metagRoot

F494745

General Info

Members	Datasets	Scaffolds	Average Seq Length
1557	677	3114	371

Family's Representative Sequence

Representative Sequence	3300046458\|Ga0495591_005410\|Ga0495591_005410_4012_5220
Length	402
Sequence	MSGNFLALAQPGVQQLSPYVPGKPVDELARELDLDPAKIVKLASNENPLGASPKALAAIREELAELTRYPDGNGFALKSLLAEQCRVELNQVTLGNGSNDILELVARAYLAPGLNAVFSEHAFAVYPIATQAVGAQAKVVPAKDWGHDLPAMLAAIDANTRVVFIANPNNPTGTWFGAEALDEFLQDVPEHVLVVLDEAYIEYAEGSDLPDGLDFLAAYPNLLVSRTFSKAYGLAALRVGYGLSTPVVADVLNRVRQPFNVNSLALAAACAALKDEEYLAQSRQLNESGMQQLQAGFRELGLNWIESKGNFICVDLAQVAAPIFQGLLREGVIVRPVANYGMPNHLRVTIGLPAENSRFLEALRKVLARGCVHCTAICCTYDRSPCGGRSGVDRWFVCQRLA

Samples

	Sample ID	Description	Type	Environment
1	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
4	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
5	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
6	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
7	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
8	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
9	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
10	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
11	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
12	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
13	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
14	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
15	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
16	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
17	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
18	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
19	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
20	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
21	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
22	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
23	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
24	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
25	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
26	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
27	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
28	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
29	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
30	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
31	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
32	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
33	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
34	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
35	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
36	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
37	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
38	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
39	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
40	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
41	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
42	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
43	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
44	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
45	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
46	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
47	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
48	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
49	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
50	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
51	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
52	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
53	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
54	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
55	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
56	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
57	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
58	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
59	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
60	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
61	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
62	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
63	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
64	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
65	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
66	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
67	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
68	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
69	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
70	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
71	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
72	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
73	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
74	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
75	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
76	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
77	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
78	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
79	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
80	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
81	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
82	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
83	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
84	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
85	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
86	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
87	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
88	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
89	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
90	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
91	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
93	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
94	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
95	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
96	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
97	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
98	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
99	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
100	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
101	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
102	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
103	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
104	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
105	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
106	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
107	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
108	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
109	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
110	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
111	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
112	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
113	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
114	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
115	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
116	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
117	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
118	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
119	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
120	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
121	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
122	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
123	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
124	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
125	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
126	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
127	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
128	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
129	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
130	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
131	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
132	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
133	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
134	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
135	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
136	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
137	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
138	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
148	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
150	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
151	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
152	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
223	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
231	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
235	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
236	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
237	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
238	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
239	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
240	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
241	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
242	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
243	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
244	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
245	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
246	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
247	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
248	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
249	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
250	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
251	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
252	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
253	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
254	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
255	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
256	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
257	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
258	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
259	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
260	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
261	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
262	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
263	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
264	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
265	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
266	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
267	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
268	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
269	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
270	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
271	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
272	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
273	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
274	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
275	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
276	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
277	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
278	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
279	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
280	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
281	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
282	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
283	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
284	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
285	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
286	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
287	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
288	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
289	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
290	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
291	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
292	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
293	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
294	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
295	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
296	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
297	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
298	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
299	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
300	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
301	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
302	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
303	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
304	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
305	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
306	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
307	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
308	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
309	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
310	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
311	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
312	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
313	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
314	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
315	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
316	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
317	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
318	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
319	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
320	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
321	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
322	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
323	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
324	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
325	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
326	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
327	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
328	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
329	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
330	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
331	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
332	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
333	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
334	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
335	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
336	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
337	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
338	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
339	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
340	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
341	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
342	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
343	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
344	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
345	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
346	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
347	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
348	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
349	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
350	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
351	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
352	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
353	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
354	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
355	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
356	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
357	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
358	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
359	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
360	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
361	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
362	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
363	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
364	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
365	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
366	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
367	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
368	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
369	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
370	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
371	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
372	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
373	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
374	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
375	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
376	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
377	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
378	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
379	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
380	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
381	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
382	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
383	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
384	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
385	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
386	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
387	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
388	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
389	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
390	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
391	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
392	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
393	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
394	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
395	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
396	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
397	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
398	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
399	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
400	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
401	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
402	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
403	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
404	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
405	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
406	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
407	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
408	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
409	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
410	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
411	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
412	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
413	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
414	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
415	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
416	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
417	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
418	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
419	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
420	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
421	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
422	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
423	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
424	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
425	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
426	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
427	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
428	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
429	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
430	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
431	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
432	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
433	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
434	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
435	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
436	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
437	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
438	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
439	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
440	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
441	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
442	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
443	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
444	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
445	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
446	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
447	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
448	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
449	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
450	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
451	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
452	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
453	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
454	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
455	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
456	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
457	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
458	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
459	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
460	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
461	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
462	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
463	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
464	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
465	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
466	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
467	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
468	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
469	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
470	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
471	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
472	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
473	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
474	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
475	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
476	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
477	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
478	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
479	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
480	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
481	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
482	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
483	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
484	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
485	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
486	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
487	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
488	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
489	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
490	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
491	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
492	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
493	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
494	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
495	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
496	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
497	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
498	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
499	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
500	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
501	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
502	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
503	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
504	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
505	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
506	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
507	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
508	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
509	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
510	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
511	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
512	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
513	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
514	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
515	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
516	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
517	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
518	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
519	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
520	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
521	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
522	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
523	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
524	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
525	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
526	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
527	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
528	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
529	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
530	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
531	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
532	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
533	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
534	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
535	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
536	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
537	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
538	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
539	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
540	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
541	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
542	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
543	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
544	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
545	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
546	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
547	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
548	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
549	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
550	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
551	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
552	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
553	2728369097	Stutzerimonas balearica st101	Isolate	Unclassified
554	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
555	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
556	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
557	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
558	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
559	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
560	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
561	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
562	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
563	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
564	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
565	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
566	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
567	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
568	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
569	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
570	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
571	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
572	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
573	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
574	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
575	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
576	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
577	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
578	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
579	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
580	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
581	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
582	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
583	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
584	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
585	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
586	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
587	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
588	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
589	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
590	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
591	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
592	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
593	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
594	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
595	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
596	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
597	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
598	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
599	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
600	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
601	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
602	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
603	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
604	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
605	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
606	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
607	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
608	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
609	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
610	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
611	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
612	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
613	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
614	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
615	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
616	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
617	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
618	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
619	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
620	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
621	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
622	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
623	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
624	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
625	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
626	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
627	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
628	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
629	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
630	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
631	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
632	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
633	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
634	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
635	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
636	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
637	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
638	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
639	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
640	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
641	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
642	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
643	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
644	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
645	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
646	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
647	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
648	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
649	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
650	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
651	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
652	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
653	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
654	651053060	Stutzerimonas stutzeri CMT.A.9	Isolate	Rhizosphere
655	8001522603	Methylomicrobium sp. RS1	Isolate	Unclassified
656	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
657	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
658	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
659	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
660	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
661	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
662	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
663	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
664	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
665	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
666	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
667	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
668	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
669	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
670	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
671	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
672	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
673	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
674	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
675	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
676	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
677	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	84.71
Metatranscriptomes	0.32
Isolates	14.96

Biome Distribution

Category	Percentage (%)
Aerial Root	0.13
Bulb	0
Endosphere	3.6
Nodule	1.67
Rhizoplane	5.65
Rhizosphere	82.72
Stem	0
Stem Tuber	0
Unclassified	0.13

