F494754

General Info

Members Datasets Scaffolds Average Seq Length
1559 378 1559 128

Family's Representative Sequence

Representative Sequence 3300001977|JGI24746J21847_1032975|JGI24746J21847_10329752
Length 119
Sequence VSAPTDLRYTRDHEWVRVDGGEATVGITQYAADQLGDIVFVEEEAKAFGVVESVKAVSDLFAPLTGTVTSTNDALAANPELVNSDPYGDGWMIKIRLSDTSEMDDLLDGPAYDDLVAAG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
207 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
208 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
248 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
251 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
257 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
258 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
261 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
262 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
263 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
264 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
265 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
266 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
270 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
271 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
285 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
323 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
324 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
347 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
350 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
351 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
352 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
353 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
374 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
376 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 4.55
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1032975 3300001977 Bacteria 715
2 JGI24743J22301_10077328 3300001991 Bacteria 699
3 JGI24749J21850_1009988 3300002076 Bacteria 1327
4 JGI24033J26618_1024710 3300002155 Bacteria 786
5 JGI24034J26672_10041353 3300002239 Bacteria 774
6 JGI24742J22300_10056306 3300002244 Bacteria 718
7 JGI24751J29686_10074371 3300002459 Bacteria 702
8 JGI24751J29686_10111555 3300002459 Bacteria 573
9 rootH2_10204396 3300003320 Bacteria 2774
10 Ga0058861_11508585 3300004800 Bacteria 672
11 Ga0058860_11420570 3300004801 Unclassified 887
12 Ga0058860_12021733 3300004801 Unclassified 2046
13 Ga0065704_10711919 3300005289 Bacteria 557
14 Ga0065715_10099969 3300005293 Bacteria 3351
15 Ga0065707_10777356 3300005295 Unclassified 608
16 Ga0070658_11142660 3300005327 Bacteria 677
17 Ga0070676_10000324 3300005328 Bacteria 21626
18 Ga0070676_10227444 3300005328 Bacteria 1235
19 Ga0070676_10655868 3300005328 Bacteria 762
20 Ga0070676_11343770 3300005328 Bacteria 547
21 Ga0070683_100031589 3300005329 Bacteria 4817
22 Ga0070683_101206059 3300005329 Bacteria 727
23 Ga0070690_100037980 3300005330 Bacteria 3036
24 Ga0070690_100148416 3300005330 Bacteria 1597
25 Ga0070670_100009620 3300005331 Bacteria 8252
26 Ga0070670_100054886 3300005331 Bacteria 3421
27 Ga0070677_10172165 3300005333 Bacteria 1024
28 Ga0068869_100000126 3300005334 Bacteria 36812
29 Ga0068869_100053183 3300005334 Bacteria 2943
30 Ga0068869_100240946 3300005334 Bacteria 1441
31 Ga0068869_100713311 3300005334 Bacteria 856
32 Ga0068869_100827810 3300005334 Bacteria 797
33 Ga0068869_101399102 3300005334 Unclassified 619
34 Ga0070666_10083773 3300005335 Bacteria 2182
35 Ga0070666_10493668 3300005335 Bacteria 887
36 Ga0070680_100000915 3300005336 Bacteria 20866
37 Ga0070680_100804256 3300005336 Bacteria 810
38 Ga0070680_100904694 3300005336 Unclassified 761
39 Ga0070682_100000272 3300005337 Bacteria 37290
40 Ga0070682_100047799 3300005337 Bacteria 2662
41 Ga0068868_100181526 3300005338 Bacteria 1746
42 Ga0068868_100314824 3300005338 Bacteria 1332
43 Ga0068868_101255881 3300005338 Bacteria 687
44 Ga0068868_101307550 3300005338 Bacteria 674
45 Ga0070660_100011088 3300005339 Bacteria 6392
46 Ga0070660_100023336 3300005339 Bacteria 4582
47 Ga0070689_100005582 3300005340 Bacteria 8606
48 Ga0070689_100006875 3300005340 Bacteria 7915
49 Ga0070689_100140265 3300005340 Bacteria 1944
50 Ga0070689_100334816 3300005340 Bacteria 1267
51 Ga0070689_101549433 3300005340 Bacteria 601
52 Ga0070689_101844731 3300005340 Bacteria 552
53 Ga0070691_10029329 3300005341 Bacteria 2573
54 Ga0070691_10118797 3300005341 Bacteria 1329
55 Ga0070691_10274614 3300005341 Bacteria 912
56 Ga0070691_10370509 3300005341 Bacteria 800
57 Ga0070691_10711641 3300005341 Bacteria 604
58 Ga0070691_10725060 3300005341 Bacteria 599
59 Ga0070687_100013100 3300005343 Bacteria 3683
60 Ga0070687_100292431 3300005343 Bacteria 1030
61 Ga0070661_100006245 3300005344 Bacteria 8219
62 Ga0070661_100030662 3300005344 Bacteria 3885
63 Ga0070692_10010203 3300005345 Bacteria 4266
64 Ga0070692_10050982 3300005345 Bacteria 2151
65 Ga0070692_10230560 3300005345 Bacteria 1099
66 Ga0070692_10866542 3300005345 Bacteria 622
67 Ga0070668_100028676 3300005347 Bacteria 4224
68 Ga0070668_101810618 3300005347 Unclassified 561
69 Ga0070669_100161055 3300005353 Bacteria 1744
70 Ga0070669_100195130 3300005353 Bacteria 1590
71 Ga0070669_100232323 3300005353 Bacteria 1462
72 Ga0070675_100006518 3300005354 Bacteria 8968
73 Ga0070675_100064873 3300005354 Bacteria 3019
74 Ga0070675_100449953 3300005354 Bacteria 1155
75 Ga0070675_100958301 3300005354 Bacteria 785
76 Ga0070671_100296847 3300005355 Bacteria 1375
77 Ga0070671_100315082 3300005355 Bacteria 1333
78 Ga0070671_100681613 3300005355 Bacteria 891
79 Ga0070674_100009702 3300005356 Bacteria 5779
80 Ga0070674_100293374 3300005356 Bacteria 1294
81 Ga0070674_100755640 3300005356 Bacteria 836
82 Ga0070674_101031542 3300005356 Bacteria 723
83 Ga0070673_100005291 3300005364 Bacteria 8246
84 Ga0070673_100019962 3300005364 Bacteria 4824
85 Ga0070673_100528108 3300005364 Bacteria 1070
86 Ga0070673_100629186 3300005364 Bacteria 981
87 Ga0070688_100008141 3300005365 Bacteria 5681
88 Ga0070688_100367670 3300005365 Bacteria 1057
89 Ga0070688_100507346 3300005365 Bacteria 911
90 Ga0070688_100684425 3300005365 Bacteria 793
91 Ga0070659_100001475 3300005366 Bacteria 16936
92 Ga0070659_100005593 3300005366 Bacteria 9031
93 Ga0070659_100060328 3300005366 Bacteria 2996
94 Ga0070659_100326158 3300005366 Bacteria 1284
95 Ga0070659_100617763 3300005366 Bacteria 933
96 Ga0070667_100193913 3300005367 Bacteria 1801
97 Ga0070667_101450692 3300005367 Bacteria 644
98 Ga0070703_10002403 3300005406 Bacteria 5395
99 Ga0070701_10144918 3300005438 Bacteria 1362
100 Ga0070701_11062343 3300005438 Bacteria 568
101 Ga0070705_100044185 3300005440 Bacteria 2558
102 Ga0070705_100048092 3300005440 Bacteria 2469
103 Ga0070705_100068789 3300005440 Bacteria 2133
104 Ga0070705_100134822 3300005440 Bacteria 1616
105 Ga0070705_100273880 3300005440 Bacteria 1197
106 Ga0070705_100766086 3300005440 Bacteria 764
107 Ga0070705_100856383 3300005440 Bacteria 728
108 Ga0070705_100860114 3300005440 Unclassified 726
109 Ga0070705_100893771 3300005440 Bacteria 714
110 Ga0070705_101012083 3300005440 Bacteria 675
111 Ga0070700_100002175 3300005441 Bacteria 9953
112 Ga0070700_100602809 3300005441 Unclassified 861
113 Ga0070700_100758294 3300005441 Bacteria 777
114 Ga0070694_100000121 3300005444 Bacteria 38329
115 Ga0070694_100000836 3300005444 Bacteria 17304
116 Ga0070694_100025505 3300005444 Bacteria 3825
117 Ga0070694_100050077 3300005444 Bacteria 2815
118 Ga0070694_100139059 3300005444 Bacteria 1762
119 Ga0070694_100148080 3300005444 Bacteria 1712
120 Ga0070694_100550165 3300005444 Bacteria 924
121 Ga0070708_100010322 3300005445 Bacteria 7563
122 Ga0070708_100033424 3300005445 Bacteria 4467
123 Ga0070708_100033711 3300005445 Bacteria 4449
124 Ga0070708_100058152 3300005445 Bacteria 3444
125 Ga0070708_100091599 3300005445 Bacteria 2769
126 Ga0070708_100131066 3300005445 Bacteria 2320
127 Ga0070708_100233019 3300005445 Bacteria 1728
128 Ga0070708_100242988 3300005445 Bacteria 1690
129 Ga0070708_100257215 3300005445 Unclassified 1641
130 Ga0070708_100333910 3300005445 Bacteria 1428
131 Ga0070708_100514607 3300005445 Unclassified 1129
132 Ga0070708_100592994 3300005445 Bacteria 1045
133 Ga0070708_100609273 3300005445 Bacteria 1029
134 Ga0070708_100973130 3300005445 Bacteria 796
135 Ga0070708_101518980 3300005445 Bacteria 624
136 Ga0070663_100000550 3300005455 Bacteria 19939
137 Ga0070663_100056350 3300005455 Bacteria 2816
138 Ga0070663_100976957 3300005455 Unclassified 735
139 Ga0070678_100038315 3300005456 Bacteria 3374
140 Ga0070678_100696475 3300005456 Bacteria 915
141 Ga0070662_100006377 3300005457 Bacteria 7600
142 Ga0070662_100023708 3300005457 Bacteria 4219
143 Ga0070662_100112277 3300005457 Bacteria 2078
144 Ga0070662_100637947 3300005457 Bacteria 898
145 Ga0070662_101763993 3300005457 Bacteria 535
146 Ga0070662_101767428 3300005457 Bacteria 534
147 Ga0068867_100001320 3300005459 Bacteria 17180
148 Ga0068867_100046416 3300005459 Bacteria 3191
149 Ga0068867_100213005 3300005459 Bacteria 1553
150 Ga0070685_10001459 3300005466 Bacteria 12407
151 Ga0070685_10451525 3300005466 Bacteria 900
152 Ga0070685_10895048 3300005466 Bacteria 660
153 Ga0070706_100003251 3300005467 Bacteria 16066
154 Ga0070706_100006513 3300005467 Bacteria 11021
155 Ga0070706_100007006 3300005467 Bacteria 10629
156 Ga0070706_100007175 3300005467 Bacteria 10478
157 Ga0070706_100007727 3300005467 Bacteria 10055
158 Ga0070706_100019195 3300005467 Bacteria 6308
159 Ga0070706_100087216 3300005467 Bacteria 2893
160 Ga0070706_100184545 3300005467 Bacteria 1949
161 Ga0070706_100320796 3300005467 Bacteria 1445
162 Ga0070706_100455536 3300005467 Bacteria 1190
163 Ga0070706_100811030 3300005467 Unclassified 866
164 Ga0070706_100944121 3300005467 Unclassified 796
165 Ga0070706_101007337 3300005467 Bacteria 768
166 Ga0070706_101106769 3300005467 Unclassified 729
167 Ga0070706_101417170 3300005467 Bacteria 636
168 Ga0070707_100001015 3300005468 Bacteria 27842
169 Ga0070707_100002728 3300005468 Bacteria 16793
170 Ga0070707_100003755 3300005468 Bacteria 14319
171 Ga0070707_100005537 3300005468 Bacteria 11800
172 Ga0070707_100011866 3300005468 Bacteria 8134
173 Ga0070707_100014128 3300005468 Bacteria 7482
174 Ga0070707_100017303 3300005468 Bacteria 6777
175 Ga0070707_100028741 3300005468 Bacteria 5292
176 Ga0070707_100046802 3300005468 Bacteria 4140
