0395900_0017776_3875_4702 274
31 3300037418 Ga0395900_0028650 Ga0395900_0028650_1756_2580 274
32 3300037466 Ga0395898_0177943 Ga0395898_0177943_33_857 274
33 3300037471 Ga0395905_0004637 Ga0395905_0004637_11101_11928 274
34 3300037471 Ga0395905_0075030 Ga0395905_0075030_266_1093 274
35 3300038443 Ga0395901_0000013 Ga0395901_0000013_253064_253891 274
36 3300039437 Ga0436365_1362947 Ga0436365_1362947_2040_2867 274
37 3300046459 Ga0495629_0071272 Ga0495629_0071272_921_1748 274
38 3300046472 Ga0495580_0198008 Ga0495580_0198008_42_872 274
39 3300046506 Ga0495583_0076395 Ga0495583_0076395_228_1055 274
40 3300046515 Ga0495620_0029469 Ga0495620_0029469_13_840 274
41 3300046522 Ga0495643_0004797 Ga0495643_0004797_6236_7063 274
42 3300046542 Ga0495597_0001137 Ga0495597_0001137_2686_3513 274
43 3300046557 Ga0495622_0005195 Ga0495622_0005195_3700_4527 274
44 3300046616 Ga0495668_0029565 Ga0495668_0029565_2146_2973 274
45 3300046684 Ga0495669_0005388 Ga0495669_0005388_3627_4454 274
46 3300048088 Ga0495602_0258265 Ga0495602_0258265_359_1186 274
47 3300053094 Ga0500566_0008723 Ga0500566_0008723_3591_4418 274
48 3300053109 Ga0500569_015539 Ga0500569_015539_814_1641 274
49 3300053122 Ga0500608_000234 Ga0500608_000234_12621_13448 274
50 3300053123 Ga0500614_003889 Ga0500614_003889_480_1307 274
51 3300053130 Ga0500642_0013219 Ga0500642_0013219_2106_2933 274
52 3300053136 Ga0500559_0021867 Ga0500559_0021867_1661_2488 274
53 3300053148 Ga0500590_030044 Ga0500590_030044_306_1133 274
54 3300053154 Ga0500619_025718 Ga0500619_025718_102_929 274
55 3300053162 Ga0500638_020014 Ga0500638_020014_139_966 274
56 3300053177 Ga0500636_0127979 Ga0500636_0127979_336_1163 274
57 3300053178 Ga0500637_0016243 Ga0500637_0016243_1944_2771 274
58 3300037471 Ga0395905_0056626 Ga0395905_0056626_2800_3627 275
59 3300038443 Ga0395901_0603556 Ga0395901_0603556_138_1004 275
60 3300049571 Ga0501034_0000339 Ga0501034_0000339_58943_59815 275
61 3300049571 Ga0501034_0399030 Ga0501034_0399030_317_1207 275
62 3300009147 Ga0114129_10165065 Ga0114129_101650654 276
63 3300035113 Ga0373936_0119635 Ga0373936_0119635_77_907 276
64 3300049591 Ga0501075_0170507 Ga0501075_0170507_629_1459 276
65 3300049741 Ga0501079_0070996 Ga0501079_0070996_1624_2454 276
66 3300050507 nmdc:mga05p37_406884_c1 nmdc:mga05p37_406884_c1_533_1372 276
67 3300009036 Ga0105244_10093869 Ga0105244_100938692 277
68 3300028556 Ga0265337_1004168 Ga0265337_10041683 277
69 3300031238 Ga0265332_10037530 Ga0265332_100375301 277
70 3300031240 Ga0265320_10000219 Ga0265320_1000021915 277
71 3300031711 Ga0265314_10049826 Ga0265314_100498262 277
72 3300036401 Ga0373937_0537571 Ga0373937_0537571_219_1061 277
73 3300042435 Ga0439434_0012297 Ga0439434_0012297_643_1479 277
74 3300046642 Ga0495634_0060805 Ga0495634_0060805_494_1333 277
75 3300046683 Ga0495658_0046865 Ga0495658_0046865_515_1354 277
76 3300047322 Ga0495680_0026107 Ga0495680_0026107_1682_2521 277
77 3300048911 Ga0496108_0636157 Ga0496108_0636157_25_858 277
78 3300048913 Ga0496110_0531537 Ga0496110_0531537_195_1028 277
79 3300048914 Ga0496111_0300416 Ga0496111_0300416_91_924 277
80 3300048916 Ga0496113_0156781 Ga0496113_0156781_732_1565 277
81 3300048921 Ga0496118_0021165 Ga0496118_0021165_2033_2869 277
82 3300048922 Ga0496119_0065300 Ga0496119_0065300_829_1665 277
83 3300048928 Ga0496125_0059875 Ga0496125_0059875_819_1655 277
84 3300039447 Ga0436361_0249575 Ga0436361_0249575_90_968 278
85 3300039437 Ga0436365_0148237 Ga0436365_0148237_12780_13619 279
86 3300021384 Ga0213876_10022439 Ga0213876_100224394 280
87 3300025920 Ga0207649_10199071 Ga0207649_101990712 280
88 3300031241 Ga0265325_10028133 Ga0265325_100281332 280
89 3300031250 Ga0265331_10036168 Ga0265331_100361682 280
90 3300031595 Ga0265313_10001334 Ga0265313_100013348 280
91 3300035398 Ga0316574_0038631 Ga0316574_0038631_697_1548 280
92 3300035398 Ga0316574_0385230 Ga0316574_0385230_19_870 280
93 3300036712 Ga0316584_0032111 Ga0316584_0032111_206_1057 280
94 3300044684 Ga0466966_0032527 Ga0466966_0032527_1653_2498 280
95 3300044693 Ga0466961_0212109 Ga0466961_0212109_193_1035 280
96 3300044719 Ga0466971_0070610 Ga0466971_0070610_641_1483 280
97 3300044719 Ga0466971_0173241 Ga0466971_0173241_72_914 280
98 3300045836 Ga0466958_0185002 Ga0466958_0185002_397_1239 280
99 3300045976 Ga0466967_0397855 Ga0466967_0397855_45_887 280
100 3300046460 Ga0495638_0078272 Ga0495638_0078272_976_1818 280
101 3300049586 Ga0501070_0294160 Ga0501070_0294160_13_855 280
102 3300053093 Ga0500651_0028788 Ga0500651_0028788_2101_2943 280
103 3300053119 Ga0500595_000001 Ga0500595_000001_616900_617742 280
104 3300053730 Ga0500645_000225 Ga0500645_000225_33336_34178 280
105 iso_pu_bacteria 2643221598 2644001784 280
106 3300005327 Ga0070658_10485780 Ga0070658_104857801 281
107 3300009093 Ga0105240_10528020 Ga0105240_105280202 281
108 3300009174 Ga0105241_10002538 Ga0105241_100025389 281
109 3300013100 Ga0157373_10032188 Ga0157373_100321885 281
110 3300013104 Ga0157370_10025628 Ga0157370_100256281 281
111 3300013104 Ga0157370_10096435 Ga0157370_100964352 281
112 3300035118 Ga0373954_0177716 Ga0373954_0177716_73_918 281
113 3300035171 Ga0373946_0041764 Ga0373946_0041764_1023_1868 281
114 3300035171 Ga0373946_0200360 Ga0373946_0200360_35_880 281
115 3300035691 Ga0373931_0103179 Ga0373931_0103179_291_1148 281
116 3300035724 Ga0373933_0042197 Ga0373933_0042197_28_873 281
117 3300036401 Ga0373937_0107310 Ga0373937_0107310_75_920 281
118 3300036401 Ga0373937_0261364 Ga0373937_0261364_24_869 281
119 3300037068 Ga0373925_0028815 Ga0373925_0028815_3214_4059 281
120 3300037068 Ga0373925_0229302 Ga0373925_0229302_315_1160 281
121 3300039437 Ga0436365_1128037 Ga0436365_1128037_13144_14001 281
122 3300039438 Ga0436360_1012588 Ga0436360_1012588_36_893 281
123 3300042012 Ga0439455_0004911 Ga0439455_0004911_1515_2360 281
124 3300046462 Ga0495651_0056241 Ga0495651_0056241_209_1054 281
125 3300046473 Ga0495582_0162472 Ga0495582_0162472_401_1246 281
126 3300046514 Ga0495618_0014425 Ga0495618_0014425_3119_3964 281
127 3300046642 Ga0495634_0144305 Ga0495634_0144305_169_1014 281
128 3300046642 Ga0495634_0164195 Ga0495634_0164195_529_1374 281
129 3300046681 Ga0495647_0039545 Ga0495647_0039545_13_858 281
130 3300047315 Ga0495581_0107467 Ga0495581_0107467_39_884 281
131 3300047318 Ga0495636_0107321 Ga0495636_0107321_16_861 281
132 3300047320 Ga0495672_0097941 Ga0495672_0097941_317_1171 281
133 3300047322 Ga0495680_0046219 Ga0495680_0046219_791_1636 281
134 3300047471 Ga0495684_0052229 Ga0495684_0052229_1881_2726 281
135 3300048905 Ga0496102_0710477 Ga0496102_0710477_56_904 281
136 3300048918 Ga0496115_0155786 Ga0496115_0155786_1016_1873 281
137 3300048929 Ga0496126_0003347 Ga0496126_0003347_18262_19110 281
138 3300049570 Ga0501033_0083065 Ga0501033_0083065_1485_2336 281
139 3300049571 Ga0501034_0149883 Ga0501034_0149883_237_1088 281
140 3300049572 Ga0501036_0115555 Ga0501036_0115555_542_1393 281
141 3300049573 Ga0501037_0102288 Ga0501037_0102288_1190_2035 281
142 3300049575 Ga0501039_0272035 Ga0501039_0272035_228_1073 281
143 3300049581 Ga0501047_0075258 Ga0501047_0075258_683_1534 281
144 3300049586 Ga0501070_0303877 Ga0501070_0303877_150_1001 281
145 3300049591 Ga0501075_0147723 Ga0501075_0147723_478_1323 281
146 3300049592 Ga0501076_0175554 Ga0501076_0175554_834_1679 281
147 3300049593 Ga0501077_0010133 Ga0501077_0010133_2175_3020 281
148 3300049741 Ga0501079_0154778 Ga0501079_0154778_687_1532 281
149 3300049742 Ga0501080_0016226 Ga0501080_0016226_75_920 281
150 3300049742 Ga0501080_0498609 Ga0501080_0498609_38_892 281
151 3300049823 Ga0501044_0130602 Ga0501044_0130602_1253_2104 281
152 3300049823 Ga0501044_0371164 Ga0501044_0371164_70_918 281
153 3300049824 Ga0501045_0476771 Ga0501045_0476771_19_864 281
154 3300053084 Ga0495595_0005742 Ga0495595_0005742_2865_3710 281
155 3300053085 Ga0495619_0000052 Ga0495619_0000052_63814_64659 281
156 3300054114 Ga0501084_0063865 Ga0501084_0063865_909_1754 281
157 3300060353 Ga0501082_0070490 Ga0501082_0070490_1396_2241 281
158 iso_pu_bacteria 2808606439 2809197669 282
159 3300001904 JGI24736J21556_1007414 JGI24736J21556_10074142 283
160 3300001915 JGI24741J21665_1000480 JGI24741J21665_10004804 283
161 3300001989 JGI24739J22299_10035979 JGI24739J22299_100359792 283
162 3300001990 JGI24737J22298_10004460 JGI24737J22298_100044605 283
163 3300002067 JGI24735J21928_10012687 JGI24735J21928_100126872 283
164 3300002075 JGI24738J21930_10000169 JGI24738J21930_100001697 283
165 3300005327 Ga0070658_10085242 Ga0070658_100852422 283
166 3300005331 Ga0070670_100053768 Ga0070670_1000537684 283
167 3300005339 Ga0070660_100062581 Ga0070660_1000625812 283
168 3300005347 Ga0070668_100015020 Ga0070668_1000150202 283
169 3300005353 Ga0070669_100014047 Ga0070669_1000140477 283
170 3300005355 Ga0070671_100010004 Ga0070671_1000100044 283
171 3300005367 Ga0070667_100024040 Ga0070667_1000240404 283
172 3300005455 Ga0070663_100001457 Ga0070663_1000014571 283
173 3300005539 Ga0068853_100142226 Ga0068853_1001422262 283
174 3300005548 Ga0070665_100120439 Ga0070665_1001204393 283
175 3300005563 Ga0068855_100097234 Ga0068855_1000972342 283
176 3300005577 Ga0068857_100230593 Ga0068857_1002305932 283
177 3300005577 Ga0068857_100436762 Ga0068857_1004367621 283
178 3300005614 Ga0068856_100001903 Ga0068856_10000190312 283
179 3300005614 Ga0068856_100135592 Ga0068856_1001355922 283
180 3300005617 Ga0068859_100002128 Ga0068859_1000021287 283
181 3300005719 Ga0068861_100184939 Ga0068861_1001849392 283
182 3300005834 Ga0068851_10005669 Ga0068851_100056694 283
183 3300005841 Ga0068863_100005675 Ga0068863_1000056757 283
184 3300005842 Ga0068858_100003620 Ga0068858_10000362011 283
185 3300005843 Ga0068860_100000571 Ga0068860_10000057118 283
186 3300005843 Ga0068860_100011314 Ga0068860_1000113148 283
187 3300005844 Ga0068862_100031143 Ga0068862_1000311435 283
188 3300006038 Ga0075365_10031262 Ga0075365_100312622 283
189 3300006051 Ga0075364_10016442 Ga0075364_100164426 283
190 3300006931 Ga0097620_100002128 Ga0097620_1000021287 283
191 3300009093 Ga0105240_10350234 Ga0105240_103502342 283
192 3300009093 Ga0105240_10350484 Ga0105240_103504842 283
193 3300009551 Ga0105238_10418350 Ga0105238_104183501 283
194 3300010375 Ga0105239_10398934 Ga0105239_103989342 283
195 3300010375 Ga0105239_10418387 Ga0105239_104183871 283
196 3300013100 Ga0157373_10207712 Ga0157373_102077122 283
197 3300013307 Ga0157372_10369355 Ga0157372_103693552 283
198 3300014325 Ga0163163_10016154 Ga0163163_100161544 283
199 3300014968 Ga0157379_10004025 Ga0157379_100040257 283
200 3300025321 Ga0207656_10002415 Ga0207656_100024154 283
201 3300025911 Ga0207654_10003291 Ga0207654_100032912 283
202 3300025913 Ga0207695_10204870 Ga0207695_102048702 283
203 3300025913 Ga0207695_10324923 Ga0207695_103249232 283
204 3300025919 Ga0207657_10004180 Ga0207657_1000418012 283
205 3300025924 Ga0207694_10044793 Ga0207694_100447931 283
206 3300025925 Ga0207650_10066713 Ga0207650_100667134 283
207 3300025931 Ga0207644_10006403 Ga0207644_100064034 283
208 3300025933 Ga0207706_10207692 Ga0207706_102076922 283
209 3300025941 Ga0207711_10005870 Ga0207711_100058707 283
210 3300025945 Ga0207679_10077903 Ga0207679_100779032 283
211 3300025945 Ga0207679_10341445 Ga0207679_103414451 283
212 3300025949 Ga0207667_10077487 Ga0207667_100774872 283
213 3300025949 Ga0207667_10323748 Ga0207667_103237482 283
214 3300025972 Ga0207668_10003367 Ga0207668_100033677 283
215 3300025981 Ga0207640_10023305 Ga0207640_100233052 283
216 3300026035 Ga0207703_10015235 Ga0207703_100152355 283
217 3300026041 Ga0207639_10000438 Ga0207639_1000043813 283
218 3300026067 Ga0207678_10000022 Ga0207678_1000002263 283
219 3300026078 Ga0207702_10004744 Ga0207702_1000474413 283
220 3300026078 Ga0207702_10182280 Ga0207702_101822802 283
221 3300026088 Ga0207641_10042539 Ga0207641_100425393 283
222 3300026142 Ga0207698_10021020 Ga0207698_100210202 283
223 3300028379 Ga0268266_10057499 Ga0268266_100574993 283
224 3300028381 Ga0268264_10000573 Ga0268264_1000057325 283
225 3300028381 Ga0268264_10016328 Ga0268264_100163286 283