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0495591_005410	3300046458	Bacteria	5923
2	SwRhRL2b_contig_1343526	2162886007	Bacteria	1567
3	JGI24741J21665_1010609	3300001915	Bacteria	1643
4	JGI25162J39368_1001982	3300002737	Bacteria	9168
5	JGI25162J39368_1001984	3300002737	Bacteria	9167
6	JGI25163J39215_1001882	3300002771	Bacteria	2726
7	JGI25163J39215_1001893	3300002771	Bacteria	2713
8	JGI25164J39214_1000969	3300002772	Bacteria	9168
9	JGI25164J39214_1000970	3300002772	Bacteria	9167
10	JGI25165J46597_1001793	3300003214	Bacteria	9168
11	JGI25165J46597_1001795	3300003214	Bacteria	9167
12	Ga0055538_1000102	3300003751	Bacteria	68013
13	Ga0055539_1000151	3300003752	Bacteria	68013
14	Ga0055533_1000154	3300003756	Bacteria	68013
15	Ga0055532_1000165	3300003758	Bacteria	57621
16	Ga0055525_1000204	3300003759	Bacteria	68013
17	Ga0055536_1002134	3300003781	Bacteria	11256
18	Ga0055536_1003058	3300003781	Bacteria	9137
19	Ga0055530_10000158	3300003791	Bacteria	61440
20	Ga0055530_10006585	3300003791	Bacteria	5148
21	Ga0055530_10018132	3300003791	Bacteria	2182
22	Ga0055540_1000182	3300003792	Bacteria	61440
23	Ga0055540_1002701	3300003792	Bacteria	9131
24	Ga0055531_10004241	3300003794	Bacteria	8818
25	Ga0055541_1000101	3300003841	Bacteria	68013
26	Ga0065714_10003445	3300005288	Bacteria	8983
27	Ga0065714_10008329	3300005288	Bacteria	3355
28	Ga0065714_10008341	3300005288	Bacteria	2575
29	Ga0065714_10010090	3300005288	Bacteria	2957
30	Ga0065714_10010507	3300005288	Bacteria	2113
31	Ga0065714_10069884	3300005288	Bacteria	4044
32	Ga0065714_10079053	3300005288	Bacteria	2541
33	Ga0065704_10093866	3300005289	Bacteria	2574
34	Ga0065712_10011044	3300005290	Bacteria	4377
35	Ga0070658_10008731	3300005327	Bacteria	8139
36	Ga0070658_10049312	3300005327	Bacteria	3410
37	Ga0070658_10225428	3300005327	Bacteria	1586
38	Ga0070676_10009027	3300005328	Bacteria	5394
39	Ga0070676_10055874	3300005328	Bacteria	2331
40	Ga0070683_100005902	3300005329	Bacteria	10247
41	Ga0070683_100020663	3300005329	Bacteria	5861
42	Ga0070670_100009541	3300005331	Bacteria	8282
43	Ga0070670_100015764	3300005331	Bacteria	6489
44	Ga0070670_100018430	3300005331	Bacteria	5989
45	Ga0070670_100024825	3300005331	Bacteria	5156
46	Ga0070670_100076173	3300005331	Bacteria	2882
47	Ga0070670_100093672	3300005331	Bacteria	2583
48	Ga0070670_100125348	3300005331	Bacteria	2217
49	Ga0070677_10000703	3300005333	Bacteria	11238
50	Ga0070677_10018256	3300005333	Bacteria	2524
51	Ga0068869_100000438	3300005334	Bacteria	22734
52	Ga0068869_100022700	3300005334	Bacteria	4327
53	Ga0068869_100066550	3300005334	Bacteria	2655
54	Ga0068869_100069230	3300005334	Bacteria	2608
55	Ga0070666_10029101	3300005335	Bacteria	3629
56	Ga0070680_100007174	3300005336	Bacteria	8494
57	Ga0068868_100007254	3300005338	Bacteria	7884
58	Ga0070660_100009009	3300005339	Bacteria	7001
59	Ga0070660_100010977	3300005339	Bacteria	6417
60	Ga0070660_100040578	3300005339	Bacteria	3543
61	Ga0070660_100070148	3300005339	Bacteria	2734
62	Ga0070689_100015942	3300005340	Bacteria	5492
63	Ga0070689_100074642	3300005340	Bacteria	2653
64	Ga0070661_100000132	3300005344	Bacteria	62286
65	Ga0070661_100002026	3300005344	Bacteria	13999
66	Ga0070661_100008903	3300005344	Bacteria	6945
67	Ga0070661_100039089	3300005344	Bacteria	3456
68	Ga0070661_100091419	3300005344	Bacteria	2254
69	Ga0070668_100014622	3300005347	Bacteria	5866
70	Ga0070668_100025125	3300005347	Bacteria	4516
71	Ga0070669_100003598	3300005353	Bacteria	11188
72	Ga0070669_100011597	3300005353	Bacteria	6251
73	Ga0070669_100015132	3300005353	Bacteria	5496
74	Ga0070669_100015797	3300005353	Bacteria	5384
75	Ga0070669_100074129	3300005353	Bacteria	2523
76	Ga0070675_100009360	3300005354	Bacteria	7621
77	Ga0070675_100012764	3300005354	Bacteria	6589
78	Ga0070675_100031118	3300005354	Bacteria	4312
79	Ga0070675_100036090	3300005354	Bacteria	4020
80	Ga0070675_100039896	3300005354	Bacteria	3832
81	Ga0070675_100127372	3300005354	Bacteria	2167
82	Ga0070671_100013018	3300005355	Bacteria	6704
83	Ga0070671_100039443	3300005355	Bacteria	3920
84	Ga0070671_100039510	3300005355	Bacteria	3917
85	Ga0070674_100016923	3300005356	Bacteria	4576
86	Ga0070674_100068923	3300005356	Bacteria	2494
87	Ga0070674_100115633	3300005356	Bacteria	1978
88	Ga0070674_100205660	3300005356	Bacteria	1523
89	Ga0070673_100001116	3300005364	Bacteria	15390
90	Ga0070673_100002706	3300005364	Bacteria	10865
91	Ga0070673_100023264	3300005364	Bacteria	4526
92	Ga0070673_100026379	3300005364	Bacteria	4291
93	Ga0070673_100168571	3300005364	Bacteria	1867
94	Ga0070688_100000859	3300005365	Bacteria	15110
95	Ga0070688_100022006	3300005365	Bacteria	3730
96	Ga0070659_100023112	3300005366	Bacteria	4753
97	Ga0070659_100031733	3300005366	Bacteria	4093
98	Ga0070667_100005988	3300005367	Bacteria	10100
99	Ga0070667_100025516	3300005367	Bacteria	4913
100	Ga0070667_100027839	3300005367	Bacteria	4704
101	Ga0070667_100091655	3300005367	Bacteria	2614
102	Ga0070667_100113083	3300005367	Bacteria	2356
103	Ga0070709_10011434	3300005434	Bacteria	4948
104	Ga0070714_100016692	3300005435	Bacteria	5935
105	Ga0070714_100019400	3300005435	Bacteria	5539
106	Ga0070714_100032308	3300005435	Bacteria	4368
107	Ga0070714_100033098	3300005435	Bacteria	4319
108	Ga0070713_100000032	3300005436	Bacteria	86800
109	Ga0070713_100005582	3300005436	Bacteria	8620
110	Ga0070713_100005784	3300005436	Bacteria	8499
111	Ga0070713_100074970	3300005436	Bacteria	2868
112	Ga0070711_100001725	3300005439	Bacteria	12129
113	Ga0070711_100111461	3300005439	Bacteria	2009
114	Ga0070705_100064691	3300005440	Bacteria	2186
115	Ga0070700_100075154	3300005441	Bacteria	2166
116	Ga0070700_100123785	3300005441	Bacteria	1736
117	Ga0070694_100076906	3300005444	Bacteria	2311
118	Ga0070708_100005401	3300005445	Bacteria	10134
119	Ga0070663_100004247	3300005455	Bacteria	8387
120	Ga0070663_100016099	3300005455	Bacteria	4843
121	Ga0070663_100064746	3300005455	Bacteria	2643
122	Ga0070663_100128216	3300005455	Bacteria	1924
123	Ga0070678_100004857	3300005456	Bacteria	7678
124	Ga0070678_100023667	3300005456	Bacteria	4097
125	Ga0070678_100028076	3300005456	Bacteria	3832
126	Ga0070678_100040039	3300005456	Bacteria	3313
127	Ga0070662_100010547	3300005457	Bacteria	6070
128	Ga0070662_100085861	3300005457	Bacteria	2353
129	Ga0070681_10022155	3300005458	Bacteria	6376
130	Ga0070681_10042623	3300005458	Bacteria	4548
131	Ga0070681_10163461	3300005458	Bacteria	2149
132	Ga0068867_100008336	3300005459	Bacteria	7316
133	Ga0068867_100010114	3300005459	Bacteria	6649
134	Ga0068867_100022453	3300005459	Bacteria	4512
135	Ga0068867_100053855	3300005459	Bacteria	2971
136	Ga0068867_100057799	3300005459	Bacteria	2873
137	Ga0068867_100064685	3300005459	Bacteria	2720
138	Ga0070685_10004154	3300005466	Bacteria	7309
139	Ga0070706_100008998	3300005467	Bacteria	9297
140	Ga0070706_100057878	3300005467	Bacteria	3577
141	Ga0070707_100294332	3300005468	Bacteria	1577
142	Ga0070698_100256952	3300005471	Bacteria	1679
143	Ga0070699_100034925	3300005518	Bacteria	4345
144	Ga0070699_100218379	3300005518	Bacteria	1698
145	Ga0070699_100311178	3300005518	Bacteria	1414
146	Ga0070679_100010905	3300005530	Bacteria	8635
147	Ga0070679_100025218	3300005530	Bacteria	5831
148	Ga0070679_100058299	3300005530	Bacteria	3847
149	Ga0070684_100002622	3300005535	Bacteria	13284
150	Ga0070684_100004381	3300005535	Bacteria	10734
151	Ga0070684_100010683	3300005535	Bacteria	7282
152	Ga0070697_100018319	3300005536	Bacteria	5520
153	Ga0070697_100179485	3300005536	Bacteria	1794
154	Ga0068853_100001549	3300005539	Bacteria	16723
155	Ga0068853_100003885	3300005539	Bacteria	11454
156	Ga0068853_100015040	3300005539	Bacteria	6359
157	Ga0068853_100038808	3300005539	Bacteria	4058
158	Ga0070672_100000208	3300005543	Bacteria	32511
159	Ga0070672_100002162	3300005543	Bacteria	12392
160	Ga0070672_100042828	3300005543	Bacteria	3487
161	Ga0070686_100008598	3300005544	Bacteria	5719
162	Ga0070686_100142911	3300005544	Bacteria	1667
163	Ga0070696_100000445	3300005546	Bacteria	25891
164	Ga0070693_100001513	3300005547	Bacteria	10477
165	Ga0070693_100011814	3300005547	Bacteria	4405
166	Ga0070693_100044039	3300005547	Bacteria	2523
167	Ga0070665_100003722	3300005548	Bacteria	16147
168	Ga0070665_100013936	3300005548	Bacteria	8087
169	Ga0070665_100052519	3300005548	Bacteria	4087
170	Ga0070665_100057546	3300005548	Bacteria	3897
171	Ga0070665_100071773	3300005548	Bacteria	3469
172	Ga0070665_100113153	3300005548	Bacteria	2717
173	Ga0070665_100504896	3300005548	Bacteria	1221
174	Ga0070704_100006009	3300005549	Bacteria	7118
175	Ga0068855_100002584	3300005563	Bacteria	22314
176	Ga0068855_100091567	3300005563	Bacteria	3507
177	Ga0068855_100352076	3300005563	Bacteria	1622
178	Ga0070664_100005816	3300005564	Bacteria	9946
179	Ga0070664_100011754	3300005564	Bacteria	7107
180	Ga0070664_100033914	3300005564	Bacteria	4280
181	Ga0070664_100036907	3300005564	Bacteria	4107
182	Ga0070664_100042234	3300005564	Bacteria	3849
183	Ga0070664_100043927	3300005564	Bacteria	3772
184	Ga0070664_100156101	3300005564	Bacteria	2016
185	Ga0068857_100008250	3300005577	Bacteria	9000
186	Ga0068857_100180626	3300005577	Bacteria	1920
187	Ga0068854_100006663	3300005578	Bacteria	7361
188	Ga0068854_100009337	3300005578	Bacteria	6332
189	Ga0068854_100009862	3300005578	Bacteria	6176
190	Ga0068854_100013743	3300005578	Bacteria	5322
191	Ga0068854_100031473	3300005578	Bacteria	3687
192	Ga0068854_100070174	3300005578	Bacteria	2561
193	Ga0068856_100020171	3300005614	Bacteria	6475
194	Ga0068856_100024383	3300005614	Bacteria	5887
195	Ga0068856_100097960	3300005614	Bacteria	2922
196	Ga0068856_100181660	3300005614	Bacteria	2117
197	Ga0070702_100024461	3300005615	Bacteria	3222
198	Ga0070702_100039585	3300005615	Bacteria	2631
199	Ga0068852_100002894	3300005616	Bacteria	11914
200	Ga0068852_100007076	3300005616	Bacteria	8172
201	Ga0068852_100025689	3300005616	Bacteria	4776
202	Ga0068852_100042721	3300005616	Bacteria	3839
203	Ga0068852_100111877	3300005616	Bacteria	2484
204	Ga0068852_100174040	3300005616	Bacteria	2020
205	Ga0068852_100347444	3300005616	Bacteria	1447
206	Ga0068859_100000189	3300005617	Bacteria	59789
207	Ga0068859_100004540	3300005617	Bacteria	14158
208	Ga0068859_100034277	3300005617	Bacteria	5096
209	Ga0068859_100533449	3300005617	Bacteria	1268
210	Ga0068864_100000192	3300005618	Bacteria	55904
211	Ga0068864_100000629	3300005618	Bacteria	29654
212	Ga0068864_100003063	3300005618	Bacteria	13802
213	Ga0068864_100025075	3300005618	Bacteria	5020
214	Ga0068864_100038175	3300005618	Bacteria	4100
215	Ga0068864_100065116	3300005618	Bacteria	3162
216	Ga0068866_10004337	3300005718	Bacteria	5827
217	Ga0068866_10108276	3300005718	Bacteria	1545
218	Ga0068861_100004831	3300005719	Bacteria	9062
219	Ga0068861_100067210	3300005719	Bacteria	2765
220	Ga0068851_10000084	3300005834	Bacteria	52007
221	Ga0068851_10000781	3300005834	Bacteria	13714
222	Ga0068851_10007670	3300005834	Bacteria	4964
223	Ga0068851_10008204	3300005834	Bacteria	4822
224	Ga0068851_10010106	3300005834	Bacteria	4397
225	Ga0068870_10003067	3300005840	Bacteria	7044
226	Ga0068870_10013946	3300005840	Bacteria	3786
227	Ga0068863_100003943	3300005841	Bacteria	14664
228	Ga0068863_100004551	3300005841	Bacteria	13672
229	Ga0068863_100083574	3300005841	Bacteria	3025
230	Ga0068863_100138526	3300005841	Bacteria	2325
231	Ga0068863_100253388	3300005841	Bacteria	1701
232	Ga0068858_100002736	3300005842	Bacteria	17736
233	Ga0068858_100028438	3300005842	Bacteria	5193
234	Ga0068858_100030176	3300005842	Bacteria	5035
235	Ga0068858_100044349	3300005842	Bacteria	4122
236	Ga0068858_100094449	3300005842	Bacteria	2785
237	Ga0068858_100139570	3300005842	Bacteria	2275
238	Ga0068860_100000802	3300005843	Bacteria	35293
239	Ga0068860_100005740	3300005843	Bacteria	12516
240	Ga0068860_100021225	3300005843	Bacteria	6290
241	Ga0068860_100032112	3300005843	Bacteria	5047
242	Ga0068860_100045971	3300005843	Bacteria	4163
243	Ga0068862_100006071	3300005844	Bacteria	10059
244	Ga0068862_100031221	3300005844	Bacteria	4495
245	Ga0068862_100037733	3300005844	Bacteria	4096
246	Ga0068862_100107023	3300005844	Bacteria	2452
247	Ga0068862_100147593	3300005844	Bacteria	2091
248	Ga0075432_10019357	3300006058	Bacteria	2325
249	Ga0075432_10034468	3300006058	Bacteria	1758
250	Ga0075432_10053790	3300006058	Bacteria	1424
251	Ga0070715_10003402	3300006163	Bacteria	5051
252	Ga0070712_100088502	3300006175	Bacteria	2263
253	Ga0075362_10053571	3300006177	Bacteria	1811
254	Ga0097621_100013060	3300006237	Bacteria	6176
255	Ga0097621_100076113	3300006237	Bacteria	2783
256	Ga0097621_100091221	3300006237	Bacteria	2550
257	Ga0068871_100004013	3300006358	Bacteria	10173
258	Ga0068871_100020139	3300006358	Bacteria	5105
259	Ga0068871_100029513	3300006358	Bacteria	4308
260	Ga0068871_100034846	3300006358	Bacteria	3997
261	Ga0068871_100187366	3300006358	Bacteria	1781
262	Ga0075428_100281901	3300006844	Bacteria	1788
263	Ga0075433_10156436	3300006852	Bacteria	2028
264	Ga0075434_100037825	3300006871	Bacteria	4777
265	Ga0075434_100186111	3300006871	Bacteria	2097
266	Ga0075434_100383720	3300006871	Bacteria	1426
267	Ga0075434_100428445	3300006871	Bacteria	1344
268	Ga0068865_100002295	3300006881	Bacteria	11266
269	Ga0068865_100032155	3300006881	Bacteria	3503
270	Ga0068865_100051255	3300006881	Bacteria	2856
271	Ga0068865_100061954	3300006881	Bacteria	2624
272	Ga0068865_100148112	3300006881	Bacteria	1778
273	Ga0068865_100170225	3300006881	Bacteria	1669
274	Ga0075436_100005071	3300006914	Bacteria	9064
275	Ga0075436_100038607	3300006914	Bacteria	3295
276	Ga0075436_100215291	3300006914	Bacteria	1362
277	Ga0097620_100000189	3300006931	Bacteria	59789
278	Ga0097620_100004540	3300006931	Bacteria	14158
279	Ga0097620_100034273	3300006931	Bacteria	5096
280	Ga0097620_100533460	3300006931	Bacteria	1268
281	Ga0079104_1000115	3300006946	Bacteria	115517
282	Ga0079104_1000806	3300006946	Bacteria	26381
283	Ga0079104_1011316	3300006946	Bacteria	2875
284	Ga0075435_100002573	3300007076	Bacteria	12099
285	Ga0105251_10000252	3300009011	Bacteria	53844
286	Ga0105251_10010353	3300009011	Bacteria	5419
287	Ga0105251_10020618	3300009011	Bacteria	3459
288	Ga0105251_10022034	3300009011	Bacteria	3316
289	Ga0105251_10032234	3300009011	Bacteria	2613
290	Ga0105244_10013606	3300009036	Bacteria	4745
291	Ga0105244_10018383	3300009036	Bacteria	3922
292	Ga0105244_10028612	3300009036	Bacteria	2987
293	Ga0105244_10046664	3300009036	Bacteria	2225
294	Ga0105244_10116870	3300009036	Bacteria	1294
295	Ga0105244_10118479	3300009036	Bacteria	1283
296	Ga0105250_10000609	3300009092	Bacteria	23317
297	Ga0105250_10004476	3300009092	Bacteria	6428
298	Ga0105250_10006522	3300009092	Bacteria	5093
299	Ga0105250_10009231	3300009092	Bacteria	4157
300	Ga0105250_10048928	3300009092	Bacteria	1695
301	Ga0105240_10002531	3300009093	Bacteria	29323
302	Ga0105240_10006195	3300009093	Bacteria	17610
303	Ga0105240_10011696	3300009093	Bacteria	12194
304	Ga0105240_10021019	3300009093	Bacteria	8686
305	Ga0111539_10012695	3300009094	Bacteria	10550
306	Ga0105245_10026231	3300009098	Bacteria	5128
307	Ga0105245_10061904	3300009098	Bacteria	3375
308	Ga0105247_10020661	3300009101	Bacteria	3959
309	Ga0105247_10032402	3300009101	Bacteria	3176
310	Ga0114129_10053510	3300009147	Bacteria	5661
311	Ga0105243_10007136	3300009148	Bacteria	8589
312	Ga0105243_10011236	3300009148	Bacteria	6773
313	Ga0105241_10001698	3300009174	Bacteria	16738
314	Ga0105241_10023158	3300009174	Bacteria	4603
315	Ga0105241_10072866	3300009174	Bacteria	2671
316	Ga0105241_10228787	3300009174	Bacteria	1567
317	Ga0105242_10010920	3300009176	Bacteria	6977
318	Ga0105248_10009318	3300009177	Bacteria	10810
319	Ga0105248_10015111	3300009177	Bacteria	8502
320	Ga0105248_10015645	3300009177	Bacteria	8362
321	Ga0105248_10088468	3300009177	Bacteria	3486
322	Ga0105248_10136317	3300009177	Bacteria	2769
323	Ga0105248_10181076	3300009177	Bacteria	2375
324	Ga0105248_10351177	3300009177	Bacteria	1660
325	Ga0105237_10000857	3300009545	Bacteria	41324
326	Ga0105237_10039684	3300009545	Bacteria	4752
327	Ga0105237_10073399	3300009545	Bacteria	3414
328	Ga0105237_10075191	3300009545	Bacteria	3370
329	Ga0105238_10000484	3300009551	Bacteria	41852
330	Ga0105238_10009771	3300009551	Bacteria	9607
331	Ga0105238_10013814	3300009551	Bacteria	8162
332	Ga0105238_10089175	3300009551	Bacteria	3071
333	Ga0105239_10047948	3300010375	Bacteria	4682
334	Ga0105239_10252496	3300010375	Bacteria	1981
335	Ga0105239_10334259	3300010375	Bacteria	1709
336	Ga0105246_10003724	3300011119	Bacteria	9231
337	Ga0105246_10014642	3300011119	Bacteria	4936
338	Ga0105246_10018277	3300011119	Bacteria	4467
339	Ga0105246_10155085	3300011119	Bacteria	1738
340	Ga0105246_10201635	3300011119	Bacteria	1547
341	Ga0157345_1000329	3300012498	Bacteria	5699
342	Ga0157373_10002280	3300013100	Bacteria	14536
343	Ga0157373_10102748	3300013100	Bacteria	2011
344	Ga0157373_10111742	3300013100	Bacteria	1921
345	Ga0157373_10157668	3300013100	Bacteria	1597
346	Ga0157371_10008958	3300013102	Bacteria	7916
347	Ga0157371_10018711	3300013102	Bacteria	5119
348	Ga0157371_10023866	3300013102	Bacteria	4470
349	Ga0157371_10103277	3300013102	Bacteria	2022
350	Ga0157371_10176546	3300013102	Bacteria	1527
351	Ga0157370_10000850	3300013104	Bacteria	38703
352	Ga0157370_10003303	3300013104	Bacteria	19008
353	Ga0157370_10012008	3300013104	Bacteria	9025
354	Ga0157370_10014064	3300013104	Bacteria	8212
355	Ga0157370_10016320	3300013104	Bacteria	7523
356	Ga0157370_10048629	3300013104	Bacteria	4062
357	Ga0157370_10054387	3300013104	Bacteria	3815
358	Ga0157370_10068470	3300013104	Bacteria	3354
359	Ga0157370_10183666	3300013104	Bacteria	1942
360	Ga0157369_10021039	3300013105	Bacteria	7292
361	Ga0157369_10028835	3300013105	Bacteria	6139
362	Ga0157369_10083536	3300013105	Bacteria	3415
363	Ga0157369_10100920	3300013105	Bacteria	3076
364	Ga0157369_10137246	3300013105	Bacteria	2588
365	Ga0157369_10238103	3300013105	Bacteria	1901
366	Ga0157369_10348991	3300013105	Bacteria	1537
367	Ga0157369_10523740	3300013105	Bacteria	1226
368	Ga0157374_10020809	3300013296	Bacteria	5827
369	Ga0157374_10021478	3300013296	Bacteria	5744
370	Ga0157374_10033220	3300013296	Bacteria	4706
371	Ga0157374_10093088	3300013296	Bacteria	2877
372	Ga0157378_10009785	3300013297	Bacteria	8357
373	Ga0157378_10229772	3300013297	Bacteria	1767
374	Ga0163162_10017634	3300013306	Bacteria	6984