177 Ga0070707_100055203 3300005468 Bacteria 3808
178 Ga0070707_100139554 3300005468 Bacteria 2359
179 Ga0070707_100151472 3300005468 Bacteria 2258
180 Ga0070707_100269866 3300005468 Bacteria 1654
181 Ga0070707_100302366 3300005468 Bacteria 1554
182 Ga0070707_100494679 3300005468 Bacteria 1184
183 Ga0070707_100888329 3300005468 Bacteria 856
184 Ga0070707_101212556 3300005468 Bacteria 721
185 Ga0070698_100007218 3300005471 Bacteria 12036
186 Ga0070698_100051947 3300005471 Bacteria 4172
187 Ga0070698_100123727 3300005471 Bacteria 2544
188 Ga0070698_100146576 3300005471 Bacteria 2310
189 Ga0070698_100148073 3300005471 Bacteria 2296
190 Ga0070698_100178881 3300005471 Bacteria 2059
191 Ga0070698_100253215 3300005471 Bacteria 1693
192 Ga0070698_100390354 3300005471 Bacteria 1325
193 Ga0070698_100506991 3300005471 Bacteria 1145
194 Ga0070698_100661489 3300005471 Bacteria 986
195 Ga0070698_100825504 3300005471 Bacteria 871
196 Ga0070698_100983801 3300005471 Bacteria 790
197 Ga0070699_100012878 3300005518 Bacteria 7208
198 Ga0070699_100031344 3300005518 Bacteria 4589
199 Ga0070699_100045107 3300005518 Bacteria 3815
200 Ga0070699_100126289 3300005518 Bacteria 2252
201 Ga0070699_100242059 3300005518 Bacteria 1611
202 Ga0070699_100271470 3300005518 Bacteria 1518
203 Ga0070699_100675952 3300005518 Bacteria 943
204 Ga0070699_100863222 3300005518 Bacteria 829
205 Ga0070699_101130637 3300005518 Bacteria 718
206 Ga0070699_101353065 3300005518 Bacteria 653
207 Ga0070679_100001430 3300005530 Bacteria 21104
208 Ga0070679_100106146 3300005530 Bacteria 2794
209 Ga0070679_101324679 3300005530 Bacteria 666
210 Ga0070684_100020991 3300005535 Bacteria 5424
211 Ga0070684_100097264 3300005535 Bacteria 2625
212 Ga0070684_100315761 3300005535 Bacteria 1435
213 Ga0070684_101090408 3300005535 Bacteria 750
214 Ga0070697_100001444 3300005536 Bacteria 18066
215 Ga0070697_100003594 3300005536 Bacteria 11919
216 Ga0070697_100006376 3300005536 Bacteria 9133
217 Ga0070697_100061278 3300005536 Bacteria 3069
218 Ga0070697_100098103 3300005536 Bacteria 2432
219 Ga0070697_100110711 3300005536 Bacteria 2288
220 Ga0070697_100136337 3300005536 Bacteria 2061
221 Ga0070697_100355561 3300005536 Bacteria 1266
222 Ga0070697_100412028 3300005536 Bacteria 1174
223 Ga0070697_100639076 3300005536 Bacteria 937
224 Ga0070697_101494636 3300005536 Bacteria 604
225 Ga0068853_100000538 3300005539 Bacteria 25729
226 Ga0068853_100713495 3300005539 Bacteria 957
227 Ga0070672_100088248 3300005543 Bacteria 2497
228 Ga0070672_100192084 3300005543 Bacteria 1705
229 Ga0070672_100317429 3300005543 Bacteria 1324
230 Ga0070672_100936737 3300005543 Bacteria 766
231 Ga0070686_100029257 3300005544 Bacteria 3349
232 Ga0070686_100117024 3300005544 Bacteria 1825
233 Ga0070686_100427794 3300005544 Bacteria 1013
234 Ga0070695_100003926 3300005545 Bacteria 8688
235 Ga0070695_100009344 3300005545 Bacteria 5832
236 Ga0070696_100003484 3300005546 Bacteria 10460
237 Ga0070696_100028449 3300005546 Bacteria 3814
238 Ga0070696_100039703 3300005546 Bacteria 3250
239 Ga0070696_100054982 3300005546 Bacteria 2776
240 Ga0070696_100206725 3300005546 Bacteria 1468
241 Ga0070696_100351561 3300005546 Bacteria 1141
242 Ga0070696_100377004 3300005546 Bacteria 1105
243 Ga0070696_100809180 3300005546 Bacteria 772
244 Ga0070693_100011840 3300005547 Bacteria 4401
245 Ga0070693_100525960 3300005547 Bacteria 843
246 Ga0070693_100872673 3300005547 Bacteria 672
247 Ga0070665_102331064 3300005548 Bacteria 538
248 Ga0070704_100010169 3300005549 Bacteria 5722
249 Ga0070704_100019769 3300005549 Bacteria 4333
250 Ga0070704_100050097 3300005549 Bacteria 2933
251 Ga0070704_100100711 3300005549 Bacteria 2176
252 Ga0070704_100116427 3300005549 Bacteria 2044
253 Ga0070704_100141383 3300005549 Bacteria 1880
254 Ga0070704_100165080 3300005549 Bacteria 1755
255 Ga0070704_100550700 3300005549 Bacteria 1008
256 Ga0070704_100890600 3300005549 Bacteria 800
257 Ga0070704_100983307 3300005549 Bacteria 762
258 Ga0070704_101040994 3300005549 Bacteria 742
259 Ga0070704_101105864 3300005549 Bacteria 720
260 Ga0070704_101754633 3300005549 Bacteria 574
261 Ga0068855_100015829 3300005563 Bacteria 9072
262 Ga0068855_100310120 3300005563 Bacteria 1746
263 Ga0068855_100359603 3300005563 Bacteria 1602
264 Ga0070664_100025974 3300005564 Bacteria 4855
265 Ga0070664_100033101 3300005564 Bacteria 4326
266 Ga0070664_100397439 3300005564 Bacteria 1260
267 Ga0070664_100681563 3300005564 Bacteria 957
268 Ga0068857_100183692 3300005577 Bacteria 1903
269 Ga0068857_100459067 3300005577 Bacteria 1192
270 Ga0068857_100607761 3300005577 Bacteria 1034
271 Ga0068857_100890649 3300005577 Bacteria 853
272 Ga0068857_100927494 3300005577 Bacteria 836
273 Ga0068857_101055250 3300005577 Unclassified 783
274 Ga0068857_101167272 3300005577 Unclassified 745
275 Ga0068854_100000401 3300005578 Bacteria 27283
276 Ga0068854_100111516 3300005578 Unclassified 2064
277 Ga0068854_100112262 3300005578 Bacteria 2058
278 Ga0068854_100227380 3300005578 Bacteria 1479
279 Ga0068854_100263739 3300005578 Bacteria 1380
280 Ga0068854_100465265 3300005578 Bacteria 1059
281 Ga0068854_100482733 3300005578 Bacteria 1041
282 Ga0068854_101211582 3300005578 Bacteria 677
283 Ga0068856_100002147 3300005614 Bacteria 20442
284 Ga0070702_100022544 3300005615 Bacteria 3331
285 Ga0070702_100036983 3300005615 Bacteria 2709
286 Ga0070702_100147612 3300005615 Bacteria 1506
287 Ga0068852_100078052 3300005616 Bacteria 2929
288 Ga0068852_102267501 3300005616 Bacteria 564
289 Ga0068859_100000796 3300005617 Bacteria 31979
290 Ga0068859_100010613 3300005617 Bacteria 9270
291 Ga0068859_100035169 3300005617 Bacteria 5026
292 Ga0068859_100117732 3300005617 Bacteria 2722
293 Ga0068859_100345890 3300005617 Bacteria 1581
294 Ga0068859_100524209 3300005617 Bacteria 1280
295 Ga0068859_101299979 3300005617 Bacteria 801
296 Ga0068864_100007093 3300005618 Bacteria 9202
297 Ga0068864_100009696 3300005618 Bacteria 7944
298 Ga0068864_100020057 3300005618 Bacteria 5590
299 Ga0068864_100077109 3300005618 Bacteria 2914
300 Ga0068866_10009623 3300005718 Bacteria 4111
301 Ga0068866_10766399 3300005718 Bacteria 668
302 Ga0068861_100346675 3300005719 Bacteria 1301
303 Ga0068861_100347708 3300005719 Bacteria 1299
304 Ga0068861_100407046 3300005719 Bacteria 1209
305 Ga0068861_100448044 3300005719 Unclassified 1156
306 Ga0068851_10752386 3300005834 Bacteria 603
307 Ga0068870_10002546 3300005840 Bacteria 7619
308 Ga0068870_10050037 3300005840 Bacteria 2207
309 Ga0068863_100003451 3300005841 Bacteria 15589
310 Ga0068863_100035929 3300005841 Bacteria 4719
311 Ga0068863_100841423 3300005841 Bacteria 916
312 Ga0068858_100074985 3300005842 Bacteria 3142
313 Ga0068858_100120337 3300005842 Bacteria 2455
314 Ga0068858_100247427 3300005842 Bacteria 1693
315 Ga0068858_100269301 3300005842 Bacteria 1620
316 Ga0068858_100486124 3300005842 Unclassified 1192
317 Ga0068858_100537920 3300005842 Bacteria 1131
318 Ga0068858_101538476 3300005842 Bacteria 656
319 Ga0068860_100042599 3300005843 Bacteria 4334
320 Ga0068860_100065669 3300005843 Bacteria 3445
321 Ga0068860_100419817 3300005843 Bacteria 1326
322 Ga0068860_100495313 3300005843 Unclassified 1219
323 Ga0068860_101396056 3300005843 Bacteria 722
324 Ga0068862_100002989 3300005844 Bacteria 14758
325 Ga0068862_100029688 3300005844 Bacteria 4608
326 Ga0068862_100041532 3300005844 Bacteria 3913
327 Ga0068862_100052986 3300005844 Bacteria 3473
328 Ga0068862_100198337 3300005844 Bacteria 1809
329 Ga0068862_100267309 3300005844 Bacteria 1563
330 Ga0068862_100335036 3300005844 Bacteria 1400
331 Ga0068862_100621660 3300005844 Unclassified 1039
332 Ga0068862_102067196 3300005844 Bacteria 581
333 Ga0068862_102149926 3300005844 Bacteria 569
334 Ga0081455_10002544 3300005937 Bacteria 21648
335 Ga0081455_10232526 3300005937 Bacteria 1359
336 Ga0081455_10403683 3300005937 Bacteria 947
337 Ga0081538_10001745 3300005981 Bacteria 22100
338 Ga0081538_10008167 3300005981 Bacteria 8931
339 Ga0081539_10000141 3300005985 Bacteria 166050
340 Ga0075365_10247793 3300006038 Bacteria 1251
341 Ga0075365_11201571 3300006038 Bacteria 533
342 Ga0075432_10076132 3300006058 Bacteria 1211
343 Ga0075432_10100971 3300006058 Bacteria 1066
344 Ga0075432_10393330 3300006058 Bacteria 597
345 Ga0070715_10405669 3300006163 Bacteria 759
346 Ga0070716_100752836 3300006173 Bacteria 750
347 Ga0097621_100258130 3300006237 Bacteria 1528
348 Ga0097621_102123180 3300006237 Bacteria 537
349 Ga0068871_100237057 3300006358 Bacteria 1585
350 Ga0068871_100953574 3300006358 Bacteria 797
351 Ga0068871_100973997 3300006358 Bacteria 789
352 Ga0075428_100000499 3300006844 Bacteria 39815
353 Ga0075428_100001339 3300006844 Bacteria 26146
354 Ga0075428_100004807 3300006844 Bacteria 14978
355 Ga0075428_100013391 3300006844 Bacteria 9122
356 Ga0075428_100027338 3300006844 Bacteria 6313
357 Ga0075428_100056467 3300006844 Bacteria 4300
358 Ga0075428_100246240 3300006844 Bacteria 1927
359 Ga0075428_100317208 3300006844 Bacteria 1675
360 Ga0075428_100380643 3300006844 Bacteria 1513
361 Ga0075428_100498169 3300006844 Bacteria 1304
362 Ga0075428_100739221 3300006844 Bacteria 1047
363 Ga0075428_102434311 3300006844 Unclassified 537
364 Ga0075430_100000005 3300006846 Bacteria 108528
365 Ga0075430_100011258 3300006846 Bacteria 7588
366 Ga0075430_100080358 3300006846 Bacteria 2731
367 Ga0075430_100131517 3300006846 Unclassified 2085
368 Ga0075430_100356811 3300006846 Unclassified 1207
369 Ga0075430_101016363 3300006846 Unclassified 683
370 Ga0075431_100000046 3300006847 Bacteria 64852
371 Ga0075431_100000189 3300006847 Bacteria 44725
372 Ga0075431_100000823 3300006847 Bacteria 27067
373 Ga0075431_100001449 3300006847 Bacteria 21860
374 Ga0075431_100002327 3300006847 Bacteria 18259
375 Ga0075431_100032296 3300006847 Bacteria 5395
376 Ga0075431_100044152 3300006847 Bacteria 4597
377 Ga0075431_100063105 3300006847 Bacteria 3823
378 Ga0075431_100117654 3300006847 Unclassified 2742
379 Ga0075431_100128795 3300006847 Bacteria 2612
380 Ga0075431_100387283 3300006847 Bacteria 1401
381 Ga0075431_100482950 3300006847 Bacteria 1231
382 Ga0075431_100577257 3300006847 Bacteria 1110
383 Ga0075431_100725082 3300006847 Bacteria 971
384 Ga0075433_10011024 3300006852 Bacteria 7269
385 Ga0075433_10023493 3300006852 Bacteria 5191
386 Ga0075433_10037136 3300006852 Bacteria 4201
387 Ga0075433_10050485 3300006852 Bacteria 3621
388 Ga0075433_10052223 3300006852 Bacteria 3561