226 3300031731 Ga0307405_10059396 Ga0307405_100593962 283
227 3300031901 Ga0307406_10001856 Ga0307406_100018566 283
228 3300031901 Ga0307406_10228315 Ga0307406_102283152 283
229 3300032002 Ga0307416_100249482 Ga0307416_1002494821 283
230 3300032004 Ga0307414_10012015 Ga0307414_100120151 283
231 3300049823 Ga0501044_0182312 Ga0501044_0182312_825_1682 283
232 3300050492 nmdc:mga0yw44_265032_c1 nmdc:mga0yw44_265032_c1_51_911 283
233 3300053116 Ga0500592_000426 Ga0500592_000426_2904_3758 283
234 3300053727 Ga0500611_000857 Ga0500611_000857_114_968 283
235 3300005617 Ga0068859_100104020 Ga0068859_1001040203 284
236 3300006042 Ga0075368_10001941 Ga0075368_100019414 284
237 3300006048 Ga0075363_100060338 Ga0075363_1000603383 284
238 3300006051 Ga0075364_10001878 Ga0075364_1000187814 284
239 3300006178 Ga0075367_10000927 Ga0075367_100009275 284
240 3300006195 Ga0075366_10063716 Ga0075366_100637163 284
241 3300006931 Ga0097620_100104023 Ga0097620_1001040233 284
242 3300027866 Ga0209813_10001761 Ga0209813_100017616 284
243 3300049572 Ga0501036_0358943 Ga0501036_0358943_274_1128 284
244 3300049582 Ga0501048_0099287 Ga0501048_0099287_275_1135 284
245 3300049823 Ga0501044_0263106 Ga0501044_0263106_207_1061 284
246 3300050490 nmdc:mga03n38_67178_c1 nmdc:mga03n38_67178_c1_182_1042 284
247 3300050491 nmdc:mga00v17_4271_c1 nmdc:mga00v17_4271_c1_3837_4697 284
248 3300050493 nmdc:mga0k408_9222_c1 nmdc:mga0k408_9222_c1_2079_2939 284
249 3300050494 nmdc:mga06z11_5823_c1 nmdc:mga06z11_5823_c1_608_1468 284
250 3300050495 nmdc:mga04h51_1904_c1 nmdc:mga04h51_1904_c1_179_1039 284
251 iso_pu_bacteria 3001889506 3001890712 284
252 3300003578 Ga0006562J51391_1190565 Ga0006562J51391_11905651 285
253 3300005336 Ga0070680_100023637 Ga0070680_1000236374 285
254 3300005347 Ga0070668_100000610 Ga0070668_10000061021 285
255 3300005366 Ga0070659_100004201 Ga0070659_1000042015 285
256 3300005366 Ga0070659_100423969 Ga0070659_1004239691 285
257 3300005367 Ga0070667_100009149 Ga0070667_1000091497 285
258 3300005458 Ga0070681_10062881 Ga0070681_100628814 285
259 3300005458 Ga0070681_10305118 Ga0070681_103051182 285
260 3300005530 Ga0070679_100011322 Ga0070679_1000113227 285
261 3300005539 Ga0068853_100014280 Ga0068853_1000142807 285
262 3300005548 Ga0070665_100000157 Ga0070665_1000001577 285
263 3300005548 Ga0070665_100001531 Ga0070665_10000153124 285
264 3300005548 Ga0070665_100073456 Ga0070665_1000734564 285
265 3300005618 Ga0068864_100001593 Ga0068864_10000159312 285
266 3300005841 Ga0068863_100000262 Ga0068863_10000026212 285
267 3300005842 Ga0068858_100001087 Ga0068858_10000108720 285
268 3300006353 Ga0075370_10098868 Ga0075370_100988682 285
269 3300009092 Ga0105250_10004815 Ga0105250_100048156 285
270 3300009093 Ga0105240_10049890 Ga0105240_100498902 285
271 3300009093 Ga0105240_10070502 Ga0105240_100705023 285
272 3300009093 Ga0105240_10126637 Ga0105240_101266371 285
273 3300009551 Ga0105238_10158553 Ga0105238_101585532 285
274 3300010375 Ga0105239_10742448 Ga0105239_107424482 285
275 3300014968 Ga0157379_10041333 Ga0157379_100413334 285
276 3300021384 Ga0213876_10046715 Ga0213876_100467151 285
277 3300025254 Ga0209148_1018161 Ga0209148_10181612 285
278 3300025909 Ga0207705_10002453 Ga0207705_100024539 285
279 3300025913 Ga0207695_10026897 Ga0207695_100268976 285
280 3300025913 Ga0207695_10254239 Ga0207695_102542392 285
281 3300025913 Ga0207695_10257203 Ga0207695_102572032 285
282 3300025917 Ga0207660_10009386 Ga0207660_100093866 285
283 3300025919 Ga0207657_10003879 Ga0207657_1000387913 285
284 3300025921 Ga0207652_10010411 Ga0207652_100104114 285
285 3300025924 Ga0207694_10087855 Ga0207694_100878551 285
286 3300025924 Ga0207694_10118101 Ga0207694_101181012 285
287 3300025932 Ga0207690_10001364 Ga0207690_100013645 285
288 3300025932 Ga0207690_10045665 Ga0207690_100456654 285
289 3300025941 Ga0207711_10037787 Ga0207711_100377871 285
290 3300025972 Ga0207668_10000013 Ga0207668_10000013133 285
291 3300026035 Ga0207703_10000051 Ga0207703_10000051125 285
292 3300026088 Ga0207641_10000003 Ga0207641_10000003134 285
293 3300026095 Ga0207676_10007303 Ga0207676_100073037 285
294 3300028379 Ga0268266_10000003 Ga0268266_100000031590 285
295 3300028379 Ga0268266_10006868 Ga0268266_100068683 285
296 3300028379 Ga0268266_10059017 Ga0268266_100590172 285
297 3300031250 Ga0265331_10000250 Ga0265331_1000025043 285
298 3300031251 Ga0265327_10000007 Ga0265327_10000007480 285
299 3300031616 Ga0307508_10421101 Ga0307508_104211011 285
300 3300039437 Ga0436365_0794414 Ga0436365_0794414_2005_2868 285
301 3300039438 Ga0436360_1250910 Ga0436360_1250910_282_1148 285
302 3300044683 Ga0466965_0040669 Ga0466965_0040669_358_1227 285
303 3300044693 Ga0466961_0012092 Ga0466961_0012092_3913_4782 285
304 3300044765 Ga0466970_0005989 Ga0466970_0005989_1130_1999 285
305 3300044901 Ga0466960_0004155 Ga0466960_0004155_1854_2717 285
306 3300044901 Ga0466960_0007952 Ga0466960_0007952_3106_3975 285
307 3300046543 Ga0495645_0131658 Ga0495645_0131658_180_1049 285
308 3300046684 Ga0495669_0032487 Ga0495669_0032487_18_926 285
309 3300048905 Ga0496102_0219292 Ga0496102_0219292_421_1302 285
310 3300048915 Ga0496112_0010330 Ga0496112_0010330_6503_7384 285
311 3300048918 Ga0496115_0017321 Ga0496115_0017321_1738_2625 285
312 3300049570 Ga0501033_0010487 Ga0501033_0010487_2381_3244 285
313 3300049571 Ga0501034_0111260 Ga0501034_0111260_911_1774 285
314 3300049572 Ga0501036_0007758 Ga0501036_0007758_6015_6881 285
315 3300049573 Ga0501037_0015640 Ga0501037_0015640_1770_2636 285
316 3300049573 Ga0501037_0065159 Ga0501037_0065159_828_1691 285
317 3300049575 Ga0501039_0304596 Ga0501039_0304596_376_1239 285
318 3300049580 Ga0501046_0012653 Ga0501046_0012653_5132_5998 285
319 3300049581 Ga0501047_0168527 Ga0501047_0168527_39_905 285
320 3300049581 Ga0501047_0240551 Ga0501047_0240551_319_1185 285
321 3300049582 Ga0501048_0085030 Ga0501048_0085030_1149_2015 285
322 3300049586 Ga0501070_0305052 Ga0501070_0305052_30_893 285
323 3300049822 Ga0501035_0008488 Ga0501035_0008488_2645_3511 285
324 3300049823 Ga0501044_0094283 Ga0501044_0094283_1150_2013 285
325 3300053103 Ga0500555_001801 Ga0500555_001801_2737_3600 285
326 iso_pu_bacteria 2855386786 2855388756 285
327 iso_pu_bacteria 2939669807 2939674038 285
328 3300031344 Ga0265316_10113144 Ga0265316_101131442 286
329 3300039437 Ga0436365_0741954 Ga0436365_0741954_2062_2931 286
330 3300044683 Ga0466965_0031305 Ga0466965_0031305_352_1236 286
331 3300044693 Ga0466961_0120183 Ga0466961_0120183_159_1043 286
332 3300044842 Ga0466957_0058735 Ga0466957_0058735_545_1438 286
333 3300044901 Ga0466960_0218885 Ga0466960_0218885_18_896 286
334 iso_pu_bacteria 2818991462 2819691323 286
335 iso_pu_bacteria 2897803580 2897803794 286
336 3300003578 Ga0006562J51391_1047206 Ga0006562J51391_10472062 287
337 3300028573 Ga0265334_10007257 Ga0265334_100072573 287
338 3300031239 Ga0265328_10055500 Ga0265328_100555001 287
339 3300031249 Ga0265339_10031136 Ga0265339_100311363 287
340 3300032133 Ga0316583_10001264 Ga0316583_100012649 287
341 3300049571 Ga0501034_0000607 Ga0501034_0000607_15882_16757 287
342 3300049573 Ga0501037_0048324 Ga0501037_0048324_506_1381 287
343 3300049583 Ga0501067_0029161 Ga0501067_0029161_1443_2318 287
344 3300049584 Ga0501068_0009625 Ga0501068_0009625_2562_3437 287
345 3300049586 Ga0501070_0072076 Ga0501070_0072076_1375_2250 287
346 3300049587 Ga0501071_0330925 Ga0501071_0330925_162_1043 287
347 3300049588 Ga0501072_0000782 Ga0501072_0000782_11443_12321 287
348 3300049589 Ga0501073_0002353 Ga0501073_0002353_1456_2331 287
349 3300049589 Ga0501073_0122143 Ga0501073_0122143_914_1792 287
350 3300049590 Ga0501074_0016150 Ga0501074_0016150_3653_4528 287
351 3300049742 Ga0501080_0001302 Ga0501080_0001302_7765_8640 287
352 3300049742 Ga0501080_0150646 Ga0501080_0150646_529_1410 287
353 3300049744 Ga0501083_0010875 Ga0501083_0010875_1161_2042 287
354 3300049744 Ga0501083_0246846 Ga0501083_0246846_44_919 287
355 iso_pu_bacteria 2643221711 2644607396 287
356 iso_pu_bacteria 2835312727 2835318368 287
357 iso_pu_bacteria 2874590934 2874591676 287
358 iso_pu_bacteria 2874645413 2874646161 287
359 iso_pu_bacteria 2876771140 2876771777 287
360 iso_pu_bacteria 2876818435 2876819121 287
361 iso_pu_bacteria 2879074833 2879075632 287
362 iso_pu_bacteria 2932794094 2932794190 287
363 iso_pu_bacteria 2932801729 2932808215 287
364 iso_pu_bacteria 2935883170 2935889214 287
365 iso_pu_bacteria 3005710791 3005711131 287
366 3300005539 Ga0068853_100122729 Ga0068853_1001227292 288
367 3300005563 Ga0068855_100000419 Ga0068855_10000041919 288
368 3300009545 Ga0105237_10216877 Ga0105237_102168772 288
369 3300013105 Ga0157369_10131872 Ga0157369_101318724 288
370 3300015265 Ga0182005_1006295 Ga0182005_10062951 288
371 3300025911 Ga0207654_10047320 Ga0207654_100473203 288
372 3300048908 Ga0496105_0125137 Ga0496105_0125137_365_1243 288
373 3300049572 Ga0501036_0404162 Ga0501036_0404162_19_930 288
374 3300049575 Ga0501039_0398431 Ga0501039_0398431_92_1009 288
375 3300049584 Ga0501068_0004896 Ga0501068_0004896_811_1692 288
376 iso_pu_bacteria 2626541554 2626639020 288
377 iso_pu_bacteria 2643221547 2643758211 288
378 iso_pu_bacteria 2811994882 2812373817 288
379 iso_pu_bacteria 2828305725 2828306462 288
380 3300039438 Ga0436360_0455427 Ga0436360_0455427_1719_2708 289
381 3300039438 Ga0436360_0495895 Ga0436360_0495895_1125_2087 289
382 iso_pu_bacteria 2508501050 2508734703 289
383 iso_pu_bacteria 2545555834 2545675028 289
384 iso_pu_bacteria 2882456835 2882459002 289
385 iso_pu_bacteria 2894232714 2894241881 289
386 iso_pu_bacteria 3003665799 3003665828 289
387 iso_pu_bacteria 643348564 643603572 289
388 3300005458 Ga0070681_10162517 Ga0070681_101625172 290
389 3300021384 Ga0213876_10073753 Ga0213876_100737532 290
390 3300025949 Ga0207667_10534054 Ga0207667_105340541 290
391 3300035114 Ga0373939_0001280 Ga0373939_0001280_3992_4864 290
392 3300004625 Ga0055543_1027913 Ga0055543_10279131 291
393 3300005329 Ga0070683_100028872 Ga0070683_1000288722 291
394 3300005336 Ga0070680_100095019 Ga0070680_1000950192 291
395 3300005336 Ga0070680_100144148 Ga0070680_1001441484 291
396 3300005337 Ga0070682_100045759 Ga0070682_1000457594 291
397 3300005341 Ga0070691_10020941 Ga0070691_100209413 291
398 3300005366 Ga0070659_100103054 Ga0070659_1001030541 291
399 3300005434 Ga0070709_10015617 Ga0070709_100156174 291
400 3300005434 Ga0070709_10277308 Ga0070709_102773081 291
401 3300005458 Ga0070681_10009671 Ga0070681_1000967112 291
402 3300005458 Ga0070681_10195401 Ga0070681_101954012 291
403 3300005530 Ga0070679_100019056 Ga0070679_10001905612 291
404 3300005530 Ga0070679_100048159 Ga0070679_1000481593 291
405 3300005530 Ga0070679_100337418 Ga0070679_1003374181 291
406 3300005535 Ga0070684_100007076 Ga0070684_1000070763 291
407 3300005535 Ga0070684_100226488 Ga0070684_1002264882 291
408 3300005563 Ga0068855_100082985 Ga0068855_1000829854 291
409 3300005577 Ga0068857_100071907 Ga0068857_1000719074 291
410 3300005614 Ga0068856_100013958 Ga0068856_10001395810 291
411 3300005616 Ga0068852_100017184 Ga0068852_1000171846 291
412 3300005937 Ga0081455_10023057 Ga0081455_100230572 291
413 3300006914 Ga0075436_100323244 Ga0075436_1003232441 291
414 3300009093 Ga0105240_10159656 Ga0105240_101596563 291
415 3300009094 Ga0111539_10025579 Ga0111539_100255791 291
416 3300009147 Ga0114129_10012887 Ga0114129_100128877 291
417 3300009545 Ga0105237_10148701 Ga0105237_101487012 291
418 3300009545 Ga0105237_10183757 Ga0105237_101837572 291
419 3300009551 Ga0105238_10012601 Ga0105238_100126014 291
420 3300009551 Ga0105238_10163350 Ga0105238_101633503 291
421 3300013105 Ga0157369_10108742 Ga0157369_101087424 291
422 3300013296 Ga0157374_10095251 Ga0157374_100952513 291
423 3300013306 Ga0163162_10115482 Ga0163162_101154822 291
424 3300020082 Ga0206353_11098713 Ga0206353_110987132 291
425 3300025253 Ga0209677_102931 Ga0209677_1029313 291
426 3300025898 Ga0207692_10194555 Ga0207692_101945551 291
427 3300025906 Ga0207699_10005583 Ga0207699_100055835 291