375	Ga0163162_10027615	3300013306	Bacteria	5613
376	Ga0163162_10029393	3300013306	Bacteria	5438
377	Ga0163162_10036898	3300013306	Bacteria	4875
378	Ga0163162_10066742	3300013306	Bacteria	3647
379	Ga0163162_10111018	3300013306	Bacteria	2839
380	Ga0163162_10303027	3300013306	Bacteria	1730
381	Ga0163162_10542868	3300013306	Bacteria	1291
382	Ga0157372_10004771	3300013307	Bacteria	14401
383	Ga0157372_10027651	3300013307	Bacteria	6180
384	Ga0157372_10029746	3300013307	Bacteria	5969
385	Ga0157372_10031252	3300013307	Bacteria	5830
386	Ga0157372_10046050	3300013307	Bacteria	4841
387	Ga0157372_10046651	3300013307	Bacteria	4811
388	Ga0157372_10060059	3300013307	Bacteria	4254
389	Ga0157372_10345645	3300013307	Bacteria	1733
390	Ga0157375_10006017	3300013308	Bacteria	10581
391	Ga0157375_10010063	3300013308	Bacteria	8316
392	Ga0157375_10022962	3300013308	Bacteria	5749
393	Ga0157375_10036251	3300013308	Bacteria	4717
394	Ga0157375_10070785	3300013308	Bacteria	3499
395	Ga0157375_10077808	3300013308	Bacteria	3348
396	Ga0157375_10158342	3300013308	Bacteria	2405
397	Ga0157375_10194655	3300013308	Bacteria	2182
398	Ga0157375_10230178	3300013308	Bacteria	2012
399	Ga0163163_10001101	3300014325	Bacteria	22936
400	Ga0163163_10025359	3300014325	Bacteria	5652
401	Ga0163163_10047605	3300014325	Bacteria	4215
402	Ga0163163_10136331	3300014325	Bacteria	2495
403	Ga0163163_10150274	3300014325	Bacteria	2373
404	Ga0163163_10512426	3300014325	Bacteria	1262
405	Ga0157380_10046974	3300014326	Bacteria	3393
406	Ga0157380_10058036	3300014326	Bacteria	3085
407	Ga0157380_10134889	3300014326	Bacteria	2112
408	Ga0157380_10327324	3300014326	Bacteria	1423
409	Ga0182008_10015013	3300014497	Bacteria	4050
410	Ga0182008_10015561	3300014497	Bacteria	3966
411	Ga0182008_10045884	3300014497	Bacteria	2173
412	Ga0182008_10055816	3300014497	Bacteria	1953
413	Ga0182008_10068612	3300014497	Bacteria	1744
414	Ga0182008_10144390	3300014497	Bacteria	1192
415	Ga0157377_10008683	3300014745	Bacteria	4962
416	Ga0157379_10000028	3300014968	Bacteria	86433
417	Ga0157379_10040070	3300014968	Bacteria	4180
418	Ga0157376_10016313	3300014969	Bacteria	5636
419	Ga0157376_10020522	3300014969	Bacteria	5112
420	Ga0157376_10057108	3300014969	Bacteria	3263
421	Ga0157376_10086678	3300014969	Bacteria	2700
422	Ga0157376_10095764	3300014969	Bacteria	2582
423	Ga0157376_10098618	3300014969	Bacteria	2547
424	Ga0182006_1007125	3300015261	Bacteria	5142
425	Ga0182006_1007407	3300015261	Bacteria	5024
426	Ga0182006_1009294	3300015261	Bacteria	4411
427	Ga0182006_1029384	3300015261	Bacteria	2227
428	Ga0182006_1030487	3300015261	Bacteria	2179
429	Ga0182006_1037664	3300015261	Bacteria	1916
430	Ga0182007_10020557	3300015262	Bacteria	2359
431	Ga0182007_10055328	3300015262	Bacteria	1304
432	Ga0182005_1012435	3300015265	Bacteria	2402
433	Ga0182005_1014305	3300015265	Bacteria	2221
434	Ga0182005_1027037	3300015265	Bacteria	1565
435	Ga0163161_10038650	3300017792	Bacteria	3423
436	Ga0163161_10044981	3300017792	Bacteria	3181
437	Ga0163161_10071105	3300017792	Bacteria	2545
438	Ga0163161_10128967	3300017792	Bacteria	1906
439	Ga0163161_10155558	3300017792	Bacteria	1740
440	Ga0163161_10242575	3300017792	Bacteria	1402
441	Ga0209435_100231	3300025206	Bacteria	15324
442	Ga0209760_100011	3300025207	Bacteria	197221
443	Ga0209760_100445	3300025207	Bacteria	9506
444	Ga0209784_100138	3300025224	Bacteria	68249
445	Ga0209566_100179	3300025225	Bacteria	68249
446	Ga0209674_100186	3300025226	Bacteria	68249
447	Ga0209147_100195	3300025229	Bacteria	68796
448	Ga0209563_100148	3300025230	Bacteria	68249
449	Ga0209563_101610	3300025230	Bacteria	5842
450	Ga0207427_100008	3300025231	Bacteria	740731
451	Ga0207427_100082	3300025231	Bacteria	142809
452	Ga0209437_100006	3300025233	Bacteria	1042724
453	Ga0209437_100014	3300025233	Bacteria	740714
454	Ga0209258_100339	3300025242	Bacteria	69328
455	Ga0209646_1000333	3300025246	Bacteria	35468
456	Ga0209677_100137	3300025253	Bacteria	68249
457	Ga0209759_1012925	3300025256	Bacteria	2286
458	Ga0209233_1000008	3300025261	Bacteria	1356712
459	Ga0209233_1000105	3300025261	Bacteria	272035
460	Ga0209675_1002340	3300025291	Bacteria	9784
461	Ga0209676_1000010	3300025292	Bacteria	954025
462	Ga0209676_1000345	3300025292	Bacteria	88051
463	Ga0209676_1005908	3300025292	Bacteria	6209
464	Ga0209050_1000009	3300025298	Bacteria	1047265
465	Ga0209050_1000081	3300025298	Bacteria	267533
466	Ga0209050_1018116	3300025298	Bacteria	2757
467	Ga0209051_1000008	3300025303	Bacteria	706935
468	Ga0209051_1000104	3300025303	Bacteria	161001
469	Ga0209051_1028091	3300025303	Bacteria	2228
470	Ga0209257_1000040	3300025304	Bacteria	538759
471	Ga0209257_1028786	3300025304	Bacteria	1823
472	Ga0207697_10000129	3300025315	Bacteria	36355
473	Ga0207697_10045632	3300025315	Bacteria	1804
474	Ga0207656_10000034	3300025321	Bacteria	66750
475	Ga0207656_10004125	3300025321	Bacteria	5049
476	Ga0207656_10019060	3300025321	Bacteria	2710
477	Ga0207696_1000063	3300025711	Bacteria	239123
478	Ga0207696_1000097	3300025711	Bacteria	175696
479	Ga0207696_1000161	3300025711	Bacteria	109070
480	Ga0207655_1001435	3300025728	Bacteria	22098
481	Ga0207655_1003817	3300025728	Bacteria	10991
482	Ga0207655_1005021	3300025728	Bacteria	9156
483	Ga0207655_1009651	3300025728	Bacteria	5968
484	Ga0207655_1010547	3300025728	Bacteria	5590
485	Ga0207655_1029508	3300025728	Bacteria	2566
486	Ga0207655_1040106	3300025728	Bacteria	2025
487	Ga0207655_1058685	3300025728	Bacteria	1502
488	Ga0207713_1000313	3300025735	Bacteria	55095
489	Ga0207713_1002959	3300025735	Bacteria	11879
490	Ga0207713_1003872	3300025735	Bacteria	9980
491	Ga0207713_1004929	3300025735	Bacteria	8532
492	Ga0207713_1005398	3300025735	Bacteria	8008
493	Ga0207713_1011284	3300025735	Bacteria	4871
494	Ga0207713_1024510	3300025735	Bacteria	2811
495	Ga0207682_10000157	3300025893	Bacteria	30775
496	Ga0207682_10000441	3300025893	Bacteria	19188
497	Ga0207710_10012769	3300025900	Bacteria	3536
498	Ga0207710_10012793	3300025900	Bacteria	3534
499	Ga0207688_10000508	3300025901	Bacteria	18745
500	Ga0207688_10043342	3300025901	Bacteria	2505
501	Ga0207680_10039771	3300025903	Bacteria	2731
502	Ga0207680_10113501	3300025903	Bacteria	1761
503	Ga0207680_10144818	3300025903	Bacteria	1578
504	Ga0207699_10026989	3300025906	Bacteria	3173
505	Ga0207699_10052947	3300025906	Bacteria	2405
506	Ga0207645_10005677	3300025907	Bacteria	9014
507	Ga0207645_10006193	3300025907	Bacteria	8594
508	Ga0207645_10028252	3300025907	Bacteria	3622
509	Ga0207645_10067283	3300025907	Bacteria	2290
510	Ga0207645_10084684	3300025907	Bacteria	2035
511	Ga0207645_10090888	3300025907	Bacteria	1963
512	Ga0207643_10000258	3300025908	Bacteria	36684
513	Ga0207643_10005143	3300025908	Bacteria	6998
514	Ga0207643_10027629	3300025908	Bacteria	3147
515	Ga0207705_10044590	3300025909	Bacteria	3187
516	Ga0207705_10087149	3300025909	Bacteria	2282
517	Ga0207684_10024761	3300025910	Bacteria	5116
518	Ga0207684_10092892	3300025910	Bacteria	2572
519	Ga0207654_10002541	3300025911	Bacteria	9256
520	Ga0207707_10007730	3300025912	Bacteria	9359
521	Ga0207707_10008958	3300025912	Bacteria	8693
522	Ga0207707_10050431	3300025912	Bacteria	3625
523	Ga0207707_10064910	3300025912	Bacteria	3179
524	Ga0207695_10008493	3300025913	Bacteria	12841
525	Ga0207695_10021152	3300025913	Bacteria	7431
526	Ga0207695_10066872	3300025913	Bacteria	3689
527	Ga0207671_10000079	3300025914	Bacteria	149692
528	Ga0207693_10002980	3300025915	Bacteria	14658
529	Ga0207693_10270095	3300025915	Bacteria	1333
530	Ga0207663_10005009	3300025916	Bacteria	6646
531	Ga0207660_10024200	3300025917	Bacteria	4109
532	Ga0207660_10031835	3300025917	Bacteria	3636
533	Ga0207660_10070154	3300025917	Bacteria	2547
534	Ga0207662_10001920	3300025918	Bacteria	10257
535	Ga0207657_10000412	3300025919	Bacteria	45322
536	Ga0207657_10000501	3300025919	Bacteria	41290
537	Ga0207657_10014608	3300025919	Bacteria	7652
538	Ga0207657_10017467	3300025919	Bacteria	6875
539	Ga0207657_10025474	3300025919	Bacteria	5455
540	Ga0207657_10049858	3300025919	Bacteria	3645
541	Ga0207657_10088347	3300025919	Bacteria	2591
542	Ga0207649_10000002	3300025920	Bacteria	498633
543	Ga0207649_10009029	3300025920	Bacteria	5445
544	Ga0207649_10020905	3300025920	Bacteria	3759
545	Ga0207649_10060913	3300025920	Bacteria	2373
546	Ga0207649_10120158	3300025920	Bacteria	1770
547	Ga0207652_10002644	3300025921	Bacteria	15037
548	Ga0207652_10021068	3300025921	Bacteria	5378
549	Ga0207646_10024731	3300025922	Bacteria	5499
550	Ga0207681_10005923	3300025923	Bacteria	7495
551	Ga0207681_10023890	3300025923	Bacteria	3916
552	Ga0207681_10076086	3300025923	Bacteria	2356
553	Ga0207694_10059874	3300025924	Bacteria	2962
554	Ga0207650_10000684	3300025925	Bacteria	26647
555	Ga0207650_10001264	3300025925	Bacteria	18363
556	Ga0207650_10006549	3300025925	Bacteria	7944
557	Ga0207650_10006624	3300025925	Bacteria	7900
558	Ga0207650_10007946	3300025925	Bacteria	7230
559	Ga0207650_10010406	3300025925	Bacteria	6376
560	Ga0207650_10069120	3300025925	Bacteria	2653
561	Ga0207650_10099298	3300025925	Bacteria	2238
562	Ga0207650_10146985	3300025925	Bacteria	1857
563	Ga0207659_10155339	3300025926	Bacteria	1791
564	Ga0207659_10167912	3300025926	Bacteria	1729
565	Ga0207687_10010558	3300025927	Bacteria	6036
566	Ga0207687_10030278	3300025927	Bacteria	3648
567	Ga0207687_10126779	3300025927	Bacteria	1918
568	Ga0207700_10000148	3300025928	Bacteria	41738
569	Ga0207700_10062383	3300025928	Bacteria	2831
570	Ga0207700_10073731	3300025928	Bacteria	2637
571	Ga0207664_10003077	3300025929	Bacteria	11082
572	Ga0207664_10005693	3300025929	Bacteria	8517
573	Ga0207664_10083844	3300025929	Bacteria	2598
574	Ga0207664_10276777	3300025929	Bacteria	1472
575	Ga0207644_10004464	3300025931	Bacteria	9084
576	Ga0207644_10106060	3300025931	Bacteria	2118
577	Ga0207644_10163217	3300025931	Bacteria	1733
578	Ga0207690_10022378	3300025932	Bacteria	3932
579	Ga0207690_10274361	3300025932	Bacteria	1311
580	Ga0207706_10000895	3300025933	Bacteria	30564
581	Ga0207706_10000928	3300025933	Bacteria	30049
582	Ga0207706_10012617	3300025933	Bacteria	7692
583	Ga0207706_10023406	3300025933	Bacteria	5547
584	Ga0207706_10146507	3300025933	Bacteria	2077
585	Ga0207686_10116856	3300025934	Bacteria	1809
586	Ga0207709_10000035	3300025935	Bacteria	300968
587	Ga0207709_10045925	3300025935	Bacteria	2648
588	Ga0207709_10108403	3300025935	Bacteria	1852
589	Ga0207709_10146180	3300025935	Bacteria	1631
590	Ga0207670_10063837	3300025936	Bacteria	2522
591	Ga0207669_10039457	3300025937	Bacteria	2729
592	Ga0207669_10082980	3300025937	Bacteria	2059
593	Ga0207669_10109906	3300025937	Bacteria	1845
594	Ga0207704_10024731	3300025938	Bacteria	3263
595	Ga0207704_10032034	3300025938	Bacteria	2969
596	Ga0207704_10060216	3300025938	Bacteria	2348
597	Ga0207665_10013628	3300025939	Bacteria	5348
598	Ga0207665_10078843	3300025939	Bacteria	2263
599	Ga0207691_10000078	3300025940	Bacteria	82874
600	Ga0207691_10000087	3300025940	Bacteria	78167
601	Ga0207691_10000342	3300025940	Bacteria	46924
602	Ga0207691_10002017	3300025940	Bacteria	19886
603	Ga0207691_10007997	3300025940	Bacteria	10168
604	Ga0207691_10055172	3300025940	Bacteria	3623
605	Ga0207691_10252439	3300025940	Bacteria	1522
606	Ga0207691_10259036	3300025940	Bacteria	1500
607	Ga0207711_10001215	3300025941	Bacteria	24411
608	Ga0207711_10013995	3300025941	Bacteria	6662
609	Ga0207711_10043013	3300025941	Bacteria	3851
610	Ga0207711_10090909	3300025941	Bacteria	2684
611	Ga0207689_10000065	3300025942	Bacteria	84074
612	Ga0207689_10004984	3300025942	Bacteria	11961
613	Ga0207689_10015299	3300025942	Bacteria	6495
614	Ga0207689_10025458	3300025942	Bacteria	4959
615	Ga0207689_10045936	3300025942	Bacteria	3611
616	Ga0207689_10128001	3300025942	Bacteria	2088
617	Ga0207661_10125768	3300025944	Bacteria	2189
618	Ga0207679_10000006	3300025945	Bacteria	498868
619	Ga0207679_10000969	3300025945	Bacteria	18437
620	Ga0207679_10051237	3300025945	Bacteria	3021
621	Ga0207679_10092316	3300025945	Bacteria	2345
622	Ga0207679_10107814	3300025945	Unclassified	2192
623	Ga0207679_10321620	3300025945	Bacteria	1340
624	Ga0207667_10002529	3300025949	Bacteria	22762
625	Ga0207667_10009404	3300025949	Bacteria	11512
626	Ga0207667_10099373	3300025949	Bacteria	3002
627	Ga0207667_10226328	3300025949	Bacteria	1916
628	Ga0207667_10265361	3300025949	Bacteria	1756
629	Ga0207667_10285795	3300025949	Bacteria	1685
630	Ga0207651_10006243	3300025960	Bacteria	6211
631	Ga0207651_10013945	3300025960	Bacteria	4623
632	Ga0207651_10024114	3300025960	Bacteria	3756
633	Ga0207651_10025670	3300025960	Bacteria	3667
634	Ga0207651_10057132	3300025960	Bacteria	2689
635	Ga0207651_10087297	3300025960	Bacteria	2270
636	Ga0207651_10203862	3300025960	Bacteria	1587
637	Ga0207712_10180314	3300025961	Bacteria	1658
638	Ga0207668_10005411	3300025972	Bacteria	7521
639	Ga0207668_10021408	3300025972	Bacteria	4123
640	Ga0207668_10081974	3300025972	Bacteria	2342
641	Ga0207640_10006084	3300025981	Bacteria	6597
642	Ga0207640_10045018	3300025981	Bacteria	2831
643	Ga0207640_10064167	3300025981	Bacteria	2444
644	Ga0207658_10002178	3300025986	Bacteria	14564
645	Ga0207658_10026772	3300025986	Bacteria	4046
646	Ga0207658_10048704	3300025986	Bacteria	3109
647	Ga0207658_10075314	3300025986	Bacteria	2568
648	Ga0207658_10125308	3300025986	Bacteria	2055
649	Ga0207658_10133871	3300025986	Bacteria	1995
650	Ga0207658_10153633	3300025986	Bacteria	1878
651	Ga0207677_10005334	3300026023	Bacteria	6972
652	Ga0207677_10018677	3300026023	Bacteria	4166
653	Ga0207677_10019904	3300026023	Bacteria	4062
654	Ga0207703_10000882	3300026035	Bacteria	29506
655	Ga0207703_10000935	3300026035	Bacteria	28307
656	Ga0207703_10024493	3300026035	Bacteria	4747
657	Ga0207703_10030101	3300026035	Bacteria	4288
658	Ga0207703_10032159	3300026035	Bacteria	4151
659	Ga0207703_10099993	3300026035	Bacteria	2456
660	Ga0207703_10204757	3300026035	Bacteria	1755
661	Ga0207639_10017142	3300026041	Bacteria	5132
662	Ga0207639_10047875	3300026041	Bacteria	3233
663	Ga0207639_10111681	3300026041	Bacteria	2229
664	Ga0207639_10253867	3300026041	Bacteria	1535
665	Ga0207678_10000654	3300026067	Bacteria	31838
666	Ga0207678_10011318	3300026067	Bacteria	7830
667	Ga0207678_10059487	3300026067	Bacteria	3287
668	Ga0207678_10156082	3300026067	Bacteria	1948
669	Ga0207708_10003045	3300026075	Bacteria	12348
670	Ga0207708_10032045	3300026075	Bacteria	3991
671	Ga0207708_10075239	3300026075	Bacteria	2589
672	Ga0207708_10116176	3300026075	Bacteria	2081
673	Ga0207702_10003864	3300026078	Bacteria	13505
674	Ga0207702_10052126	3300026078	Bacteria	3461
675	Ga0207702_10107725	3300026078	Bacteria	2472
676	Ga0207702_10111878	3300026078	Bacteria	2429
677	Ga0207702_10113942	3300026078	Bacteria	2409
678	Ga0207702_10286371	3300026078	Bacteria	1559
679	Ga0207641_10024009	3300026088	Bacteria	5024
680	Ga0207641_10038659	3300026088	Bacteria	3989
681	Ga0207641_10042026	3300026088	Bacteria	3834
682	Ga0207641_10049576	3300026088	Bacteria	3549
683	Ga0207648_10002002	3300026089	Bacteria	22242
684	Ga0207648_10003235	3300026089	Bacteria	17141
685	Ga0207648_10007134	3300026089	Bacteria	11021
686	Ga0207648_10009934	3300026089	Bacteria	9068
687	Ga0207648_10018306	3300026089	Bacteria	6345
688	Ga0207648_10025832	3300026089	Bacteria	5226
689	Ga0207648_10087699	3300026089	Bacteria	2716
690	Ga0207648_10101620	3300026089	Bacteria	2519
691	Ga0207648_10112978	3300026089	Bacteria	2385
692	Ga0207648_10216754	3300026089	Bacteria	1700
693	Ga0207648_10378916	3300026089	Bacteria	1279
694	Ga0207676_10003080	3300026095	Bacteria	11900
695	Ga0207676_10008258	3300026095	Bacteria	7405
696	Ga0207676_10013466	3300026095	Bacteria	5875
697	Ga0207676_10022814	3300026095	Bacteria	4608
698	Ga0207676_10091332	3300026095	Bacteria	2501
699	Ga0207676_10267566	3300026095	Bacteria	1546
700	Ga0207674_10002032	3300026116	Bacteria	25666
701	Ga0207674_10003437	3300026116	Bacteria	19384
702	Ga0207674_10008004	3300026116	Bacteria	12264
703	Ga0207674_10023929	3300026116	Bacteria	6533
704	Ga0207674_10183529	3300026116	Bacteria	2043
705	Ga0207675_100001205	3300026118	Bacteria	25755
706	Ga0207675_100023730	3300026118	Bacteria	5707
707	Ga0207675_100040951	3300026118	Bacteria	4328
708	Ga0207675_100055960	3300026118	Bacteria	3680
709	Ga0207675_100108276	3300026118	Bacteria	2621
710	Ga0207675_100110263	3300026118	Bacteria	2597
711	Ga0207675_100114312	3300026118	Bacteria	2549
712	Ga0207675_100346852	3300026118	Bacteria	1454
713	Ga0207683_10000020	3300026121	Bacteria	118805
714	Ga0207683_10000686	3300026121	Bacteria	31075
715	Ga0207683_10000744	3300026121	Bacteria	29624
716	Ga0207683_10015179	3300026121	Bacteria	6555
717	Ga0207683_10043937	3300026121	Bacteria	3905
718	Ga0207683_10123856	3300026121	Bacteria	2322
719	Ga0207683_10261256	3300026121	Bacteria	1581
720	Ga0207698_10023083	3300026142	Bacteria	4340
721	Ga0207698_10024378	3300026142	Bacteria	4246
722	Ga0207698_10040074	3300026142	Bacteria	3476
723	Ga0207698_10257382	3300026142	Bacteria	1601
724	Ga0209281_1000018	3300027111	Bacteria	579091
725	Ga0209281_1000077	3300027111	Bacteria	262887
726	Ga0209281_1004346	3300027111	Bacteria	4268
727	Ga0209281_1007031	3300027111	Bacteria	2853
728	Ga0209371_1000397	3300027312	Bacteria	45561
729	Ga0209981_1006054	3300027378	Bacteria	1615
730	Ga0209996_1000212	3300027395	Bacteria	7599
731	Ga0209995_1002194	3300027471	Bacteria	3068
732	Ga0209968_1003820	3300027526	Bacteria	2261
733	Ga0209983_1000457	3300027665	Bacteria	8828
734	Ga0209974_10000870	3300027876	Bacteria	10438
735	Ga0209974_10004610	3300027876	Bacteria	4903
736	Ga0207428_10059748	3300027907	Bacteria	3022
737	Ga0207428_10076883	3300027907	Bacteria	2614
738	Ga0207428_10177629	3300027907	Bacteria	1610
739	Ga0207428_10202905	3300027907	Bacteria	1492
740	Ga0268266_10011128	3300028379	Bacteria	7832
741	Ga0268266_10021179	3300028379	Bacteria	5539
742	Ga0268266_10114805	3300028379	Bacteria	2390
743	Ga0268266_10128542	3300028379	Bacteria	2264
744	Ga0268265_10035550	3300028380	Bacteria	3641
745	Ga0268265_10060468	3300028380	Bacteria	2903
746	Ga0268265_10129806	3300028380	Bacteria	2092
747	Ga0268264_10001146	3300028381	Bacteria	25886
748	Ga0268264_10004082	3300028381	Bacteria	12499
749	Ga0268264_10020406	3300028381	Bacteria	5416
750	Ga0268264_10021996	3300028381	Bacteria	5204
751	Ga0268264_10088923	3300028381	Bacteria	2659
752	Ga0268264_10125622	3300028381	Bacteria	2266