389 Ga0075433_10061246 3300006852 Bacteria 3296
390 Ga0075433_10091221 3300006852 Bacteria 2693
391 Ga0075433_10149420 3300006852 Bacteria 2078
392 Ga0075433_10295431 3300006852 Bacteria 1435
393 Ga0075433_10649415 3300006852 Bacteria 925
394 Ga0075433_11232549 3300006852 Bacteria 649
395 Ga0075433_11340086 3300006852 Bacteria 620
396 Ga0075433_11546811 3300006852 Unclassified 573
397 Ga0075434_100040756 3300006871 Bacteria 4599
398 Ga0075434_100053139 3300006871 Bacteria 4026
399 Ga0075434_100054084 3300006871 Bacteria 3988
400 Ga0075434_100091193 3300006871 Bacteria 3049
401 Ga0075434_100127883 3300006871 Bacteria 2558
402 Ga0075434_100154275 3300006871 Bacteria 2316
403 Ga0075434_100235988 3300006871 Bacteria 1849
404 Ga0075434_100286378 3300006871 Bacteria 1667
405 Ga0075434_100322351 3300006871 Bacteria 1566
406 Ga0075434_100468001 3300006871 Bacteria 1282
407 Ga0075434_100513638 3300006871 Bacteria 1219
408 Ga0075434_100623047 3300006871 Bacteria 1098
409 Ga0075434_100748084 3300006871 Bacteria 994
410 Ga0075434_100851905 3300006871 Bacteria 927
411 Ga0075434_101238497 3300006871 Bacteria 758
412 Ga0075429_100000077 3300006880 Bacteria 49812
413 Ga0075429_100025746 3300006880 Bacteria 5109
414 Ga0075429_100028420 3300006880 Bacteria 4856
415 Ga0075429_100093784 3300006880 Bacteria 2618
416 Ga0075429_100115099 3300006880 Bacteria 2351
417 Ga0075429_100123491 3300006880 Bacteria 2264
418 Ga0075429_100140989 3300006880 Bacteria 2110
419 Ga0075429_100249977 3300006880 Bacteria 1553
420 Ga0075429_100425402 3300006880 Unclassified 1163
421 Ga0075429_100432461 3300006880 Bacteria 1153
422 Ga0075429_100813472 3300006880 Bacteria 818
423 Ga0075429_101242503 3300006880 Bacteria 650
424 Ga0075429_101481547 3300006880 Bacteria 590
425 Ga0068865_100042382 3300006881 Bacteria 3103
426 Ga0068865_100186019 3300006881 Bacteria 1603
427 Ga0068865_100514588 3300006881 Bacteria 1000
428 Ga0068865_101124501 3300006881 Bacteria 693
429 Ga0075436_100001664 3300006914 Bacteria 15178
430 Ga0075436_100243492 3300006914 Bacteria 1279
431 Ga0075436_101268666 3300006914 Bacteria 557
432 Ga0097620_100000796 3300006931 Bacteria 31979
433 Ga0097620_100010613 3300006931 Bacteria 9270
434 Ga0097620_100035166 3300006931 Bacteria 5026
435 Ga0097620_100117736 3300006931 Bacteria 2722
436 Ga0097620_100345876 3300006931 Bacteria 1581
437 Ga0097620_100524244 3300006931 Bacteria 1280
438 Ga0097620_101299975 3300006931 Bacteria 801
439 Ga0075435_100024554 3300007076 Bacteria 4680
440 Ga0075435_100179817 3300007076 Bacteria 1787
441 Ga0075435_100182169 3300007076 Bacteria 1775
442 Ga0075435_100297299 3300007076 Bacteria 1380
443 Ga0075435_100360739 3300007076 Bacteria 1246
444 Ga0075435_100543797 3300007076 Bacteria 1005
445 Ga0075435_100744388 3300007076 Bacteria 853
446 Ga0075435_100871919 3300007076 Bacteria 785
447 Ga0099794_10018413 3300007265 Bacteria 3131
448 Ga0099794_10729771 3300007265 Bacteria 528
449 Ga0105251_10113002 3300009011 Bacteria 1236
450 Ga0105251_10326333 3300009011 Bacteria 698
451 Ga0105244_10431162 3300009036 Bacteria 606
452 Ga0105250_10547541 3300009092 Bacteria 530
453 Ga0105240_10533475 3300009093 Bacteria 1301
454 Ga0111539_10000182 3300009094 Bacteria 73143
455 Ga0111539_10073894 3300009094 Bacteria 4018
456 Ga0111539_10096923 3300009094 Bacteria 3464
457 Ga0111539_10135950 3300009094 Bacteria 2879
458 Ga0111539_10317252 3300009094 Bacteria 1814
459 Ga0111539_10326872 3300009094 Unclassified 1785
460 Ga0111539_10359159 3300009094 Bacteria 1696
461 Ga0111539_10551114 3300009094 Bacteria 1343
462 Ga0111539_10603641 3300009094 Bacteria 1278
463 Ga0111539_10702336 3300009094 Bacteria 1177
464 Ga0111539_10811402 3300009094 Bacteria 1089
465 Ga0111539_10839074 3300009094 Bacteria 1069
466 Ga0111539_11536483 3300009094 Bacteria 772
467 Ga0105245_10028975 3300009098 Bacteria 4889
468 Ga0105245_10126955 3300009098 Bacteria 2389
469 Ga0105245_10396686 3300009098 Bacteria 1378
470 Ga0105245_10515454 3300009098 Bacteria 1214
471 Ga0105245_10741123 3300009098 Unclassified 1018
472 Ga0105245_10760777 3300009098 Bacteria 1005
473 Ga0105245_12715710 3300009098 Bacteria 548
474 Ga0105247_10152911 3300009101 Bacteria 1522
475 Ga0114129_10000129 3300009147 Bacteria 77208
476 Ga0114129_10000144 3300009147 Bacteria 75111
477 Ga0114129_10001890 3300009147 Bacteria 28567
478 Ga0114129_10011263 3300009147 Bacteria 12747
479 Ga0114129_10018527 3300009147 Bacteria 9912
480 Ga0114129_10022634 3300009147 Bacteria 8913
481 Ga0114129_10044982 3300009147 Bacteria 6208
482 Ga0114129_10051159 3300009147 Bacteria 5801
483 Ga0114129_10070080 3300009147 Bacteria 4888
484 Ga0114129_10168323 3300009147 Bacteria 2989
485 Ga0114129_10173763 3300009147 Bacteria 2935
486 Ga0114129_10175529 3300009147 Bacteria 2918
487 Ga0114129_10204495 3300009147 Bacteria 2672
488 Ga0114129_10233952 3300009147 Bacteria 2473
489 Ga0114129_10304741 3300009147 Bacteria 2122
490 Ga0114129_10312776 3300009147 Bacteria 2090
491 Ga0114129_10382810 3300009147 Bacteria 1858
492 Ga0114129_10471291 3300009147 Bacteria 1644
493 Ga0114129_10489958 3300009147 Bacteria 1607
494 Ga0114129_10647173 3300009147 Bacteria 1365
495 Ga0114129_10866564 3300009147 Bacteria 1147
496 Ga0114129_10926412 3300009147 Bacteria 1102
497 Ga0114129_12001015 3300009147 Bacteria 701
498 Ga0105243_10005060 3300009148 Bacteria 10345
499 Ga0105243_10029759 3300009148 Bacteria 4202
500 Ga0105243_10650649 3300009148 Bacteria 1021
501 Ga0105243_10990885 3300009148 Bacteria 842
502 Ga0105243_11160473 3300009148 Bacteria 784
503 Ga0105241_10003595 3300009174 Bacteria 11534
504 Ga0105242_10030769 3300009176 Bacteria 4287
505 Ga0105242_11193918 3300009176 Bacteria 780
506 Ga0105242_12110488 3300009176 Bacteria 607
507 Ga0105248_10036014 3300009177 Bacteria 5535
508 Ga0105248_10193111 3300009177 Bacteria 2294
509 Ga0105248_10915904 3300009177 Bacteria 990
510 Ga0105248_11504736 3300009177 Bacteria 762
511 Ga0105248_11858531 3300009177 Unclassified 683
512 Ga0105238_10198588 3300009551 Bacteria 1981
513 Ga0105249_10011527 3300009553 Bacteria 7768
514 Ga0105249_10012622 3300009553 Bacteria 7449
515 Ga0105249_10039447 3300009553 Bacteria 4288
516 Ga0105249_10166427 3300009553 Bacteria 2135
517 Ga0105249_10228649 3300009553 Bacteria 1834
518 Ga0105249_10284941 3300009553 Bacteria 1651
519 Ga0105249_10295678 3300009553 Bacteria 1622
520 Ga0105249_10318628 3300009553 Bacteria 1565
521 Ga0105249_10582187 3300009553 Bacteria 1172
522 Ga0105249_11098278 3300009553 Bacteria 865
523 Ga0105249_11279415 3300009553 Bacteria 805
524 Ga0105249_11562558 3300009553 Bacteria 732
525 Ga0105239_10032185 3300010375 Bacteria 5764
526 Ga0105239_10037283 3300010375 Bacteria 5332
527 Ga0105239_10663150 3300010375 Bacteria 1192
528 Ga0105239_10719966 3300010375 Bacteria 1141
529 Ga0105239_11326630 3300010375 Bacteria 830
530 Ga0105246_10017639 3300011119 Bacteria 4541
531 Ga0105246_10359739 3300011119 Bacteria 1195
532 Ga0157321_1007243 3300012487 Bacteria 776
533 Ga0157373_10000102 3300013100 Bacteria 67573
534 Ga0157373_10368460 3300013100 Bacteria 1026
535 Ga0157373_11358746 3300013100 Bacteria 539
536 Ga0157371_10026792 3300013102 Bacteria 4187
537 Ga0157371_10572122 3300013102 Bacteria 839
538 Ga0157370_10164441 3300013104 Bacteria 2064
539 Ga0157369_10009506 3300013105 Bacteria 11115
540 Ga0157374_10378894 3300013296 Bacteria 1409
541 Ga0157374_10610476 3300013296 Bacteria 1101
542 Ga0157378_10028279 3300013297 Bacteria 4945
543 Ga0157378_10279326 3300013297 Bacteria 1609
544 Ga0157378_10312200 3300013297 Bacteria 1525
545 Ga0157378_10669744 3300013297 Bacteria 1055
546 Ga0157378_13080173 3300013297 Bacteria 517
547 Ga0163162_10043045 3300013306 Bacteria 4520
548 Ga0163162_10144047 3300013306 Bacteria 2498
549 Ga0163162_10831400 3300013306 Bacteria 1039
550 Ga0163162_10955101 3300013306 Bacteria 968
551 Ga0163162_10981280 3300013306 Bacteria 955
552 Ga0163162_10990553 3300013306 Bacteria 950
553 Ga0163162_11123842 3300013306 Bacteria 890
554 Ga0163162_11435918 3300013306 Bacteria 785
555 Ga0163162_12011314 3300013306 Bacteria 662
556 Ga0163162_12184369 3300013306 Bacteria 635
557 Ga0157372_10055364 3300013307 Bacteria 4429
558 Ga0157375_10008744 3300013308 Bacteria 8873
559 Ga0157375_10045690 3300013308 Bacteria 4264
560 Ga0157375_10160890 3300013308 Bacteria 2387
561 Ga0157375_10321429 3300013308 Bacteria 1712
562 Ga0157375_10686221 3300013308 Bacteria 1178
563 Ga0163163_10003752 3300014325 Bacteria 12934
564 Ga0163163_10040249 3300014325 Bacteria 4564
565 Ga0163163_10061302 3300014325 Bacteria 3727
566 Ga0163163_10079267 3300014325 Bacteria 3282
567 Ga0163163_10314098 3300014325 Bacteria 1620
568 Ga0163163_10457719 3300014325 Bacteria 1336
569 Ga0163163_12463666 3300014325 Bacteria 578
570 Ga0157380_10134129 3300014326 Bacteria 2117
571 Ga0157380_10176535 3300014326 Bacteria 1872
572 Ga0157380_10249278 3300014326 Bacteria 1606
573 Ga0157380_12600944 3300014326 Bacteria 572
574 Ga0157380_13234748 3300014326 Bacteria 520
575 Ga0157380_13248918 3300014326 Bacteria 519
576 Ga0182008_10292381 3300014497 Bacteria 850
577 Ga0182008_10475635 3300014497 Bacteria 683
578 Ga0157377_10005048 3300014745 Bacteria 6162
579 Ga0157377_10045565 3300014745 Bacteria 2451
580 Ga0157377_10096144 3300014745 Bacteria 1757
581 Ga0157377_10294734 3300014745 Bacteria 1068
582 Ga0157377_10424034 3300014745 Bacteria 912
583 Ga0157377_10623537 3300014745 Bacteria 772
584 Ga0157379_10016679 3300014968 Bacteria 6460
585 Ga0157379_10029831 3300014968 Bacteria 4850
586 Ga0157379_10079598 3300014968 Bacteria 2935
587 Ga0157379_10125761 3300014968 Bacteria 2307
588 Ga0157379_10175556 3300014968 Bacteria 1935
589 Ga0157379_10415963 3300014968 Bacteria 1238
590 Ga0157379_10750790 3300014968 Bacteria 918
591 Ga0157379_11354733 3300014968 Unclassified 688
592 Ga0157376_10358683 3300014969 Bacteria 1397
593 Ga0157376_10926427 3300014969 Bacteria 891
594 Ga0182007_10069582 3300015262 Bacteria 1153
595 Ga0163161_10157397 3300017792 Bacteria 1730
596 Ga0163161_10500742 3300017792 Bacteria 989
597 Ga0163161_10609531 3300017792 Bacteria 901
598 Ga0163161_10849652 3300017792 Bacteria 770
599 Ga0163161_10926651 3300017792 Bacteria 740
600 Ga0206356_10630729 3300020070 Bacteria 2657
601 Ga0206353_10815269 3300020082 Bacteria 2144
602 Ga0207653_10008914 3300025885 Bacteria 3129
603 Ga0207653_10034652 3300025885 Bacteria 1640