428 3300025912 Ga0207707_10001947 Ga0207707_1000194723 291
429 3300025912 Ga0207707_10163304 Ga0207707_101633042 291
430 3300025912 Ga0207707_10282125 Ga0207707_102821252 291
431 3300025913 Ga0207695_10319731 Ga0207695_103197311 291
432 3300025914 Ga0207671_10022076 Ga0207671_100220763 291
433 3300025914 Ga0207671_10187523 Ga0207671_101875232 291
434 3300025917 Ga0207660_10131525 Ga0207660_101315252 291
435 3300025917 Ga0207660_10180595 Ga0207660_101805952 291
436 3300025921 Ga0207652_10139161 Ga0207652_101391613 291
437 3300025921 Ga0207652_10675722 Ga0207652_106757221 291
438 3300025924 Ga0207694_10026270 Ga0207694_100262703 291
439 3300025924 Ga0207694_10157910 Ga0207694_101579102 291
440 3300025935 Ga0207709_10280019 Ga0207709_102800191 291
441 3300025944 Ga0207661_10005672 Ga0207661_100056728 291
442 3300025944 Ga0207661_10011706 Ga0207661_100117064 291
443 3300025961 Ga0207712_10145500 Ga0207712_101455002 291
444 3300026078 Ga0207702_10010411 Ga0207702_1001041110 291
445 3300026078 Ga0207702_10632175 Ga0207702_106321751 291
446 3300026116 Ga0207674_10051030 Ga0207674_100510304 291
447 3300026142 Ga0207698_10507791 Ga0207698_105077911 291
448 3300028379 Ga0268266_10550687 Ga0268266_105506871 291
449 3300028556 Ga0265337_1000392 Ga0265337_100039213 291
450 3300031344 Ga0265316_10029512 Ga0265316_100295122 291
451 3300031344 Ga0265316_10075798 Ga0265316_100757982 291
452 3300031595 Ga0265313_10000008 Ga0265313_1000000830 291
453 3300031711 Ga0265314_10122643 Ga0265314_101226432 291
454 3300035083 Ga0373926_0004776 Ga0373926_0004776_2809_3684 291
455 3300035089 Ga0373944_0018155 Ga0373944_0018155_824_1699 291
456 3300035111 Ga0373923_0008412 Ga0373923_0008412_1541_2416 291
457 3300035111 Ga0373923_0099578 Ga0373923_0099578_222_1097 291
458 3300035116 Ga0373945_0032988 Ga0373945_0032988_773_1648 291
459 3300035117 Ga0373953_0077569 Ga0373953_0077569_160_1035 291
460 3300035118 Ga0373954_0013777 Ga0373954_0013777_1145_2020 291
461 3300035118 Ga0373954_0020248 Ga0373954_0020248_750_1625 291
462 3300035120 Ga0373957_0021058 Ga0373957_0021058_639_1514 291
463 3300035120 Ga0373957_0059724 Ga0373957_0059724_244_1119 291
464 3300035170 Ga0373943_0037844 Ga0373943_0037844_1142_2017 291
465 3300035171 Ga0373946_0020505 Ga0373946_0020505_191_1066 291
466 3300035172 Ga0373955_0030959 Ga0373955_0030959_1609_2484 291
467 3300035172 Ga0373955_0083091 Ga0373955_0083091_211_1086 291
468 3300035410 Ga0373924_0105219 Ga0373924_0105219_268_1143 291
469 3300035692 Ga0373935_0031532 Ga0373935_0031532_183_1058 291
470 3300035695 Ga0373927_0010444 Ga0373927_0010444_4489_5364 291
471 3300035695 Ga0373927_0068391 Ga0373927_0068391_601_1476 291
472 3300035724 Ga0373933_0000068 Ga0373933_0000068_47218_48099 291
473 3300035724 Ga0373933_0041178 Ga0373933_0041178_1754_2629 291
474 3300036401 Ga0373937_0048840 Ga0373937_0048840_1728_2603 291
475 3300036401 Ga0373937_0082824 Ga0373937_0082824_926_1801 291
476 3300036401 Ga0373937_0098375 Ga0373937_0098375_175_1050 291
477 3300036401 Ga0373937_0137425 Ga0373937_0137425_1029_1904 291
478 3300037068 Ga0373925_0079559 Ga0373925_0079559_390_1265 291
479 3300037418 Ga0395900_0002835 Ga0395900_0002835_5237_6112 291
480 3300037418 Ga0395900_0030079 Ga0395900_0030079_57_932 291
481 3300037418 Ga0395900_0165043 Ga0395900_0165043_1082_1957 291
482 3300037418 Ga0395900_0540983 Ga0395900_0540983_179_1054 291
483 3300037466 Ga0395898_0020711 Ga0395898_0020711_1224_2099 291
484 3300037466 Ga0395898_0033914 Ga0395898_0033914_2154_3029 291
485 3300038443 Ga0395901_0006379 Ga0395901_0006379_1720_2595 291
486 3300038443 Ga0395901_0207924 Ga0395901_0207924_913_1788 291
487 3300039437 Ga0436365_0377120 Ga0436365_0377120_1533_2408 291
488 3300039437 Ga0436365_0880454 Ga0436365_0880454_709_1584 291
489 3300039438 Ga0436360_0378170 Ga0436360_0378170_100_1134 291
490 3300039447 Ga0436361_0429651 Ga0436361_0429651_1227_2114 291
491 3300044656 Ga0466969_0138235 Ga0466969_0138235_176_1051 291
492 3300044684 Ga0466966_0051085 Ga0466966_0051085_834_1709 291
493 3300044693 Ga0466961_0119613 Ga0466961_0119613_364_1239 291
494 3300044694 Ga0466963_0152771 Ga0466963_0152771_350_1225 291
495 3300044694 Ga0466963_0359712 Ga0466963_0359712_115_996 291
496 3300044735 Ga0466968_0124408 Ga0466968_0124408_182_1057 291
497 3300044842 Ga0466957_0037744 Ga0466957_0037744_466_1341 291
498 3300044842 Ga0466957_0154813 Ga0466957_0154813_299_1174 291
499 3300045836 Ga0466958_0071195 Ga0466958_0071195_718_1593 291
500 3300045976 Ga0466967_0008743 Ga0466967_0008743_3915_4790 291
501 3300046454 Ga0495592_0077436 Ga0495592_0077436_584_1459 291
502 3300046455 Ga0495603_0052856 Ga0495603_0052856_706_1581 291
503 3300046459 Ga0495629_0085166 Ga0495629_0085166_132_1007 291
504 3300046462 Ga0495651_0063535 Ga0495651_0063535_1088_1963 291
505 3300046472 Ga0495580_0022982 Ga0495580_0022982_1337_2212 291
506 3300046473 Ga0495582_0015124 Ga0495582_0015124_891_1766 291
507 3300046476 Ga0495662_0051975 Ga0495662_0051975_396_1271 291
508 3300046477 Ga0495664_0006101 Ga0495664_0006101_2616_3491 291
509 3300046516 Ga0495628_0201512 Ga0495628_0201512_110_985 291
510 3300046531 Ga0495665_0022232 Ga0495665_0022232_2092_2967 291
511 3300046559 Ga0495667_0078084 Ga0495667_0078084_1206_2081 291
512 3300046675 Ga0495657_0047044 Ga0495657_0047044_1689_2564 291
513 3300046681 Ga0495647_0016344 Ga0495647_0016344_183_1058 291
514 3300046690 Ga0495624_0116763 Ga0495624_0116763_112_987 291
515 3300047317 Ga0495604_0081771 Ga0495604_0081771_755_1630 291
516 3300047319 Ga0495674_0076422 Ga0495674_0076422_757_1632 291
517 3300047319 Ga0495674_0178030 Ga0495674_0178030_87_962 291
518 3300047322 Ga0495680_0006975 Ga0495680_0006975_4281_5156 291
519 3300047444 Ga0495675_0015935 Ga0495675_0015935_218_1093 291
520 3300047471 Ga0495684_0016579 Ga0495684_0016579_4743_5618 291
521 3300048088 Ga0495602_0057244 Ga0495602_0057244_975_1850 291
522 3300048915 Ga0496112_0214038 Ga0496112_0214038_578_1456 291
523 3300048924 Ga0496121_0080084 Ga0496121_0080084_1124_1999 291
524 3300049569 Ga0501032_0097925 Ga0501032_0097925_1021_1896 291
525 3300049571 Ga0501034_0057101 Ga0501034_0057101_303_1178 291
526 3300049571 Ga0501034_0106715 Ga0501034_0106715_196_1071 291
527 3300049571 Ga0501034_0531090 Ga0501034_0531090_103_978 291
528 3300049573 Ga0501037_0173481 Ga0501037_0173481_241_1116 291
529 3300049574 Ga0501038_0440435 Ga0501038_0440435_63_938 291
530 3300049580 Ga0501046_0293919 Ga0501046_0293919_183_1058 291
531 3300049581 Ga0501047_0102242 Ga0501047_0102242_158_1033 291
532 3300049581 Ga0501047_0106205 Ga0501047_0106205_156_1031 291
533 3300049583 Ga0501067_0026359 Ga0501067_0026359_875_1750 291
534 3300049583 Ga0501067_0168700 Ga0501067_0168700_190_1065 291
535 3300049585 Ga0501069_0026062 Ga0501069_0026062_655_1578 291
536 3300049586 Ga0501070_0009447 Ga0501070_0009447_5707_6630 291
537 3300049586 Ga0501070_0036105 Ga0501070_0036105_2631_3506 291
538 3300049588 Ga0501072_0065812 Ga0501072_0065812_136_1011 291
539 3300049589 Ga0501073_0040533 Ga0501073_0040533_846_1721 291
540 3300049589 Ga0501073_0101909 Ga0501073_0101909_1070_1945 291
541 3300049744 Ga0501083_0005799 Ga0501083_0005799_1907_2782 291
542 3300049822 Ga0501035_0015144 Ga0501035_0015144_3145_4020 291
543 3300049823 Ga0501044_0370716 Ga0501044_0370716_456_1331 291
544 3300050491 nmdc:mga00v17_167557_c1 nmdc:mga00v17_167557_c1_383_1264 291
545 3300050507 nmdc:mga05p37_6624_c1 nmdc:mga05p37_6624_c1_8312_9226 291
546 3300053077 Ga0495601_0001346 Ga0495601_0001346_10971_11846 291
547 3300053077 Ga0495601_0071638 Ga0495601_0071638_1178_2053 291
548 3300053078 Ga0495612_0008868 Ga0495612_0008868_1797_2672 291
549 3300053084 Ga0495595_0003252 Ga0495595_0003252_294_1169 291
550 3300053085 Ga0495619_0014971 Ga0495619_0014971_2743_3618 291
551 3300053088 Ga0500644_0004418 Ga0500644_0004418_2497_3372 291
552 3300053153 Ga0500616_0000001 Ga0500616_0000001_1370264_1371139 291
553 3300055283 Ga0500661_009014 Ga0500661_009014_890_1771 291
554 3300060353 Ga0501082_0023050 Ga0501082_0023050_618_1493 291
555 3300061719 Ga0466962_0043694 Ga0466962_0043694_53_928 291
556 2209111006 2214745207 2213754724 292
557 3300000041 ARcpr5oldR_c000007 ARcpr5oldR_00000713 292
558 3300000042 ARSoilYngRDRAFT_c00111 ARSoilYngRDRAFT_0011113 292
559 3300000043 ARcpr5yngRDRAFT_c000090 ARcpr5yngRDRAFT_0000909 292
560 3300000044 ARSoilOldRDRAFT_c000004 ARSoilOldRDRAFT_00000455 292
561 3300000652 ARCol0yngRDRAFT_1000074 ARCol0yngRDRAFT_10000749 292
562 3300001976 JGI24752J21851_1000640 JGI24752J21851_10006405 292
563 3300001977 JGI24746J21847_1000605 JGI24746J21847_10006058 292
564 3300001989 JGI24739J22299_10000119 JGI24739J22299_1000011921 292
565 3300001990 JGI24737J22298_10000258 JGI24737J22298_100002589 292
566 3300001990 JGI24737J22298_10004381 JGI24737J22298_100043812 292
567 3300002070 JGI24750J21931_1000164 JGI24750J21931_10001649 292
568 3300002073 JGI24745J21846_1000018 JGI24745J21846_10000186 292
569 3300002073 JGI24745J21846_1000103 JGI24745J21846_100010311 292
570 3300002075 JGI24738J21930_10000155 JGI24738J21930_100001554 292
571 3300002076 JGI24749J21850_1000093 JGI24749J21850_10000939 292
572 3300002076 JGI24749J21850_1004421 JGI24749J21850_10044213 292
573 3300002077 JGI24744J21845_10006890 JGI24744J21845_100068902 292
574 3300002126 JGI24035J26624_1000048 JGI24035J26624_10000482 292
575 3300002239 JGI24034J26672_10003984 JGI24034J26672_100039842 292
576 3300002244 JGI24742J22300_10000595 JGI24742J22300_100005959 292
577 3300002459 JGI24751J29686_10004452 JGI24751J29686_100044521 292
578 3300003215 JGI25153J46596_10001652 JGI25153J46596_100016526 292
579 3300003659 JGI25404J52841_10015611 JGI25404J52841_100156112 292
580 3300003911 JGI25405J52794_10012973 JGI25405J52794_100129731 292
581 3300005289 Ga0065704_10077166 Ga0065704_100771665 292
582 3300005290 Ga0065712_10006793 Ga0065712_100067934 292
583 3300005290 Ga0065712_10068351 Ga0065712_1006835111 292
584 3300005293 Ga0065715_10002722 Ga0065715_100027224 292
585 3300005293 Ga0065715_10088946 Ga0065715_1008894618 292
586 3300005293 Ga0065715_10156332 Ga0065715_101563322 292
587 3300005295 Ga0065707_10200617 Ga0065707_102006172 292
588 3300005327 Ga0070658_10019947 Ga0070658_100199473 292
589 3300005327 Ga0070658_10102707 Ga0070658_101027073 292
590 3300005328 Ga0070676_10000514 Ga0070676_1000051417 292
591 3300005328 Ga0070676_10023508 Ga0070676_100235082 292
592 3300005328 Ga0070676_10235693 Ga0070676_102356931 292
593 3300005329 Ga0070683_100005318 Ga0070683_1000053183 292
594 3300005329 Ga0070683_100107174 Ga0070683_1001071741 292
595 3300005329 Ga0070683_100118808 Ga0070683_1001188082 292
596 3300005330 Ga0070690_100005935 Ga0070690_1000059352 292
597 3300005330 Ga0070690_100008454 Ga0070690_1000084543 292
598 3300005330 Ga0070690_100051987 Ga0070690_1000519873 292
599 3300005331 Ga0070670_100029103 Ga0070670_1000291033 292
600 3300005331 Ga0070670_100031842 Ga0070670_1000318423 292
601 3300005331 Ga0070670_100290350 Ga0070670_1002903502 292
602 3300005333 Ga0070677_10000023 Ga0070677_1000002343 292
603 3300005334 Ga0068869_100000153 Ga0068869_10000015328 292
604 3300005334 Ga0068869_100443697 Ga0068869_1004436971 292
605 3300005335 Ga0070666_10003393 Ga0070666_100033933 292
606 3300005335 Ga0070666_10026307 Ga0070666_100263072 292
607 3300005335 Ga0070666_10090311 Ga0070666_100903113 292
608 3300005336 Ga0070680_100000814 Ga0070680_10000081414 292
609 3300005336 Ga0070680_100021932 Ga0070680_1000219325 292
610 3300005336 Ga0070680_100023840 Ga0070680_1000238404 292
611 3300005336 Ga0070680_100055430 Ga0070680_1000554303 292
612 3300005336 Ga0070680_100065394 Ga0070680_1000653944 292
613 3300005336 Ga0070680_100081528 Ga0070680_1000815281 292
614 3300005336 Ga0070680_100231403 Ga0070680_1002314032 292
615 3300005337 Ga0070682_100000445 Ga0070682_10000044517 292
616 3300005337 Ga0070682_100034266 Ga0070682_1000342665 292
617 3300005338 Ga0068868_100036011 Ga0068868_1000360112 292
618 3300005339 Ga0070660_100001480 Ga0070660_10000148012 292