753	Ga0268264_10152539	3300028381	Bacteria	2073
754	Ga0265319_1032017	3300028563	Bacteria	1827
755	Ga0268256_1000340	3300030500	Bacteria	45572
756	Ga0314311_1034768	3300030733	Bacteria	3879
757	Ga0316183_1066633	3300030742	Bacteria	1367
758	Ga0265328_10000002	3300031239	Bacteria	275819
759	Ga0265328_10046576	3300031239	Bacteria	1594
760	Ga0265331_10088348	3300031250	Bacteria	1434
761	Ga0265327_10006360	3300031251	Bacteria	9469
762	Ga0265327_10007314	3300031251	Bacteria	8558
763	Ga0265327_10009323	3300031251	Bacteria	7103
764	Ga0265316_10087316	3300031344	Bacteria	2383
765	Ga0307408_100000050	3300031548	Bacteria	157571
766	Ga0307408_100028350	3300031548	Bacteria	3868
767	Ga0307408_100142686	3300031548	Bacteria	1881
768	Ga0316575_10001029	3300031665	Bacteria	8643
769	Ga0316575_10017936	3300031665	Bacteria	2694
770	Ga0316579_10000066	3300031691	Bacteria	26093
771	Ga0316579_10000265	3300031691	Bacteria	16028
772	Ga0316579_10002328	3300031691	Bacteria	7179
773	Ga0316579_10005939	3300031691	Bacteria	4953
774	Ga0316579_10024451	3300031691	Bacteria	2720
775	Ga0316579_10093047	3300031691	Bacteria	1440
776	Ga0265314_10029106	3300031711	Bacteria	4109
777	Ga0316576_10002339	3300031727	Bacteria	10767
778	Ga0316576_10005435	3300031727	Bacteria	7784
779	Ga0316576_10018250	3300031727	Bacteria	4786
780	Ga0316576_10026296	3300031727	Bacteria	4084
781	Ga0316576_10050219	3300031727	Bacteria	3032
782	Ga0316576_10144787	3300031727	Bacteria	1790
783	Ga0316578_10026863	3300031728	Bacteria	3248
784	Ga0316578_10027076	3300031728	Bacteria	3238
785	Ga0316578_10029694	3300031728	Bacteria	3104
786	Ga0316578_10036774	3300031728	Bacteria	2819
787	Ga0316578_10053865	3300031728	Bacteria	2358
788	Ga0316578_10166542	3300031728	Bacteria	1328
789	Ga0307405_10027301	3300031731	Bacteria	3307
790	Ga0307405_10095899	3300031731	Bacteria	1976
791	Ga0316577_10001913	3300031733	Bacteria	10071
792	Ga0316577_10012784	3300031733	Bacteria	4579
793	Ga0316577_10128689	3300031733	Bacteria	1424
794	Ga0307413_10011950	3300031824	Bacteria	4297
795	Ga0307406_10094321	3300031901	Bacteria	2023
796	Ga0307406_10116545	3300031901	Bacteria	1848
797	Ga0307412_10096707	3300031911	Bacteria	2079
798	Ga0307412_10098882	3300031911	Bacteria	2058
799	Ga0307412_10111443	3300031911	Bacteria	1954
800	Ga0307412_10116800	3300031911	Bacteria	1914
801	Ga0307412_10205600	3300031911	Bacteria	1498
802	Ga0307409_100017692	3300031995	Bacteria	4761
803	Ga0307409_100052760	3300031995	Bacteria	3120
804	Ga0307409_100088234	3300031995	Bacteria	2531
805	Ga0307416_100004425	3300032002	Bacteria	8469
806	Ga0307414_10069199	3300032004	Bacteria	2536
807	Ga0307414_10182005	3300032004	Bacteria	1691
808	Ga0307414_10336078	3300032004	Bacteria	1291
809	Ga0307411_10025401	3300032005	Bacteria	3548
810	Ga0307411_10100668	3300032005	Bacteria	2043
811	Ga0316583_10006017	3300032133	Bacteria	4360
812	Ga0316583_10007429	3300032133	Bacteria	3944
813	Ga0316583_10023526	3300032133	Bacteria	2200
814	Ga0316583_10047852	3300032133	Bacteria	1507
815	Ga0316585_10000045	3300032137	Bacteria	19293
816	Ga0316585_10000063	3300032137	Bacteria	17552
817	Ga0316585_10004640	3300032137	Bacteria	3842
818	Ga0316580_10000166	3300032139	Bacteria	12994
819	Ga0316580_10003317	3300032139	Bacteria	4555
820	Ga0316593_10000139	3300032168	Bacteria	10234
821	Ga0316593_10001003	3300032168	Bacteria	5845
822	Ga0316593_10004080	3300032168	Bacteria	3705
823	Ga0316593_10013931	3300032168	Bacteria	2389
824	Ga0307510_10035206	3300033180	Bacteria	5595
825	Ga0316596_1000198	3300033541	Bacteria	8794
826	Ga0373926_0034792	3300035083	Bacteria	1785
827	Ga0373944_0011586	3300035089	Bacteria	2418
828	Ga0373936_0011973	3300035113	Bacteria	3292
829	Ga0373953_0002964	3300035117	Bacteria	5190
830	Ga0373943_0023902	3300035170	Bacteria	2846
831	Ga0373946_0008629	3300035171	Bacteria	3741
832	Ga0373955_0146565	3300035172	Bacteria	1387
833	Ga0316574_0000424	3300035398	Bacteria	16777
834	Ga0316574_0001795	3300035398	Bacteria	10441
835	Ga0316574_0004259	3300035398	Bacteria	7476
836	Ga0316574_0012134	3300035398	Bacteria	4922
837	Ga0316574_0014061	3300035398	Bacteria	4616
838	Ga0316574_0063932	3300035398	Bacteria	2315
839	Ga0316574_0095715	3300035398	Bacteria	1898
840	Ga0316574_0160849	3300035398	Bacteria	1446
841	Ga0316574_0192825	3300035398	Bacteria	1310
842	Ga0373935_0133297	3300035692	Bacteria	1671
843	Ga0373927_0006896	3300035695	Bacteria	7719
844	Ga0373927_0014812	3300035695	Bacteria	5156
845	Ga0373927_0026087	3300035695	Bacteria	3819
846	Ga0373927_0068889	3300035695	Bacteria	2290
847	Ga0373927_0077884	3300035695	Bacteria	2147
848	Ga0373933_0150445	3300035724	Bacteria	1474
849	Ga0373947_0018178	3300035725	Bacteria	4045
850	Ga0373947_0047494	3300035725	Bacteria	2572
851	Ga0373947_0132223	3300035725	Bacteria	1594
852	Ga0373937_0010189	3300036401	Bacteria	8201
853	Ga0373937_0050127	3300036401	Bacteria	3823
854	Ga0373937_0083698	3300036401	Bacteria	2951
855	Ga0373937_0205252	3300036401	Bacteria	1853
856	Ga0316582_0000097	3300036647	Bacteria	23972
857	Ga0316582_0001576	3300036647	Bacteria	10154
858	Ga0316582_0008047	3300036647	Bacteria	5640
859	Ga0316582_0033324	3300036647	Bacteria	3163
860	Ga0316582_0039249	3300036647	Bacteria	2947
861	Ga0316582_0048864	3300036647	Bacteria	2676
862	Ga0316584_0000243	3300036712	Bacteria	27250
863	Ga0316584_0000877	3300036712	Bacteria	17104
864	Ga0316584_0006296	3300036712	Bacteria	8036
865	Ga0316584_0032834	3300036712	Bacteria	3841
866	Ga0316584_0038656	3300036712	Bacteria	3551
867	Ga0316584_0044312	3300036712	Bacteria	3318
868	Ga0316584_0057544	3300036712	Bacteria	2910
869	Ga0373925_0010920	3300037068	Bacteria	6590
870	Ga0373925_0030010	3300037068	Bacteria	3989
871	Ga0373925_0050741	3300037068	Bacteria	3096
872	Ga0373925_0066621	3300037068	Bacteria	2715
873	Ga0373925_0148315	3300037068	Bacteria	1840
874	Ga0373925_0164132	3300037068	Bacteria	1751
875	Ga0395905_0123271	3300037471	Bacteria	2437
876	Ga0395905_0156017	3300037471	Bacteria	2147
877	Ga0395901_0021407	3300038443	Bacteria	6625
878	Ga0237819_03441	3300038705	Bacteria	2805
879	Ga0400490_53660	3300038726	Bacteria	19438
880	Ga0400485_08865	3300038735	Bacteria	3284
881	Ga0400488_43672	3300038741	Bacteria	20946
882	Ga0400486_19648	3300038742	Bacteria	10695
883	Ga0400483_034048	3300039062	Bacteria	4478
884	Ga0400483_200847	3300039062	Bacteria	2511
885	Ga0400483_205966	3300039062	Unclassified	3066
886	Ga0400489_30794	3300039093	Bacteria	8124
887	Ga0439436_0001066	3300041404	Bacteria	7730
888	Ga0439438_007282	3300041405	Bacteria	3796
889	Ga0439438_009147	3300041405	Bacteria	3226
890	Ga0439438_009326	3300041405	Bacteria	3183
891	Ga0439438_011226	3300041405	Bacteria	2798
892	Ga0439438_014227	3300041405	Bacteria	2373
893	Ga0439438_018397	3300041405	Bacteria	1991
894	Ga0439438_019771	3300041405	Bacteria	1899
895	Ga0439438_020464	3300041405	Bacteria	1856
896	Ga0439447_004164	3300041407	Bacteria	5026
897	Ga0439447_007143	3300041407	Bacteria	3568
898	Ga0439447_016163	3300041407	Bacteria	2054
899	Ga0439447_017651	3300041407	Bacteria	1940
900	Ga0439466_0019259	3300041411	Bacteria	2443
901	Ga0439466_0022187	3300041411	Bacteria	2242
902	Ga0439466_0029888	3300041411	Bacteria	1872
903	Ga0439466_0033175	3300041411	Bacteria	1755
904	Ga0439466_0037457	3300041411	Bacteria	1632
905	Ga0439431_0013685	3300041997	Bacteria	1873
906	Ga0439445_0018180	3300042004	Bacteria	1742
907	Ga0439432_003999	3300042006	Bacteria	5414
908	Ga0439432_006452	3300042006	Bacteria	4188
909	Ga0439432_028164	3300042006	Bacteria	1831
910	Ga0439451_009794	3300042009	Bacteria	1934
911	Ga0439451_011915	3300042009	Bacteria	1753
912	Ga0439451_017594	3300042009	Bacteria	1441
913	Ga0439452_004169	3300042010	Bacteria	4900
914	Ga0439452_004341	3300042010	Bacteria	4776
915	Ga0439452_004600	3300042010	Bacteria	4588
916	Ga0439452_007255	3300042010	Bacteria	3408
917	Ga0439452_022833	3300042010	Bacteria	1615
918	Ga0439452_024609	3300042010	Bacteria	1537
919	Ga0439456_006685	3300042013	Bacteria	2359
920	Ga0439456_008257	3300042013	Bacteria	2148
921	Ga0439456_016376	3300042013	Bacteria	1550
922	Ga0439463_003383	3300042016	Bacteria	4040
923	Ga0439463_012370	3300042016	Bacteria	2098
924	Ga0450911_001758	3300042115	Bacteria	4671
925	Ga0450911_007625	3300042115	Bacteria	1561
926	Ga0450919_006828	3300042121	Bacteria	1344
927	Ga0450920_001992	3300042122	Bacteria	3446
928	Ga0450922_001969	3300042124	Bacteria	1967
929	Ga0450890_005971	3300042127	Bacteria	1565
930	Ga0450902_010955	3300042137	Bacteria	1437
931	Ga0450903_008359	3300042138	Bacteria	1693
932	Ga0450905_005666	3300042142	Bacteria	1676
933	Ga0450906_003577	3300042145	Bacteria	3331
934	Ga0450907_001141	3300042146	Bacteria	6031
935	Ga0450907_004088	3300042146	Bacteria	2528
936	Ga0450907_007340	3300042146	Bacteria	1842
937	Ga0450910_000451	3300042147	Bacteria	4860
938	Ga0439446_0010626	3300042156	Bacteria	2483
939	Ga0439446_0024723	3300042156	Bacteria	1715
940	Ga0450908_002045	3300042184	Bacteria	3941
941	Ga0450909_001264	3300042185	Bacteria	3513
942	Ga0439434_0015472	3300042435	Bacteria	2276
943	Ga0439460_0003326	3300042461	Bacteria	3893
944	Ga0439460_0015455	3300042461	Bacteria	2021
945	Ga0450901_002499	3300042533	Bacteria	1973
946	Ga0439440_0018056	3300042993	Bacteria	1559
947	Ga0466957_0027463	3300044842	Bacteria	3383
948	Ga0495617_009964	3300046452	Bacteria	3257
949	Ga0495617_018114	3300046452	Bacteria	2381
950	Ga0495617_028328	3300046452	Bacteria	1882
951	Ga0495617_028754	3300046452	Bacteria	1868
952	Ga0495617_029776	3300046452	Bacteria	1835
953	Ga0495627_004774	3300046453	Bacteria	5601
954	Ga0495627_030469	3300046453	Bacteria	1709
955	Ga0495603_0014545	3300046455	Bacteria	4760
956	Ga0495590_0015199	3300046457	Bacteria	2798
957	Ga0495590_0020051	3300046457	Bacteria	2376
958	Ga0495590_0027269	3300046457	Bacteria	2004
959	Ga0495591_005239	3300046458	Bacteria	6058
960	Ga0495591_020588	3300046458	Bacteria	2175
961	Ga0495591_021100	3300046458	Bacteria	2135
962	Ga0495591_023116	3300046458	Bacteria	1998
963	Ga0495591_026139	3300046458	Bacteria	1819
964	Ga0495629_0091691	3300046459	Bacteria	2120
965	Ga0495629_0222215	3300046459	Bacteria	1303
966	Ga0495638_0013190	3300046460	Bacteria	5637
967	Ga0495638_0016258	3300046460	Bacteria	4985
968	Ga0495638_0077118	3300046460	Bacteria	2030
969	Ga0495638_0080546	3300046460	Bacteria	1978
970	Ga0495638_0154961	3300046460	Bacteria	1326
971	Ga0495653_0020723	3300046463	Bacteria	5324
972	Ga0495653_0052720	3300046463	Bacteria	3117
973	Ga0495653_0060964	3300046463	Bacteria	2855
974	Ga0495650_0010846	3300046471	Bacteria	5050
975	Ga0495650_0034927	3300046471	Bacteria	2218
976	Ga0495650_0035455	3300046471	Bacteria	2196
977	Ga0495650_0069006	3300046471	Bacteria	1392
978	Ga0495650_0071476	3300046471	Bacteria	1360
979	Ga0495580_0011278	3300046472	Bacteria	6915
980	Ga0495582_0037037	3300046473	Bacteria	2683
981	Ga0495605_0017061	3300046474	Bacteria	3919
982	Ga0495605_0020687	3300046474	Bacteria	3494
983	Ga0495605_0041432	3300046474	Bacteria	2293
984	Ga0495605_0067585	3300046474	Bacteria	1695
985	Ga0495639_0010384	3300046475	Bacteria	4010
986	Ga0495639_0015527	3300046475	Bacteria	3303
987	Ga0495662_0012150	3300046476	Bacteria	4206
988	Ga0495664_0017148	3300046477	Bacteria	4138
989	Ga0495584_0027798	3300046491	Bacteria	2866
990	Ga0495584_0036176	3300046491	Bacteria	2494
991	Ga0495584_0058297	3300046491	Bacteria	1942
992	Ga0495584_0069651	3300046491	Bacteria	1767
993	Ga0495584_0071500	3300046491	Bacteria	1743
994	Ga0495584_0093260	3300046491	Bacteria	1519
995	Ga0495585_0010329	3300046492	Bacteria	5565
996	Ga0495585_0012220	3300046492	Bacteria	5059
997	Ga0495585_0019154	3300046492	Bacteria	3949
998	Ga0495585_0036470	3300046492	Bacteria	2772
999	Ga0495585_0039155	3300046492	Bacteria	2665
1000	Ga0495594_0012450	3300046499	Bacteria	4431
1001	Ga0495596_0007382	3300046500	Bacteria	4961
1002	Ga0495607_0012647	3300046501	Bacteria	5560
1003	Ga0495607_0012973	3300046501	Bacteria	5479
1004	Ga0495607_0016408	3300046501	Bacteria	4779
1005	Ga0495607_0022628	3300046501	Bacteria	3944
1006	Ga0495607_0025041	3300046501	Bacteria	3715
1007	Ga0495607_0026872	3300046501	Bacteria	3566
1008	Ga0495607_0028420	3300046501	Bacteria	3451
1009	Ga0495607_0083191	3300046501	Bacteria	1753
1010	Ga0495607_0142634	3300046501	Bacteria	1234
1011	Ga0495583_0010890	3300046506	Bacteria	5258
1012	Ga0495583_0067169	3300046506	Bacteria	1584
1013	Ga0495606_0000884	3300046507	Bacteria	44821
1014	Ga0495606_0019237	3300046507	Bacteria	5089
1015	Ga0495606_0024394	3300046507	Bacteria	4358
1016	Ga0495606_0026011	3300046507	Bacteria	4176
1017	Ga0495606_0035089	3300046507	Bacteria	3433
1018	Ga0495606_0066608	3300046507	Bacteria	2283
1019	Ga0495606_0077291	3300046507	Bacteria	2078
1020	Ga0495606_0207109	3300046507	Bacteria	1114
1021	Ga0495608_0016527	3300046511	Bacteria	5106
1022	Ga0495610_0033495	3300046512	Bacteria	2655
1023	Ga0495610_0050741	3300046512	Bacteria	2023
1024	Ga0495610_0056327	3300046512	Bacteria	1890
1025	Ga0495610_0082671	3300046512	Bacteria	1471
1026	Ga0495616_0012087	3300046513	Bacteria	4914
1027	Ga0495616_0019095	3300046513	Bacteria	3746
1028	Ga0495616_0045692	3300046513	Bacteria	2215
1029	Ga0495616_0070369	3300046513	Bacteria	1694
1030	Ga0495616_0070919	3300046513	Bacteria	1686
1031	Ga0495620_0007055	3300046515	Bacteria	6128
1032	Ga0495620_0027139	3300046515	Bacteria	2684
1033	Ga0495620_0031983	3300046515	Bacteria	2402
1034	Ga0495620_0061483	3300046515	Bacteria	1562
1035	Ga0495628_0010990	3300046516	Bacteria	7667
1036	Ga0495630_0033344	3300046517	Bacteria	3840
1037	Ga0495631_0008870	3300046518	Bacteria	5046
1038	Ga0495631_0041703	3300046518	Bacteria	2030
1039	Ga0495632_0024694	3300046519	Bacteria	3188
1040	Ga0495632_0039475	3300046519	Bacteria	2382
1041	Ga0495632_0046592	3300046519	Bacteria	2153
1042	Ga0495632_0053037	3300046519	Bacteria	1992
1043	Ga0495632_0054787	3300046519	Bacteria	1954
1044	Ga0495637_0009082	3300046520	Bacteria	4857
1045	Ga0495637_0013557	3300046520	Bacteria	3865
1046	Ga0495637_0014185	3300046520	Bacteria	3762
1047	Ga0495637_0015588	3300046520	Bacteria	3566
1048	Ga0495637_0020244	3300046520	Bacteria	3063
1049	Ga0495637_0029385	3300046520	Bacteria	2447
1050	Ga0495637_0040370	3300046520	Bacteria	2009
1051	Ga0495637_0048644	3300046520	Bacteria	1784
1052	Ga0495637_0062974	3300046520	Bacteria	1516
1053	Ga0495637_0099440	3300046520	Bacteria	1138
1054	Ga0495643_0000271	3300046522	Bacteria	75201
1055	Ga0495643_0010180	3300046522	Bacteria	5797
1056	Ga0495643_0057126	3300046522	Bacteria	2080
1057	Ga0495644_0041986	3300046523	Bacteria	1722
1058	Ga0495644_0043613	3300046523	Bacteria	1687
1059	Ga0495648_0017085	3300046524	Bacteria	5202
1060	Ga0495648_0037647	3300046524	Bacteria	3105
1061	Ga0495648_0061093	3300046524	Bacteria	2239
1062	Ga0495648_0067837	3300046524	Bacteria	2084
1063	Ga0495648_0074046	3300046524	Bacteria	1963
1064	Ga0495648_0081689	3300046524	Bacteria	1837
1065	Ga0495648_0092499	3300046524	Bacteria	1688
1066	Ga0495648_0162378	3300046524	Bacteria	1153
1067	Ga0495642_0007423	3300046528	Bacteria	4201
1068	Ga0495642_0016268	3300046528	Bacteria	2897
1069	Ga0495642_0066471	3300046528	Bacteria	1502
1070	Ga0495652_0078810	3300046529	Bacteria	2726
1071	Ga0495654_0007177	3300046530	Bacteria	6257
1072	Ga0495654_0025541	3300046530	Bacteria	3042
1073	Ga0495654_0055566	3300046530	Bacteria	1916
1074	Ga0495654_0056154	3300046530	Bacteria	1904
1075	Ga0495654_0057615	3300046530	Bacteria	1876
1076	Ga0495654_0058162	3300046530	Bacteria	1866
1077	Ga0495654_0063344	3300046530	Bacteria	1770
1078	Ga0495654_0068036	3300046530	Bacteria	1693
1079	Ga0495654_0098999	3300046530	Bacteria	1344
1080	Ga0495665_0021822	3300046531	Bacteria	3443
1081	Ga0495587_0032357	3300046536	Bacteria	3162
1082	Ga0495587_0095110	3300046536	Bacteria	1719
1083	Ga0495609_0009509	3300046538	Bacteria	4703
1084	Ga0495609_0011947	3300046538	Bacteria	4125
1085	Ga0495609_0021235	3300046538	Bacteria	2995
1086	Ga0495609_0055908	3300046538	Bacteria	1749
1087	Ga0495597_0003081	3300046542	Bacteria	10030
1088	Ga0495597_0019251	3300046542	Bacteria	3196
1089	Ga0495597_0020909	3300046542	Bacteria	3043
1090	Ga0495597_0025945	3300046542	Bacteria	2694
1091	Ga0495597_0033319	3300046542	Bacteria	2333
1092	Ga0495597_0036415	3300046542	Bacteria	2215
1093	Ga0495597_0063950	3300046542	Bacteria	1598
1094	Ga0495645_0001129	3300046543	Bacteria	18061
1095	Ga0495645_0042984	3300046543	Bacteria	3296
1096	Ga0495645_0163015	3300046543	Bacteria	1540
1097	Ga0495622_0005454	3300046557	Bacteria	5901
1098	Ga0495622_0007580	3300046557	Bacteria	5040
1099	Ga0495622_0010745	3300046557	Bacteria	4224
1100	Ga0495622_0021132	3300046557	Bacteria	3032
1101	Ga0495622_0045185	3300046557	Bacteria	2047
1102	Ga0495633_0018862	3300046558	Bacteria	3494
1103	Ga0495668_0013472	3300046616	Bacteria	4820
1104	Ga0495668_0053074	3300046616	Bacteria	2242
1105	Ga0495668_0054442	3300046616	Bacteria	2211
1106	Ga0495634_0096120	3300046642	Bacteria	1918
1107	Ga0495611_0005034	3300046648	Bacteria	5662
1108	Ga0495625_0038676	3300046660	Bacteria	3490
1109	Ga0495625_0042931	3300046660	Bacteria	3282
1110	Ga0495625_0057231	3300046660	Bacteria	2773
1111	Ga0495625_0080142	3300046660	Bacteria	2274
1112	Ga0495625_0153291	3300046660	Bacteria	1548
1113	Ga0495635_0011132	3300046663	Bacteria	6306
1114	Ga0495635_0015891	3300046663	Bacteria	5258
1115	Ga0495635_0020465	3300046663	Bacteria	4608
1116	Ga0495659_0014530	3300046664	Bacteria	2578
1117	Ga0495659_0016887	3300046664	Bacteria	2412
1118	Ga0495661_0000127	3300046665	Bacteria	92684
1119	Ga0495661_0024575	3300046665	Bacteria	3900
1120	Ga0495661_0056088	3300046665	Bacteria	2358
1121	Ga0495661_0080037	3300046665	Bacteria	1886
1122	Ga0495661_0109520	3300046665	Bacteria	1541
1123	Ga0495588_0133828	3300046674	Bacteria	1308
1124	Ga0495599_0084226	3300046678	Bacteria	1985
1125	Ga0495599_0106209	3300046678	Bacteria	1750
1126	Ga0495623_0015741	3300046679	Bacteria	4888
1127	Ga0495623_0064215	3300046679	Bacteria	2297
1128	Ga0495646_0072473	3300046680	Bacteria	2025
1129	Ga0495647_0001030	3300046681	Bacteria	8504
1130	Ga0495658_0030468	3300046683	Bacteria	2929
1131	Ga0495658_0067921	3300046683	Bacteria	2063
1132	Ga0495669_0003873	3300046684	Bacteria	6155
1133	Ga0495613_0057477	3300046689	Bacteria	2856
1134	Ga0495613_0095569	3300046689	Bacteria	2149
1135	Ga0495624_0014989	3300046690	Bacteria	5249