604 Ga0207653_10155409 3300025885 Bacteria 844
605 Ga0207642_10007518 3300025899 Bacteria 3685
606 Ga0207642_10556572 3300025899 Bacteria 709
607 Ga0207688_10013673 3300025901 Bacteria 4412
608 Ga0207688_10151165 3300025901 Bacteria 1371
609 Ga0207688_10484965 3300025901 Bacteria 773
610 Ga0207699_11100942 3300025906 Bacteria 588
611 Ga0207645_10000033 3300025907 Bacteria 91108
612 Ga0207645_10184698 3300025907 Bacteria 1368
613 Ga0207645_10187271 3300025907 Bacteria 1359
614 Ga0207645_10361125 3300025907 Bacteria 973
615 Ga0207643_10000641 3300025908 Bacteria 21901
616 Ga0207643_10019158 3300025908 Bacteria 3749
617 Ga0207643_10434809 3300025908 Bacteria 833
618 Ga0207643_10716494 3300025908 Unclassified 647
619 Ga0207684_10001908 3300025910 Bacteria 21650
620 Ga0207684_10006750 3300025910 Bacteria 10417
621 Ga0207684_10013178 3300025910 Bacteria 7156
622 Ga0207684_10035398 3300025910 Bacteria 4240
623 Ga0207684_10039789 3300025910 Bacteria 3985
624 Ga0207684_10082654 3300025910 Bacteria 2735
625 Ga0207684_10103497 3300025910 Bacteria 2434
626 Ga0207684_10105513 3300025910 Bacteria 2410
627 Ga0207684_10139694 3300025910 Bacteria 2082
628 Ga0207684_10244803 3300025910 Bacteria 1547
629 Ga0207684_10340200 3300025910 Bacteria 1292
630 Ga0207684_10504934 3300025910 Bacteria 1036
631 Ga0207684_10732514 3300025910 Unclassified 839
632 Ga0207684_10815151 3300025910 Bacteria 788
633 Ga0207684_11390634 3300025910 Bacteria 575
634 Ga0207654_10000903 3300025911 Bacteria 16423
635 Ga0207654_10447861 3300025911 Bacteria 905
636 Ga0207707_10000162 3300025912 Bacteria 70164
637 Ga0207707_10091371 3300025912 Bacteria 2661
638 Ga0207660_10016617 3300025917 Bacteria 4875
639 Ga0207660_10455675 3300025917 Bacteria 1035
640 Ga0207660_10461523 3300025917 Unclassified 1028
641 Ga0207660_10947712 3300025917 Bacteria 702
642 Ga0207662_10014313 3300025918 Bacteria 4450
643 Ga0207662_10068634 3300025918 Bacteria 2141
644 Ga0207662_10674489 3300025918 Unclassified 723
645 Ga0207657_10001749 3300025919 Bacteria 23427
646 Ga0207657_10055850 3300025919 Bacteria 3409
647 Ga0207649_10007071 3300025920 Bacteria 6094
648 Ga0207649_10037996 3300025920 Bacteria 2912
649 Ga0207652_10139350 3300025921 Bacteria 2168
650 Ga0207652_10659047 3300025921 Bacteria 936
651 Ga0207646_10002616 3300025922 Bacteria 21157
652 Ga0207646_10002778 3300025922 Bacteria 20446
653 Ga0207646_10003964 3300025922 Bacteria 16419
654 Ga0207646_10012707 3300025922 Bacteria 8082
655 Ga0207646_10013330 3300025922 Bacteria 7865
656 Ga0207646_10017167 3300025922 Bacteria 6778
657 Ga0207646_10069350 3300025922 Bacteria 3149
658 Ga0207646_10160209 3300025922 Bacteria 2030
659 Ga0207646_10318142 3300025922 Bacteria 1406
660 Ga0207646_10328250 3300025922 Bacteria 1382
661 Ga0207646_10395618 3300025922 Bacteria 1248
662 Ga0207646_10400724 3300025922 Bacteria 1239
663 Ga0207646_10420015 3300025922 Bacteria 1207
664 Ga0207646_10609101 3300025922 Bacteria 980
665 Ga0207646_11024191 3300025922 Bacteria 729
666 Ga0207646_11314377 3300025922 Bacteria 631
667 Ga0207646_11617974 3300025922 Bacteria 558
668 Ga0207681_10336034 3300025923 Bacteria 1205
669 Ga0207681_10509389 3300025923 Bacteria 986
670 Ga0207681_10857203 3300025923 Bacteria 760
671 Ga0207681_11092972 3300025923 Bacteria 670
672 Ga0207694_11161253 3300025924 Bacteria 653
673 Ga0207650_10056190 3300025925 Bacteria 2924
674 Ga0207650_10247145 3300025925 Bacteria 1443
675 Ga0207650_11580534 3300025925 Bacteria 557
676 Ga0207659_10021648 3300025926 Bacteria 4271
677 Ga0207659_10245184 3300025926 Bacteria 1451
678 Ga0207659_10447034 3300025926 Bacteria 1088
679 Ga0207659_11112780 3300025926 Bacteria 679
680 Ga0207659_11233786 3300025926 Bacteria 642
681 Ga0207659_11362760 3300025926 Bacteria 608
682 Ga0207687_10020512 3300025927 Bacteria 4384
683 Ga0207687_10106256 3300025927 Bacteria 2075
684 Ga0207687_10229444 3300025927 Bacteria 1466
685 Ga0207687_10529410 3300025927 Bacteria 987
686 Ga0207687_10633040 3300025927 Bacteria 904
687 Ga0207687_10675034 3300025927 Bacteria 875
688 Ga0207644_10421882 3300025931 Bacteria 1093
689 Ga0207644_10580906 3300025931 Bacteria 929
690 Ga0207690_10005168 3300025932 Bacteria 7700
691 Ga0207690_10059291 3300025932 Bacteria 2593
692 Ga0207690_10342174 3300025932 Bacteria 1181
693 Ga0207690_10749631 3300025932 Bacteria 805
694 Ga0207690_10958076 3300025932 Bacteria 711
695 Ga0207706_10003550 3300025933 Bacteria 14887
696 Ga0207706_10008080 3300025933 Bacteria 9710
697 Ga0207706_10095003 3300025933 Bacteria 2622
698 Ga0207686_10158004 3300025934 Bacteria 1586
699 Ga0207686_10806865 3300025934 Unclassified 753
700 Ga0207709_10036343 3300025935 Bacteria 2919
701 Ga0207709_10239773 3300025935 Bacteria 1318
702 Ga0207709_10251406 3300025935 Bacteria 1291
703 Ga0207709_10529142 3300025935 Bacteria 924
704 Ga0207709_10978210 3300025935 Bacteria 691
705 Ga0207670_10012307 3300025936 Bacteria 5001
706 Ga0207670_10049824 3300025936 Bacteria 2803
707 Ga0207670_10176365 3300025936 Bacteria 1607
708 Ga0207670_10368483 3300025936 Bacteria 1141
709 Ga0207669_10005809 3300025937 Bacteria 5579
710 Ga0207669_10219628 3300025937 Bacteria 1394
711 Ga0207669_10355315 3300025937 Bacteria 1134
712 Ga0207704_10016192 3300025938 Bacteria 3824
713 Ga0207704_11413447 3300025938 Bacteria 596
714 Ga0207665_10173190 3300025939 Bacteria 1560
715 Ga0207665_10299406 3300025939 Bacteria 1202
716 Ga0207691_10030181 3300025940 Bacteria 5067
717 Ga0207691_10200645 3300025940 Bacteria 1736
718 Ga0207691_10646949 3300025940 Bacteria 893
719 Ga0207691_10777322 3300025940 Bacteria 805
720 Ga0207691_11462171 3300025940 Bacteria 560
721 Ga0207691_11628670 3300025940 Bacteria 524
722 Ga0207689_10000139 3300025942 Bacteria 62281
723 Ga0207689_10085623 3300025942 Bacteria 2591
724 Ga0207689_10150162 3300025942 Bacteria 1921
725 Ga0207689_10789938 3300025942 Bacteria 801
726 Ga0207661_10386395 3300025944 Bacteria 1267
727 Ga0207661_11022204 3300025944 Bacteria 761
728 Ga0207679_10000655 3300025945 Bacteria 23173
729 Ga0207679_11122730 3300025945 Bacteria 721
730 Ga0207667_10033052 3300025949 Bacteria 5566
731 Ga0207667_10470988 3300025949 Bacteria 1275
732 Ga0207651_10004737 3300025960 Bacteria 6912
733 Ga0207651_10134811 3300025960 Bacteria 1897
734 Ga0207651_10234105 3300025960 Bacteria 1493
735 Ga0207651_10644061 3300025960 Bacteria 930
736 Ga0207712_10138444 3300025961 Bacteria 1865
737 Ga0207712_10154018 3300025961 Bacteria 1778
738 Ga0207712_10156626 3300025961 Bacteria 1765
739 Ga0207712_10187855 3300025961 Bacteria 1629
740 Ga0207712_10253930 3300025961 Bacteria 1423
741 Ga0207668_10308872 3300025972 Bacteria 1308
742 Ga0207668_10370206 3300025972 Bacteria 1203
743 Ga0207668_11585364 3300025972 Bacteria 591
744 Ga0207640_10003202 3300025981 Bacteria 8815
745 Ga0207640_10186252 3300025981 Bacteria 1561
746 Ga0207640_10270625 3300025981 Bacteria 1329
747 Ga0207640_10382754 3300025981 Bacteria 1140
748 Ga0207640_11886999 3300025981 Bacteria 541
749 Ga0207658_10983340 3300025986 Bacteria 770
750 Ga0207677_10077079 3300026023 Bacteria 2376
751 Ga0207677_10160303 3300026023 Bacteria 1747
752 Ga0207677_10751408 3300026023 Bacteria 869
753 Ga0207677_10895923 3300026023 Bacteria 799
754 Ga0207703_10038357 3300026035 Bacteria 3823
755 Ga0207703_10104847 3300026035 Bacteria 2402
756 Ga0207703_10512888 3300026035 Unclassified 1127
757 Ga0207703_10627472 3300026035 Bacteria 1018
758 Ga0207703_10834083 3300026035 Bacteria 881
759 Ga0207703_11059140 3300026035 Bacteria 779
760 Ga0207639_10743500 3300026041 Bacteria 912
761 Ga0207639_10891660 3300026041 Bacteria 831
762 Ga0207678_10000479 3300026067 Bacteria 36311
763 Ga0207678_10004666 3300026067 Bacteria 12306
764 Ga0207678_10423257 3300026067 Bacteria 1155
765 Ga0207678_10636342 3300026067 Bacteria 937
766 Ga0207678_11176464 3300026067 Bacteria 679
767 Ga0207708_10001488 3300026075 Bacteria 17483
768 Ga0207708_10155546 3300026075 Bacteria 1803
769 Ga0207708_10979574 3300026075 Bacteria 734
770 Ga0207641_10027137 3300026088 Bacteria 4729
771 Ga0207641_10082849 3300026088 Bacteria 2788
772 Ga0207641_10124577 3300026088 Bacteria 2305
773 Ga0207648_10013007 3300026089 Bacteria 7764
774 Ga0207648_10101596 3300026089 Bacteria 2520
775 Ga0207648_10351197 3300026089 Bacteria 1329
776 Ga0207648_10699564 3300026089 Bacteria 939
777 Ga0207648_10831402 3300026089 Bacteria 861
778 Ga0207648_10839432 3300026089 Bacteria 856
779 Ga0207676_10000947 3300026095 Bacteria 22389
780 Ga0207676_10015129 3300026095 Bacteria 5565
781 Ga0207676_10022751 3300026095 Bacteria 4613
782 Ga0207676_10986433 3300026095 Bacteria 829
783 Ga0207676_11727044 3300026095 Bacteria 624
784 Ga0207674_10000976 3300026116 Bacteria 37399
785 Ga0207674_10020864 3300026116 Bacteria 7070
786 Ga0207674_10150873 3300026116 Bacteria 2281
787 Ga0207675_100012320 3300026118 Bacteria 7988
788 Ga0207675_100013335 3300026118 Bacteria 7669
789 Ga0207675_100146992 3300026118 Bacteria 2242
790 Ga0207675_100191955 3300026118 Bacteria 1959
791 Ga0207675_100280366 3300026118 Bacteria 1619
792 Ga0207675_100363659 3300026118 Bacteria 1420
793 Ga0207675_100624917 3300026118 Bacteria 1082
794 Ga0207698_11494138 3300026142 Bacteria 691
795 Ga0207698_12066501 3300026142 Bacteria 584
796 Ga0209973_1068824 3300027252 Bacteria 552
797 Ga0209973_1080000 3300027252 Bacteria 519
798 Ga0209995_1083802 3300027471 Bacteria 548
799 Ga0209968_1079422 3300027526 Bacteria 589
800 Ga0209999_1069820 3300027543 Bacteria 673
801 Ga0209982_1008968 3300027552 Bacteria 1473
802 Ga0209970_1004724 3300027614 Bacteria 2253
803 Ga0209970_1011043 3300027614 Bacteria 1482
804 Ga0210002_1061489 3300027617 Bacteria 655
805 Ga0209983_1007130 3300027665 Bacteria 2296
806 Ga0209588_1068802 3300027671 Bacteria 1144
807 Ga0209588_1132519 3300027671 Bacteria 795
808 Ga0209588_1183116 3300027671 Bacteria 657
809 Ga0209971_1053872 3300027682 Bacteria 972
810 Ga0209966_1025761 3300027695 Bacteria 1169
811 Ga0209966_1032498 3300027695 Bacteria 1063
812 Ga0209998_10000033 3300027717 Bacteria 58970
813 Ga0209998_10004684 3300027717 Bacteria 2897
814 Ga0209974_10004944 3300027876 Bacteria 4715
815 Ga0209974_10036354 3300027876 Bacteria 1636
816 Ga0209974_10046309 3300027876 Bacteria 1454
817 Ga0209974_10447288 3300027876 Bacteria 512
818 Ga0207428_10001231 3300027907 Bacteria 27439
819 Ga0207428_10006171 3300027907 Bacteria 11072
820 Ga0207428_10152289 3300027907 Bacteria 1760