619 3300005339 Ga0070660_100009730 Ga0070660_1000097304 292
620 3300005339 Ga0070660_100016064 Ga0070660_1000160642 292
621 3300005339 Ga0070660_100044698 Ga0070660_1000446982 292
622 3300005340 Ga0070689_100000880 Ga0070689_10000088013 292
623 3300005340 Ga0070689_100014559 Ga0070689_1000145592 292
624 3300005340 Ga0070689_100016659 Ga0070689_1000166592 292
625 3300005340 Ga0070689_100019999 Ga0070689_1000199992 292
626 3300005340 Ga0070689_100102900 Ga0070689_1001029002 292
627 3300005340 Ga0070689_100303013 Ga0070689_1003030131 292
628 3300005341 Ga0070691_10000320 Ga0070691_1000032017 292
629 3300005343 Ga0070687_100000187 Ga0070687_10000018713 292
630 3300005343 Ga0070687_100052972 Ga0070687_1000529722 292
631 3300005344 Ga0070661_100001011 Ga0070661_10000101119 292
632 3300005344 Ga0070661_100121125 Ga0070661_1001211252 292
633 3300005344 Ga0070661_100185723 Ga0070661_1001857232 292
634 3300005345 Ga0070692_10005354 Ga0070692_100053543 292
635 3300005345 Ga0070692_10010362 Ga0070692_100103622 292
636 3300005347 Ga0070668_100002838 Ga0070668_1000028387 292
637 3300005347 Ga0070668_100463953 Ga0070668_1004639531 292
638 3300005353 Ga0070669_100000501 Ga0070669_10000050128 292
639 3300005353 Ga0070669_100073177 Ga0070669_1000731772 292
640 3300005354 Ga0070675_100001136 Ga0070675_10000113617 292
641 3300005354 Ga0070675_100112684 Ga0070675_1001126842 292
642 3300005354 Ga0070675_100398912 Ga0070675_1003989122 292
643 3300005355 Ga0070671_100000595 Ga0070671_10000059525 292
644 3300005355 Ga0070671_100094911 Ga0070671_1000949113 292
645 3300005355 Ga0070671_100296233 Ga0070671_1002962332 292
646 3300005356 Ga0070674_100000249 Ga0070674_10000024926 292
647 3300005356 Ga0070674_100036352 Ga0070674_1000363522 292
648 3300005356 Ga0070674_100154908 Ga0070674_1001549082 292
649 3300005364 Ga0070673_100000233 Ga0070673_1000002336 292
650 3300005364 Ga0070673_100009233 Ga0070673_1000092336 292
651 3300005364 Ga0070673_100157333 Ga0070673_1001573333 292
652 3300005365 Ga0070688_100000432 Ga0070688_10000043215 292
653 3300005365 Ga0070688_100007072 Ga0070688_1000070728 292
654 3300005365 Ga0070688_100013313 Ga0070688_1000133133 292
655 3300005366 Ga0070659_100000746 Ga0070659_10000074618 292
656 3300005366 Ga0070659_100032594 Ga0070659_1000325943 292
657 3300005367 Ga0070667_100001881 Ga0070667_10000188114 292
658 3300005367 Ga0070667_100047305 Ga0070667_1000473053 292
659 3300005367 Ga0070667_100150390 Ga0070667_1001503902 292
660 3300005367 Ga0070667_100596193 Ga0070667_1005961931 292
661 3300005406 Ga0070703_10001482 Ga0070703_100014823 292
662 3300005406 Ga0070703_10011260 Ga0070703_100112602 292
663 3300005434 Ga0070709_10005407 Ga0070709_100054076 292
664 3300005434 Ga0070709_10099473 Ga0070709_100994732 292
665 3300005435 Ga0070714_100026730 Ga0070714_1000267304 292
666 3300005435 Ga0070714_100386758 Ga0070714_1003867581 292
667 3300005436 Ga0070713_100071321 Ga0070713_1000713211 292
668 3300005437 Ga0070710_10239969 Ga0070710_102399691 292
669 3300005438 Ga0070701_10000164 Ga0070701_100001643 292
670 3300005438 Ga0070701_10027546 Ga0070701_100275462 292
671 3300005439 Ga0070711_100052667 Ga0070711_1000526672 292
672 3300005439 Ga0070711_100154905 Ga0070711_1001549052 292
673 3300005439 Ga0070711_100193775 Ga0070711_1001937752 292
674 3300005440 Ga0070705_100000361 Ga0070705_10000036115 292
675 3300005440 Ga0070705_100400224 Ga0070705_1004002241 292
676 3300005441 Ga0070700_100000357 Ga0070700_10000035718 292
677 3300005441 Ga0070700_100028226 Ga0070700_1000282263 292
678 3300005444 Ga0070694_100009629 Ga0070694_1000096293 292
679 3300005444 Ga0070694_100016773 Ga0070694_1000167733 292
680 3300005445 Ga0070708_100011297 Ga0070708_1000112973 292
681 3300005455 Ga0070663_100000582 Ga0070663_10000058219 292
682 3300005455 Ga0070663_100020266 Ga0070663_1000202662 292
683 3300005455 Ga0070663_100072831 Ga0070663_1000728312 292
684 3300005455 Ga0070663_100107595 Ga0070663_1001075951 292
685 3300005455 Ga0070663_100115033 Ga0070663_1001150332 292
686 3300005456 Ga0070678_100000438 Ga0070678_1000004388 292
687 3300005456 Ga0070678_100071597 Ga0070678_1000715974 292
688 3300005456 Ga0070678_100293356 Ga0070678_1002933561 292
689 3300005456 Ga0070678_100575000 Ga0070678_1005750001 292
690 3300005457 Ga0070662_100119108 Ga0070662_1001191082 292
691 3300005458 Ga0070681_10007036 Ga0070681_100070362 292
692 3300005458 Ga0070681_10009946 Ga0070681_100099464 292
693 3300005458 Ga0070681_10035954 Ga0070681_100359541 292
694 3300005458 Ga0070681_10250967 Ga0070681_102509672 292
695 3300005459 Ga0068867_100001099 Ga0068867_10000109918 292
696 3300005459 Ga0068867_100025161 Ga0068867_1000251613 292
697 3300005459 Ga0068867_100313540 Ga0068867_1003135402 292
698 3300005466 Ga0070685_10005188 Ga0070685_100051885 292
699 3300005466 Ga0070685_10006230 Ga0070685_100062307 292
700 3300005466 Ga0070685_10030426 Ga0070685_100304262 292
701 3300005468 Ga0070707_100245854 Ga0070707_1002458542 292
702 3300005518 Ga0070699_100204893 Ga0070699_1002048932 292
703 3300005530 Ga0070679_100002503 Ga0070679_1000025037 292
704 3300005530 Ga0070679_100020075 Ga0070679_1000200756 292
705 3300005530 Ga0070679_100051793 Ga0070679_1000517934 292
706 3300005530 Ga0070679_100052714 Ga0070679_1000527142 292
707 3300005530 Ga0070679_100174880 Ga0070679_1001748802 292
708 3300005535 Ga0070684_100000101 Ga0070684_10000010150 292
709 3300005535 Ga0070684_100013001 Ga0070684_1000130013 292
710 3300005535 Ga0070684_100075904 Ga0070684_1000759043 292
711 3300005535 Ga0070684_100164515 Ga0070684_1001645152 292
712 3300005536 Ga0070697_100101634 Ga0070697_1001016343 292
713 3300005536 Ga0070697_100136920 Ga0070697_1001369202 292
714 3300005539 Ga0068853_100003127 Ga0068853_1000031273 292
715 3300005539 Ga0068853_100244036 Ga0068853_1002440362 292
716 3300005543 Ga0070672_100017991 Ga0070672_1000179913 292
717 3300005543 Ga0070672_100242750 Ga0070672_1002427502 292
718 3300005543 Ga0070672_100324630 Ga0070672_1003246302 292
719 3300005544 Ga0070686_100000532 Ga0070686_1000005326 292
720 3300005544 Ga0070686_100019991 Ga0070686_1000199912 292
721 3300005544 Ga0070686_100063377 Ga0070686_1000633771 292
722 3300005545 Ga0070695_100010023 Ga0070695_1000100234 292
723 3300005546 Ga0070696_100004177 Ga0070696_10000417710 292
724 3300005546 Ga0070696_100061565 Ga0070696_1000615652 292
725 3300005547 Ga0070693_100003380 Ga0070693_1000033802 292
726 3300005548 Ga0070665_100229913 Ga0070665_1002299132 292
727 3300005548 Ga0070665_100260502 Ga0070665_1002605022 292
728 3300005548 Ga0070665_100742754 Ga0070665_1007427541 292
729 3300005549 Ga0070704_100009296 Ga0070704_1000092963 292
730 3300005549 Ga0070704_100100285 Ga0070704_1001002852 292
731 3300005563 Ga0068855_100055244 Ga0068855_1000552444 292
732 3300005563 Ga0068855_100111871 Ga0068855_1001118712 292
733 3300005563 Ga0068855_100131923 Ga0068855_1001319233 292
734 3300005563 Ga0068855_100205696 Ga0068855_1002056962 292
735 3300005563 Ga0068855_100267708 Ga0068855_1002677082 292
736 3300005563 Ga0068855_100304463 Ga0068855_1003044632 292
737 3300005564 Ga0070664_100020910 Ga0070664_1000209102 292
738 3300005564 Ga0070664_100038658 Ga0070664_1000386582 292
739 3300005564 Ga0070664_100050840 Ga0070664_1000508405 292
740 3300005564 Ga0070664_100150501 Ga0070664_1001505013 292
741 3300005564 Ga0070664_100662440 Ga0070664_1006624401 292
742 3300005577 Ga0068857_100001072 Ga0068857_10000107215 292
743 3300005577 Ga0068857_100161399 Ga0068857_1001613993 292
744 3300005578 Ga0068854_100000794 Ga0068854_10000079419 292
745 3300005578 Ga0068854_100318226 Ga0068854_1003182262 292
746 3300005614 Ga0068856_100006877 Ga0068856_10000687714 292
747 3300005614 Ga0068856_100273432 Ga0068856_1002734322 292
748 3300005614 Ga0068856_100416284 Ga0068856_1004162842 292
749 3300005615 Ga0070702_100038337 Ga0070702_1000383372 292
750 3300005615 Ga0070702_100213865 Ga0070702_1002138652 292
751 3300005616 Ga0068852_100000713 Ga0068852_10000071316 292
752 3300005616 Ga0068852_100086835 Ga0068852_1000868352 292
753 3300005617 Ga0068859_100001523 Ga0068859_10000152315 292
754 3300005617 Ga0068859_100054307 Ga0068859_1000543074 292
755 3300005617 Ga0068859_100069759 Ga0068859_1000697593 292
756 3300005617 Ga0068859_100082804 Ga0068859_1000828045 292
757 3300005617 Ga0068859_100145521 Ga0068859_1001455212 292
758 3300005618 Ga0068864_100000715 Ga0068864_10000071513 292
759 3300005618 Ga0068864_100054297 Ga0068864_1000542975 292
760 3300005618 Ga0068864_100159548 Ga0068864_1001595481 292
761 3300005718 Ga0068866_10000861 Ga0068866_1000086112 292
762 3300005718 Ga0068866_10008505 Ga0068866_100085057 292
763 3300005718 Ga0068866_10046359 Ga0068866_100463593 292
764 3300005719 Ga0068861_100000574 Ga0068861_10000057412 292
765 3300005719 Ga0068861_100191918 Ga0068861_1001919182 292
766 3300005840 Ga0068870_10000009 Ga0068870_100000096 292
767 3300005841 Ga0068863_100001272 Ga0068863_10000127220 292
768 3300005841 Ga0068863_100013621 Ga0068863_1000136216 292
769 3300005841 Ga0068863_100099993 Ga0068863_1000999932 292
770 3300005841 Ga0068863_100142437 Ga0068863_1001424372 292
771 3300005842 Ga0068858_100008506 Ga0068858_1000085063 292
772 3300005842 Ga0068858_100053433 Ga0068858_1000534333 292
773 3300005842 Ga0068858_100062407 Ga0068858_1000624074 292
774 3300005843 Ga0068860_100001758 Ga0068860_1000017587 292
775 3300005843 Ga0068860_100089794 Ga0068860_1000897942 292
776 3300005843 Ga0068860_100183724 Ga0068860_1001837241 292
777 3300005844 Ga0068862_100012556 Ga0068862_1000125563 292
778 3300005937 Ga0081455_10000002 Ga0081455_10000002399 292
779 3300005937 Ga0081455_10016728 Ga0081455_100167284 292
780 3300005937 Ga0081455_10328335 Ga0081455_103283351 292
781 3300005981 Ga0081538_10022500 Ga0081538_100225003 292
782 3300005983 Ga0081540_1000315 Ga0081540_100031526 292
783 3300005985 Ga0081539_10010883 Ga0081539_100108834 292
784 3300006028 Ga0070717_10001112 Ga0070717_1000111211 292
785 3300006028 Ga0070717_10019559 Ga0070717_100195593 292
786 3300006038 Ga0075365_10077587 Ga0075365_100775872 292
787 3300006042 Ga0075368_10097878 Ga0075368_100978781 292
788 3300006048 Ga0075363_100043794 Ga0075363_1000437942 292
789 3300006048 Ga0075363_100104572 Ga0075363_1001045723 292
790 3300006048 Ga0075363_100257885 Ga0075363_1002578851 292
791 3300006051 Ga0075364_10010261 Ga0075364_100102612 292
792 3300006051 Ga0075364_10023768 Ga0075364_100237685 292
793 3300006051 Ga0075364_10065414 Ga0075364_100654143 292
794 3300006058 Ga0075432_10042421 Ga0075432_100424212 292
795 3300006173 Ga0070716_100044143 Ga0070716_1000441434 292
796 3300006175 Ga0070712_100050955 Ga0070712_1000509553 292
797 3300006175 Ga0070712_100329441 Ga0070712_1003294412 292
798 3300006177 Ga0075362_10000822 Ga0075362_100008225 292
799 3300006177 Ga0075362_10142203 Ga0075362_101422032 292
800 3300006178 Ga0075367_10027428 Ga0075367_100274284 292
801 3300006178 Ga0075367_10131897 Ga0075367_101318972 292
802 3300006195 Ga0075366_10001911 Ga0075366_1000191117 292
803 3300006195 Ga0075366_10006442 Ga0075366_100064422 292
804 3300006237 Ga0097621_100001018 Ga0097621_1000010188 292
805 3300006237 Ga0097621_100066291 Ga0097621_1000662911 292
806 3300006237 Ga0097621_100072805 Ga0097621_1000728051 292
807 3300006353 Ga0075370_10014466 Ga0075370_100144667 292
808 3300006353 Ga0075370_10071682 Ga0075370_100716822 292
809 3300006358 Ga0068871_100000012 Ga0068871_10000001231 292
810 3300006358 Ga0068871_100027675 Ga0068871_1000276753 292
811 3300006358 Ga0068871_100057342 Ga0068871_1000573423 292
812 3300006844 Ga0075428_100001200 Ga0075428_1000012005 292
813 3300006844 Ga0075428_100186579 Ga0075428_1001865792 292
814 3300006844 Ga0075428_100604667 Ga0075428_1006046671 292
815 3300006846 Ga0075430_100000032 Ga0075430_10000003248 292
816 3300006846 Ga0075430_100139668 Ga0075430_1001396683 292
817 3300006847 Ga0075431_100009024 Ga0075431_1000090243 292
818 3300006852 Ga0075433_10000072 Ga0075433_100000726 292
819 3300006852 Ga0075433_10005026 Ga0075433_100050266 292