1136	Ga0495670_0044617	3300046691	Bacteria	2213
1137	Ga0495670_0059095	3300046691	Bacteria	1924
1138	Ga0495670_0079562	3300046691	Bacteria	1668
1139	Ga0495670_0100718	3300046691	Bacteria	1487
1140	Ga0495670_0136972	3300046691	Bacteria	1278
1141	Ga0495671_0010065	3300046692	Bacteria	5258
1142	Ga0495671_0020363	3300046692	Bacteria	3495
1143	Ga0495671_0033674	3300046692	Bacteria	2608
1144	Ga0495671_0039814	3300046692	Bacteria	2371
1145	Ga0495671_0054821	3300046692	Bacteria	1975
1146	Ga0495671_0057785	3300046692	Bacteria	1919
1147	Ga0495671_0060919	3300046692	Bacteria	1862
1148	Ga0495671_0082275	3300046692	Bacteria	1577
1149	Ga0495671_0107933	3300046692	Bacteria	1359
1150	Ga0495671_0116015	3300046692	Bacteria	1307
1151	Ga0495649_0009026	3300046694	Bacteria	5954
1152	Ga0495649_0010741	3300046694	Bacteria	5394
1153	Ga0495649_0015062	3300046694	Bacteria	4409
1154	Ga0495649_0044103	3300046694	Bacteria	2434
1155	Ga0495649_0045139	3300046694	Bacteria	2404
1156	Ga0495649_0046651	3300046694	Bacteria	2359
1157	Ga0495649_0065107	3300046694	Bacteria	1956
1158	Ga0495649_0066560	3300046694	Bacteria	1933
1159	Ga0495649_0115908	3300046694	Bacteria	1418
1160	Ga0495649_0130405	3300046694	Bacteria	1326
1161	Ga0495589_0007656	3300046794	Bacteria	5656
1162	Ga0495589_0008954	3300046794	Bacteria	5208
1163	Ga0495589_0020456	3300046794	Bacteria	3384
1164	Ga0495589_0051151	3300046794	Bacteria	2043
1165	Ga0495600_0018624	3300046809	Bacteria	4425
1166	Ga0495600_0027549	3300046809	Bacteria	3672
1167	Ga0495660_0027098	3300046810	Bacteria	3243
1168	Ga0495660_0062052	3300046810	Bacteria	2004
1169	Ga0495660_0085868	3300046810	Bacteria	1643
1170	Ga0495660_0086999	3300046810	Bacteria	1630
1171	Ga0495660_0093977	3300046810	Bacteria	1553
1172	Ga0495660_0143497	3300046810	Bacteria	1185
1173	Ga0495660_0156187	3300046810	Bacteria	1122
1174	Ga0495581_0002331	3300047315	Bacteria	10699
1175	Ga0495604_0021078	3300047317	Bacteria	5200
1176	Ga0495636_0005841	3300047318	Bacteria	4826
1177	Ga0495674_0069947	3300047319	Bacteria	3034
1178	Ga0495672_0011351	3300047320	Bacteria	6293
1179	Ga0495672_0015233	3300047320	Bacteria	5229
1180	Ga0495672_0015301	3300047320	Bacteria	5214
1181	Ga0495672_0019663	3300047320	Bacteria	4451
1182	Ga0495672_0023103	3300047320	Bacteria	4031
1183	Ga0495672_0025692	3300047320	Bacteria	3765
1184	Ga0495672_0051739	3300047320	Bacteria	2417
1185	Ga0495672_0065167	3300047320	Bacteria	2083
1186	Ga0495672_0073514	3300047320	Bacteria	1927
1187	Ga0495672_0074841	3300047320	Bacteria	1905
1188	Ga0495680_0063702	3300047322	Bacteria	2830
1189	Ga0495680_0124458	3300047322	Bacteria	1900
1190	Ga0495683_0000018	3300047323	Bacteria	185871
1191	Ga0495683_0012089	3300047323	Bacteria	4537
1192	Ga0495683_0024239	3300047323	Bacteria	3114
1193	Ga0495683_0033459	3300047323	Bacteria	2615
1194	Ga0495683_0037170	3300047323	Bacteria	2469
1195	Ga0495683_0072592	3300047323	Bacteria	1688
1196	Ga0495687_014325	3300047443	Bacteria	4087
1197	Ga0495687_039927	3300047443	Bacteria	2072
1198	Ga0495687_048037	3300047443	Bacteria	1833
1199	Ga0495675_0047528	3300047444	Bacteria	2730
1200	Ga0495677_0010150	3300047445	Bacteria	3463
1201	Ga0495679_022708	3300047446	Bacteria	2142
1202	Ga0495679_041627	3300047446	Bacteria	1421
1203	Ga0495679_047973	3300047446	Bacteria	1293
1204	Ga0495673_0010575	3300047469	Bacteria	5008
1205	Ga0495673_0010939	3300047469	Bacteria	4908
1206	Ga0495673_0015284	3300047469	Bacteria	3958
1207	Ga0495673_0020853	3300047469	Bacteria	3252
1208	Ga0495673_0024324	3300047469	Bacteria	2929
1209	Ga0495673_0024446	3300047469	Bacteria	2919
1210	Ga0495673_0033210	3300047469	Bacteria	2397
1211	Ga0495673_0035103	3300047469	Bacteria	2313
1212	Ga0495673_0047593	3300047469	Bacteria	1894
1213	Ga0495673_0076178	3300047469	Bacteria	1399
1214	Ga0495681_0010554	3300047470	Bacteria	5587
1215	Ga0495681_0011711	3300047470	Bacteria	5200
1216	Ga0495681_0012445	3300047470	Bacteria	4997
1217	Ga0495681_0012546	3300047470	Bacteria	4973
1218	Ga0495681_0018250	3300047470	Bacteria	3869
1219	Ga0495681_0025789	3300047470	Bacteria	3071
1220	Ga0495681_0029052	3300047470	Bacteria	2835
1221	Ga0495681_0040008	3300047470	Bacteria	2285
1222	Ga0495681_0050207	3300047470	Bacteria	1967
1223	Ga0495681_0055526	3300047470	Bacteria	1846
1224	Ga0495684_0012649	3300047471	Bacteria	6513
1225	Ga0495684_0027815	3300047471	Bacteria	4343
1226	Ga0495684_0124574	3300047471	Bacteria	1939
1227	Ga0495686_0055758	3300047472	Bacteria	2470
1228	Ga0495686_0058017	3300047472	Bacteria	2414
1229	Ga0495593_0027846	3300047673	Bacteria	3107
1230	Ga0495593_0038678	3300047673	Bacteria	2575
1231	Ga0495593_0045367	3300047673	Bacteria	2346
1232	Ga0495593_0130764	3300047673	Bacteria	1274
1233	Ga0495602_0126182	3300048088	Bacteria	2050
1234	Ga0495614_0076558	3300048089	Bacteria	1446
1235	Ga0495626_0010222	3300048091	Bacteria	5026
1236	Ga0495626_0022438	3300048091	Bacteria	3117
1237	Ga0495626_0032439	3300048091	Bacteria	2507
1238	Ga0495626_0033309	3300048091	Bacteria	2470
1239	Ga0495626_0045093	3300048091	Bacteria	2059
1240	Ga0495626_0055102	3300048091	Bacteria	1824
1241	Ga0495626_0061985	3300048091	Bacteria	1699
1242	Ga0495626_0095912	3300048091	Bacteria	1298
1243	Ga0496101_0104288	3300048904	Bacteria	2126
1244	Ga0496102_0027720	3300048905	Bacteria	5058
1245	Ga0496102_0375851	3300048905	Bacteria	1337
1246	Ga0496103_0015294	3300048906	Bacteria	4563
1247	Ga0496103_0065435	3300048906	Bacteria	2268
1248	Ga0496104_0013052	3300048907	Bacteria	7482
1249	Ga0496104_0015342	3300048907	Bacteria	6937
1250	Ga0496105_0041837	3300048908	Bacteria	3776
1251	Ga0496106_0064149	3300048909	Bacteria	2794
1252	Ga0496107_0102161	3300048910	Bacteria	2102
1253	Ga0496107_0189958	3300048910	Bacteria	1526
1254	Ga0496108_0011388	3300048911	Bacteria	7229
1255	Ga0496109_0005430	3300048912	Bacteria	10661
1256	Ga0496109_0039894	3300048912	Bacteria	4251
1257	Ga0496109_0042474	3300048912	Bacteria	4118
1258	Ga0496109_0249094	3300048912	Bacteria	1673
1259	Ga0496110_0051692	3300048913	Bacteria	3611
1260	Ga0496110_0197084	3300048913	Bacteria	1829
1261	Ga0496112_0010454	3300048915	Bacteria	8418
1262	Ga0496112_0069409	3300048915	Bacteria	3481
1263	Ga0496112_0168389	3300048915	Bacteria	2157
1264	Ga0496113_0228920	3300048916	Bacteria	1482
1265	Ga0496114_0017233	3300048917	Bacteria	5827
1266	Ga0496116_0010930	3300048919	Bacteria	7562
1267	Ga0496116_0014283	3300048919	Bacteria	6351
1268	Ga0496116_0018186	3300048919	Bacteria	5428
1269	Ga0496116_0108134	3300048919	Bacteria	1642
1270	Ga0496117_0018237	3300048920	Bacteria	5824
1271	Ga0496117_0020838	3300048920	Bacteria	5332
1272	Ga0496118_0027866	3300048921	Bacteria	4771
1273	Ga0496118_0029638	3300048921	Bacteria	4585
1274	Ga0496118_0073183	3300048921	Bacteria	2456
1275	Ga0496119_0080438	3300048922	Bacteria	1879
1276	Ga0496121_0015741	3300048924	Bacteria	7880
1277	Ga0496122_0027261	3300048925	Bacteria	4889
1278	Ga0496122_0152940	3300048925	Bacteria	1421
1279	Ga0496122_0170941	3300048925	Bacteria	1310
1280	Ga0496123_0065970	3300048926	Bacteria	2296
1281	Ga0496124_0042911	3300048927	Bacteria	3890
1282	Ga0496124_0131324	3300048927	Bacteria	1989
1283	Ga0496124_0142764	3300048927	Bacteria	1887
1284	Ga0496124_0151089	3300048927	Bacteria	1821
1285	Ga0496125_0030687	3300048928	Bacteria	4804
1286	Ga0496125_0041224	3300048928	Bacteria	3950
1287	Ga0496125_0053097	3300048928	Bacteria	3326
1288	Ga0495678_009579	3300049459	Bacteria	4782
1289	Ga0495678_020442	3300049459	Bacteria	2931
1290	Ga0495678_038587	3300049459	Bacteria	1931
1291	Ga0495678_038699	3300049459	Bacteria	1927
1292	Ga0495678_039987	3300049459	Bacteria	1888
1293	Ga0495678_040228	3300049459	Bacteria	1880
1294	Ga0495678_051289	3300049459	Bacteria	1595
1295	Ga0495682_0030417	3300049460	Bacteria	1997
1296	Ga0495682_0061411	3300049460	Bacteria	1356
1297	Ga0501040_0000159	3300049576	Bacteria	37483
1298	Ga0501040_0016892	3300049576	Bacteria	4837
1299	Ga0501042_0001075	3300049578	Bacteria	15655
1300	Ga0501047_0044540	3300049581	Bacteria	4288
1301	Ga0501067_0011573	3300049583	Bacteria	4887
1302	Ga0501080_0009650	3300049742	Bacteria	8813
1303	Ga0501080_0146083	3300049742	Bacteria	2186
1304	Ga0501083_0079863	3300049744	Bacteria	2169
1305	Ga0501241_020454	3300049758	Bacteria	1217
1306	nmdc:mga03683_43608_c1	3300050489	Bacteria	1851
1307	nmdc:mga08y16_69202_c1	3300050511	Bacteria	3680
1308	nmdc:mga0n895_52145_c1	3300050512	Bacteria	3398
1309	nmdc:mga0n895_59456_c1	3300050512	Bacteria	3770
1310	nmdc:mga0n895_6777_c1	3300050512	Bacteria	9773
1311	nmdc:mga0rr50_107656_c1	3300050513	Bacteria	2201
1312	nmdc:mga0rr50_161186_c1	3300050513	Bacteria	1820
1313	nmdc:mga0rr50_47837_c1	3300050513	Bacteria	3158
1314	nmdc:mga08x19_60743_c1	3300050514	Bacteria	2448
1315	nmdc:mga08x19_9601_c1	3300050514	Bacteria	5792
1316	Ga0495601_0007530	3300053077	Bacteria	6388
1317	Ga0495601_0144268	3300053077	Bacteria	1554
1318	Ga0495595_0060719	3300053084	Bacteria	1770
1319	Ga0495619_0004249	3300053085	Bacteria	9130
1320	Ga0495619_0056286	3300053085	Bacteria	2607
1321	Ga0500618_008723	3300053125	Bacteria	2808
1322	Ga0500586_094527	3300053145	Bacteria	1049
1323	Ga0500622_0000001	3300053156	Bacteria	657715
1324	Ga0500634_0107185	3300053161	Bacteria	1386
1325	2510281267	2510065053	Bacteria	5005518
1326	2510294447	2510065055	Bacteria	5037935
1327	2510309415	2510065058	Bacteria	5005894
1328	2511254975	2511231004	Bacteria	6669789
1329	2511268364	2511231006	Bacteria	6794709
1330	2511272996	2511231007	Bacteria	6306603
1331	2511277823	2511231008	Bacteria	6624100
1332	2511287702	2511231010	Bacteria	6373152
1333	2511295193	2511231011	Bacteria	6149768
1334	2511301169	2511231012	Bacteria	6738011
1335	2511313238	2511231014	Bacteria	6462302
1336	2511321113	2511231015	Bacteria	6598026
1337	2511324125	2511231016	Bacteria	6704427
1338	2511331637	2511231017	Bacteria	6503007
1339	2511339776	2511231018	Bacteria	6436256
1340	2511345883	2511231019	Bacteria	6520662
1341	2511349761	2511231020	Bacteria	6115223
1342	2511359417	2511231021	Bacteria	7302637
1343	2511362920	2511231022	Bacteria	6719296
1344	2511368040	2511231023	Bacteria	6808468
1345	2511410777	2511231031	Bacteria	6558529
1346	2511823627	2511231156	Bacteria	6845832
1347	2512324062	2512047018	Bacteria	6663241
1348	2555671327	2554235341	Bacteria	6867980
1349	2583793734	2582580891	Bacteria	6800976
1350	2597859409	2597489887	Bacteria	6666321
1351	2597862929	2597489888	Bacteria	6179543
1352	2597868730	2597489889	Bacteria	6297495
1353	2599354518	2599185160	Bacteria	6844013
1354	2599359768	2599185161	Bacteria	6960462
1355	2599366090	2599185162	Bacteria	6957254
1356	2599372880	2599185163	Bacteria	6995158
1357	2599379626	2599185164	Bacteria	6841688
1358	2599385396	2599185165	Bacteria	6843250
1359	2599391739	2599185166	Bacteria	6959206
1360	2599396471	2599185167	Bacteria	6353609
1361	2599403505	2599185168	Bacteria	6997636
1362	2599453473	2599185179	Bacteria	6611171
1363	2599461352	2599185181	Bacteria	6844519
1364	2599469896	2599185182	Bacteria	6883168
1365	2599482239	2599185185	Bacteria	6652270
1366	2599490372	2599185186	Bacteria	6831633
1367	2599504119	2599185188	Bacteria	6164180
1368	2599507500	2599185189	Bacteria	5862825
1369	2599514754	2599185190	Bacteria	6285678
1370	2599517264	2599185191	Bacteria	6297582
1371	2599611686	2599185212	Bacteria	6765997
1372	2599770218	2599185248	Bacteria	6696816
1373	2599804042	2599185257	Bacteria	6492581
1374	2599883063	2599185288	Bacteria	6666191
1375	2599887583	2599185289	Bacteria	6778765
1376	2599893981	2599185290	Bacteria	6289611
1377	2599899938	2599185291	Bacteria	6775623
1378	2599932080	2599185300	Bacteria	6062622
1379	2599941853	2599185302	Bacteria	5954930
1380	2599951740	2599185303	Bacteria	6512725
1381	2599952627	2599185304	Bacteria	5951361
1382	2599960515	2599185305	Bacteria	6748700
1383	2599964820	2599185306	Bacteria	6637356
1384	2599976067	2599185308	Bacteria	6621546
1385	2599982018	2599185309	Bacteria	5969593
1386	2599987928	2599185310	Bacteria	6014457
1387	2599995631	2599185311	Bacteria	6354990
1388	2599998181	2599185312	Bacteria	5912071
1389	2600005344	2599185313	Bacteria	6658188
1390	2600010052	2599185314	Bacteria	6621749
1391	2600017445	2599185315	Bacteria	6771107
1392	2600022660	2599185316	Bacteria	6320029
1393	2600027698	2599185317	Bacteria	6435722
1394	2600034464	2599185318	Bacteria	6961590
1395	2600041695	2599185319	Bacteria	6637840
1396	2600046257	2599185320	Bacteria	5963263
1397	2600052268	2599185321	Bacteria	6764560
1398	2600057634	2599185322	Bacteria	6763055
1399	2600065159	2599185323	Bacteria	6688755
1400	2600072375	2599185324	Bacteria	6590677
1401	2600075935	2599185325	Bacteria	6324919
1402	2600213968	2599185356	Bacteria	6843884
1403	2600356593	2600254930	Bacteria	6431253
1404	2600364315	2600254931	Bacteria	6734225
1405	2600445589	2600254954	Bacteria	5100516
1406	2601691451	2600255296	Bacteria	5784754
1407	2601774134	2600255313	Bacteria	6842543
1408	2601796329	2600255318	Bacteria	6383414
1409	2602009998	2600255389	Bacteria	5275336
1410	2606073479	2603880185	Bacteria	6379190
1411	2606126877	2603880199	Bacteria	6377649
1412	2621300997	2619619299	Bacteria	6649820
1413	2624481972	2623620443	Bacteria	6427864
1414	2624490939	2623620446	Bacteria	6500345
1415	2643845684	2643221565	Bacteria	6216018
1416	2643870947	2643221571	Bacteria	6228673
1417	2643956556	2643221589	Bacteria	6250934
1418	2644025402	2643221602	Bacteria	6249926
1419	2644188626	2643221633	Bacteria	6733554
1420	2644281688	2643221650	Bacteria	7029547
1421	2644625203	2643221713	Bacteria	6554480
1422	2652543589	2651869719	Bacteria	6047974
1423	2671090244	2667528170	Bacteria	6786960
1424	2671097099	2667528171	Bacteria	6900659
1425	2671125950	2667528176	Bacteria	6724917
1426	2671770390	2671180172	Bacteria	6495783
1427	2677896770	2675903420	Bacteria	6247433
1428	2678262549	2675903515	Bacteria	6580491
1429	2715751286	2713897148	Bacteria	5883533
1430	2715758282	2713897149	Bacteria	6506249
1431	2718635221	2718217725	Bacteria	5758958
1432	2723247750	2721755607	Bacteria	5841722
1433	2729148912	2728369097	Bacteria	4333476
1434	2738670379	2738541265	Bacteria	6594665
1435	2738748772	2738541282	Bacteria	6593925
1436	2738809656	2738541294	Bacteria	6925949
1437	2738857814	2738541303	Bacteria	6591772
1438	2738897016	2738541309	Bacteria	6926455
1439	2739197109	2738543004	Bacteria	6381073
1440	2739259176	2738543015	Bacteria	6750701
1441	2739288897	2738543020	Bacteria	5718238
1442	2739294209	2738543021	Bacteria	5718241
1443	2739314011	2738543025	Bacteria	6600348
1444	2743738940	2740892503	Bacteria	6855563
1445	2745008891	2744054620	Bacteria	6551379
1446	2774121253	2773857670	Bacteria	6407454
1447	2774131704	2773857672	Bacteria	4993178
1448	2774132881	2773857673	Bacteria	6513460
1449	2784263257	2784132063	Bacteria	6262788
1450	2784316555	2784132072	Bacteria	6596533
1451	2794596358	2791355520	Bacteria	5948615
1452	2808854990	2808606361	Bacteria	6136259
1453	2808923639	2808606376	Bacteria	6248667
1454	2808930663	2808606377	Bacteria	6646337
1455	2808935646	2808606378	Bacteria	6177535
1456	2808940493	2808606379	Bacteria	5022697
1457	2808945598	2808606380	Bacteria	6248705
1458	2808952785	2808606381	Bacteria	6646461
1459	2808957734	2808606382	Bacteria	6841132
1460	2808963659	2808606383	Bacteria	6138645
1461	2808975799	2808606385	Bacteria	6711065
1462	2808990563	2808606388	Bacteria	6706662
1463	2808998383	2808606389	Bacteria	6138126
1464	2809218823	2808606445	Bacteria	6057339
1465	2817489700	2816332298	Bacteria	6852809
1466	2819655718	2818991456	Bacteria	6123676
1467	2819702193	2818991464	Bacteria	6907494
1468	2823424175	2823421272	Bacteria	5372474
1469	2825653094	2825651385	Bacteria	6715909
1470	2834029576	2834028612	Bacteria	6354979
1471	2842810068	2842805378	Bacteria	5385175
1472	2842831711	2842826826	Bacteria	5974129
1473	2842836578	2842832357	Bacteria	5959113
1474	2842842234	2842837860	Bacteria	6066181
1475	2842844691	2842843487	Bacteria	6004777
1476	2842854604	2842854478	Bacteria	6143501
1477	2844671848	2844665904	Bacteria	6817974
1478	2852614908	2852612431	Bacteria	6885235
1479	2852663066	2852657418	Bacteria	6472974
1480	2852669876	2852667396	Bacteria	6885555
1481	2860340882	2860339153	Bacteria	6846989
1482	2860869570	2860867994	Bacteria	5645326
1483	2878033962	2878029506	Bacteria	6418441
1484	2880234582	2880230671	Bacteria	6140320
1485	2904521279	2904518522	Bacteria	6068986
1486	2904555055	2904550169	Bacteria	6221258
1487	2908448496	2908446538	Bacteria	6829095
1488	2913038521	2913036834	Bacteria	6704877
1489	2917075191	2917070673	Bacteria	6868303
1490	2917833564	2917832318	Bacteria	5346010
1491	2919068947	2919063839	Bacteria	6302690
1492	2919129410	2919125081	Bacteria	5385106
1493	2919388057	2919385768	Bacteria	5897293
1494	2919461017	2919456309	Bacteria	6586567
1495	2919481805	2919481497	Bacteria	6907839
1496	2919489758	2919487758	Bacteria	5929766
1497	2919503889	2919501602	Bacteria	5286340
1498	2919701931	2919697872	Bacteria	6553725
1499	2923158017	2923153595	Bacteria	6870622
1500	2923587359	2923586266	Bacteria	6565975
1501	2926065538	2926063275	Bacteria	5285848
1502	2929145981	2929144301	Bacteria	6622272
1503	2929191549	2929189879	Bacteria	5930554
1504	2931370681	2931369376	Bacteria	6847892
1505	2931392638	2931390751	Bacteria	6273349
1506	2931396625	2931396565	Bacteria	7251677
1507	2935356179	2935353572	Unclassified	6955622
1508	2939637566	2939636861	Bacteria	6297853
1509	2945929021	2945928738	Bacteria	6053221
1510	2945962185	2945961074	Bacteria	7342064
1511	2946011237	2946006987	Bacteria	6705746
1512	2946029828	2946027586	Bacteria	6049274
1513	2947236399	2947233263	Bacteria	6439278
1514	2969308734	2969304461	Bacteria	6601805
1515	2974289882	2974289157	Bacteria	6080362
1516	2974300824	2974298342	Bacteria	4840922
1517	2984288160	2984286254	Bacteria	6702062
1518	2984503294	2984499530	Bacteria	5020881
1519	2984508232	2984504281	Bacteria	5262371
1520	2988733516	2988728565	Bacteria	6124362
1521	2998144039	2998139840	Bacteria	6073514
1522	3007256878	3007252601	Bacteria	4559114
1523	3007318869	3007315729	Bacteria	5076637
1524	3007397326	3007395558	Bacteria	6755444
1525	3007513102	3007511990	Bacteria	6481491
1526	3007615584	3007614139	Bacteria	6053559
1527	3007624852	3007619802	Bacteria	6411688
1528	3007718968	3007718800	Bacteria	5971527
1529	3007858974	3007855910	Bacteria	5637581
1530	3007865470	3007861166	Bacteria	6045338