821 Ga0207428_10416125 3300027907 Unclassified 983
822 Ga0207428_10652072 3300027907 Bacteria 755
823 Ga0268266_10834383 3300028379 Bacteria 891
824 Ga0268265_10022581 3300028380 Bacteria 4423
825 Ga0268265_10073601 3300028380 Bacteria 2669
826 Ga0268265_10117820 3300028380 Bacteria 2182
827 Ga0268265_10504020 3300028380 Bacteria 1141
828 Ga0268264_10012105 3300028381 Bacteria 7102
829 Ga0268264_10025410 3300028381 Bacteria 4839
830 Ga0268264_10166724 3300028381 Bacteria 1989
831 Ga0268264_10239075 3300028381 Bacteria 1681
832 Ga0268264_10264437 3300028381 Bacteria 1604
833 Ga0268264_10317707 3300028381 Bacteria 1471
834 Ga0268264_10432311 3300028381 Bacteria 1271
835 Ga0268264_10822558 3300028381 Bacteria 929
836 Ga0268264_10839492 3300028381 Bacteria 920
837 Ga0265326_10062699 3300028558 Bacteria 1051
838 Ga0265326_10139494 3300028558 Bacteria 692
839 Ga0265334_10043538 3300028573 Bacteria 1747
840 Ga0265334_10218149 3300028573 Bacteria 660
841 Ga0265334_10319722 3300028573 Bacteria 531
842 Ga0265323_10041686 3300028653 Bacteria 1665
843 Ga0265330_10030303 3300031235 Bacteria 2430
844 Ga0265325_10067385 3300031241 Bacteria 1804
845 Ga0265329_10003882 3300031242 Bacteria 6406
846 Ga0265329_10138309 3300031242 Bacteria 786
847 Ga0265339_10390981 3300031249 Bacteria 651
848 Ga0265331_10415132 3300031250 Bacteria 604
849 Ga0265316_10401842 3300031344 Bacteria 986
850 Ga0307408_100031382 3300031548 Bacteria 3700
851 Ga0307408_100033898 3300031548 Bacteria 3571
852 Ga0307408_100144256 3300031548 Bacteria 1872
853 Ga0307408_100285801 3300031548 Bacteria 1375
854 Ga0307408_100298633 3300031548 Bacteria 1348
855 Ga0316576_10101550 3300031727 Bacteria 2150
856 Ga0316578_10178691 3300031728 Bacteria 1279
857 Ga0307405_10137143 3300031731 Bacteria 1700
858 Ga0307405_10344546 3300031731 Bacteria 1147
859 Ga0307413_11056222 3300031824 Bacteria 699
860 Ga0307413_11260188 3300031824 Bacteria 645
861 Ga0307410_10144141 3300031852 Bacteria 1766
862 Ga0307410_10348062 3300031852 Bacteria 1183
863 Ga0307406_10272831 3300031901 Bacteria 1286
864 Ga0307406_10461961 3300031901 Bacteria 1021
865 Ga0307407_10261618 3300031903 Bacteria 1190
866 Ga0307407_10316454 3300031903 Bacteria 1094
867 Ga0307412_10408707 3300031911 Bacteria 1107
868 Ga0307412_10413370 3300031911 Bacteria 1102
869 Ga0307412_11098661 3300031911 Bacteria 708
870 Ga0307412_12035751 3300031911 Bacteria 532
871 Ga0307409_100482044 3300031995 Bacteria 1204
872 Ga0307409_100719521 3300031995 Bacteria 999
873 Ga0307409_100791322 3300031995 Bacteria 955
874 Ga0307409_100813077 3300031995 Bacteria 943
875 Ga0307409_101121213 3300031995 Bacteria 808
876 Ga0307416_100134480 3300032002 Bacteria 2234
877 Ga0307416_100775697 3300032002 Bacteria 1053
878 Ga0307416_100868487 3300032002 Bacteria 1001
879 Ga0307416_101450586 3300032002 Unclassified 792
880 Ga0307416_101792640 3300032002 Bacteria 718
881 Ga0307416_101896083 3300032002 Bacteria 699
882 Ga0307416_102849089 3300032002 Bacteria 578
883 Ga0307416_103557515 3300032002 Bacteria 521
884 Ga0307414_10654697 3300032004 Bacteria 947
885 Ga0307411_10053072 3300032005 Bacteria 2654
886 Ga0307411_10671177 3300032005 Bacteria 900
887 Ga0307411_11660179 3300032005 Bacteria 591
888 Ga0307415_100246364 3300032126 Bacteria 1449
889 Ga0307415_101576067 3300032126 Bacteria 630
890 Ga0307415_101803246 3300032126 Bacteria 592
891 Ga0373959_0004617 3300034820 Bacteria 2227
892 Ga0373929_0157631 3300035085 Bacteria 613
893 Ga0373940_0042618 3300035088 Bacteria 1251
894 Ga0373949_0067099 3300035090 Bacteria 933
895 Ga0373939_0384918 3300035114 Bacteria 578
896 Ga0373960_0009905 3300035121 Bacteria 2318
897 Ga0373960_0172378 3300035121 Bacteria 751
898 Ga0373961_0014163 3300035241 Bacteria 2022
899 Ga0373962_0016111 3300035242 Bacteria 1924
900 Ga0373962_0042926 3300035242 Bacteria 1280
901 Ga0373962_0063244 3300035242 Bacteria 1091
902 Ga0316574_0255009 3300035398 Bacteria 1120
903 Ga0373924_0175689 3300035410 Bacteria 942
904 Ga0373931_0018366 3300035691 Bacteria 3478
905 Ga0373931_0751515 3300035691 Bacteria 647
906 Ga0373933_0247907 3300035724 Bacteria 1147
907 Ga0373947_0464824 3300035725 Bacteria 858
908 Ga0395899_0017851 3300037312 Bacteria 5403
909 Ga0395899_0198132 3300037312 Bacteria 1402
910 Ga0395899_0807189 3300037312 Unclassified 579
911 Ga0395900_0000746 3300037418 Bacteria 43291
912 Ga0395900_0018449 3300037418 Bacteria 7116
913 Ga0395900_0276187 3300037418 Bacteria 1674
914 Ga0395898_0029991 3300037466 Bacteria 5445
915 Ga0395898_1776218 3300037466 Bacteria 538
916 Ga0395905_0086808 3300037471 Bacteria 2933
917 Ga0395905_0354268 3300037471 Bacteria 1360
918 Ga0395905_0717739 3300037471 Bacteria 902
919 Ga0395905_1110518 3300037471 Bacteria 694
920 Ga0395901_0001043 3300038443 Bacteria 29907
921 Ga0395901_0889184 3300038443 Bacteria 873
922 Ga0395901_1194720 3300038443 Unclassified 727
923 Ga0242420_035022 3300038996 Bacteria 943
924 Ga0242420_043835 3300038996 Bacteria 860
925 Ga0242420_053324 3300038996 Bacteria 794
926 Ga0439453_0078180 3300041408 Bacteria 710
927 Ga0439466_0042083 3300041411 Bacteria 1522
928 Ga0439466_0110455 3300041411 Bacteria 853
929 Ga0451791_1171156 3300041451 Bacteria 657
930 Ga0451793_0444071 3300041452 Bacteria 790
931 Ga0451798_1149648 3300041458 Bacteria 866
932 Ga0451800_0820853 3300041459 Bacteria 543
933 Ga0451804_1164747 3300041463 Bacteria 724
934 Ga0451807_0409845 3300041486 Bacteria 1232
935 Ga0451807_2391327 3300041486 Bacteria 1126
936 Ga0451849_1106345 3300041505 Bacteria 834
937 Ga0451851_0504347 3300041507 Bacteria 590
938 Ga0451855_0646559 3300041511 Bacteria 914
939 Ga0451853_0993859 3300041512 Bacteria 1008
940 Ga0439442_044452 3300042002 Bacteria 936
941 Ga0439450_095862 3300042008 Bacteria 749
942 Ga0450919_001995 3300042121 Bacteria 2650
943 Ga0450920_007538 3300042122 Bacteria 1974
944 Ga0450921_016431 3300042123 Bacteria 672
945 Ga0450923_098248 3300042125 Bacteria 673
946 Ga0450910_002440 3300042147 Bacteria 2443
947 Ga0439458_0003437 3300042157 Bacteria 3705
948 Ga0450908_038110 3300042184 Bacteria 833
949 Ga0439435_0004487 3300042436 Bacteria 3012
950 Ga0439459_0000781 3300042438 Bacteria 4390
951 Ga0439460_0008194 3300042461 Bacteria 2637
952 Ga0439460_0060508 3300042461 Bacteria 1155
953 Ga0439460_0066005 3300042461 Bacteria 1113
954 Ga0439460_0122098 3300042461 Bacteria 853
955 Ga0439460_0186128 3300042461 Bacteria 703
956 Ga0451577_0004126 3300042876 Bacteria 15566
957 Ga0451577_0086611 3300042876 Bacteria 2795
958 Ga0451577_0120015 3300042876 Bacteria 2355
959 Ga0451577_0681400 3300042876 Bacteria 932
960 Ga0453683_0033756 3300044673 Bacteria 3227
961 Ga0453683_0261074 3300044673 Bacteria 1105
962 Ga0453683_1067532 3300044673 Bacteria 538
963 Ga0453684_0046535 3300044712 Bacteria 5768
964 Ga0453684_0914737 3300044712 Bacteria 939
965 Ga0451576_0018548 3300045051 Bacteria 7622
966 Ga0451576_0029953 3300045051 Bacteria 5821
967 Ga0451576_0036653 3300045051 Bacteria 5197
968 Ga0451576_0946372 3300045051 Bacteria 903
969 Ga0451576_2206537 3300045051 Bacteria 565
970 Ga0451576_2604002 3300045051 Bacteria 516
971 Ga0466958_1044198 3300045836 Bacteria 533
972 Ga0495603_0563135 3300046455 Bacteria 652
973 Ga0495629_0278000 3300046459 Bacteria 1149
974 Ga0495629_0667924 3300046459 Bacteria 691
975 Ga0495641_0186682 3300046461 Bacteria 929
976 Ga0495641_0378146 3300046461 Bacteria 642
977 Ga0495584_0142086 3300046491 Bacteria 1219
978 Ga0495584_0277479 3300046491 Bacteria 852
979 Ga0495594_0311626 3300046499 Bacteria 897
980 Ga0495628_0483684 3300046516 Bacteria 896
981 Ga0495630_0268865 3300046517 Bacteria 1303
982 Ga0495630_0420422 3300046517 Bacteria 1024
983 Ga0495630_1517003 3300046517 Bacteria 503
984 Ga0495644_0055901 3300046523 Bacteria 1483
985 Ga0495644_0379692 3300046523 Bacteria 558
986 Ga0495642_0177562 3300046528 Bacteria 926
987 Ga0495640_0216001 3300046533 Bacteria 1211
988 Ga0495598_0070179 3300046537 Bacteria 1101
989 Ga0495645_0599719 3300046543 Bacteria 678
990 Ga0495633_0093328 3300046558 Bacteria 1399
991 Ga0495656_0042852 3300046615 Bacteria 1897
992 Ga0495656_0126235 3300046615 Bacteria 1213
993 Ga0495634_0344026 3300046642 Bacteria 894
994 Ga0495634_0397470 3300046642 Bacteria 819
995 Ga0495659_0010045 3300046664 Bacteria 3029
996 Ga0495657_0560667 3300046675 Bacteria 663
997 Ga0495647_0128779 3300046681 Bacteria 1071
998 Ga0495658_0154371 3300046683 Bacteria 1412
999 Ga0495658_0744590 3300046683 Bacteria 628
1000 Ga0495669_0525801 3300046684 Bacteria 575
1001 Ga0495670_0513380 3300046691 Bacteria 651
1002 Ga0495589_0528986 3300046794 Bacteria 538
1003 Ga0495636_0615305 3300047318 Bacteria 532
1004 Ga0495674_0131145 3300047319 Bacteria 2112
1005 Ga0495676_0412443 3300047321 Bacteria 895
1006 Ga0495676_1095893 3300047321 Bacteria 506
1007 Ga0495680_0466720 3300047322 Bacteria 862
1008 Ga0495675_0788568 3300047444 Bacteria 527
1009 Ga0495593_0311452 3300047673 Bacteria 787
1010 Ga0495614_0598942 3300048089 Bacteria 529
1011 Ga0496100_0435783 3300048903 Bacteria 1003
1012 Ga0496101_0172398 3300048904 Bacteria 1663
1013 Ga0496101_0618231 3300048904 Bacteria 856
1014 Ga0496101_0691772 3300048904 Bacteria 805
1015 Ga0496102_0002927 3300048905 Bacteria 14484
1016 Ga0496102_0162829 3300048905 Bacteria 2099
1017 Ga0496102_0201554 3300048905 Bacteria 1876
1018 Ga0496102_0437761 3300048905 Bacteria 1227
1019 Ga0496102_0642523 3300048905 Bacteria 984
1020 Ga0496102_1002751 3300048905 Bacteria 756
1021 Ga0496103_0038810 3300048906 Bacteria 2924
1022 Ga0496103_0118691 3300048906 Bacteria 1684
1023 Ga0496103_0246704 3300048906 Bacteria 1149
1024 Ga0496104_0046083 3300048907 Bacteria 4104
1025 Ga0496105_0056039 3300048908 Bacteria 3254
1026 Ga0496105_0078974 3300048908 Bacteria 2717
1027 Ga0496105_0652075 3300048908 Bacteria 812
1028 Ga0496106_0026511 3300048909 Bacteria 4316
1029 Ga0496106_0061533 3300048909 Bacteria 2848
1030 Ga0496106_0429381 3300048909 Bacteria 1062
1031 Ga0496106_0436720 3300048909 Bacteria 1052
1032 Ga0496106_0716067 3300048909 Bacteria 797
1033 Ga0496107_0011048 3300048910 Bacteria 6282
1034 Ga0496107_0020716 3300048910 Bacteria 4647
1035 Ga0496107_0114402 3300048910 Bacteria 1985
1036 Ga0496108_0011780 3300048911 Bacteria 7112
1037 Ga0496108_0172864 3300048911 Bacteria 1869
1038 Ga0496108_0203199 3300048911 Bacteria 1719
1039 Ga0496108_0225282 3300048911 Bacteria 1630