820 3300006852 Ga0075433_10018903 Ga0075433_100189033 292
821 3300006852 Ga0075433_10061737 Ga0075433_100617372 292
822 3300006871 Ga0075434_100000341 Ga0075434_10000034121 292
823 3300006871 Ga0075434_100001937 Ga0075434_1000019376 292
824 3300006871 Ga0075434_100018020 Ga0075434_1000180205 292
825 3300006871 Ga0075434_100197526 Ga0075434_1001975262 292
826 3300006880 Ga0075429_100000631 Ga0075429_10000063124 292
827 3300006881 Ga0068865_100000328 Ga0068865_10000032820 292
828 3300006881 Ga0068865_100169816 Ga0068865_1001698162 292
829 3300006914 Ga0075436_100081950 Ga0075436_1000819501 292
830 3300006931 Ga0097620_100001523 Ga0097620_10000152315 292
831 3300006931 Ga0097620_100054305 Ga0097620_1000543054 292
832 3300006931 Ga0097620_100069758 Ga0097620_1000697583 292
833 3300006931 Ga0097620_100082799 Ga0097620_1000827992 292
834 3300006931 Ga0097620_100145522 Ga0097620_1001455222 292
835 3300007076 Ga0075435_100031353 Ga0075435_1000313534 292
836 3300007076 Ga0075435_100061717 Ga0075435_1000617173 292
837 3300007076 Ga0075435_100251199 Ga0075435_1002511992 292
838 3300009011 Ga0105251_10029935 Ga0105251_100299352 292
839 3300009093 Ga0105240_10099394 Ga0105240_100993942 292
840 3300009093 Ga0105240_10221581 Ga0105240_102215812 292
841 3300009093 Ga0105240_10272352 Ga0105240_102723521 292
842 3300009093 Ga0105240_10360082 Ga0105240_103600822 292
843 3300009094 Ga0111539_10000915 Ga0111539_1000091534 292
844 3300009094 Ga0111539_10001908 Ga0111539_1000190829 292
845 3300009094 Ga0111539_10002936 Ga0111539_1000293614 292
846 3300009094 Ga0111539_10070815 Ga0111539_100708152 292
847 3300009094 Ga0111539_10082296 Ga0111539_100822963 292
848 3300009094 Ga0111539_10820795 Ga0111539_108207951 292
849 3300009098 Ga0105245_10001404 Ga0105245_1000140411 292
850 3300009098 Ga0105245_10032714 Ga0105245_100327143 292
851 3300009098 Ga0105245_10404154 Ga0105245_104041541 292
852 3300009101 Ga0105247_10000881 Ga0105247_100008819 292
853 3300009101 Ga0105247_10028905 Ga0105247_100289053 292
854 3300009101 Ga0105247_10052704 Ga0105247_100527042 292
855 3300009147 Ga0114129_10001035 Ga0114129_1000103514 292
856 3300009147 Ga0114129_10001551 Ga0114129_1000155129 292
857 3300009148 Ga0105243_10001028 Ga0105243_1000102818 292
858 3300009148 Ga0105243_10057738 Ga0105243_100577382 292
859 3300009148 Ga0105243_10230806 Ga0105243_102308062 292
860 3300009174 Ga0105241_10002719 Ga0105241_100027194 292
861 3300009176 Ga0105242_10000607 Ga0105242_1000060718 292
862 3300009176 Ga0105242_10014532 Ga0105242_100145326 292
863 3300009176 Ga0105242_10037770 Ga0105242_100377704 292
864 3300009177 Ga0105248_10000309 Ga0105248_1000030917 292
865 3300009177 Ga0105248_10011832 Ga0105248_1001183211 292
866 3300009177 Ga0105248_10054667 Ga0105248_100546674 292
867 3300009177 Ga0105248_10092991 Ga0105248_100929912 292
868 3300009177 Ga0105248_10262071 Ga0105248_102620712 292
869 3300009177 Ga0105248_10574620 Ga0105248_105746202 292
870 3300009545 Ga0105237_10044704 Ga0105237_100447043 292
871 3300009551 Ga0105238_10047188 Ga0105238_100471884 292
872 3300009551 Ga0105238_10070269 Ga0105238_100702693 292
873 3300009551 Ga0105238_10256270 Ga0105238_102562702 292
874 3300009551 Ga0105238_10681190 Ga0105238_106811901 292
875 3300009553 Ga0105249_10000486 Ga0105249_1000048633 292
876 3300009553 Ga0105249_10025434 Ga0105249_100254344 292
877 3300009553 Ga0105249_10150182 Ga0105249_101501823 292
878 3300010375 Ga0105239_10006677 Ga0105239_1000667710 292
879 3300010375 Ga0105239_10044405 Ga0105239_100444052 292
880 3300010375 Ga0105239_10608082 Ga0105239_106080822 292
881 3300010375 Ga0105239_10718658 Ga0105239_107186581 292
882 3300011119 Ga0105246_10000696 Ga0105246_1000069614 292
883 3300011119 Ga0105246_10028766 Ga0105246_100287663 292
884 3300011119 Ga0105246_10069057 Ga0105246_100690572 292
885 3300011119 Ga0105246_10078191 Ga0105246_100781913 292
886 3300011119 Ga0105246_10271685 Ga0105246_102716852 292
887 3300012492 Ga0157335_1000803 Ga0157335_10008032 292
888 3300013100 Ga0157373_10022136 Ga0157373_100221361 292
889 3300013100 Ga0157373_10123940 Ga0157373_101239402 292
890 3300013100 Ga0157373_10164895 Ga0157373_101648952 292
891 3300013102 Ga0157371_10006574 Ga0157371_100065746 292
892 3300013104 Ga0157370_10171597 Ga0157370_101715972 292
893 3300013104 Ga0157370_10221246 Ga0157370_102212462 292
894 3300013105 Ga0157369_10070663 Ga0157369_100706633 292
895 3300013296 Ga0157374_10001864 Ga0157374_1000186414 292
896 3300013296 Ga0157374_10062732 Ga0157374_100627323 292
897 3300013296 Ga0157374_10117339 Ga0157374_101173392 292
898 3300013297 Ga0157378_10006042 Ga0157378_1000604213 292
899 3300013297 Ga0157378_10013393 Ga0157378_100133937 292
900 3300013297 Ga0157378_10089040 Ga0157378_100890403 292
901 3300013297 Ga0157378_10404076 Ga0157378_104040761 292
902 3300013306 Ga0163162_10000992 Ga0163162_1000099219 292
903 3300013306 Ga0163162_10043846 Ga0163162_100438464 292
904 3300013306 Ga0163162_10068960 Ga0163162_100689602 292
905 3300013307 Ga0157372_10021474 Ga0157372_100214742 292
906 3300013307 Ga0157372_10458241 Ga0157372_104582412 292
907 3300013307 Ga0157372_10632191 Ga0157372_106321912 292
908 3300013308 Ga0157375_10002320 Ga0157375_1000232011 292
909 3300013308 Ga0157375_10055552 Ga0157375_100555522 292
910 3300013308 Ga0157375_10063691 Ga0157375_100636913 292
911 3300013308 Ga0157375_10159046 Ga0157375_101590462 292
912 3300014325 Ga0163163_10000824 Ga0163163_1000082432 292
913 3300014325 Ga0163163_10025580 Ga0163163_100255803 292
914 3300014325 Ga0163163_10079548 Ga0163163_100795483 292
915 3300014325 Ga0163163_10293711 Ga0163163_102937112 292
916 3300014326 Ga0157380_10000711 Ga0157380_1000071110 292
917 3300014326 Ga0157380_10130679 Ga0157380_101306791 292
918 3300014497 Ga0182008_10061091 Ga0182008_100610912 292
919 3300014745 Ga0157377_10000336 Ga0157377_1000033611 292
920 3300014745 Ga0157377_10175723 Ga0157377_101757232 292
921 3300014968 Ga0157379_10000678 Ga0157379_1000067823 292
922 3300014968 Ga0157379_10002722 Ga0157379_100027226 292
923 3300014968 Ga0157379_10026862 Ga0157379_100268624 292
924 3300014968 Ga0157379_10043686 Ga0157379_100436865 292
925 3300014968 Ga0157379_10142800 Ga0157379_101428002 292
926 3300014969 Ga0157376_10019841 Ga0157376_100198415 292
927 3300014969 Ga0157376_10087282 Ga0157376_100872822 292
928 3300017792 Ga0163161_10000534 Ga0163161_1000053415 292
929 3300017792 Ga0163161_10039860 Ga0163161_100398602 292
930 3300021388 Ga0213875_10000036 Ga0213875_10000036149 292
931 3300025271 Ga0207666_1000177 Ga0207666_100017714 292
932 3300025271 Ga0207666_1001810 Ga0207666_10018102 292
933 3300025297 Ga0209758_1000469 Ga0209758_100046963 292
934 3300025297 Ga0209758_1039044 Ga0209758_10390442 292
935 3300025315 Ga0207697_10000374 Ga0207697_1000037414 292
936 3300025315 Ga0207697_10008005 Ga0207697_100080054 292
937 3300025885 Ga0207653_10012113 Ga0207653_100121132 292
938 3300025893 Ga0207682_10000011 Ga0207682_1000001168 292
939 3300025898 Ga0207692_10052034 Ga0207692_100520343 292
940 3300025898 Ga0207692_10064081 Ga0207692_100640812 292
941 3300025899 Ga0207642_10014960 Ga0207642_100149604 292
942 3300025900 Ga0207710_10000805 Ga0207710_1000080513 292
943 3300025900 Ga0207710_10009874 Ga0207710_100098743 292
944 3300025900 Ga0207710_10010652 Ga0207710_100106522 292
945 3300025901 Ga0207688_10000020 Ga0207688_1000002047 292
946 3300025901 Ga0207688_10017255 Ga0207688_100172552 292
947 3300025903 Ga0207680_10002333 Ga0207680_100023335 292
948 3300025903 Ga0207680_10099046 Ga0207680_100990461 292
949 3300025904 Ga0207647_10002391 Ga0207647_100023916 292
950 3300025904 Ga0207647_10021814 Ga0207647_100218143 292
951 3300025906 Ga0207699_10034519 Ga0207699_100345192 292
952 3300025907 Ga0207645_10000108 Ga0207645_100001086 292
953 3300025907 Ga0207645_10039054 Ga0207645_100390542 292
954 3300025907 Ga0207645_10055277 Ga0207645_100552771 292
955 3300025907 Ga0207645_10231683 Ga0207645_102316832 292
956 3300025908 Ga0207643_10000685 Ga0207643_1000068521 292
957 3300025909 Ga0207705_10026788 Ga0207705_100267882 292
958 3300025909 Ga0207705_10067910 Ga0207705_100679102 292
959 3300025911 Ga0207654_10000818 Ga0207654_1000081811 292
960 3300025912 Ga0207707_10000689 Ga0207707_1000068917 292
961 3300025912 Ga0207707_10023475 Ga0207707_100234754 292
962 3300025912 Ga0207707_10088365 Ga0207707_100883652 292
963 3300025912 Ga0207707_10194073 Ga0207707_101940732 292
964 3300025913 Ga0207695_10160418 Ga0207695_101604181 292
965 3300025914 Ga0207671_10024759 Ga0207671_100247596 292
966 3300025914 Ga0207671_10065984 Ga0207671_100659843 292
967 3300025915 Ga0207693_10006663 Ga0207693_100066633 292
968 3300025915 Ga0207693_10055219 Ga0207693_100552193 292
969 3300025915 Ga0207693_10357480 Ga0207693_103574801 292
970 3300025916 Ga0207663_10098314 Ga0207663_100983141 292
971 3300025916 Ga0207663_10131692 Ga0207663_101316922 292
972 3300025917 Ga0207660_10000442 Ga0207660_1000044217 292
973 3300025917 Ga0207660_10016403 Ga0207660_100164033 292
974 3300025917 Ga0207660_10051713 Ga0207660_100517132 292
975 3300025917 Ga0207660_10053393 Ga0207660_100533932 292
976 3300025917 Ga0207660_10212301 Ga0207660_102123012 292
977 3300025917 Ga0207660_10219231 Ga0207660_102192312 292
978 3300025918 Ga0207662_10000249 Ga0207662_1000024916 292
979 3300025918 Ga0207662_10008544 Ga0207662_1000854411 292
980 3300025918 Ga0207662_10042261 Ga0207662_100422612 292
981 3300025919 Ga0207657_10002726 Ga0207657_100027266 292
982 3300025919 Ga0207657_10005961 Ga0207657_1000596110 292
983 3300025919 Ga0207657_10012139 Ga0207657_100121392 292
984 3300025919 Ga0207657_10068686 Ga0207657_100686862 292
985 3300025919 Ga0207657_10103443 Ga0207657_101034432 292
986 3300025920 Ga0207649_10000057 Ga0207649_1000005778 292
987 3300025920 Ga0207649_10046622 Ga0207649_100466224 292
988 3300025921 Ga0207652_10005483 Ga0207652_100054839 292
989 3300025921 Ga0207652_10008473 Ga0207652_100084734 292
990 3300025921 Ga0207652_10053598 Ga0207652_100535982 292
991 3300025921 Ga0207652_10087914 Ga0207652_100879143 292
992 3300025921 Ga0207652_10097400 Ga0207652_100974002 292
993 3300025921 Ga0207652_10106353 Ga0207652_101063532 292
994 3300025921 Ga0207652_10467563 Ga0207652_104675632 292
995 3300025923 Ga0207681_10000181 Ga0207681_1000018138 292
996 3300025924 Ga0207694_10046766 Ga0207694_100467662 292
997 3300025924 Ga0207694_10256174 Ga0207694_102561742 292
998 3300025925 Ga0207650_10001609 Ga0207650_1000160920 292
999 3300025925 Ga0207650_10229813 Ga0207650_102298132 292
1000 3300025925 Ga0207650_10317613 Ga0207650_103176131 292
1001 3300025926 Ga0207659_10000028 Ga0207659_1000002856 292
1002 3300025926 Ga0207659_10446023 Ga0207659_104460231 292
1003 3300025927 Ga0207687_10000061 Ga0207687_1000006150 292
1004 3300025927 Ga0207687_10116271 Ga0207687_101162712 292
1005 3300025927 Ga0207687_10130962 Ga0207687_101309622 292
1006 3300025928 Ga0207700_10056101 Ga0207700_100561012 292
1007 3300025928 Ga0207700_10389075 Ga0207700_103890751 292
1008 3300025929 Ga0207664_10041548 Ga0207664_100415484 292
1009 3300025929 Ga0207664_10064704 Ga0207664_100647043 292
1010 3300025929 Ga0207664_10150667 Ga0207664_101506672 292
1011 3300025929 Ga0207664_10398235 Ga0207664_103982352 292
1012 3300025929 Ga0207664_10460966 Ga0207664_104609661 292
1013 3300025931 Ga0207644_10000315 Ga0207644_1000031521 292
1014 3300025931 Ga0207644_10004323 Ga0207644_100043232 292
1015 3300025931 Ga0207644_10138885 Ga0207644_101388852 292
1016 3300025931 Ga0207644_10158306 Ga0207644_101583062 292
1017 3300025932 Ga0207690_10000445 Ga0207690_1000044519 292
1018 3300025932 Ga0207690_10377307 Ga0207690_103773072 292
1019 3300025933 Ga0207706_10002206 Ga0207706_1000220612 292
1020 3300025933 Ga0207706_10020104 Ga0207706_100201043 292
1021 3300025933 Ga0207706_10024556 Ga0207706_100245564 292
1022 3300025933 Ga0207706_10196840 Ga0207706_101968402 292
1023 3300025934 Ga0207686_10005349 Ga0207686_100053497 292
1024 3300025934 Ga0207686_10219377 Ga0207686_102193771 292