1531	3007870318	3007866637	Bacteria	5899198
1532	637321648	637000220	Bacteria	7074893
1533	640488284	640427133	Bacteria	4567418
1534	651176237	651053060	Bacteria	4689946
1535	8001524656	8001522603	Bacteria	4726425
1536	8015692114	8015687852	Bacteria	6613826
1537	8016729562	8016728285	Bacteria	5263933
1538	8019773102	8019769354	Bacteria	6924660
1539	8019779334	8019775933	Bacteria	6858656
1540	8029996839	8029995093	Bacteria	5990776
1541	8034965807	8034962539	Bacteria	4884839
1542	8054285189	8054285046	Bacteria	6919322
1543	8054352002	8054347763	Bacteria	5901107
1544	8054505152	8054503363	Bacteria	6101651
1545	8055775324	8055770955	Bacteria	6827675
1546	8055819675	8055817908	Bacteria	6609162
1547	8056127517	8056125926	Bacteria	6228218
1548	8056133480	8056131705	Bacteria	6107031
1549	8056147310	8056143049	Bacteria	6307666
1550	8056149753	8056148874	Bacteria	6479865
1551	8056155091	8056155041	Bacteria	6486948
1552	8056164893	8056161164	Bacteria	6106669
1553	8056167244	8056166840	Bacteria	5820959
1554	8056173212	8056172158	Bacteria	6133900
1555	8056179404	8056177738	Bacteria	6748268
1556	8056572780	8056569372	Bacteria	5997322
1557	8057804143	8057798959	Bacteria	6713499
1558	Ga0495591_005410
1559	SwRhRL2b_contig_1343526
1560	JGI24741J21665_1010609
1561	JGI25162J39368_1001982
1562	JGI25162J39368_1001984
1563	JGI25163J39215_1001882
1564	JGI25163J39215_1001893
1565	JGI25164J39214_1000969
1566	JGI25164J39214_1000970
1567	JGI25165J46597_1001793
1568	JGI25165J46597_1001795
1569	Ga0055538_1000102
1570	Ga0055539_1000151
1571	Ga0055533_1000154
1572	Ga0055532_1000165
1573	Ga0055525_1000204
1574	Ga0055536_1002134
1575	Ga0055536_1003058
1576	Ga0055530_10000158
1577	Ga0055530_10006585
1578	Ga0055530_10018132
1579	Ga0055540_1000182
1580	Ga0055540_1002701
1581	Ga0055531_10004241
1582	Ga0055541_1000101
1583	Ga0065714_10003445
1584	Ga0065714_10008329
1585	Ga0065714_10008341
1586	Ga0065714_10010090
1587	Ga0065714_10010507
1588	Ga0065714_10069884
1589	Ga0065714_10079053
1590	Ga0065704_10093866
1591	Ga0065712_10011044
1592	Ga0070658_10008731
1593	Ga0070658_10049312
1594	Ga0070658_10225428
1595	Ga0070676_10009027
1596	Ga0070676_10055874
1597	Ga0070683_100005902
1598	Ga0070683_100020663
1599	Ga0070670_100009541
1600	Ga0070670_100015764
1601	Ga0070670_100018430
1602	Ga0070670_100024825
1603	Ga0070670_100076173
1604	Ga0070670_100093672
1605	Ga0070670_100125348
1606	Ga0070677_10000703
1607	Ga0070677_10018256
1608	Ga0068869_100000438
1609	Ga0068869_100022700
1610	Ga0068869_100066550
1611	Ga0068869_100069230
1612	Ga0070666_10029101
1613	Ga0070680_100007174
1614	Ga0068868_100007254
1615	Ga0070660_100009009
1616	Ga0070660_100010977
1617	Ga0070660_100040578
1618	Ga0070660_100070148
1619	Ga0070689_100015942
1620	Ga0070689_100074642
1621	Ga0070661_100000132
1622	Ga0070661_100002026
1623	Ga0070661_100008903
1624	Ga0070661_100039089
1625	Ga0070661_100091419
1626	Ga0070668_100014622
1627	Ga0070668_100025125
1628	Ga0070669_100003598
1629	Ga0070669_100011597
1630	Ga0070669_100015132
1631	Ga0070669_100015797
1632	Ga0070669_100074129
1633	Ga0070675_100009360
1634	Ga0070675_100012764
1635	Ga0070675_100031118
1636	Ga0070675_100036090
1637	Ga0070675_100039896
1638	Ga0070675_100127372
1639	Ga0070671_100013018
1640	Ga0070671_100039443
1641	Ga0070671_100039510
1642	Ga0070674_100016923
1643	Ga0070674_100068923
1644	Ga0070674_100115633
1645	Ga0070674_100205660
1646	Ga0070673_100001116
1647	Ga0070673_100002706
1648	Ga0070673_100023264
1649	Ga0070673_100026379
1650	Ga0070673_100168571
1651	Ga0070688_100000859
1652	Ga0070688_100022006
1653	Ga0070659_100023112
1654	Ga0070659_100031733
1655	Ga0070667_100005988
1656	Ga0070667_100025516
1657	Ga0070667_100027839
1658	Ga0070667_100091655
1659	Ga0070667_100113083
1660	Ga0070709_10011434
1661	Ga0070714_100016692
1662	Ga0070714_100019400
1663	Ga0070714_100032308
1664	Ga0070714_100033098
1665	Ga0070713_100000032
1666	Ga0070713_100005582
1667	Ga0070713_100005784
1668	Ga0070713_100074970
1669	Ga0070711_100001725
1670	Ga0070711_100111461
1671	Ga0070705_100064691
1672	Ga0070700_100075154
1673	Ga0070700_100123785
1674	Ga0070694_100076906
1675	Ga0070708_100005401
1676	Ga0070663_100004247
1677	Ga0070663_100016099
1678	Ga0070663_100064746
1679	Ga0070663_100128216
1680	Ga0070678_100004857
1681	Ga0070678_100023667
1682	Ga0070678_100028076
1683	Ga0070678_100040039
1684	Ga0070662_100010547
1685	Ga0070662_100085861
1686	Ga0070681_10022155
1687	Ga0070681_10042623
1688	Ga0070681_10163461
1689	Ga0068867_100008336
1690	Ga0068867_100010114
1691	Ga0068867_100022453
1692	Ga0068867_100053855
1693	Ga0068867_100057799
1694	Ga0068867_100064685
1695	Ga0070685_10004154
1696	Ga0070706_100008998
1697	Ga0070706_100057878
1698	Ga0070707_100294332
1699	Ga0070698_100256952
1700	Ga0070699_100034925
1701	Ga0070699_100218379
1702	Ga0070699_100311178
1703	Ga0070679_100010905
1704	Ga0070679_100025218
1705	Ga0070679_100058299
1706	Ga0070684_100002622
1707	Ga0070684_100004381
1708	Ga0070684_100010683
1709	Ga0070697_100018319
1710	Ga0070697_100179485
1711	Ga0068853_100001549
1712	Ga0068853_100003885
1713	Ga0068853_100015040
1714	Ga0068853_100038808
1715	Ga0070672_100000208
1716	Ga0070672_100002162
1717	Ga0070672_100042828
1718	Ga0070686_100008598
1719	Ga0070686_100142911
1720	Ga0070696_100000445
1721	Ga0070693_100001513
1722	Ga0070693_100011814
1723	Ga0070693_100044039
1724	Ga0070665_100003722
1725	Ga0070665_100013936
1726	Ga0070665_100052519
1727	Ga0070665_100057546
1728	Ga0070665_100071773
1729	Ga0070665_100113153
1730	Ga0070665_100504896
1731	Ga0070704_100006009
1732	Ga0068855_100002584
1733	Ga0068855_100091567
1734	Ga0068855_100352076
1735	Ga0070664_100005816
1736	Ga0070664_100011754
1737	Ga0070664_100033914
1738	Ga0070664_100036907
1739	Ga0070664_100042234
1740	Ga0070664_100043927
1741	Ga0070664_100156101
1742	Ga0068857_100008250
1743	Ga0068857_100180626
1744	Ga0068854_100006663
1745	Ga0068854_100009337
1746	Ga0068854_100009862
1747	Ga0068854_100013743
1748	Ga0068854_100031473
1749	Ga0068854_100070174
1750	Ga0068856_100020171
1751	Ga0068856_100024383
1752	Ga0068856_100097960
1753	Ga0068856_100181660
1754	Ga0070702_100024461
1755	Ga0070702_100039585
1756	Ga0068852_100002894
1757	Ga0068852_100007076
1758	Ga0068852_100025689
1759	Ga0068852_100042721
1760	Ga0068852_100111877
1761	Ga0068852_100174040
1762	Ga0068852_100347444
1763	Ga0068859_100000189
1764	Ga0068859_100004540
1765	Ga0068859_100034277
1766	Ga0068859_100533449
1767	Ga0068864_100000192
1768	Ga0068864_100000629
1769	Ga0068864_100003063
1770	Ga0068864_100025075
1771	Ga0068864_100038175
1772	Ga0068864_100065116
1773	Ga0068866_10004337
1774	Ga0068866_10108276
1775	Ga0068861_100004831
1776	Ga0068861_100067210
1777	Ga0068851_10000084
1778	Ga0068851_10000781
1779	Ga0068851_10007670
1780	Ga0068851_10008204
1781	Ga0068851_10010106
1782	Ga0068870_10003067
1783	Ga0068870_10013946
1784	Ga0068863_100003943
1785	Ga0068863_100004551
1786	Ga0068863_100083574
1787	Ga0068863_100138526
1788	Ga0068863_100253388
1789	Ga0068858_100002736
1790	Ga0068858_100028438
1791	Ga0068858_100030176
1792	Ga0068858_100044349
1793	Ga0068858_100094449
1794	Ga0068858_100139570
1795	Ga0068860_100000802
1796	Ga0068860_100005740
1797	Ga0068860_100021225
1798	Ga0068860_100032112
1799	Ga0068860_100045971
1800	Ga0068862_100006071
1801	Ga0068862_100031221
1802	Ga0068862_100037733
1803	Ga0068862_100107023
1804	Ga0068862_100147593
1805	Ga0075432_10019357
1806	Ga0075432_10034468
1807	Ga0075432_10053790
1808	Ga0070715_10003402
1809	Ga0070712_100088502
1810	Ga0075362_10053571
1811	Ga0097621_100013060
1812	Ga0097621_100076113
1813	Ga0097621_100091221
1814	Ga0068871_100004013
1815	Ga0068871_100020139
1816	Ga0068871_100029513
1817	Ga0068871_100034846
1818	Ga0068871_100187366
1819	Ga0075428_100281901
1820	Ga0075433_10156436
1821	Ga0075434_100037825
1822	Ga0075434_100186111
1823	Ga0075434_100383720
1824	Ga0075434_100428445
1825	Ga0068865_100002295
1826	Ga0068865_100032155
1827	Ga0068865_100051255
1828	Ga0068865_100061954
1829	Ga0068865_100148112
1830	Ga0068865_100170225
1831	Ga0075436_100005071
1832	Ga0075436_100038607
1833	Ga0075436_100215291
1834	Ga0097620_100000189
1835	Ga0097620_100004540
1836	Ga0097620_100034273
1837	Ga0097620_100533460
1838	Ga0079104_1000115
1839	Ga0079104_1000806
1840	Ga0079104_1011316
1841	Ga0075435_100002573
1842	Ga0105251_10000252
1843	Ga0105251_10010353
1844	Ga0105251_10020618
1845	Ga0105251_10022034
1846	Ga0105251_10032234
1847	Ga0105244_10013606
1848	Ga0105244_10018383
1849	Ga0105244_10028612
1850	Ga0105244_10046664
1851	Ga0105244_10116870
1852	Ga0105244_10118479
1853	Ga0105250_10000609
1854	Ga0105250_10004476
1855	Ga0105250_10006522
1856	Ga0105250_10009231
1857	Ga0105250_10048928
1858	Ga0105240_10002531
1859	Ga0105240_10006195
1860	Ga0105240_10011696
1861	Ga0105240_10021019
1862	Ga0111539_10012695
1863	Ga0105245_10026231
1864	Ga0105245_10061904
1865	Ga0105247_10020661
1866	Ga0105247_10032402
1867	Ga0114129_10053510
1868	Ga0105243_10007136
1869	Ga0105243_10011236
1870	Ga0105241_10001698
1871	Ga0105241_10023158
1872	Ga0105241_10072866
1873	Ga0105241_10228787
1874	Ga0105242_10010920
1875	Ga0105248_10009318
1876	Ga0105248_10015111
1877	Ga0105248_10015645
1878	Ga0105248_10088468
1879	Ga0105248_10136317
1880	Ga0105248_10181076
1881	Ga0105248_10351177
1882	Ga0105237_10000857
1883	Ga0105237_10039684
1884	Ga0105237_10073399
1885	Ga0105237_10075191
1886	Ga0105238_10000484
1887	Ga0105238_10009771
1888	Ga0105238_10013814
1889	Ga0105238_10089175
1890	Ga0105239_10047948
1891	Ga0105239_10252496
1892	Ga0105239_10334259
1893	Ga0105246_10003724
1894	Ga0105246_10014642
1895	Ga0105246_10018277
1896	Ga0105246_10155085
1897	Ga0105246_10201635
1898	Ga0157345_1000329
1899	Ga0157373_10002280
1900	Ga0157373_10102748
1901	Ga0157373_10111742
1902	Ga0157373_10157668
1903	Ga0157371_10008958
1904	Ga0157371_10018711
1905	Ga0157371_10023866
1906	Ga0157371_10103277
1907	Ga0157371_10176546
1908	Ga0157370_10000850
1909	Ga0157370_10003303
1910	Ga0157370_10012008
1911	Ga0157370_10014064
1912	Ga0157370_10016320
1913	Ga0157370_10048629
1914	Ga0157370_10054387
1915	Ga0157370_10068470
1916	Ga0157370_10183666
1917	Ga0157369_10021039
1918	Ga0157369_10028835
1919	Ga0157369_10083536
1920	Ga0157369_10100920
1921	Ga0157369_10137246
1922	Ga0157369_10238103
1923	Ga0157369_10348991
1924	Ga0157369_10523740
1925	Ga0157374_10020809
1926	Ga0157374_10021478
1927	Ga0157374_10033220
1928	Ga0157374_10093088
1929	Ga0157378_10009785
1930	Ga0157378_10229772
1931	Ga0163162_10017634
1932	Ga0163162_10027615
1933	Ga0163162_10029393
1934	Ga0163162_10036898
1935	Ga0163162_10066742
1936	Ga0163162_10111018
1937	Ga0163162_10303027
1938	Ga0163162_10542868
1939	Ga0157372_10004771
1940	Ga0157372_10027651
1941	Ga0157372_10029746
1942	Ga0157372_10031252
1943	Ga0157372_10046050
1944	Ga0157372_10046651
1945	Ga0157372_10060059
1946	Ga0157372_10345645
1947	Ga0157375_10006017
1948	Ga0157375_10010063
1949	Ga0157375_10022962
1950	Ga0157375_10036251
1951	Ga0157375_10070785
1952	Ga0157375_10077808
1953	Ga0157375_10158342
1954	Ga0157375_10194655
1955	Ga0157375_10230178
1956	Ga0163163_10001101
1957	Ga0163163_10025359
1958	Ga0163163_10047605
1959	Ga0163163_10136331
1960	Ga0163163_10150274
1961	Ga0163163_10512426
1962	Ga0157380_10046974
1963	Ga0157380_10058036
1964	Ga0157380_10134889
1965	Ga0157380_10327324
1966	Ga0182008_10015013
1967	Ga0182008_10015561
1968	Ga0182008_10045884
1969	Ga0182008_10055816
1970	Ga0182008_10068612
1971	Ga0182008_10144390
1972	Ga0157377_10008683
1973	Ga0157379_10000028
1974	Ga0157379_10040070
1975	Ga0157376_10016313
1976	Ga0157376_10020522
1977	Ga0157376_10057108
1978	Ga0157376_10086678
1979	Ga0157376_10095764
1980	Ga0157376_10098618
1981	Ga0182006_1007125
1982	Ga0182006_1007407
1983	Ga0182006_1009294
1984	Ga0182006_1029384
1985	Ga0182006_1030487
1986	Ga0182006_1037664
1987	Ga0182007_10020557
1988	Ga0182007_10055328
1989	Ga0182005_1012435
1990	Ga0182005_1014305
1991	Ga0182005_1027037
1992	Ga0163161_10038650
1993	Ga0163161_10044981
1994	Ga0163161_10071105
1995	Ga0163161_10128967
1996	Ga0163161_10155558
1997	Ga0163161_10242575
1998	Ga0209435_100231
1999	Ga0209760_100011
2000	Ga0209760_100445
2001	Ga0209784_100138
2002	Ga0209566_100179
2003	Ga0209674_100186
2004	Ga0209147_100195
2005	Ga0209563_100148
2006	Ga0209563_101610
2007	Ga0207427_100008
2008	Ga0207427_100082
2009	Ga0209437_100006
2010	Ga0209437_100014
2011	Ga0209258_100339
2012	Ga0209646_1000333
2013	Ga0209677_100137
2014	Ga0209759_1012925
2015	Ga0209233_1000008
2016	Ga0209233_1000105
2017	Ga0209675_1002340
2018	Ga0209676_1000010
2019	Ga0209676_1000345
2020	Ga0209676_1005908
2021	Ga0209050_1000009
2022	Ga0209050_1000081
2023	Ga0209050_1018116
2024	Ga0209051_1000008
2025	Ga0209051_1000104
2026	Ga0209051_1028091
2027	Ga0209257_1000040
2028	Ga0209257_1028786
2029	Ga0207697_10000129
2030	Ga0207697_10045632
2031	Ga0207656_10000034
2032	Ga0207656_10004125
2033	Ga0207656_10019060
2034	Ga0207696_1000063
2035	Ga0207696_1000097
2036	Ga0207696_1000161
2037	Ga0207655_1001435
2038	Ga0207655_1003817
2039	Ga0207655_1005021
2040	Ga0207655_1009651
2041	Ga0207655_1010547
2042	Ga0207655_1029508
2043	Ga0207655_1040106
2044	Ga0207655_1058685
2045	Ga0207713_1000313
2046	Ga0207713_1002959
2047	Ga0207713_1003872
2048	Ga0207713_1004929
2049	Ga0207713_1005398
2050	Ga0207713_1011284
2051	Ga0207713_1024510
2052	Ga0207682_10000157
2053	Ga0207682_10000441
2054	Ga0207710_10012769
2055	Ga0207710_10012793
2056	Ga0207688_10000508
2057	Ga0207688_10043342
2058	Ga0207680_10039771
2059	Ga0207680_10113501
2060	Ga0207680_10144818
2061	Ga0207699_10026989
2062	Ga0207699_10052947
2063	Ga0207645_10005677
2064	Ga0207645_10006193
2065	Ga0207645_10028252
2066	Ga0207645_10067283
2067	Ga0207645_10084684
2068	Ga0207645_10090888
2069	Ga0207643_10000258
2070	Ga0207643_10005143
2071	Ga0207643_10027629
2072	Ga0207705_10044590
2073	Ga0207705_10087149
2074	Ga0207684_10024761
2075	Ga0207684_10092892
2076	Ga0207654_10002541
2077	Ga0207707_10007730
2078	Ga0207707_10008958
2079	Ga0207707_10050431
2080	Ga0207707_10064910
2081	Ga0207695_10008493
2082	Ga0207695_10021152
2083	Ga0207695_10066872
2084	Ga0207671_10000079
2085	Ga0207693_10002980
2086	Ga0207693_10270095
2087	Ga0207663_10005009
2088	Ga0207660_10024200
2089	Ga0207660_10031835
2090	Ga0207660_10070154
2091	Ga0207662_10001920
2092	Ga0207657_10000412
2093	Ga0207657_10000501
2094	Ga0207657_10014608
2095	Ga0207657_10017467
2096	Ga0207657_10025474
2097	Ga0207657_10049858
2098	Ga0207657_10088347
2099	Ga0207649_10000002
2100	Ga0207649_10009029
2101	Ga0207649_10020905
2102	Ga0207649_10060913
2103	Ga0207649_10120158
2104	Ga0207652_10002644
2105	Ga0207652_10021068
2106	Ga0207646_10024731
2107	Ga0207681_10005923
2108	Ga0207681_10023890
2109	Ga0207681_10076086
2110	Ga0207694_10059874
2111	Ga0207650_10000684
2112	Ga0207650_10001264
2113	Ga0207650_10006549
2114	Ga0207650_10006624
2115	Ga0207650_10007946
2116	Ga0207650_10010406
2117	Ga0207650_10069120
2118	Ga0207650_10099298
2119	Ga0207650_10146985
2120	Ga0207659_10155339
2121	Ga0207659_10167912
2122	Ga0207687_10010558
2123	Ga0207687_10030278
2124	Ga0207687_10126779
2125	Ga0207700_10000148
2126	Ga0207700_10062383
2127	Ga0207700_10073731
2128	Ga0207664_10003077
2129	Ga0207664_10005693
2130	Ga0207664_10083844
2131	Ga0207664_10276777
2132	Ga0207644_10004464
2133	Ga0207644_10106060
2134	Ga0207644_10163217
2135	Ga0207690_10022378
2136	Ga0207690_10274361
2137	Ga0207706_10000895
2138	Ga0207706_10000928
2139	Ga0207706_10012617
2140	Ga0207706_10023406
2141	Ga0207706_10146507
2142	Ga0207686_10116856
2143	Ga0207709_10000035
2144	Ga0207709_10045925
2145	Ga0207709_10108403
2146	Ga0207709_10146180
2147	Ga0207670_10063837
2148	Ga0207669_10039457
2149	Ga0207669_10082980
2150	Ga0207669_10109906
2151	Ga0207704_10024731
2152	Ga0207704_10032034
2153	Ga0207704_10060216
2154	Ga0207665_10013628
2155	Ga0207665_10078843
2156	Ga0207691_10000078
2157	Ga0207691_10000087
2158	Ga0207691_10000342
2159	Ga0207691_10002017
2160	Ga0207691_10007997
2161	Ga0207691_10055172
2162	Ga0207691_10252439
2163	Ga0207691_10259036
2164	Ga0207711_10001215
2165	Ga0207711_10013995
2166	Ga0207711_10043013
2167	Ga0207711_10090909
2168	Ga0207689_10000065
2169	Ga0207689_10004984
2170	Ga0207689_10015299
2171	Ga0207689_10025458
2172	Ga0207689_10045936
2173	Ga0207689_10128001
2174	Ga0207661_10125768
2175	Ga0207679_10000006
2176	Ga0207679_10000969
2177	Ga0207679_10051237
2178	Ga0207679_10092316
2179	Ga0207679_10107814
2180	Ga0207679_10321620
2181	Ga0207667_10002529
2182	Ga0207667_10009404
2183	Ga0207667_10099373
2184	Ga0207667_10226328
2185	Ga0207667_10265361
2186	Ga0207667_10285795
2187	Ga0207651_10006243
2188	Ga0207651_10013945
2189	Ga0207651_10024114
2190	Ga0207651_10025670
2191	Ga0207651_10057132
2192	Ga0207651_10087297
2193	Ga0207651_10203862
2194	Ga0207712_10180314
2195	Ga0207668_10005411
2196	Ga0207668_10021408
2197	Ga0207668_10081974
2198	Ga0207640_10006084
2199	Ga0207640_10045018
2200	Ga0207640_10064167
2201	Ga0207658_10002178
2202	Ga0207658_10026772
2203	Ga0207658_10048704
2204	Ga0207658_10075314
2205	Ga0207658_10125308
2206	Ga0207658_10133871
2207	Ga0207658_10153633
2208	Ga0207677_10005334
2209	Ga0207677_10018677
2210	Ga0207677_10019904
2211	Ga0207703_10000882
2212	Ga0207703_10000935
2213	Ga0207703_10024493
2214	Ga0207703_10030101
2215	Ga0207703_10032159
2216	Ga0207703_10099993
2217	Ga0207703_10204757
2218	Ga0207639_10017142
2219	Ga0207639_10047875
2220	Ga0207639_10111681
2221	Ga0207639_10253867
2222	Ga0207678_10000654
2223	Ga0207678_10011318
2224	Ga0207678_10059487
2225	Ga0207678_10156082
2226	Ga0207708_10003045
2227	Ga0207708_10032045
2228	Ga0207708_10075239
2229	Ga0207708_10116176
2230	Ga0207702_10003864
2231	Ga0207702_10052126
2232	Ga0207702_10107725
2233	Ga0207702_10111878
2234	Ga0207702_10113942
2235	Ga0207702_10286371
2236	Ga0207641_10024009
2237	Ga0207641_10038659
2238	Ga0207641_10042026
2239	Ga0207641_10049576
2240	Ga0207648_10002002
2241	Ga0207648_10003235
2242	Ga0207648_10007134
2243	Ga0207648_10009934
2244	Ga0207648_10018306
2245	Ga0207648_10025832
2246	Ga0207648_10087699
2247	Ga0207648_10101620
2248	Ga0207648_10112978
2249	Ga0207648_10216754
2250	Ga0207648_10378916
2251	Ga0207676_10003080
2252	Ga0207676_10008258
2253	Ga0207676_10013466
2254	Ga0207676_10022814
2255	Ga0207676_10091332
2256	Ga0207676_10267566
2257	Ga0207674_10002032
2258	Ga0207674_10003437