1040 Ga0496108_1081512 3300048911 Bacteria 682
1041 Ga0496108_1462832 3300048911 Bacteria 570
1042 Ga0496108_1672400 3300048911 Bacteria 525
1043 Ga0496109_0004228 3300048912 Bacteria 11982
1044 Ga0496109_0090274 3300048912 Bacteria 2833
1045 Ga0496109_0190412 3300048912 Bacteria 1928
1046 Ga0496109_0478361 3300048912 Bacteria 1176
1047 Ga0496109_0665783 3300048912 Bacteria 978
1048 Ga0496109_0808767 3300048912 Bacteria 875
1049 Ga0496109_1040798 3300048912 Bacteria 756
1050 Ga0496109_1116776 3300048912 Bacteria 725
1051 Ga0496109_1283023 3300048912 Unclassified 668
1052 Ga0496110_0037117 3300048913 Bacteria 4234
1053 Ga0496110_0151375 3300048913 Bacteria 2101
1054 Ga0496110_0620278 3300048913 Bacteria 980
1055 Ga0496110_0907567 3300048913 Bacteria 787
1056 Ga0496111_0002415 3300048914 Bacteria 11266
1057 Ga0496111_0145415 3300048914 Bacteria 1757
1058 Ga0496111_0439125 3300048914 Bacteria 963
1059 Ga0496111_0726040 3300048914 Bacteria 722
1060 Ga0496112_0031692 3300048915 Bacteria 5128
1061 Ga0496112_0103091 3300048915 Bacteria 2823
1062 Ga0496112_0187098 3300048915 Bacteria 2034
1063 Ga0496112_0314432 3300048915 Bacteria 1511
1064 Ga0496113_0003033 3300048916 Bacteria 9941
1065 Ga0496113_0050258 3300048916 Bacteria 3108
1066 Ga0496113_0068001 3300048916 Bacteria 2703
1067 Ga0496113_0092907 3300048916 Bacteria 2328
1068 Ga0496113_0100148 3300048916 Bacteria 2245
1069 Ga0496114_0245722 3300048917 Bacteria 1574
1070 Ga0496114_0877890 3300048917 Bacteria 777
1071 Ga0496114_1194704 3300048917 Bacteria 647
1072 Ga0496114_1223204 3300048917 Bacteria 637
1073 Ga0496114_1335711 3300048917 Bacteria 604
1074 Ga0496115_0903741 3300048918 Bacteria 681
1075 Ga0501291_152622 3300049514 Bacteria 523
1076 Ga0501298_104912 3300049521 Bacteria 649
1077 Ga0501299_193370 3300049522 Bacteria 537
1078 Ga0501031_0001102 3300049568 Bacteria 16477
1079 Ga0501031_0066354 3300049568 Bacteria 2351
1080 Ga0501031_0107588 3300049568 Bacteria 1821
1081 Ga0501031_0184597 3300049568 Bacteria 1362
1082 Ga0501031_0349833 3300049568 Bacteria 957
1083 Ga0501031_0541257 3300049568 Bacteria 750
1084 Ga0501031_0673821 3300049568 Bacteria 664
1085 Ga0501032_0046191 3300049569 Bacteria 2943
1086 Ga0501032_0137787 3300049569 Bacteria 1608
1087 Ga0501032_0356349 3300049569 Bacteria 942
1088 Ga0501033_0098027 3300049570 Bacteria 2141
1089 Ga0501033_0175385 3300049570 Bacteria 1538
1090 Ga0501033_0301623 3300049570 Bacteria 1128
1091 Ga0501033_1025479 3300049570 Bacteria 551
1092 Ga0501034_0112774 3300049571 Bacteria 2709
1093 Ga0501034_0306340 3300049571 Bacteria 1524
1094 Ga0501036_0014639 3300049572 Bacteria 6536
1095 Ga0501036_0018529 3300049572 Bacteria 5835
1096 Ga0501036_0020368 3300049572 Bacteria 5572
1097 Ga0501036_0118983 3300049572 Bacteria 2231
1098 Ga0501036_0135776 3300049572 Bacteria 2076
1099 Ga0501036_0143810 3300049572 Bacteria 2012
1100 Ga0501036_0167949 3300049572 Bacteria 1849
1101 Ga0501036_0421848 3300049572 Bacteria 1112
1102 Ga0501036_0475578 3300049572 Bacteria 1040
1103 Ga0501036_0607291 3300049572 Bacteria 907
1104 Ga0501036_1218461 3300049572 Bacteria 613
1105 Ga0501037_0023877 3300049573 Bacteria 4522
1106 Ga0501037_0141957 3300049573 Bacteria 1718
1107 Ga0501037_0916106 3300049573 Bacteria 574
1108 Ga0501038_0029771 3300049574 Bacteria 4835
1109 Ga0501038_0034839 3300049574 Bacteria 4424
1110 Ga0501038_0043208 3300049574 Bacteria 3920
1111 Ga0501038_0296463 3300049574 Unclassified 1270
1112 Ga0501038_0913653 3300049574 Bacteria 648
1113 Ga0501039_0005800 3300049575 Bacteria 9349
1114 Ga0501039_0005907 3300049575 Bacteria 9273
1115 Ga0501039_0022988 3300049575 Bacteria 4782
1116 Ga0501039_0089783 3300049575 Bacteria 2395
1117 Ga0501039_0160545 3300049575 Bacteria 1767
1118 Ga0501039_0180448 3300049575 Bacteria 1660
1119 Ga0501039_0353834 3300049575 Bacteria 1154
1120 Ga0501039_0399536 3300049575 Bacteria 1079
1121 Ga0501039_0457064 3300049575 Bacteria 1003
1122 Ga0501039_0687475 3300049575 Bacteria 800
1123 Ga0501039_0725711 3300049575 Bacteria 776
1124 Ga0501040_0027705 3300049576 Bacteria 3816
1125 Ga0501040_0030257 3300049576 Bacteria 3657
1126 Ga0501040_0040890 3300049576 Bacteria 3156
1127 Ga0501040_0053109 3300049576 Bacteria 2774
1128 Ga0501040_0081347 3300049576 Bacteria 2245
1129 Ga0501040_0131315 3300049576 Bacteria 1761
1130 Ga0501040_0132299 3300049576 Bacteria 1754
1131 Ga0501040_0178112 3300049576 Bacteria 1506
1132 Ga0501040_0316013 3300049576 Bacteria 1117
1133 Ga0501040_0434878 3300049576 Bacteria 944
1134 Ga0501040_0662735 3300049576 Bacteria 754
1135 Ga0501040_0972659 3300049576 Bacteria 615
1136 Ga0501040_1378340 3300049576 Unclassified 512
1137 Ga0501041_0018777 3300049577 Bacteria 4118
1138 Ga0501041_0018852 3300049577 Bacteria 4110
1139 Ga0501041_0035439 3300049577 Bacteria 3023
1140 Ga0501041_0037954 3300049577 Bacteria 2920
1141 Ga0501041_0040238 3300049577 Bacteria 2837
1142 Ga0501041_0056330 3300049577 Bacteria 2401
1143 Ga0501041_0074163 3300049577 Bacteria 2090
1144 Ga0501041_0074545 3300049577 Bacteria 2085
1145 Ga0501041_0090099 3300049577 Bacteria 1894
1146 Ga0501041_0098445 3300049577 Bacteria 1809
1147 Ga0501041_0153951 3300049577 Bacteria 1436
1148 Ga0501041_0323453 3300049577 Bacteria 973
1149 Ga0501041_0347514 3300049577 Bacteria 937
1150 Ga0501041_0462888 3300049577 Bacteria 805
1151 Ga0501041_0642233 3300049577 Bacteria 678
1152 Ga0501041_0930215 3300049577 Bacteria 559
1153 Ga0501041_1080647 3300049577 Unclassified 517
1154 Ga0501042_0007208 3300049578 Bacteria 7276
1155 Ga0501042_0015115 3300049578 Bacteria 5277
1156 Ga0501042_0057888 3300049578 Bacteria 2766
1157 Ga0501042_0066250 3300049578 Bacteria 2582
1158 Ga0501042_0181707 3300049578 Bacteria 1517
1159 Ga0501042_0210747 3300049578 Bacteria 1402
1160 Ga0501042_0260715 3300049578 Bacteria 1251
1161 Ga0501042_0529207 3300049578 Bacteria 856
1162 Ga0501042_1007529 3300049578 Bacteria 607
1163 Ga0501042_1299690 3300049578 Bacteria 530
1164 Ga0501043_0026715 3300049579 Bacteria 4529
1165 Ga0501043_0052487 3300049579 Bacteria 3202
1166 Ga0501043_0238518 3300049579 Bacteria 1403
1167 Ga0501046_0025165 3300049580 Bacteria 4874
1168 Ga0501046_0034844 3300049580 Bacteria 4060
1169 Ga0501046_0074596 3300049580 Bacteria 2632
1170 Ga0501046_0088073 3300049580 Bacteria 2391
1171 Ga0501046_0128316 3300049580 Bacteria 1925
1172 Ga0501046_0247233 3300049580 Bacteria 1314
1173 Ga0501046_0757552 3300049580 Bacteria 682
1174 Ga0501046_1027082 3300049580 Bacteria 571
1175 Ga0501046_1211348 3300049580 Bacteria 518
1176 Ga0501048_0006684 3300049582 Bacteria 8759
1177 Ga0501048_0031851 3300049582 Bacteria 3813
1178 Ga0501048_0035284 3300049582 Bacteria 3601
1179 Ga0501048_0038877 3300049582 Bacteria 3414
1180 Ga0501048_0077748 3300049582 Bacteria 2342
1181 Ga0501048_0122662 3300049582 Bacteria 1836
1182 Ga0501048_0183580 3300049582 Bacteria 1483
1183 Ga0501048_0242449 3300049582 Bacteria 1279
1184 Ga0501048_0247696 3300049582 Bacteria 1265
1185 Ga0501048_0424844 3300049582 Bacteria 951
1186 Ga0501048_0976484 3300049582 Bacteria 609
1187 Ga0501048_1249604 3300049582 Bacteria 534
1188 Ga0501048_1375103 3300049582 Unclassified 507
1189 Ga0501067_0005760 3300049583 Bacteria 6876
1190 Ga0501067_0010581 3300049583 Bacteria 5104
1191 Ga0501067_0019689 3300049583 Bacteria 3736
1192 Ga0501067_0222873 3300049583 Bacteria 1050
1193 Ga0501067_0495584 3300049583 Bacteria 683
1194 Ga0501068_0022009 3300049584 Bacteria 3726
1195 Ga0501068_0023799 3300049584 Bacteria 3592
1196 Ga0501068_0054677 3300049584 Bacteria 2418
1197 Ga0501068_0088356 3300049584 Bacteria 1909
1198 Ga0501068_0091270 3300049584 Bacteria 1879
1199 Ga0501068_0114285 3300049584 Bacteria 1680
1200 Ga0501068_0233171 3300049584 Bacteria 1171
1201 Ga0501068_0322134 3300049584 Bacteria 991
1202 Ga0501068_0385517 3300049584 Bacteria 903
1203 Ga0501069_0008035 3300049585 Bacteria 5541
1204 Ga0501069_0039036 3300049585 Bacteria 2622
1205 Ga0501069_0042709 3300049585 Bacteria 2508
1206 Ga0501069_0091422 3300049585 Bacteria 1721
1207 Ga0501069_0113912 3300049585 Bacteria 1542
1208 Ga0501069_0144433 3300049585 Unclassified 1366
1209 Ga0501069_0225722 3300049585 Bacteria 1089
1210 Ga0501069_0442458 3300049585 Bacteria 772
1211 Ga0501069_0643694 3300049585 Bacteria 638
1212 Ga0501070_0032346 3300049586 Bacteria 4377
1213 Ga0501070_0064055 3300049586 Bacteria 3045
1214 Ga0501070_0144315 3300049586 Bacteria 1965
1215 Ga0501070_0173569 3300049586 Bacteria 1775
1216 Ga0501070_0396889 3300049586 Bacteria 1116
1217 Ga0501070_0399408 3300049586 Bacteria 1112
1218 Ga0501070_0883372 3300049586 Bacteria 698
1219 Ga0501070_0954653 3300049586 Bacteria 667
1220 Ga0501071_0006712 3300049587 Bacteria 7482
1221 Ga0501071_0061077 3300049587 Bacteria 2729
1222 Ga0501071_0069813 3300049587 Bacteria 2559
1223 Ga0501071_0070094 3300049587 Bacteria 2553
1224 Ga0501071_0070969 3300049587 Bacteria 2538
1225 Ga0501071_0083857 3300049587 Bacteria 2335
1226 Ga0501071_0096077 3300049587 Bacteria 2181
1227 Ga0501071_0111146 3300049587 Bacteria 2025
1228 Ga0501071_0117501 3300049587 Bacteria 1970
1229 Ga0501071_0143861 3300049587 Bacteria 1777
1230 Ga0501071_0261877 3300049587 Bacteria 1306
1231 Ga0501071_0266426 3300049587 Bacteria 1294
1232 Ga0501071_0300236 3300049587 Bacteria 1217
1233 Ga0501071_0359289 3300049587 Unclassified 1109
1234 Ga0501071_0620029 3300049587 Bacteria 832
1235 Ga0501071_0822134 3300049587 Bacteria 716
1236 Ga0501072_0004990 3300049588 Bacteria 10096
1237 Ga0501072_0005095 3300049588 Bacteria 9997
1238 Ga0501072_0006661 3300049588 Bacteria 8787
1239 Ga0501072_0031968 3300049588 Bacteria 4120
1240 Ga0501072_0035339 3300049588 Bacteria 3916
1241 Ga0501072_0041583 3300049588 Bacteria 3611
1242 Ga0501072_0061418 3300049588 Bacteria 2964
1243 Ga0501072_0064661 3300049588 Bacteria 2885
1244 Ga0501072_0128528 3300049588 Bacteria 2019
1245 Ga0501072_0133693 3300049588 Bacteria 1978
1246 Ga0501072_0167980 3300049588 Bacteria 1750
1247 Ga0501072_0177774 3300049588 Bacteria 1697
1248 Ga0501072_0374657 3300049588 Bacteria 1129
1249 Ga0501072_0593191 3300049588 Bacteria 874
1250 Ga0501072_0620424 3300049588 Bacteria 852
1251 Ga0501072_0947136 3300049588 Unclassified 672
1252 Ga0501072_1230685 3300049588 Bacteria 581
1253 Ga0501073_0094928 3300049589 Bacteria 2071
1254 Ga0501073_0101177 3300049589 Bacteria 2001
1255 Ga0501073_0104471 3300049589 Bacteria 1966
1256 Ga0501073_0143797 3300049589 Bacteria 1653