1025 3300025935 Ga0207709_10000539 Ga0207709_1000053937 292
1026 3300025935 Ga0207709_10009571 Ga0207709_100095712 292
1027 3300025935 Ga0207709_10161220 Ga0207709_101612201 292
1028 3300025936 Ga0207670_10000217 Ga0207670_1000021719 292
1029 3300025936 Ga0207670_10001702 Ga0207670_1000170211 292
1030 3300025936 Ga0207670_10288595 Ga0207670_102885952 292
1031 3300025937 Ga0207669_10000147 Ga0207669_1000014728 292
1032 3300025937 Ga0207669_10157528 Ga0207669_101575282 292
1033 3300025937 Ga0207669_10198807 Ga0207669_101988072 292
1034 3300025938 Ga0207704_10000299 Ga0207704_1000029923 292
1035 3300025938 Ga0207704_10009342 Ga0207704_100093424 292
1036 3300025938 Ga0207704_10029713 Ga0207704_100297133 292
1037 3300025938 Ga0207704_10045682 Ga0207704_100456824 292
1038 3300025938 Ga0207704_10245760 Ga0207704_102457601 292
1039 3300025939 Ga0207665_10003176 Ga0207665_100031766 292
1040 3300025939 Ga0207665_10477320 Ga0207665_104773201 292
1041 3300025940 Ga0207691_10002033 Ga0207691_100020336 292
1042 3300025940 Ga0207691_10022424 Ga0207691_100224248 292
1043 3300025940 Ga0207691_10046867 Ga0207691_100468671 292
1044 3300025941 Ga0207711_10020025 Ga0207711_100200256 292
1045 3300025941 Ga0207711_10021540 Ga0207711_100215406 292
1046 3300025941 Ga0207711_10063266 Ga0207711_100632663 292
1047 3300025941 Ga0207711_10475288 Ga0207711_104752881 292
1048 3300025942 Ga0207689_10001029 Ga0207689_1000102916 292
1049 3300025942 Ga0207689_10259596 Ga0207689_102595961 292
1050 3300025944 Ga0207661_10000215 Ga0207661_1000021538 292
1051 3300025944 Ga0207661_10086764 Ga0207661_100867642 292
1052 3300025944 Ga0207661_10142306 Ga0207661_101423061 292
1053 3300025944 Ga0207661_10417547 Ga0207661_104175472 292
1054 3300025944 Ga0207661_10568626 Ga0207661_105686261 292
1055 3300025945 Ga0207679_10000026 Ga0207679_10000026146 292
1056 3300025945 Ga0207679_10094405 Ga0207679_100944051 292
1057 3300025949 Ga0207667_10071293 Ga0207667_100712933 292
1058 3300025949 Ga0207667_10235382 Ga0207667_102353822 292
1059 3300025960 Ga0207651_10000342 Ga0207651_100003426 292
1060 3300025960 Ga0207651_10018758 Ga0207651_100187583 292
1061 3300025960 Ga0207651_10196427 Ga0207651_101964272 292
1062 3300025961 Ga0207712_10000686 Ga0207712_1000068619 292
1063 3300025961 Ga0207712_10252179 Ga0207712_102521791 292
1064 3300025972 Ga0207668_10000242 Ga0207668_1000024218 292
1065 3300025972 Ga0207668_10170737 Ga0207668_101707371 292
1066 3300025972 Ga0207668_10239032 Ga0207668_102390322 292
1067 3300025972 Ga0207668_10255285 Ga0207668_102552852 292
1068 3300025981 Ga0207640_10000833 Ga0207640_1000083318 292
1069 3300025986 Ga0207658_10036817 Ga0207658_100368171 292
1070 3300025986 Ga0207658_10068883 Ga0207658_100688832 292
1071 3300025986 Ga0207658_10104023 Ga0207658_101040232 292
1072 3300025986 Ga0207658_10235644 Ga0207658_102356442 292
1073 3300025986 Ga0207658_10243072 Ga0207658_102430721 292
1074 3300026023 Ga0207677_10066237 Ga0207677_100662374 292
1075 3300026035 Ga0207703_10004423 Ga0207703_100044234 292
1076 3300026035 Ga0207703_10022281 Ga0207703_100222817 292
1077 3300026035 Ga0207703_10052613 Ga0207703_100526132 292
1078 3300026041 Ga0207639_10061852 Ga0207639_100618522 292
1079 3300026041 Ga0207639_10309162 Ga0207639_103091622 292
1080 3300026067 Ga0207678_10001079 Ga0207678_1000107918 292
1081 3300026067 Ga0207678_10024480 Ga0207678_100244804 292
1082 3300026067 Ga0207678_10100420 Ga0207678_101004202 292
1083 3300026067 Ga0207678_10145554 Ga0207678_101455542 292
1084 3300026075 Ga0207708_10000805 Ga0207708_1000080518 292
1085 3300026075 Ga0207708_10020125 Ga0207708_100201254 292
1086 3300026078 Ga0207702_10002121 Ga0207702_1000212113 292
1087 3300026078 Ga0207702_10183561 Ga0207702_101835612 292
1088 3300026078 Ga0207702_10376173 Ga0207702_103761732 292
1089 3300026088 Ga0207641_10005860 Ga0207641_1000586014 292
1090 3300026088 Ga0207641_10175789 Ga0207641_101757892 292
1091 3300026088 Ga0207641_10225659 Ga0207641_102256592 292
1092 3300026089 Ga0207648_10000731 Ga0207648_1000073114 292
1093 3300026089 Ga0207648_10041487 Ga0207648_100414873 292
1094 3300026089 Ga0207648_10052588 Ga0207648_100525886 292
1095 3300026095 Ga0207676_10000361 Ga0207676_1000036127 292
1096 3300026095 Ga0207676_10004164 Ga0207676_1000416411 292
1097 3300026095 Ga0207676_10005133 Ga0207676_100051336 292
1098 3300026116 Ga0207674_10002121 Ga0207674_1000212114 292
1099 3300026116 Ga0207674_10254153 Ga0207674_102541532 292
1100 3300026118 Ga0207675_100001489 Ga0207675_10000148918 292
1101 3300026118 Ga0207675_100322011 Ga0207675_1003220112 292
1102 3300026118 Ga0207675_100370336 Ga0207675_1003703362 292
1103 3300026121 Ga0207683_10000034 Ga0207683_1000003453 292
1104 3300026121 Ga0207683_10006107 Ga0207683_1000610714 292
1105 3300026121 Ga0207683_10139000 Ga0207683_101390002 292
1106 3300026121 Ga0207683_10239543 Ga0207683_102395431 292
1107 3300026142 Ga0207698_10000304 Ga0207698_1000030410 292
1108 3300026142 Ga0207698_10117313 Ga0207698_101173133 292
1109 3300026142 Ga0207698_10285768 Ga0207698_102857682 292
1110 3300027695 Ga0209966_1003327 Ga0209966_10033273 292
1111 3300027876 Ga0209974_10004638 Ga0209974_100046383 292
1112 3300027876 Ga0209974_10013408 Ga0209974_100134083 292
1113 3300027907 Ga0207428_10000082 Ga0207428_10000082102 292
1114 3300027907 Ga0207428_10000352 Ga0207428_1000035238 292
1115 3300027907 Ga0207428_10001078 Ga0207428_1000107812 292
1116 3300028379 Ga0268266_10021877 Ga0268266_100218774 292
1117 3300028379 Ga0268266_10165456 Ga0268266_101654561 292
1118 3300028379 Ga0268266_10378526 Ga0268266_103785262 292
1119 3300028380 Ga0268265_10001338 Ga0268265_1000133818 292
1120 3300028380 Ga0268265_10020285 Ga0268265_100202854 292
1121 3300028380 Ga0268265_10431767 Ga0268265_104317672 292
1122 3300028380 Ga0268265_10545916 Ga0268265_105459162 292
1123 3300028381 Ga0268264_10002557 Ga0268264_100025575 292
1124 3300028381 Ga0268264_10052830 Ga0268264_100528303 292
1125 3300028381 Ga0268264_10171882 Ga0268264_101718822 292
1126 3300028800 Ga0265338_10281651 Ga0265338_102816512 292
1127 3300031235 Ga0265330_10029201 Ga0265330_100292012 292
1128 3300031241 Ga0265325_10000141 Ga0265325_1000014137 292
1129 3300031241 Ga0265325_10008050 Ga0265325_100080505 292
1130 3300031247 Ga0265340_10013101 Ga0265340_100131015 292
1131 3300031249 Ga0265339_10017617 Ga0265339_100176174 292
1132 3300031456 Ga0307513_10079026 Ga0307513_100790262 292
1133 3300031595 Ga0265313_10011824 Ga0265313_100118245 292
1134 3300031595 Ga0265313_10075758 Ga0265313_100757583 292
1135 3300031711 Ga0265314_10003712 Ga0265314_100037123 292
1136 3300031711 Ga0265314_10019730 Ga0265314_100197302 292
1137 3300031712 Ga0265342_10000149 Ga0265342_1000014954 292
1138 3300031712 Ga0265342_10039073 Ga0265342_100390732 292
1139 3300031911 Ga0307412_10434065 Ga0307412_104340651 292
1140 3300031995 Ga0307409_100262777 Ga0307409_1002627772 292
1141 3300032005 Ga0307411_10084642 Ga0307411_100846422 292
1142 3300034816 Ga0373930_0000071 Ga0373930_0000071_1343_2221 292
1143 3300034816 Ga0373930_0012311 Ga0373930_0012311_86_964 292
1144 3300034817 Ga0373948_0000973 Ga0373948_0000973_627_1505 292
1145 3300034818 Ga0373950_0000552 Ga0373950_0000552_921_1799 292
1146 3300034819 Ga0373958_0000121 Ga0373958_0000121_826_1704 292
1147 3300034819 Ga0373958_0006748 Ga0373958_0006748_462_1340 292
1148 3300034820 Ga0373959_0000829 Ga0373959_0000829_825_1703 292
1149 3300034820 Ga0373959_0005700 Ga0373959_0005700_970_1848 292
1150 3300034957 Ga0373938_0000045 Ga0373938_0000045_10217_11095 292
1151 3300034957 Ga0373938_0000596 Ga0373938_0000596_1775_2653 292
1152 3300035084 Ga0373928_0003774 Ga0373928_0003774_1353_2231 292
1153 3300035085 Ga0373929_0002006 Ga0373929_0002006_1056_1934 292
1154 3300035088 Ga0373940_0003018 Ga0373940_0003018_2180_3058 292
1155 3300035090 Ga0373949_0002498 Ga0373949_0002498_698_1576 292
1156 3300035090 Ga0373949_0005152 Ga0373949_0005152_1377_2255 292
1157 3300035090 Ga0373949_0006059 Ga0373949_0006059_762_1640 292
1158 3300035091 Ga0373951_0000695 Ga0373951_0000695_3786_4664 292
1159 3300035091 Ga0373951_0001161 Ga0373951_0001161_2498_3376 292
1160 3300035091 Ga0373951_0001863 Ga0373951_0001863_298_1176 292
1161 3300035092 Ga0373952_0000221 Ga0373952_0000221_6247_7125 292
1162 3300035092 Ga0373952_0004057 Ga0373952_0004057_1045_1923 292
1163 3300035111 Ga0373923_0005448 Ga0373923_0005448_994_1872 292
1164 3300035112 Ga0373932_0001446 Ga0373932_0001446_661_1539 292
1165 3300035112 Ga0373932_0002183 Ga0373932_0002183_1619_2497 292
1166 3300035112 Ga0373932_0003396 Ga0373932_0003396_472_1350 292
1167 3300035113 Ga0373936_0025479 Ga0373936_0025479_1281_2159 292
1168 3300035114 Ga0373939_0000875 Ga0373939_0000875_996_1874 292
1169 3300035114 Ga0373939_0016634 Ga0373939_0016634_492_1370 292
1170 3300035115 Ga0373941_0001970 Ga0373941_0001970_1574_2452 292
1171 3300035115 Ga0373941_0039828 Ga0373941_0039828_48_926 292
1172 3300035116 Ga0373945_0000864 Ga0373945_0000864_5167_6045 292
1173 3300035116 Ga0373945_0062734 Ga0373945_0062734_106_984 292
1174 3300035117 Ga0373953_0002911 Ga0373953_0002911_676_1554 292
1175 3300035117 Ga0373953_0004191 Ga0373953_0004191_3592_4470 292
1176 3300035118 Ga0373954_0008274 Ga0373954_0008274_882_1760 292
1177 3300035118 Ga0373954_0010833 Ga0373954_0010833_2292_3170 292
1178 3300035119 Ga0373956_0022522 Ga0373956_0022522_1122_2000 292
1179 3300035119 Ga0373956_0139478 Ga0373956_0139478_136_1014 292
1180 3300035120 Ga0373957_0029774 Ga0373957_0029774_712_1590 292
1181 3300035121 Ga0373960_0000083 Ga0373960_0000083_5594_6472 292
1182 3300035121 Ga0373960_0000603 Ga0373960_0000603_3113_3991 292
1183 3300035170 Ga0373943_0002515 Ga0373943_0002515_147_1025 292
1184 3300035170 Ga0373943_0005818 Ga0373943_0005818_808_1686 292
1185 3300035170 Ga0373943_0048885 Ga0373943_0048885_969_1847 292
1186 3300035171 Ga0373946_0019286 Ga0373946_0019286_1582_2460 292
1187 3300035171 Ga0373946_0035678 Ga0373946_0035678_14_892 292
1188 3300035172 Ga0373955_0000946 Ga0373955_0000946_4240_5118 292
1189 3300035172 Ga0373955_0002872 Ga0373955_0002872_2005_2883 292
1190 3300035172 Ga0373955_0059881 Ga0373955_0059881_1205_2083 292
1191 3300035207 Ga0373942_0000535 Ga0373942_0000535_894_1772 292
1192 3300035207 Ga0373942_0010093 Ga0373942_0010093_843_1721 292
1193 3300035207 Ga0373942_0021137 Ga0373942_0021137_674_1555 292
1194 3300035207 Ga0373942_0053975 Ga0373942_0053975_43_921 292
1195 3300035241 Ga0373961_0000559 Ga0373961_0000559_10610_11488 292
1196 3300035241 Ga0373961_0003591 Ga0373961_0003591_214_1092 292
1197 3300035241 Ga0373961_0003814 Ga0373961_0003814_536_1414 292
1198 3300035242 Ga0373962_0000468 Ga0373962_0000468_6852_7730 292
1199 3300035242 Ga0373962_0001431 Ga0373962_0001431_470_1348 292
1200 3300035242 Ga0373962_0024476 Ga0373962_0024476_602_1480 292
1201 3300035410 Ga0373924_0009408 Ga0373924_0009408_1758_2636 292
1202 3300035410 Ga0373924_0047956 Ga0373924_0047956_740_1618 292
1203 3300035691 Ga0373931_0000179 Ga0373931_0000179_7786_8664 292
1204 3300035691 Ga0373931_0003177 Ga0373931_0003177_3999_4877 292
1205 3300035691 Ga0373931_0004682 Ga0373931_0004682_50_928 292
1206 3300035692 Ga0373935_0011857 Ga0373935_0011857_675_1553 292
1207 3300035692 Ga0373935_0038533 Ga0373935_0038533_1142_2020 292
1208 3300035692 Ga0373935_0056911 Ga0373935_0056911_577_1455 292
1209 3300035695 Ga0373927_0024375 Ga0373927_0024375_2139_3017 292
1210 3300035695 Ga0373927_0040612 Ga0373927_0040612_785_1675 292
1211 3300035695 Ga0373927_0040730 Ga0373927_0040730_1232_2110 292
1212 3300035695 Ga0373927_0050471 Ga0373927_0050471_1161_2039 292
1213 3300035724 Ga0373933_0016187 Ga0373933_0016187_3100_3978 292
1214 3300035725 Ga0373947_0006073 Ga0373947_0006073_823_1701 292
1215 3300035725 Ga0373947_0018586 Ga0373947_0018586_673_1551 292
1216 3300035725 Ga0373947_0030405 Ga0373947_0030405_520_1398 292
1217 3300036401 Ga0373937_0000879 Ga0373937_0000879_19447_20325 292
1218 3300036401 Ga0373937_0189276 Ga0373937_0189276_897_1775 292
1219 3300037068 Ga0373925_0006666 Ga0373925_0006666_3136_4014 292