2259	Ga0207674_10008004
2260	Ga0207674_10023929
2261	Ga0207674_10183529
2262	Ga0207675_100001205
2263	Ga0207675_100023730
2264	Ga0207675_100040951
2265	Ga0207675_100055960
2266	Ga0207675_100108276
2267	Ga0207675_100110263
2268	Ga0207675_100114312
2269	Ga0207675_100346852
2270	Ga0207683_10000020
2271	Ga0207683_10000686
2272	Ga0207683_10000744
2273	Ga0207683_10015179
2274	Ga0207683_10043937
2275	Ga0207683_10123856
2276	Ga0207683_10261256
2277	Ga0207698_10023083
2278	Ga0207698_10024378
2279	Ga0207698_10040074
2280	Ga0207698_10257382
2281	Ga0209281_1000018
2282	Ga0209281_1000077
2283	Ga0209281_1004346
2284	Ga0209281_1007031
2285	Ga0209371_1000397
2286	Ga0209981_1006054
2287	Ga0209996_1000212
2288	Ga0209995_1002194
2289	Ga0209968_1003820
2290	Ga0209983_1000457
2291	Ga0209974_10000870
2292	Ga0209974_10004610
2293	Ga0207428_10059748
2294	Ga0207428_10076883
2295	Ga0207428_10177629
2296	Ga0207428_10202905
2297	Ga0268266_10011128
2298	Ga0268266_10021179
2299	Ga0268266_10114805
2300	Ga0268266_10128542
2301	Ga0268265_10035550
2302	Ga0268265_10060468
2303	Ga0268265_10129806
2304	Ga0268264_10001146
2305	Ga0268264_10004082
2306	Ga0268264_10020406
2307	Ga0268264_10021996
2308	Ga0268264_10088923
2309	Ga0268264_10125622
2310	Ga0268264_10152539
2311	Ga0265319_1032017
2312	Ga0268256_1000340
2313	Ga0314311_1034768
2314	Ga0316183_1066633
2315	Ga0265328_10000002
2316	Ga0265328_10046576
2317	Ga0265331_10088348
2318	Ga0265327_10006360
2319	Ga0265327_10007314
2320	Ga0265327_10009323
2321	Ga0265316_10087316
2322	Ga0307408_100000050
2323	Ga0307408_100028350
2324	Ga0307408_100142686
2325	Ga0316575_10001029
2326	Ga0316575_10017936
2327	Ga0316579_10000066
2328	Ga0316579_10000265
2329	Ga0316579_10002328
2330	Ga0316579_10005939
2331	Ga0316579_10024451
2332	Ga0316579_10093047
2333	Ga0265314_10029106
2334	Ga0316576_10002339
2335	Ga0316576_10005435
2336	Ga0316576_10018250
2337	Ga0316576_10026296
2338	Ga0316576_10050219
2339	Ga0316576_10144787
2340	Ga0316578_10026863
2341	Ga0316578_10027076
2342	Ga0316578_10029694
2343	Ga0316578_10036774
2344	Ga0316578_10053865
2345	Ga0316578_10166542
2346	Ga0307405_10027301
2347	Ga0307405_10095899
2348	Ga0316577_10001913
2349	Ga0316577_10012784
2350	Ga0316577_10128689
2351	Ga0307413_10011950
2352	Ga0307406_10094321
2353	Ga0307406_10116545
2354	Ga0307412_10096707
2355	Ga0307412_10098882
2356	Ga0307412_10111443
2357	Ga0307412_10116800
2358	Ga0307412_10205600
2359	Ga0307409_100017692
2360	Ga0307409_100052760
2361	Ga0307409_100088234
2362	Ga0307416_100004425
2363	Ga0307414_10069199
2364	Ga0307414_10182005
2365	Ga0307414_10336078
2366	Ga0307411_10025401
2367	Ga0307411_10100668
2368	Ga0316583_10006017
2369	Ga0316583_10007429
2370	Ga0316583_10023526
2371	Ga0316583_10047852
2372	Ga0316585_10000045
2373	Ga0316585_10000063
2374	Ga0316585_10004640
2375	Ga0316580_10000166
2376	Ga0316580_10003317
2377	Ga0316593_10000139
2378	Ga0316593_10001003
2379	Ga0316593_10004080
2380	Ga0316593_10013931
2381	Ga0307510_10035206
2382	Ga0316596_1000198
2383	Ga0373926_0034792
2384	Ga0373944_0011586
2385	Ga0373936_0011973
2386	Ga0373953_0002964
2387	Ga0373943_0023902
2388	Ga0373946_0008629
2389	Ga0373955_0146565
2390	Ga0316574_0000424
2391	Ga0316574_0001795
2392	Ga0316574_0004259
2393	Ga0316574_0012134
2394	Ga0316574_0014061
2395	Ga0316574_0063932
2396	Ga0316574_0095715
2397	Ga0316574_0160849
2398	Ga0316574_0192825
2399	Ga0373935_0133297
2400	Ga0373927_0006896
2401	Ga0373927_0014812
2402	Ga0373927_0026087
2403	Ga0373927_0068889
2404	Ga0373927_0077884
2405	Ga0373933_0150445
2406	Ga0373947_0018178
2407	Ga0373947_0047494
2408	Ga0373947_0132223
2409	Ga0373937_0010189
2410	Ga0373937_0050127
2411	Ga0373937_0083698
2412	Ga0373937_0205252
2413	Ga0316582_0000097
2414	Ga0316582_0001576
2415	Ga0316582_0008047
2416	Ga0316582_0033324
2417	Ga0316582_0039249
2418	Ga0316582_0048864
2419	Ga0316584_0000243
2420	Ga0316584_0000877
2421	Ga0316584_0006296
2422	Ga0316584_0032834
2423	Ga0316584_0038656
2424	Ga0316584_0044312
2425	Ga0316584_0057544
2426	Ga0373925_0010920
2427	Ga0373925_0030010
2428	Ga0373925_0050741
2429	Ga0373925_0066621
2430	Ga0373925_0148315
2431	Ga0373925_0164132
2432	Ga0395905_0123271
2433	Ga0395905_0156017
2434	Ga0395901_0021407
2435	Ga0237819_03441
2436	Ga0400490_53660
2437	Ga0400485_08865
2438	Ga0400488_43672
2439	Ga0400486_19648
2440	Ga0400483_034048
2441	Ga0400483_200847
2442	Ga0400483_205966
2443	Ga0400489_30794
2444	Ga0439436_0001066
2445	Ga0439438_007282
2446	Ga0439438_009147
2447	Ga0439438_009326
2448	Ga0439438_011226
2449	Ga0439438_014227
2450	Ga0439438_018397
2451	Ga0439438_019771
2452	Ga0439438_020464
2453	Ga0439447_004164
2454	Ga0439447_007143
2455	Ga0439447_016163
2456	Ga0439447_017651
2457	Ga0439466_0019259
2458	Ga0439466_0022187
2459	Ga0439466_0029888
2460	Ga0439466_0033175
2461	Ga0439466_0037457
2462	Ga0439431_0013685
2463	Ga0439445_0018180
2464	Ga0439432_003999
2465	Ga0439432_006452
2466	Ga0439432_028164
2467	Ga0439451_009794
2468	Ga0439451_011915
2469	Ga0439451_017594
2470	Ga0439452_004169
2471	Ga0439452_004341
2472	Ga0439452_004600
2473	Ga0439452_007255
2474	Ga0439452_022833
2475	Ga0439452_024609
2476	Ga0439456_006685
2477	Ga0439456_008257
2478	Ga0439456_016376
2479	Ga0439463_003383
2480	Ga0439463_012370
2481	Ga0450911_001758
2482	Ga0450911_007625
2483	Ga0450919_006828
2484	Ga0450920_001992
2485	Ga0450922_001969
2486	Ga0450890_005971
2487	Ga0450902_010955
2488	Ga0450903_008359
2489	Ga0450905_005666
2490	Ga0450906_003577
2491	Ga0450907_001141
2492	Ga0450907_004088
2493	Ga0450907_007340
2494	Ga0450910_000451
2495	Ga0439446_0010626
2496	Ga0439446_0024723
2497	Ga0450908_002045
2498	Ga0450909_001264
2499	Ga0439434_0015472
2500	Ga0439460_0003326
2501	Ga0439460_0015455
2502	Ga0450901_002499
2503	Ga0439440_0018056
2504	Ga0466957_0027463
2505	Ga0495617_009964
2506	Ga0495617_018114
2507	Ga0495617_028328
2508	Ga0495617_028754
2509	Ga0495617_029776
2510	Ga0495627_004774
2511	Ga0495627_030469
2512	Ga0495603_0014545
2513	Ga0495590_0015199
2514	Ga0495590_0020051
2515	Ga0495590_0027269
2516	Ga0495591_005239
2517	Ga0495591_020588
2518	Ga0495591_021100
2519	Ga0495591_023116
2520	Ga0495591_026139
2521	Ga0495629_0091691
2522	Ga0495629_0222215
2523	Ga0495638_0013190
2524	Ga0495638_0016258
2525	Ga0495638_0077118
2526	Ga0495638_0080546
2527	Ga0495638_0154961
2528	Ga0495653_0020723
2529	Ga0495653_0052720
2530	Ga0495653_0060964
2531	Ga0495650_0010846
2532	Ga0495650_0034927
2533	Ga0495650_0035455
2534	Ga0495650_0069006
2535	Ga0495650_0071476
2536	Ga0495580_0011278
2537	Ga0495582_0037037
2538	Ga0495605_0017061
2539	Ga0495605_0020687
2540	Ga0495605_0041432
2541	Ga0495605_0067585
2542	Ga0495639_0010384
2543	Ga0495639_0015527
2544	Ga0495662_0012150
2545	Ga0495664_0017148
2546	Ga0495584_0027798
2547	Ga0495584_0036176
2548	Ga0495584_0058297
2549	Ga0495584_0069651
2550	Ga0495584_0071500
2551	Ga0495584_0093260
2552	Ga0495585_0010329
2553	Ga0495585_0012220
2554	Ga0495585_0019154
2555	Ga0495585_0036470
2556	Ga0495585_0039155
2557	Ga0495594_0012450
2558	Ga0495596_0007382
2559	Ga0495607_0012647
2560	Ga0495607_0012973
2561	Ga0495607_0016408
2562	Ga0495607_0022628
2563	Ga0495607_0025041
2564	Ga0495607_0026872
2565	Ga0495607_0028420
2566	Ga0495607_0083191
2567	Ga0495607_0142634
2568	Ga0495583_0010890
2569	Ga0495583_0067169
2570	Ga0495606_0000884
2571	Ga0495606_0019237
2572	Ga0495606_0024394
2573	Ga0495606_0026011
2574	Ga0495606_0035089
2575	Ga0495606_0066608
2576	Ga0495606_0077291
2577	Ga0495606_0207109
2578	Ga0495608_0016527
2579	Ga0495610_0033495
2580	Ga0495610_0050741
2581	Ga0495610_0056327
2582	Ga0495610_0082671
2583	Ga0495616_0012087
2584	Ga0495616_0019095
2585	Ga0495616_0045692
2586	Ga0495616_0070369
2587	Ga0495616_0070919
2588	Ga0495620_0007055
2589	Ga0495620_0027139
2590	Ga0495620_0031983
2591	Ga0495620_0061483
2592	Ga0495628_0010990
2593	Ga0495630_0033344
2594	Ga0495631_0008870
2595	Ga0495631_0041703
2596	Ga0495632_0024694
2597	Ga0495632_0039475
2598	Ga0495632_0046592
2599	Ga0495632_0053037
2600	Ga0495632_0054787
2601	Ga0495637_0009082
2602	Ga0495637_0013557
2603	Ga0495637_0014185
2604	Ga0495637_0015588
2605	Ga0495637_0020244
2606	Ga0495637_0029385
2607	Ga0495637_0040370
2608	Ga0495637_0048644
2609	Ga0495637_0062974
2610	Ga0495637_0099440
2611	Ga0495643_0000271
2612	Ga0495643_0010180
2613	Ga0495643_0057126
2614	Ga0495644_0041986
2615	Ga0495644_0043613
2616	Ga0495648_0017085
2617	Ga0495648_0037647
2618	Ga0495648_0061093
2619	Ga0495648_0067837
2620	Ga0495648_0074046
2621	Ga0495648_0081689
2622	Ga0495648_0092499
2623	Ga0495648_0162378
2624	Ga0495642_0007423
2625	Ga0495642_0016268
2626	Ga0495642_0066471
2627	Ga0495652_0078810
2628	Ga0495654_0007177
2629	Ga0495654_0025541
2630	Ga0495654_0055566
2631	Ga0495654_0056154
2632	Ga0495654_0057615
2633	Ga0495654_0058162
2634	Ga0495654_0063344
2635	Ga0495654_0068036
2636	Ga0495654_0098999
2637	Ga0495665_0021822
2638	Ga0495587_0032357
2639	Ga0495587_0095110
2640	Ga0495609_0009509
2641	Ga0495609_0011947
2642	Ga0495609_0021235
2643	Ga0495609_0055908
2644	Ga0495597_0003081
2645	Ga0495597_0019251
2646	Ga0495597_0020909
2647	Ga0495597_0025945
2648	Ga0495597_0033319
2649	Ga0495597_0036415
2650	Ga0495597_0063950
2651	Ga0495645_0001129
2652	Ga0495645_0042984
2653	Ga0495645_0163015
2654	Ga0495622_0005454
2655	Ga0495622_0007580
2656	Ga0495622_0010745
2657	Ga0495622_0021132
2658	Ga0495622_0045185
2659	Ga0495633_0018862
2660	Ga0495668_0013472
2661	Ga0495668_0053074
2662	Ga0495668_0054442
2663	Ga0495634_0096120
2664	Ga0495611_0005034
2665	Ga0495625_0038676
2666	Ga0495625_0042931
2667	Ga0495625_0057231
2668	Ga0495625_0080142
2669	Ga0495625_0153291
2670	Ga0495635_0011132
2671	Ga0495635_0015891
2672	Ga0495635_0020465
2673	Ga0495659_0014530
2674	Ga0495659_0016887
2675	Ga0495661_0000127
2676	Ga0495661_0024575
2677	Ga0495661_0056088
2678	Ga0495661_0080037
2679	Ga0495661_0109520
2680	Ga0495588_0133828
2681	Ga0495599_0084226
2682	Ga0495599_0106209
2683	Ga0495623_0015741
2684	Ga0495623_0064215
2685	Ga0495646_0072473
2686	Ga0495647_0001030
2687	Ga0495658_0030468
2688	Ga0495658_0067921
2689	Ga0495669_0003873
2690	Ga0495613_0057477
2691	Ga0495613_0095569
2692	Ga0495624_0014989
2693	Ga0495670_0044617
2694	Ga0495670_0059095
2695	Ga0495670_0079562
2696	Ga0495670_0100718
2697	Ga0495670_0136972
2698	Ga0495671_0010065
2699	Ga0495671_0020363
2700	Ga0495671_0033674
2701	Ga0495671_0039814
2702	Ga0495671_0054821
2703	Ga0495671_0057785
2704	Ga0495671_0060919
2705	Ga0495671_0082275
2706	Ga0495671_0107933
2707	Ga0495671_0116015
2708	Ga0495649_0009026
2709	Ga0495649_0010741
2710	Ga0495649_0015062
2711	Ga0495649_0044103
2712	Ga0495649_0045139
2713	Ga0495649_0046651
2714	Ga0495649_0065107
2715	Ga0495649_0066560
2716	Ga0495649_0115908
2717	Ga0495649_0130405
2718	Ga0495589_0007656
2719	Ga0495589_0008954
2720	Ga0495589_0020456
2721	Ga0495589_0051151
2722	Ga0495600_0018624
2723	Ga0495600_0027549
2724	Ga0495660_0027098
2725	Ga0495660_0062052
2726	Ga0495660_0085868
2727	Ga0495660_0086999
2728	Ga0495660_0093977
2729	Ga0495660_0143497
2730	Ga0495660_0156187
2731	Ga0495581_0002331
2732	Ga0495604_0021078
2733	Ga0495636_0005841
2734	Ga0495674_0069947
2735	Ga0495672_0011351
2736	Ga0495672_0015233
2737	Ga0495672_0015301
2738	Ga0495672_0019663
2739	Ga0495672_0023103
2740	Ga0495672_0025692
2741	Ga0495672_0051739
2742	Ga0495672_0065167
2743	Ga0495672_0073514
2744	Ga0495672_0074841
2745	Ga0495680_0063702
2746	Ga0495680_0124458
2747	Ga0495683_0000018
2748	Ga0495683_0012089
2749	Ga0495683_0024239
2750	Ga0495683_0033459
2751	Ga0495683_0037170
2752	Ga0495683_0072592
2753	Ga0495687_014325
2754	Ga0495687_039927
2755	Ga0495687_048037
2756	Ga0495675_0047528
2757	Ga0495677_0010150
2758	Ga0495679_022708
2759	Ga0495679_041627
2760	Ga0495679_047973
2761	Ga0495673_0010575
2762	Ga0495673_0010939
2763	Ga0495673_0015284
2764	Ga0495673_0020853
2765	Ga0495673_0024324
2766	Ga0495673_0024446
2767	Ga0495673_0033210
2768	Ga0495673_0035103
2769	Ga0495673_0047593
2770	Ga0495673_0076178
2771	Ga0495681_0010554
2772	Ga0495681_0011711
2773	Ga0495681_0012445
2774	Ga0495681_0012546
2775	Ga0495681_0018250
2776	Ga0495681_0025789
2777	Ga0495681_0029052
2778	Ga0495681_0040008
2779	Ga0495681_0050207
2780	Ga0495681_0055526
2781	Ga0495684_0012649
2782	Ga0495684_0027815
2783	Ga0495684_0124574
2784	Ga0495686_0055758
2785	Ga0495686_0058017
2786	Ga0495593_0027846
2787	Ga0495593_0038678
2788	Ga0495593_0045367
2789	Ga0495593_0130764
2790	Ga0495602_0126182
2791	Ga0495614_0076558
2792	Ga0495626_0010222
2793	Ga0495626_0022438
2794	Ga0495626_0032439
2795	Ga0495626_0033309
2796	Ga0495626_0045093
2797	Ga0495626_0055102
2798	Ga0495626_0061985
2799	Ga0495626_0095912
2800	Ga0496101_0104288
2801	Ga0496102_0027720
2802	Ga0496102_0375851
2803	Ga0496103_0015294
2804	Ga0496103_0065435
2805	Ga0496104_0013052
2806	Ga0496104_0015342
2807	Ga0496105_0041837
2808	Ga0496106_0064149
2809	Ga0496107_0102161
2810	Ga0496107_0189958
2811	Ga0496108_0011388
2812	Ga0496109_0005430
2813	Ga0496109_0039894
2814	Ga0496109_0042474
2815	Ga0496109_0249094
2816	Ga0496110_0051692
2817	Ga0496110_0197084
2818	Ga0496112_0010454
2819	Ga0496112_0069409
2820	Ga0496112_0168389
2821	Ga0496113_0228920
2822	Ga0496114_0017233
2823	Ga0496116_0010930
2824	Ga0496116_0014283
2825	Ga0496116_0018186
2826	Ga0496116_0108134
2827	Ga0496117_0018237
2828	Ga0496117_0020838
2829	Ga0496118_0027866
2830	Ga0496118_0029638
2831	Ga0496118_0073183
2832	Ga0496119_0080438
2833	Ga0496121_0015741
2834	Ga0496122_0027261
2835	Ga0496122_0152940
2836	Ga0496122_0170941
2837	Ga0496123_0065970
2838	Ga0496124_0042911
2839	Ga0496124_0131324
2840	Ga0496124_0142764
2841	Ga0496124_0151089
2842	Ga0496125_0030687
2843	Ga0496125_0041224
2844	Ga0496125_0053097
2845	Ga0495678_009579
2846	Ga0495678_020442
2847	Ga0495678_038587
2848	Ga0495678_038699
2849	Ga0495678_039987
2850	Ga0495678_040228
2851	Ga0495678_051289
2852	Ga0495682_0030417
2853	Ga0495682_0061411
2854	Ga0501040_0000159
2855	Ga0501040_0016892
2856	Ga0501042_0001075
2857	Ga0501047_0044540
2858	Ga0501067_0011573
2859	Ga0501080_0009650
2860	Ga0501080_0146083
2861	Ga0501083_0079863
2862	Ga0501241_020454
2863	nmdc:mga03683_43608_c1
2864	nmdc:mga08y16_69202_c1
2865	nmdc:mga0n895_52145_c1
2866	nmdc:mga0n895_59456_c1
2867	nmdc:mga0n895_6777_c1
2868	nmdc:mga0rr50_107656_c1
2869	nmdc:mga0rr50_161186_c1
2870	nmdc:mga0rr50_47837_c1
2871	nmdc:mga08x19_60743_c1
2872	nmdc:mga08x19_9601_c1
2873	Ga0495601_0007530
2874	Ga0495601_0144268
2875	Ga0495595_0060719
2876	Ga0495619_0004249
2877	Ga0495619_0056286
2878	Ga0500618_008723
2879	Ga0500586_094527
2880	Ga0500622_0000001
2881	Ga0500634_0107185
2882	2510281267
2883	2510294447
2884	2510309415
2885	2511254975
2886	2511268364
2887	2511272996
2888	2511277823
2889	2511287702
2890	2511295193
2891	2511301169
2892	2511313238
2893	2511321113
2894	2511324125
2895	2511331637
2896	2511339776
2897	2511345883
2898	2511349761
2899	2511359417
2900	2511362920
2901	2511368040
2902	2511410777
2903	2511823627
2904	2512324062
2905	2555671327
2906	2583793734
2907	2597859409
2908	2597862929
2909	2597868730
2910	2599354518
2911	2599359768
2912	2599366090
2913	2599372880
2914	2599379626
2915	2599385396
2916	2599391739
2917	2599396471
2918	2599403505
2919	2599453473
2920	2599461352
2921	2599469896
2922	2599482239
2923	2599490372
2924	2599504119
2925	2599507500
2926	2599514754
2927	2599517264
2928	2599611686
2929	2599770218
2930	2599804042
2931	2599883063
2932	2599887583
2933	2599893981
2934	2599899938
2935	2599932080
2936	2599941853
2937	2599951740
2938	2599952627
2939	2599960515
2940	2599964820
2941	2599976067
2942	2599982018
2943	2599987928
2944	2599995631
2945	2599998181
2946	2600005344
2947	2600010052
2948	2600017445
2949	2600022660
2950	2600027698
2951	2600034464
2952	2600041695
2953	2600046257
2954	2600052268
2955	2600057634
2956	2600065159
2957	2600072375
2958	2600075935
2959	2600213968
2960	2600356593
2961	2600364315
2962	2600445589
2963	2601691451
2964	2601774134
2965	2601796329
2966	2602009998
2967	2606073479
2968	2606126877
2969	2621300997
2970	2624481972
2971	2624490939
2972	2643845684
2973	2643870947
2974	2643956556
2975	2644025402
2976	2644188626
2977	2644281688
2978	2644625203
2979	2652543589
2980	2671090244
2981	2671097099
2982	2671125950
2983	2671770390
2984	2677896770
2985	2678262549
2986	2715751286
2987	2715758282
2988	2718635221
2989	2723247750
2990	2729148912
2991	2738670379
2992	2738748772
2993	2738809656
2994	2738857814
2995	2738897016
2996	2739197109
2997	2739259176
2998	2739288897
2999	2739294209
3000	2739314011
3001	2743738940
3002	2745008891
3003	2774121253
3004	2774131704
3005	2774132881
3006	2784263257
3007	2784316555
3008	2794596358
3009	2808854990
3010	2808923639
3011	2808930663
3012	2808935646
3013	2808940493
3014	2808945598
3015	2808952785
3016	2808957734
3017	2808963659
3018	2808975799
3019	2808990563
3020	2808998383
3021	2809218823
3022	2817489700
3023	2819655718
3024	2819702193
3025	2823424175
3026	2825653094
3027	2834029576
3028	2842810068
3029	2842831711
3030	2842836578
3031	2842842234
3032	2842844691
3033	2842854604
3034	2844671848
3035	2852614908
3036	2852663066
3037	2852669876
3038	2860340882
3039	2860869570
3040	2878033962
3041	2880234582
3042	2904521279
3043	2904555055
3044	2908448496
3045	2913038521
3046	2917075191
3047	2917833564
3048	2919068947
3049	2919129410
3050	2919388057
3051	2919461017
3052	2919481805
3053	2919489758
3054	2919503889
3055	2919701931
3056	2923158017
3057	2923587359
3058	2926065538
3059	2929145981
3060	2929191549
3061	2931370681
3062	2931392638
3063	2931396625
3064	2935356179
3065	2939637566
3066	2945929021
3067	2945962185
3068	2946011237
3069	2946029828
3070	2947236399
3071	2969308734
3072	2974289882
3073	2974300824
3074	2984288160
3075	2984503294
3076	2984508232
3077	2988733516
3078	2998144039
3079	3007256878
3080	3007318869
3081	3007397326
3082	3007513102
3083	3007615584
3084	3007624852
3085	3007718968
3086	3007858974
3087	3007865470
3088	3007870318
3089	637321648
3090	640488284
3091	651176237
3092	8001524656
3093	8015692114
3094	8016729562
3095	8019773102
3096	8019779334
3097	8029996839
3098	8034965807
3099	8054285189
3100	8054352002
3101	8054505152
3102	8055775324
3103	8055819675
3104	8056127517
3105	8056133480
3106	8056147310
3107	8056149753
3108	8056155091
3109	8056164893
3110	8056167244
3111	8056173212
3112	8056179404
3113	8056572780
3114	8057804143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