1257 Ga0501073_0407421 3300049589 Bacteria 939
1258 Ga0501073_0434680 3300049589 Bacteria 907
1259 Ga0501074_0013225 3300049590 Bacteria 6001
1260 Ga0501074_0018600 3300049590 Bacteria 5047
1261 Ga0501074_0035394 3300049590 Bacteria 3618
1262 Ga0501074_0047789 3300049590 Bacteria 3092
1263 Ga0501074_0163681 3300049590 Bacteria 1588
1264 Ga0501074_0205306 3300049590 Bacteria 1404
1265 Ga0501074_0243635 3300049590 Bacteria 1279
1266 Ga0501074_0282885 3300049590 Bacteria 1179
1267 Ga0501074_0880006 3300049590 Bacteria 630
1268 Ga0501074_1274508 3300049590 Bacteria 515
1269 Ga0501075_0003686 3300049591 Bacteria 10280
1270 Ga0501075_0006527 3300049591 Bacteria 8031
1271 Ga0501075_0032553 3300049591 Bacteria 3874
1272 Ga0501075_0045044 3300049591 Bacteria 3310
1273 Ga0501075_0048619 3300049591 Bacteria 3187
1274 Ga0501075_0054210 3300049591 Bacteria 3016
1275 Ga0501075_0054941 3300049591 Bacteria 2996
1276 Ga0501075_0096087 3300049591 Bacteria 2249
1277 Ga0501075_0129687 3300049591 Bacteria 1921
1278 Ga0501075_0133394 3300049591 Bacteria 1892
1279 Ga0501075_0166070 3300049591 Bacteria 1684
1280 Ga0501075_0294179 3300049591 Bacteria 1237
1281 Ga0501075_0295006 3300049591 Bacteria 1235
1282 Ga0501075_0303232 3300049591 Bacteria 1217
1283 Ga0501075_0341325 3300049591 Bacteria 1141
1284 Ga0501075_0483603 3300049591 Bacteria 944
1285 Ga0501075_0595012 3300049591 Bacteria 844
1286 Ga0501075_0610679 3300049591 Bacteria 832
1287 Ga0501075_1214346 3300049591 Bacteria 572
1288 Ga0501076_0000828 3300049592 Bacteria 20096
1289 Ga0501076_0006003 3300049592 Bacteria 8774
1290 Ga0501076_0008325 3300049592 Bacteria 7600
1291 Ga0501076_0010568 3300049592 Bacteria 6854
1292 Ga0501076_0025463 3300049592 Bacteria 4578
1293 Ga0501076_0030364 3300049592 Bacteria 4209
1294 Ga0501076_0033732 3300049592 Bacteria 3997
1295 Ga0501076_0053642 3300049592 Bacteria 3195
1296 Ga0501076_0198082 3300049592 Bacteria 1640
1297 Ga0501076_0239018 3300049592 Unclassified 1486
1298 Ga0501076_0266810 3300049592 Bacteria 1402
1299 Ga0501076_0284374 3300049592 Bacteria 1355
1300 Ga0501076_0310524 3300049592 Bacteria 1293
1301 Ga0501076_0327149 3300049592 Bacteria 1257
1302 Ga0501076_0537126 3300049592 Bacteria 964
1303 Ga0501076_0571261 3300049592 Bacteria 932
1304 Ga0501076_0946884 3300049592 Unclassified 710
1305 Ga0501076_0952015 3300049592 Bacteria 708
1306 Ga0501076_1541642 3300049592 Bacteria 545
1307 Ga0501077_0002228 3300049593 Bacteria 11694
1308 Ga0501077_0007973 3300049593 Bacteria 6545
1309 Ga0501077_0008664 3300049593 Bacteria 6305
1310 Ga0501077_0015616 3300049593 Bacteria 4782
1311 Ga0501077_0021866 3300049593 Bacteria 4049
1312 Ga0501077_0086304 3300049593 Bacteria 1989
1313 Ga0501077_0092745 3300049593 Bacteria 1913
1314 Ga0501077_0093040 3300049593 Bacteria 1911
1315 Ga0501077_0095370 3300049593 Bacteria 1886
1316 Ga0501077_0122826 3300049593 Bacteria 1646
1317 Ga0501077_0186839 3300049593 Bacteria 1317
1318 Ga0501077_0266468 3300049593 Bacteria 1090
1319 Ga0501077_0292983 3300049593 Bacteria 1036
1320 Ga0501077_0853332 3300049593 Bacteria 586
1321 Ga0501077_1132275 3300049593 Bacteria 504
1322 Ga0501214_097818 3300049659 Bacteria 513
1323 Ga0501235_033634 3300049669 Bacteria 1162
1324 Ga0501236_019746 3300049670 Bacteria 986
1325 Ga0501221_259428 3300049704 Bacteria 502
1326 Ga0501079_0007693 3300049741 Bacteria 8156
1327 Ga0501079_0008408 3300049741 Bacteria 7824
1328 Ga0501079_0011385 3300049741 Bacteria 6789
1329 Ga0501079_0012882 3300049741 Bacteria 6383
1330 Ga0501079_0015423 3300049741 Bacteria 5830
1331 Ga0501079_0028355 3300049741 Bacteria 4295
1332 Ga0501079_0037158 3300049741 Bacteria 3752
1333 Ga0501079_0043397 3300049741 Bacteria 3471
1334 Ga0501079_0050019 3300049741 Bacteria 3226
1335 Ga0501079_0159507 3300049741 Bacteria 1758
1336 Ga0501079_0535217 3300049741 Bacteria 921
1337 Ga0501079_0824169 3300049741 Bacteria 731
1338 Ga0501080_0007716 3300049742 Bacteria 9727
1339 Ga0501080_0008862 3300049742 Bacteria 9145
1340 Ga0501080_0011401 3300049742 Bacteria 8142
1341 Ga0501080_0013087 3300049742 Bacteria 7619
1342 Ga0501080_0073228 3300049742 Bacteria 3187
1343 Ga0501080_0102029 3300049742 Bacteria 2662
1344 Ga0501080_0252128 3300049742 Bacteria 1609
1345 Ga0501080_0275938 3300049742 Bacteria 1529
1346 Ga0501080_0665037 3300049742 Bacteria 921
1347 Ga0501080_0919146 3300049742 Bacteria 762
1348 Ga0501080_1183785 3300049742 Bacteria 658
1349 Ga0501080_1265206 3300049742 Bacteria 633
1350 Ga0501080_1344792 3300049742 Bacteria 611
1351 Ga0501081_0000603 3300049743 Bacteria 20525
1352 Ga0501081_0002842 3300049743 Bacteria 10997
1353 Ga0501081_0004264 3300049743 Bacteria 9166
1354 Ga0501081_0006863 3300049743 Bacteria 7403
1355 Ga0501081_0025611 3300049743 Bacteria 3970
1356 Ga0501081_0027309 3300049743 Bacteria 3850
1357 Ga0501081_0030008 3300049743 Bacteria 3677
1358 Ga0501081_0042769 3300049743 Bacteria 3105
1359 Ga0501081_0056784 3300049743 Bacteria 2706
1360 Ga0501081_0061300 3300049743 Bacteria 2608
1361 Ga0501081_0119600 3300049743 Bacteria 1875
1362 Ga0501081_0269792 3300049743 Bacteria 1244
1363 Ga0501081_0710963 3300049743 Bacteria 754
1364 Ga0501081_0994221 3300049743 Bacteria 634
1365 Ga0501083_0085258 3300049744 Bacteria 2090
1366 Ga0501083_0086258 3300049744 Bacteria 2076
1367 Ga0501083_0094361 3300049744 Bacteria 1975
1368 Ga0501083_0201990 3300049744 Bacteria 1296
1369 Ga0501083_0258197 3300049744 Bacteria 1134
1370 Ga0501083_0331268 3300049744 Bacteria 990
1371 Ga0501083_0516786 3300049744 Bacteria 777
1372 Ga0501083_0827960 3300049744 Bacteria 602
1373 Ga0501035_0012454 3300049822 Bacteria 7860
1374 Ga0501035_0123831 3300049822 Bacteria 2258
1375 Ga0501035_0222552 3300049822 Bacteria 1611
1376 Ga0501035_0477590 3300049822 Bacteria 1028
1377 Ga0501035_0738543 3300049822 Bacteria 791
1378 Ga0501035_0795923 3300049822 Bacteria 755
1379 Ga0501044_0434746 3300049823 Bacteria 1221
1380 Ga0501044_0841110 3300049823 Bacteria 795
1381 Ga0501045_0005861 3300049824 Bacteria 8501
1382 Ga0501045_0005964 3300049824 Bacteria 8430
1383 Ga0501045_0013281 3300049824 Bacteria 5814
1384 Ga0501045_0020637 3300049824 Bacteria 4708
1385 Ga0501045_0050570 3300049824 Bacteria 3032
1386 Ga0501045_0066560 3300049824 Bacteria 2645
1387 Ga0501045_0067339 3300049824 Bacteria 2630
1388 Ga0501045_0115015 3300049824 Bacteria 1996
1389 Ga0501045_0177509 3300049824 Bacteria 1587
1390 Ga0501045_0475234 3300049824 Bacteria 929
1391 Ga0501045_0588383 3300049824 Bacteria 824
1392 Ga0501045_0731929 3300049824 Bacteria 729
1393 Ga0501045_0765706 3300049824 Bacteria 711
1394 Ga0501045_0772861 3300049824 Bacteria 708
1395 Ga0501045_0950527 3300049824 Bacteria 631
1396 nmdc:mga05p37_1273147_c1 3300050507 Bacteria 752
1397 nmdc:mga05p37_127_c1 3300050507 Bacteria 69551
1398 nmdc:mga05p37_132836_c1 3300050507 Bacteria 3053
1399 nmdc:mga05p37_1614121_c1 3300050507 Bacteria 638
1400 nmdc:mga05p37_1771_c1 3300050507 Bacteria 25228
1401 nmdc:mga05p37_237152_c1 3300050507 Bacteria 2195
1402 nmdc:mga05p37_239_c1 3300050507 Bacteria 56085
1403 nmdc:mga05p37_359769_c1 3300050507 Bacteria 1711
1404 nmdc:mga05p37_3711_c3 3300050507 Bacteria 3488
1405 nmdc:mga05p37_41349_c1 3300050507 Bacteria 5659
1406 nmdc:mga05p37_41677_c1 3300050507 Bacteria 5638
1407 nmdc:mga05p37_449685_c1 3300050507 Bacteria 1492
1408 nmdc:mga05p37_465675_c1 3300050507 Bacteria 1459
1409 nmdc:mga05p37_46567_c1 3300050507 Bacteria 3740
1410 nmdc:mga05p37_48588_c1 3300050507 Bacteria 5218
1411 nmdc:mga05p37_633329_c1 3300050507 Bacteria 1201
1412 nmdc:mga05p37_749680_c1 3300050507 Bacteria 1076
1413 nmdc:mga05p37_7507_c1 3300050507 Bacteria 12855
1414 nmdc:mga05p37_82059_c1 3300050507 Bacteria 3972
1415 nmdc:mga05p37_87223_c1 3300050507 Bacteria 3846
1416 nmdc:mga05p37_99945_c1 3300050507 Bacteria 3572
1417 nmdc:mga09592_100912_c1 3300050508 Bacteria 2472
1418 nmdc:mga09592_3272_c1 3300050508 Bacteria 13116
1419 nmdc:mga09592_395144_c1 3300050508 Unclassified 1195
1420 nmdc:mga09592_427_c1 3300050508 Bacteria 31032
1421 nmdc:mga09592_4396_c1 3300050508 Bacteria 11403
1422 nmdc:mga09592_50910_c1 3300050508 Bacteria 3493
1423 nmdc:mga09592_8665_c1 3300050508 Bacteria 8278
1424 nmdc:mga09592_94679_c1 3300050508 Bacteria 2554
1425 nmdc:mga0qj67_11105_c1 3300050509 Bacteria 6744
1426 nmdc:mga0qj67_151458_c1 3300050509 Unclassified 1882
1427 nmdc:mga0qj67_1550410_c1 3300050509 Unclassified 509
1428 nmdc:mga0qj67_343909_c1 3300050509 Unclassified 1206
1429 nmdc:mga0qj67_4377_c1 3300050509 Bacteria 10231
1430 nmdc:mga0qj67_67987_c1 3300050509 Bacteria 2839
1431 nmdc:mga0qj67_70580_c1 3300050509 Bacteria 2786
1432 nmdc:mga0qj67_823880_c1 3300050509 Bacteria 734
1433 nmdc:mga0qj67_85671_c1 3300050509 Bacteria 2527
1434 nmdc:mga06r32_116907_c1 3300050510 Bacteria 2628
1435 nmdc:mga06r32_173288_c1 3300050510 Bacteria 2142
1436 nmdc:mga06r32_221351_c1 3300050510 Bacteria 1881
1437 nmdc:mga06r32_223308_c1 3300050510 Bacteria 1872
1438 nmdc:mga06r32_3037_c1 3300050510 Bacteria 15027
1439 nmdc:mga06r32_339939_c1 3300050510 Bacteria 1486
1440 nmdc:mga06r32_366437_c1 3300050510 Bacteria 1424
1441 nmdc:mga06r32_443_c2 3300050510 Bacteria 17730
1442 nmdc:mga06r32_46009_c1 3300050510 Bacteria 4162
1443 nmdc:mga06r32_4884_c1 3300050510 Bacteria 12078
1444 nmdc:mga06r32_56447_c1 3300050510 Bacteria 3770
1445 nmdc:mga06r32_58216_c1 3300050510 Bacteria 3714
1446 nmdc:mga06r32_622833_c1 3300050510 Bacteria 1049
1447 nmdc:mga08y16_1356033_c1 3300050511 Bacteria 676
1448 nmdc:mga08y16_1390810_c1 3300050511 Unclassified 665
1449 nmdc:mga08y16_1476_c1 3300050511 Bacteria 23611
1450 nmdc:mga08y16_157784_c1 3300050511 Bacteria 2358
1451 nmdc:mga08y16_1725416_c1 3300050511 Bacteria 581
1452 nmdc:mga08y16_320611_c1 3300050511 Bacteria 1595
1453 nmdc:mga08y16_430421_c1 3300050511 Bacteria 1348
1454 nmdc:mga08y16_4404_c1 3300050511 Bacteria 14719
1455 nmdc:mga08y16_462407_c1 3300050511 Bacteria 1293
1456 nmdc:mga08y16_606536_c1 3300050511 Bacteria 1103
1457 nmdc:mga08y16_67961_c1 3300050511 Bacteria 3717
1458 nmdc:mga08y16_852381_c1 3300050511 Bacteria 900
1459 nmdc:mga08y16_94351_c1 3300050511 Bacteria 3117
1460 nmdc:mga0n895_10071_c1 3300050512 Bacteria 8319
1461 nmdc:mga0n895_115875_c1 3300050512 Bacteria 2698
1462 nmdc:mga0n895_12425_c1 3300050512 Bacteria 7638
1463 nmdc:mga0n895_125307_c1 3300050512 Bacteria 2592
1464 nmdc:mga0n895_19695_c1 3300050512 Bacteria 6275