1220 3300037068 Ga0373925_0022396 Ga0373925_0022396_226_1104 292
1221 3300037068 Ga0373925_0137223 Ga0373925_0137223_556_1434 292
1222 3300037068 Ga0373925_0211408 Ga0373925_0211408_106_984 292
1223 3300037853 Ga0436364_1103433 Ga0436364_1103433_764_1660 292
1224 3300039447 Ga0436361_0418088 Ga0436361_0418088_144_1025 292
1225 3300041408 Ga0439453_0001316 Ga0439453_0001316_113_1042 292
1226 3300042003 Ga0439443_002112 Ga0439443_002112_782_1756 292
1227 3300042438 Ga0439459_0023277 Ga0439459_0023277_127_1023 292
1228 3300042876 Ga0451577_0017275 Ga0451577_0017275_2430_3308 292
1229 3300044694 Ga0466963_0298246 Ga0466963_0298246_107_985 292
1230 3300044719 Ga0466971_0018122 Ga0466971_0018122_1366_2247 292
1231 3300045051 Ga0451576_0004698 Ga0451576_0004698_13450_14328 292
1232 3300046454 Ga0495592_0002436 Ga0495592_0002436_10228_11106 292
1233 3300046454 Ga0495592_0096460 Ga0495592_0096460_281_1159 292
1234 3300046455 Ga0495603_0061621 Ga0495603_0061621_86_964 292
1235 3300046455 Ga0495603_0071235 Ga0495603_0071235_66_944 292
1236 3300046455 Ga0495603_0090066 Ga0495603_0090066_727_1605 292
1237 3300046459 Ga0495629_0000062 Ga0495629_0000062_9979_10857 292
1238 3300046459 Ga0495629_0041665 Ga0495629_0041665_1098_1976 292
1239 3300046459 Ga0495629_0080870 Ga0495629_0080870_398_1276 292
1240 3300046460 Ga0495638_0015263 Ga0495638_0015263_4124_5005 292
1241 3300046461 Ga0495641_0019496 Ga0495641_0019496_922_1800 292
1242 3300046461 Ga0495641_0080364 Ga0495641_0080364_310_1188 292
1243 3300046461 Ga0495641_0084125 Ga0495641_0084125_529_1407 292
1244 3300046462 Ga0495651_0000910 Ga0495651_0000910_21323_22201 292
1245 3300046462 Ga0495651_0024994 Ga0495651_0024994_1393_2271 292
1246 3300046463 Ga0495653_0007557 Ga0495653_0007557_1529_2407 292
1247 3300046463 Ga0495653_0014042 Ga0495653_0014042_927_1805 292
1248 3300046472 Ga0495580_0132482 Ga0495580_0132482_770_1648 292
1249 3300046473 Ga0495582_0015348 Ga0495582_0015348_2595_3473 292
1250 3300046475 Ga0495639_0002473 Ga0495639_0002473_4318_5196 292
1251 3300046476 Ga0495662_0080819 Ga0495662_0080819_302_1180 292
1252 3300046477 Ga0495664_0006433 Ga0495664_0006433_731_1609 292
1253 3300046477 Ga0495664_0039349 Ga0495664_0039349_898_1776 292
1254 3300046491 Ga0495584_0054271 Ga0495584_0054271_1045_1923 292
1255 3300046492 Ga0495585_0000389 Ga0495585_0000389_6830_7708 292
1256 3300046499 Ga0495594_0012681 Ga0495594_0012681_2265_3143 292
1257 3300046499 Ga0495594_0016941 Ga0495594_0016941_2692_3570 292
1258 3300046511 Ga0495608_0000129 Ga0495608_0000129_3304_4182 292
1259 3300046511 Ga0495608_0009967 Ga0495608_0009967_3216_4094 292
1260 3300046511 Ga0495608_0020973 Ga0495608_0020973_1037_1915 292
1261 3300046514 Ga0495618_0003211 Ga0495618_0003211_2755_3633 292
1262 3300046514 Ga0495618_0017692 Ga0495618_0017692_362_1240 292
1263 3300046516 Ga0495628_0004609 Ga0495628_0004609_11228_12106 292
1264 3300046516 Ga0495628_0018229 Ga0495628_0018229_1638_2516 292
1265 3300046516 Ga0495628_0173995 Ga0495628_0173995_143_1021 292
1266 3300046517 Ga0495630_0097260 Ga0495630_0097260_538_1416 292
1267 3300046517 Ga0495630_0102387 Ga0495630_0102387_197_1075 292
1268 3300046518 Ga0495631_0042051 Ga0495631_0042051_970_1848 292
1269 3300046520 Ga0495637_0026461 Ga0495637_0026461_952_1830 292
1270 3300046523 Ga0495644_0008150 Ga0495644_0008150_1897_2775 292
1271 3300046529 Ga0495652_0020765 Ga0495652_0020765_1638_2516 292
1272 3300046529 Ga0495652_0092131 Ga0495652_0092131_1311_2189 292
1273 3300046531 Ga0495665_0012108 Ga0495665_0012108_2562_3440 292
1274 3300046531 Ga0495665_0098903 Ga0495665_0098903_545_1423 292
1275 3300046533 Ga0495640_0005586 Ga0495640_0005586_1903_2781 292
1276 3300046533 Ga0495640_0039588 Ga0495640_0039588_1116_1994 292
1277 3300046533 Ga0495640_0059593 Ga0495640_0059593_639_1517 292
1278 3300046535 Ga0495586_0001909 Ga0495586_0001909_9398_10276 292
1279 3300046535 Ga0495586_0027483 Ga0495586_0027483_1397_2275 292
1280 3300046536 Ga0495587_0001060 Ga0495587_0001060_14785_15663 292
1281 3300046536 Ga0495587_0002945 Ga0495587_0002945_6895_7773 292
1282 3300046536 Ga0495587_0004785 Ga0495587_0004785_326_1204 292
1283 3300046537 Ga0495598_0000638 Ga0495598_0000638_1672_2550 292
1284 3300046539 Ga0495621_0006729 Ga0495621_0006729_1159_2037 292
1285 3300046543 Ga0495645_0000974 Ga0495645_0000974_7590_8468 292
1286 3300046543 Ga0495645_0008141 Ga0495645_0008141_4626_5504 292
1287 3300046557 Ga0495622_0010569 Ga0495622_0010569_2533_3411 292
1288 3300046558 Ga0495633_0021496 Ga0495633_0021496_1517_2395 292
1289 3300046559 Ga0495667_0007026 Ga0495667_0007026_1808_2686 292
1290 3300046559 Ga0495667_0016191 Ga0495667_0016191_4081_4959 292
1291 3300046559 Ga0495667_0065659 Ga0495667_0065659_686_1564 292
1292 3300046615 Ga0495656_0001231 Ga0495656_0001231_6397_7275 292
1293 3300046642 Ga0495634_0017126 Ga0495634_0017126_228_1106 292
1294 3300046663 Ga0495635_0011298 Ga0495635_0011298_1106_1984 292
1295 3300046663 Ga0495635_0017949 Ga0495635_0017949_962_1840 292
1296 3300046663 Ga0495635_0024646 Ga0495635_0024646_2776_3654 292
1297 3300046663 Ga0495635_0123468 Ga0495635_0123468_65_943 292
1298 3300046664 Ga0495659_0004677 Ga0495659_0004677_2747_3625 292
1299 3300046674 Ga0495588_0083699 Ga0495588_0083699_529_1407 292
1300 3300046675 Ga0495657_0044613 Ga0495657_0044613_1053_1931 292
1301 3300046675 Ga0495657_0064200 Ga0495657_0064200_253_1131 292
1302 3300046678 Ga0495599_0000294 Ga0495599_0000294_26195_27073 292
1303 3300046678 Ga0495599_0002371 Ga0495599_0002371_4335_5213 292
1304 3300046678 Ga0495599_0033590 Ga0495599_0033590_1196_2074 292
1305 3300046679 Ga0495623_0001158 Ga0495623_0001158_14807_15685 292
1306 3300046680 Ga0495646_0010253 Ga0495646_0010253_3304_4182 292
1307 3300046680 Ga0495646_0055026 Ga0495646_0055026_1204_2082 292
1308 3300046680 Ga0495646_0098572 Ga0495646_0098572_72_950 292
1309 3300046683 Ga0495658_0000109 Ga0495658_0000109_2451_3329 292
1310 3300046689 Ga0495613_0035806 Ga0495613_0035806_355_1233 292
1311 3300046690 Ga0495624_0018920 Ga0495624_0018920_3437_4315 292
1312 3300046691 Ga0495670_0000106 Ga0495670_0000106_2949_3827 292
1313 3300046809 Ga0495600_0000977 Ga0495600_0000977_10872_11750 292
1314 3300046809 Ga0495600_0001906 Ga0495600_0001906_529_1407 292
1315 3300046809 Ga0495600_0056840 Ga0495600_0056840_316_1194 292
1316 3300047315 Ga0495581_0155462 Ga0495581_0155462_401_1279 292
1317 3300047317 Ga0495604_0001139 Ga0495604_0001139_10230_11108 292
1318 3300047317 Ga0495604_0007197 Ga0495604_0007197_7786_8664 292
1319 3300047317 Ga0495604_0016220 Ga0495604_0016220_2501_3379 292
1320 3300047319 Ga0495674_0010157 Ga0495674_0010157_3288_4166 292
1321 3300047319 Ga0495674_0160820 Ga0495674_0160820_137_1015 292
1322 3300047319 Ga0495674_0249032 Ga0495674_0249032_568_1446 292
1323 3300047321 Ga0495676_0019809 Ga0495676_0019809_951_1829 292
1324 3300047321 Ga0495676_0057669 Ga0495676_0057669_244_1122 292
1325 3300047322 Ga0495680_0003174 Ga0495680_0003174_4885_5763 292
1326 3300047322 Ga0495680_0039105 Ga0495680_0039105_1751_2629 292
1327 3300047444 Ga0495675_0000190 Ga0495675_0000190_21115_21993 292
1328 3300047446 Ga0495679_022071 Ga0495679_022071_879_1757 292
1329 3300047471 Ga0495684_0012906 Ga0495684_0012906_1049_1927 292
1330 3300047471 Ga0495684_0050907 Ga0495684_0050907_1287_2165 292
1331 3300047673 Ga0495593_0001596 Ga0495593_0001596_409_1287 292
1332 3300047673 Ga0495593_0182912 Ga0495593_0182912_162_1040 292
1333 3300048088 Ga0495602_0013848 Ga0495602_0013848_4932_5810 292
1334 3300048088 Ga0495602_0018144 Ga0495602_0018144_3490_4368 292
1335 3300048089 Ga0495614_0004512 Ga0495614_0004512_1462_2340 292
1336 3300048903 Ga0496100_0001014 Ga0496100_0001014_5286_6164 292
1337 3300048903 Ga0496100_0035966 Ga0496100_0035966_2092_2970 292
1338 3300048903 Ga0496100_0198379 Ga0496100_0198379_31_999 292
1339 3300048904 Ga0496101_0001110 Ga0496101_0001110_1877_2755 292
1340 3300048904 Ga0496101_0010552 Ga0496101_0010552_320_1210 292
1341 3300048904 Ga0496101_0027611 Ga0496101_0027611_2338_3216 292
1342 3300048904 Ga0496101_0071080 Ga0496101_0071080_1398_2276 292
1343 3300048904 Ga0496101_0273320 Ga0496101_0273320_174_1052 292
1344 3300048905 Ga0496102_0008594 Ga0496102_0008594_2004_2882 292
1345 3300048905 Ga0496102_0028624 Ga0496102_0028624_2066_2944 292
1346 3300048905 Ga0496102_0144315 Ga0496102_0144315_1125_2003 292
1347 3300048905 Ga0496102_0631123 Ga0496102_0631123_102_980 292
1348 3300048906 Ga0496103_0000582 Ga0496103_0000582_4924_5802 292
1349 3300048906 Ga0496103_0005721 Ga0496103_0005721_2338_3216 292
1350 3300048906 Ga0496103_0020761 Ga0496103_0020761_248_1138 292
1351 3300048906 Ga0496103_0064663 Ga0496103_0064663_1228_2106 292
1352 3300048907 Ga0496104_0000067 Ga0496104_0000067_100526_101404 292
1353 3300048907 Ga0496104_0035483 Ga0496104_0035483_2410_3288 292
1354 3300048907 Ga0496104_0042135 Ga0496104_0042135_640_1518 292
1355 3300048907 Ga0496104_0048360 Ga0496104_0048360_2859_3749 292
1356 3300048907 Ga0496104_0053787 Ga0496104_0053787_762_1640 292
1357 3300048907 Ga0496104_0058571 Ga0496104_0058571_1320_2198 292
1358 3300048907 Ga0496104_0138383 Ga0496104_0138383_1447_2325 292
1359 3300048908 Ga0496105_0078777 Ga0496105_0078777_256_1134 292
1360 3300048908 Ga0496105_0098348 Ga0496105_0098348_674_1552 292
1361 3300048909 Ga0496106_0002154 Ga0496106_0002154_5280_6158 292
1362 3300048909 Ga0496106_0023714 Ga0496106_0023714_1139_2017 292
1363 3300048909 Ga0496106_0042860 Ga0496106_0042860_1378_2256 292
1364 3300048909 Ga0496106_0086149 Ga0496106_0086149_1335_2213 292
1365 3300048909 Ga0496106_0135524 Ga0496106_0135524_224_1102 292
1366 3300048909 Ga0496106_0166723 Ga0496106_0166723_260_1150 292
1367 3300048910 Ga0496107_0007065 Ga0496107_0007065_3198_4076 292
1368 3300048910 Ga0496107_0010170 Ga0496107_0010170_4450_5328 292
1369 3300048910 Ga0496107_0096601 Ga0496107_0096601_214_1092 292
1370 3300048910 Ga0496107_0158316 Ga0496107_0158316_668_1546 292
1371 3300048911 Ga0496108_0006074 Ga0496108_0006074_4557_5435 292
1372 3300048911 Ga0496108_0091254 Ga0496108_0091254_256_1134 292
1373 3300048911 Ga0496108_0153148 Ga0496108_0153148_362_1240 292
1374 3300048911 Ga0496108_0314201 Ga0496108_0314201_275_1165 292
1375 3300048912 Ga0496109_0000384 Ga0496109_0000384_38014_38892 292
1376 3300048912 Ga0496109_0000736 Ga0496109_0000736_5931_6809 292
1377 3300048912 Ga0496109_0154855 Ga0496109_0154855_1141_2019 292
1378 3300048912 Ga0496109_0205336 Ga0496109_0205336_357_1235 292
1379 3300048913 Ga0496110_0033018 Ga0496110_0033018_2107_2985 292
1380 3300048913 Ga0496110_0051084 Ga0496110_0051084_1449_2327 292
1381 3300048913 Ga0496110_0064338 Ga0496110_0064338_385_1275 292
1382 3300048913 Ga0496110_0102678 Ga0496110_0102678_83_961 292
1383 3300048914 Ga0496111_0014758 Ga0496111_0014758_352_1230 292
1384 3300048914 Ga0496111_0085720 Ga0496111_0085720_970_1848 292
1385 3300048914 Ga0496111_0094683 Ga0496111_0094683_170_1048 292
1386 3300048914 Ga0496111_0241509 Ga0496111_0241509_382_1260 292
1387 3300048914 Ga0496111_0259885 Ga0496111_0259885_68_946 292
1388 3300048915 Ga0496112_0002196 Ga0496112_0002196_8335_9213 292
1389 3300048915 Ga0496112_0027921 Ga0496112_0027921_2475_3353 292
1390 3300048915 Ga0496112_0047972 Ga0496112_0047972_3257_4147 292
1391 3300048915 Ga0496112_0130643 Ga0496112_0130643_1309_2187 292
1392 3300048915 Ga0496112_0145818 Ga0496112_0145818_605_1483 292
1393 3300048916 Ga0496113_0000688 Ga0496113_0000688_1886_2764 292
1394 3300048916 Ga0496113_0018382 Ga0496113_0018382_1120_1998 292
1395 3300048916 Ga0496113_0050817 Ga0496113_0050817_1970_2860 292
1396 3300048916 Ga0496113_0088113 Ga0496113_0088113_464_1342 292
1397 3300048916 Ga0496113_0134941 Ga0496113_0134941_127_1005 292
1398 3300048917 Ga0496114_0015565 Ga0496114_0015565_4516_5394 292
1399 3300048917 Ga0496114_0018669 Ga0496114_0018669_4504_5382 292
1400 3300048917 Ga0496114_0051872 Ga0496114_0051872_1976_2854 292
1401 3300048918 Ga0496115_0002409 Ga0496115_0002409_10140_11018 292