37

363

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3ly1-assembly1.cif.gz_B	crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution	0.9498	37	369
4r5z-assembly2.cif.gz_D	crystal structure of rv3772 encoded aminotransferase	0.9449	10	370
3get-assembly1.cif.gz_A	crystal structure of putative histidinol-phosphate aminotransferase (np_281508.1) from campylobacter jejuni at 2.01 a resolution	0.9417	10	367
3ffh-assembly1.cif.gz_B	the crystal structure of histidinol-phosphate aminotransferase from listeria innocua clip11262.	0.9401	9	366
3get-assembly1.cif.gz_B	crystal structure of putative histidinol-phosphate aminotransferase (np_281508.1) from campylobacter jejuni at 2.01 a resolution	0.9366	10	367

ID	Description	Score	Start	End	Superfamily
af_Q2G087_68_261_3.40.640.10	Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain)	0.9843	78	269	3.40.640.10
af_Q2G087_68_261_3.40.640.10	Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain)	0.9693	78	269	3.40.640.10
4r5zC02	Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain)	0.9673	51	274	3.40.640.10
af_P9WML5_24_353_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9613	40	370	3.50.50.60
af_P9WML5_24_353_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9556	40	370	3.50.50.60

ID	Description	Score	Start	End	GO Terms
AF-A0A7C1ETC8-F1-model_v4	Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	0.9883	173	370	GO:0008483 GO:0009058 GO:0030170
AF-A0A537LMV4-F1-model_v4	Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	0.9847	226	369	GO:0008483 GO:0009058 GO:0030170
AF-A0A7V1K5B9-F1-model_v4	deleted	0.9839	115	368
AF-A0A7C1ETC8-F1-model_v4	Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	0.9834	173	370	GO:0008483 GO:0009058 GO:0030170
AF-F1VZB7-F1-model_v4	Putative histidinol-phosphate aminotransferase protein	0.9832	193	367	GO:0008483 GO:0009058 GO:0030170

F494745

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00155

Aminotran_1_2

Aminotransferase class I and II

37

363

0.94

Structural Annotation

Top 5 Hits

Map