1402 3300048918 Ga0496115_0029698 Ga0496115_0029698_3162_4040 292
1403 3300048918 Ga0496115_0053029 Ga0496115_0053029_947_1825 292
1404 3300048922 Ga0496119_0000861 Ga0496119_0000861_776_1660 292
1405 3300048924 Ga0496121_0000654 Ga0496121_0000654_24118_25005 292
1406 3300048925 Ga0496122_0038369 Ga0496122_0038369_2165_3049 292
1407 3300048926 Ga0496123_0007659 Ga0496123_0007659_792_1676 292
1408 3300048929 Ga0496126_0044377 Ga0496126_0044377_1421_2308 292
1409 3300049569 Ga0501032_0026118 Ga0501032_0026118_279_1157 292
1410 3300049569 Ga0501032_0075612 Ga0501032_0075612_892_1770 292
1411 3300049569 Ga0501032_0117088 Ga0501032_0117088_503_1387 292
1412 3300049569 Ga0501032_0140018 Ga0501032_0140018_405_1283 292
1413 3300049570 Ga0501033_0068615 Ga0501033_0068615_713_1597 292
1414 3300049570 Ga0501033_0073687 Ga0501033_0073687_953_1852 292
1415 3300049571 Ga0501034_0000374 Ga0501034_0000374_67730_68608 292
1416 3300049571 Ga0501034_0009431 Ga0501034_0009431_5044_5922 292
1417 3300049571 Ga0501034_0049353 Ga0501034_0049353_1896_2774 292
1418 3300049571 Ga0501034_0193603 Ga0501034_0193603_1010_1894 292
1419 3300049571 Ga0501034_0350272 Ga0501034_0350272_101_985 292
1420 3300049571 Ga0501034_0635238 Ga0501034_0635238_66_947 292
1421 3300049572 Ga0501036_0001435 Ga0501036_0001435_17354_18232 292
1422 3300049572 Ga0501036_0014849 Ga0501036_0014849_5513_6397 292
1423 3300049572 Ga0501036_0042684 Ga0501036_0042684_1064_1942 292
1424 3300049572 Ga0501036_0061483 Ga0501036_0061483_1509_2387 292
1425 3300049572 Ga0501036_0130914 Ga0501036_0130914_535_1416 292
1426 3300049572 Ga0501036_0207371 Ga0501036_0207371_235_1116 292
1427 3300049573 Ga0501037_0014097 Ga0501037_0014097_2009_2887 292
1428 3300049573 Ga0501037_0022523 Ga0501037_0022523_3413_4297 292
1429 3300049573 Ga0501037_0049189 Ga0501037_0049189_836_1714 292
1430 3300049573 Ga0501037_0055344 Ga0501037_0055344_438_1316 292
1431 3300049574 Ga0501038_0022202 Ga0501038_0022202_1237_2121 292
1432 3300049574 Ga0501038_0023734 Ga0501038_0023734_3501_4379 292
1433 3300049574 Ga0501038_0035664 Ga0501038_0035664_1692_2573 292
1434 3300049574 Ga0501038_0186510 Ga0501038_0186510_49_930 292
1435 3300049575 Ga0501039_0007451 Ga0501039_0007451_566_1444 292
1436 3300049575 Ga0501039_0091560 Ga0501039_0091560_316_1194 292
1437 3300049578 Ga0501042_0003820 Ga0501042_0003820_2680_3564 292
1438 3300049579 Ga0501043_0002453 Ga0501043_0002453_3132_4010 292
1439 3300049579 Ga0501043_0041164 Ga0501043_0041164_1472_2350 292
1440 3300049579 Ga0501043_0059551 Ga0501043_0059551_848_1726 292
1441 3300049580 Ga0501046_0012773 Ga0501046_0012773_5942_6826 292
1442 3300049580 Ga0501046_0019149 Ga0501046_0019149_4102_4980 292
1443 3300049580 Ga0501046_0047578 Ga0501046_0047578_2108_2986 292
1444 3300049581 Ga0501047_0000234 Ga0501047_0000234_3505_4383 292
1445 3300049581 Ga0501047_0030818 Ga0501047_0030818_1835_2716 292
1446 3300049581 Ga0501047_0085579 Ga0501047_0085579_1445_2323 292
1447 3300049581 Ga0501047_0089188 Ga0501047_0089188_1012_1890 292
1448 3300049581 Ga0501047_0091048 Ga0501047_0091048_1474_2352 292
1449 3300049581 Ga0501047_0100284 Ga0501047_0100284_20_904 292
1450 3300049581 Ga0501047_0191945 Ga0501047_0191945_12_896 292
1451 3300049581 Ga0501047_0463480 Ga0501047_0463480_113_991 292
1452 3300049582 Ga0501048_0000051 Ga0501048_0000051_47223_48101 292
1453 3300049582 Ga0501048_0093299 Ga0501048_0093299_259_1137 292
1454 3300049582 Ga0501048_0116956 Ga0501048_0116956_188_1072 292
1455 3300049584 Ga0501068_0002377 Ga0501068_0002377_766_1650 292
1456 3300049584 Ga0501068_0024705 Ga0501068_0024705_248_1126 292
1457 3300049584 Ga0501068_0034380 Ga0501068_0034380_2047_2925 292
1458 3300049584 Ga0501068_0075067 Ga0501068_0075067_931_1809 292
1459 3300049585 Ga0501069_0002651 Ga0501069_0002651_7393_8277 292
1460 3300049586 Ga0501070_0001845 Ga0501070_0001845_229_1107 292
1461 3300049586 Ga0501070_0038326 Ga0501070_0038326_678_1562 292
1462 3300049586 Ga0501070_0042185 Ga0501070_0042185_1248_2126 292
1463 3300049586 Ga0501070_0047792 Ga0501070_0047792_590_1471 292
1464 3300049586 Ga0501070_0058892 Ga0501070_0058892_1925_2809 292
1465 3300049588 Ga0501072_0058420 Ga0501072_0058420_1428_2306 292
1466 3300049589 Ga0501073_0031696 Ga0501073_0031696_963_1847 292
1467 3300049589 Ga0501073_0037303 Ga0501073_0037303_1122_2000 292
1468 3300049589 Ga0501073_0085012 Ga0501073_0085012_1223_2101 292
1469 3300049589 Ga0501073_0119946 Ga0501073_0119946_152_1033 292
1470 3300049590 Ga0501074_0307941 Ga0501074_0307941_145_1071 292
1471 3300049592 Ga0501076_0085736 Ga0501076_0085736_1272_2156 292
1472 3300049592 Ga0501076_0163696 Ga0501076_0163696_772_1668 292
1473 3300049593 Ga0501077_0308039 Ga0501077_0308039_97_993 292
1474 3300049742 Ga0501080_0000383 Ga0501080_0000383_16984_17862 292
1475 3300049742 Ga0501080_0008942 Ga0501080_0008942_3501_4385 292
1476 3300049742 Ga0501080_0077843 Ga0501080_0077843_1670_2548 292
1477 3300049742 Ga0501080_0496066 Ga0501080_0496066_172_1050 292
1478 3300049743 Ga0501081_0138048 Ga0501081_0138048_697_1575 292
1479 3300049744 Ga0501083_0002191 Ga0501083_0002191_1953_2831 292
1480 3300049744 Ga0501083_0015328 Ga0501083_0015328_2808_3689 292
1481 3300049744 Ga0501083_0052270 Ga0501083_0052270_937_1821 292
1482 3300049744 Ga0501083_0284775 Ga0501083_0284775_114_1028 292
1483 3300049822 Ga0501035_0018523 Ga0501035_0018523_3344_4225 292
1484 3300049822 Ga0501035_0023250 Ga0501035_0023250_101_985 292
1485 3300049822 Ga0501035_0072716 Ga0501035_0072716_858_1742 292
1486 3300049822 Ga0501035_0078217 Ga0501035_0078217_1505_2383 292
1487 3300049822 Ga0501035_0093105 Ga0501035_0093105_695_1579 292
1488 3300049823 Ga0501044_0000398 Ga0501044_0000398_51407_52285 292
1489 3300049823 Ga0501044_0005993 Ga0501044_0005993_8415_9293 292
1490 3300049823 Ga0501044_0088471 Ga0501044_0088471_309_1187 292
1491 3300049823 Ga0501044_0117488 Ga0501044_0117488_1249_2127 292
1492 3300049823 Ga0501044_0298640 Ga0501044_0298640_626_1510 292
1493 3300050489 nmdc:mga03683_109042_c1 nmdc:mga03683_109042_c1_164_1042 292
1494 3300050489 nmdc:mga03683_3736_c1 nmdc:mga03683_3736_c1_3891_4787 292
1495 3300050491 nmdc:mga00v17_38016_c1 nmdc:mga00v17_38016_c1_186_1064 292
1496 3300050491 nmdc:mga00v17_57556_c1 nmdc:mga00v17_57556_c1_548_1444 292
1497 3300050492 nmdc:mga0yw44_3033_c1 nmdc:mga0yw44_3033_c1_368_1246 292
1498 3300050492 nmdc:mga0yw44_67116_c1 nmdc:mga0yw44_67116_c1_1191_2087 292
1499 3300050493 nmdc:mga0k408_19359_c1 nmdc:mga0k408_19359_c1_599_1480 292
1500 3300050493 nmdc:mga0k408_40804_c1 nmdc:mga0k408_40804_c1_886_1764 292
1501 3300050494 nmdc:mga06z11_8923_c1 nmdc:mga06z11_8923_c1_2481_3359 292
1502 3300050507 nmdc:mga05p37_19_c2 nmdc:mga05p37_19_c2_40968_41846 292
1503 3300050507 nmdc:mga05p37_5389_c1 nmdc:mga05p37_5389_c1_1328_2206 292
1504 3300050508 nmdc:mga09592_238_c1 nmdc:mga09592_238_c1_2225_3103 292
1505 3300050509 nmdc:mga0qj67_259_c1 nmdc:mga0qj67_259_c1_26551_27429 292
1506 3300050510 nmdc:mga06r32_183979_c1 nmdc:mga06r32_183979_c1_189_1085 292
1507 3300050510 nmdc:mga06r32_2023_c1 nmdc:mga06r32_2023_c1_10081_10959 292
1508 3300050511 nmdc:mga08y16_189432_c1 nmdc:mga08y16_189432_c1_675_1556 292
1509 3300050511 nmdc:mga08y16_2548_c1 nmdc:mga08y16_2548_c1_7381_8259 292
1510 3300050511 nmdc:mga08y16_2735_c1 nmdc:mga08y16_2735_c1_14851_15729 292
1511 3300050512 nmdc:mga0n895_125265_c1 nmdc:mga0n895_125265_c1_318_1196 292
1512 3300050512 nmdc:mga0n895_1651_c1 nmdc:mga0n895_1651_c1_6556_7434 292
1513 3300050512 nmdc:mga0n895_394_c1 nmdc:mga0n895_394_c1_8752_9630 292
1514 3300050512 nmdc:mga0n895_7279_c1 nmdc:mga0n895_7279_c1_1739_2617 292
1515 3300050512 nmdc:mga0n895_9070_c1 nmdc:mga0n895_9070_c1_4279_5157 292
1516 3300050513 nmdc:mga0rr50_22766_c1 nmdc:mga0rr50_22766_c1_634_1512 292
1517 3300050513 nmdc:mga0rr50_400416_c1 nmdc:mga0rr50_400416_c1_103_993 292
1518 3300050513 nmdc:mga0rr50_48999_c1 nmdc:mga0rr50_48999_c1_935_1813 292
1519 3300050513 nmdc:mga0rr50_72450_c1 nmdc:mga0rr50_72450_c1_576_1454 292
1520 3300050515 nmdc:mga0a205_1167_c2 nmdc:mga0a205_1167_c2_6503_7381 292
1521 3300050515 nmdc:mga0a205_22640_c1 nmdc:mga0a205_22640_c1_1314_2192 292
1522 3300050515 nmdc:mga0a205_249_c1 nmdc:mga0a205_249_c1_28781_29659 292
1523 3300050515 nmdc:mga0a205_27060_c1 nmdc:mga0a205_27060_c1_284_1162 292
1524 3300050516 nmdc:mga0sz30_53095_c1 nmdc:mga0sz30_53095_c1_142_1020 292
1525 3300053077 Ga0495601_0000711 Ga0495601_0000711_6421_7299 292
1526 3300053077 Ga0495601_0002495 Ga0495601_0002495_7206_8084 292
1527 3300053077 Ga0495601_0006979 Ga0495601_0006979_4217_5095 292
1528 3300053077 Ga0495601_0019854 Ga0495601_0019854_1992_2870 292
1529 3300053078 Ga0495612_0005592 Ga0495612_0005592_3086_3964 292
1530 3300053078 Ga0495612_0010155 Ga0495612_0010155_1123_2001 292
1531 3300053078 Ga0495612_0024637 Ga0495612_0024637_1109_1987 292
1532 3300053084 Ga0495595_0000305 Ga0495595_0000305_13014_13892 292
1533 3300053084 Ga0495595_0000463 Ga0495595_0000463_6123_7001 292
1534 3300053084 Ga0495595_0000952 Ga0495595_0000952_3518_4396 292
1535 3300053084 Ga0495595_0072278 Ga0495595_0072278_601_1479 292
1536 3300053085 Ga0495619_0000078 Ga0495619_0000078_60597_61475 292
1537 3300053085 Ga0495619_0001206 Ga0495619_0001206_8881_9759 292
1538 3300053085 Ga0495619_0007134 Ga0495619_0007134_1826_2704 292
1539 3300053085 Ga0495619_0008359 Ga0495619_0008359_4515_5393 292
1540 3300053085 Ga0495619_0031610 Ga0495619_0031610_17_895 292
1541 3300053085 Ga0495619_0117573 Ga0495619_0117573_856_1761 292
1542 3300053090 Ga0500646_0022472 Ga0500646_0022472_449_1333 292
1543 3300053094 Ga0500566_0103966 Ga0500566_0103966_254_1132 292
1544 3300053096 Ga0500641_0015505 Ga0500641_0015505_910_1791 292
1545 3300053104 Ga0500556_0001403 Ga0500556_0001403_2134_3018 292
1546 3300053108 Ga0500562_029326 Ga0500562_029326_21_902 292
1547 3300053131 Ga0500652_001890 Ga0500652_001890_220_1104 292
1548 3300053158 Ga0500627_0030433 Ga0500627_0030433_1232_2110 292
1549 3300053730 Ga0500645_030270 Ga0500645_030270_25_909 292
1550 3300054114 Ga0501084_0094862 Ga0501084_0094862_221_1099 292
1551 3300054114 Ga0501084_0121018 Ga0501084_0121018_1093_2016 292
1552 3300060353 Ga0501082_0000006 Ga0501082_0000006_115751_116638 292
1553 3300060353 Ga0501082_0108915 Ga0501082_0108915_491_1387 292
1554 3300060353 Ga0501082_0121469 Ga0501082_0121469_542_1426 292
1555 3300060353 Ga0501082_0497901 Ga0501082_0497901_25_921 292
1556 3300061734 Ga0530510_0092418 Ga0530510_0092418_337_1233 292
1557 3300061734 Ga0530510_0321437 Ga0530510_0321437_241_1137 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

7

224

0.97

PF15617

C-C_Bond_Lyase

C-C_Bond_Lyase of the TIM-Barrel fold

8

288

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.9328 8 242
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.9205 4 237
1sgj-assembly1.cif.gz_C crystal structure of citrate lyase beta subunit 0.9098 3 236
1sgj-assembly1.cif.gz_C crystal structure of citrate lyase beta subunit 0.9023 3 236
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.8991 8 242
ID Description Score Start End Superfamily
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9399 2 286 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9283 1 242 3.20.20.60
af_Q54Q74_39_346_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9271 3 286 3.20.20.60
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9205 4 237 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9198 1 242 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A4V1SSB9-F1-model_v4 CoA ester lyase 0.9931 2 165 GO:0000287
GO:0006107
GO:0016829
AF-A0A854Q040-F1-model_v4 deleted 0.9907 12 97
AF-A0A382D2N4-F1-model_v4 HpcH/HpaI aldolase/citrate lyase domain-containing protein 0.989 3 108 GO:0000287
GO:0003824
GO:0006107
AF-A0A1E1V1A8-F1-model_v4 L-malyl-CoA/beta-methylmalyl-CoA lyase 0.9885 1 289 GO:0000287
GO:0006107
GO:0016829
AF-A0A370L0R9-F1-model_v4 CoA ester lyase 0.9872 1 289 GO:0000287
GO:0006107
GO:0016829

Feature Viewer

pLDDT pTM Quality
95.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map