1465 nmdc:mga0n895_241394_c1 3300050512 Bacteria 1834
1466 nmdc:mga0n895_2780_c1 3300050512 Bacteria 13838
1467 nmdc:mga0n895_29836_c1 3300050512 Bacteria 5205
1468 nmdc:mga0n895_327285_c1 3300050512 Bacteria 1553
1469 nmdc:mga0n895_487472_c1 3300050512 Bacteria 1243
1470 nmdc:mga0n895_618867_c1 3300050512 Bacteria 1084
1471 nmdc:mga0n895_66139_c1 3300050512 Bacteria 3579
1472 nmdc:mga0n895_735210_c1 3300050512 Bacteria 981
1473 nmdc:mga0n895_765352_c1 3300050512 Bacteria 958
1474 nmdc:mga0n895_976908_c1 3300050512 Bacteria 829
1475 nmdc:mga0rr50_1004031_c1 3300050513 Bacteria 711
1476 nmdc:mga0rr50_110997_c1 3300050513 Bacteria 2170
1477 nmdc:mga0rr50_1255723_c1 3300050513 Bacteria 629
1478 nmdc:mga0rr50_193_c1 3300050513 Bacteria 33095
1479 nmdc:mga0rr50_342580_c1 3300050513 Bacteria 1256
1480 nmdc:mga0rr50_396286_c1 3300050513 Bacteria 1166
1481 nmdc:mga0rr50_44168_c1 3300050513 Bacteria 3267
1482 nmdc:mga0rr50_594369_c1 3300050513 Bacteria 943
1483 nmdc:mga0rr50_647439_c1 3300050513 Bacteria 902
1484 nmdc:mga08x19_134704_c1 3300050514 Bacteria 1665
1485 nmdc:mga08x19_201954_c1 3300050514 Bacteria 1363
1486 nmdc:mga08x19_29139_c1 3300050514 Bacteria 3461
1487 nmdc:mga08x19_382_c1 3300050514 Bacteria 31074
1488 nmdc:mga08x19_434834_c1 3300050514 Bacteria 923
1489 nmdc:mga0a205_1045541_c1 3300050515 Bacteria 664
1490 nmdc:mga0a205_117324_c1 3300050515 Bacteria 2560
1491 nmdc:mga0a205_1220759_c1 3300050515 Bacteria 600
1492 nmdc:mga0a205_1525_c1 3300050515 Bacteria 19796
1493 nmdc:mga0a205_167925_c1 3300050515 Bacteria 2090
1494 nmdc:mga0a205_175729_c1 3300050515 Bacteria 2037
1495 nmdc:mga0a205_193959_c1 3300050515 Bacteria 1923
1496 nmdc:mga0a205_3226_c1 3300050515 Bacteria 10022
1497 nmdc:mga0a205_335988_c1 3300050515 Unclassified 1380
1498 nmdc:mga0a205_389725_c1 3300050515 Bacteria 1258
1499 nmdc:mga0a205_410408_c1 3300050515 Bacteria 1217
1500 nmdc:mga0a205_4157_c1 3300050515 Bacteria 12968
1501 nmdc:mga0a205_4728_c1 3300050515 Bacteria 12228
1502 nmdc:mga0a205_55968_c1 3300050515 Bacteria 3808
1503 nmdc:mga0a205_859233_c1 3300050515 Bacteria 754
1504 nmdc:mga0a205_88158_c1 3300050515 Bacteria 2998
1505 Ga0495601_0291029 3300053077 Bacteria 1064
1506 Ga0495595_0472939 3300053084 Bacteria 638
1507 Ga0501084_0003108 3300054114 Bacteria 13456
1508 Ga0501084_0007770 3300054114 Bacteria 8825
1509 Ga0501084_0007825 3300054114 Bacteria 8795
1510 Ga0501084_0008989 3300054114 Bacteria 8263
1511 Ga0501084_0020565 3300054114 Bacteria 5504
1512 Ga0501084_0034405 3300054114 Bacteria 4237
1513 Ga0501084_0046728 3300054114 Bacteria 3626
1514 Ga0501084_0088522 3300054114 Bacteria 2599
1515 Ga0501084_0150328 3300054114 Bacteria 1963
1516 Ga0501084_0225189 3300054114 Bacteria 1582
1517 Ga0501084_0268415 3300054114 Bacteria 1441
1518 Ga0501084_0281811 3300054114 Bacteria 1403
1519 Ga0501084_0345171 3300054114 Bacteria 1257
1520 Ga0501084_0361739 3300054114 Bacteria 1226
1521 Ga0501084_0400080 3300054114 Bacteria 1161
1522 Ga0501084_0529690 3300054114 Bacteria 996
1523 Ga0501084_0949467 3300054114 Bacteria 723
1524 Ga0501084_1324922 3300054114 Bacteria 603
1525 Ga0590071_000379 3300059421 Bacteria 13043
1526 Ga0590074_004807 3300059423 Bacteria 2230
1527 Ga0590075_005853 3300059424 Bacteria 2908
1528 Ga0590077_001676 3300059426 Bacteria 5071
1529 Ga0501082_0003994 3300060353 Bacteria 12872
1530 Ga0501082_0004439 3300060353 Bacteria 12252
1531 Ga0501082_0008904 3300060353 Bacteria 8659
1532 Ga0501082_0027950 3300060353 Bacteria 4858
1533 Ga0501082_0072005 3300060353 Bacteria 2977
1534 Ga0501082_0098452 3300060353 Bacteria 2529
1535 Ga0501082_0147365 3300060353 Bacteria 2043
1536 Ga0501082_0159341 3300060353 Bacteria 1961
1537 Ga0501082_0216463 3300060353 Bacteria 1666
1538 Ga0501082_0252935 3300060353 Bacteria 1533
1539 Ga0501082_0263594 3300060353 Bacteria 1499
1540 Ga0501082_0358531 3300060353 Bacteria 1272
1541 Ga0501082_0496182 3300060353 Bacteria 1067
1542 Ga0501082_0695532 3300060353 Bacteria 890
1543 Ga0530510_0006927 3300061734 Bacteria 7901
1544 Ga0530510_0009546 3300061734 Bacteria 6803
1545 Ga0530510_0011881 3300061734 Bacteria 6111
1546 Ga0530510_0023614 3300061734 Bacteria 4383
1547 Ga0530510_0025278 3300061734 Bacteria 4245
1548 Ga0530510_0034539 3300061734 Bacteria 3644
1549 Ga0530510_0040894 3300061734 Bacteria 3347
1550 Ga0530510_0053095 3300061734 Bacteria 2928
1551 Ga0530510_0054905 3300061734 Bacteria 2878
1552 Ga0530510_0059549 3300061734 Bacteria 2763
1553 Ga0530510_0255763 3300061734 Bacteria 1305
1554 Ga0530510_0258933 3300061734 Bacteria 1297
1555 Ga0530510_0266857 3300061734 Bacteria 1277
1556 Ga0530510_0311972 3300061734 Bacteria 1178
1557 Ga0530510_0434912 3300061734 Bacteria 991
1558 Ga0530510_0723744 3300061734 Bacteria 759
1559 Ga0530510_1049876 3300061734 Bacteria 624

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_1067532 Ga0453683_1067532_183_524 101
2 3300049580 Ga0501046_1211348 Ga0501046_1211348_27_368 101
3 3300009177 Ga0105248_10915904 Ga0105248_109159041 102
4 3300049588 Ga0501072_1230685 Ga0501072_1230685_182_514 102
5 3300049744 Ga0501083_0827960 Ga0501083_0827960_253_588 103
6 3300027876 Ga0209974_10447288 Ga0209974_104472882 108
7 3300049583 Ga0501067_0005760 Ga0501067_0005760_2604_2981 108
8 3300049585 Ga0501069_0008035 Ga0501069_0008035_933_1310 108
9 3300061734 Ga0530510_0025278 Ga0530510_0025278_1121_1498 108
10 3300049570 Ga0501033_1025479 Ga0501033_1025479_110_475 110
11 3300049587 Ga0501071_0096077 Ga0501071_0096077_1507_1872 111
12 3300009036 Ga0105244_10431162 Ga0105244_104311621 113
13 3300009094 Ga0111539_10135950 Ga0111539_101359502 113
14 3300009098 Ga0105245_10028975 Ga0105245_100289753 113
15 3300009101 Ga0105247_10152911 Ga0105247_101529112 113
16 3300009148 Ga0105243_10005060 Ga0105243_100050604 113
17 3300009176 Ga0105242_10030769 Ga0105242_100307692 113
18 3300009177 Ga0105248_10036014 Ga0105248_100360145 113
19 3300009551 Ga0105238_10198588 Ga0105238_101985882 113
20 3300009553 Ga0105249_10012622 Ga0105249_100126227 113
21 3300010375 Ga0105239_10037283 Ga0105239_100372832 113
22 3300011119 Ga0105246_10017639 Ga0105246_100176393 113
23 3300013100 Ga0157373_11358746 Ga0157373_113587462 113
24 3300013102 Ga0157371_10572122 Ga0157371_105721222 113
25 3300013296 Ga0157374_10610476 Ga0157374_106104762 113
26 3300013297 Ga0157378_10028279 Ga0157378_100282794 113
27 3300013306 Ga0163162_10043045 Ga0163162_100430455 113
28 3300013308 Ga0157375_10008744 Ga0157375_100087444 113
29 3300014325 Ga0163163_10040249 Ga0163163_100402492 113
30 3300014745 Ga0157377_10005048 Ga0157377_100050484 113
31 3300014968 Ga0157379_10125761 Ga0157379_101257612 113
32 3300035242 Ga0373962_0016111 Ga0373962_0016111_1439_1804 113
33 3300035691 Ga0373931_0018366 Ga0373931_0018366_829_1194 113
34 3300048904 Ga0496101_0618231 Ga0496101_0618231_403_768 113
35 3300048905 Ga0496102_0162829 Ga0496102_0162829_386_751 113
36 3300048909 Ga0496106_0061533 Ga0496106_0061533_2413_2778 113
37 3300048910 Ga0496107_0020716 Ga0496107_0020716_1017_1382 113
38 3300048911 Ga0496108_0011780 Ga0496108_0011780_403_768 113
39 3300048912 Ga0496109_0090274 Ga0496109_0090274_370_735 113
40 3300048913 Ga0496110_0037117 Ga0496110_0037117_1678_2043 113
41 3300048914 Ga0496111_0002415 Ga0496111_0002415_10581_10946 113
42 3300048915 Ga0496112_0314432 Ga0496112_0314432_752_1117 113
43 3300048916 Ga0496113_0050258 Ga0496113_0050258_1727_2092 113
44 3300048917 Ga0496114_1194704 Ga0496114_1194704_245_610 113
45 3300050511 nmdc:mga08y16_67961_c1 nmdc:mga08y16_67961_c1_777_1142 113
46 3300050512 nmdc:mga0n895_976908_c1 nmdc:mga0n895_976908_c1_225_590 113
47 3300005616 Ga0068852_102267501 Ga0068852_1022675011 115
48 3300032005 Ga0307411_11660179 Ga0307411_116601791 115
49 3300049741 Ga0501079_0824169 Ga0501079_0824169_114_491 115
50 3300049742 Ga0501080_1344792 Ga0501080_1344792_91_468 115
51 3300054114 Ga0501084_0529690 Ga0501084_0529690_125_502 115
52 3300005844 Ga0068862_102149926 Ga0068862_1021499262 116
53 3300006038 Ga0075365_11201571 Ga0075365_112015711 116
54 3300025981 Ga0207640_11886999 Ga0207640_118869992 116
55 3300037312 Ga0395899_0807189 Ga0395899_0807189_125_499 116
56 3300037471 Ga0395905_0717739 Ga0395905_0717739_129_503 116
57 3300041411 Ga0439466_0110455 Ga0439466_0110455_282_656 116
58 3300041451 Ga0451791_1171156 Ga0451791_1171156_255_635 116
59 3300049568 Ga0501031_0541257 Ga0501031_0541257_67_447 116
60 3300049574 Ga0501038_0913653 Ga0501038_0913653_53_433 116
61 3300049585 Ga0501069_0039036 Ga0501069_0039036_409_789 116
62 3300060353 Ga0501082_0496182 Ga0501082_0496182_69_449 116
63 3300005295 Ga0065707_10777356 Ga0065707_107773561 117
64 3300005336 Ga0070680_100904694 Ga0070680_1009046941 117
65 3300005343 Ga0070687_100292431 Ga0070687_1002924312 117
66 3300005356 Ga0070674_101031542 Ga0070674_1010315422 117
67 3300005364 Ga0070673_100528108 Ga0070673_1005281082 117
68 3300005440 Ga0070705_100860114 Ga0070705_1008601141 117
69 3300005441 Ga0070700_100758294 Ga0070700_1007582941 117
70 3300005577 Ga0068857_101055250 Ga0068857_1010552502 117
71 3300005617 Ga0068859_100117732 Ga0068859_1001177324 117
72 3300005618 Ga0068864_100077109 Ga0068864_1000771092 117
73 3300005844 Ga0068862_100267309 Ga0068862_1002673092 117
74 3300005844 Ga0068862_100621660 Ga0068862_1006216602 117
75 3300006846 Ga0075430_101016363 Ga0075430_1010163631 117
76 3300006847 Ga0075431_100063105 Ga0075431_1000631052 117
77 3300006847 Ga0075431_100128795 Ga0075431_1001287952 117
78 3300006871 Ga0075434_100235988 Ga0075434_1002359882 117
79 3300006931 Ga0097620_100117736 Ga0097620_1001177364 117
80 3300009094 Ga0111539_10551114 Ga0111539_105511142 117
81 3300009094 Ga0111539_10811402 Ga0111539_108114022 117
82 3300009094 Ga0111539_11536483 Ga0111539_115364832 117
83 3300009147 Ga0114129_10051159 Ga0114129_100511599 117
84 3300009147 Ga0114129_10647173 Ga0114129_106471732 117
85 3300009148 Ga0105243_11160473 Ga0105243_111604732 117
86 3300014968 Ga0157379_10175556 Ga0157379_101755562 117
87 3300014968 Ga0157379_10415963 Ga0157379_104159632 117
88 3300014969 Ga0157376_10926427 Ga0157376_109264272 117
89 3300025908 Ga0207643_10716494 Ga0207643_107164942 117
90 3300025917 Ga0207660_10461523 Ga0207660_104615232 117
91 3300025918 Ga0207662_10674489 Ga0207662_106744892 117
92 3300025923 Ga0207681_10857203 Ga0207681_108572031 117
93 3300025934 Ga0207686_10806865 Ga0207686_108068651 117
94 3300025935 Ga0207709_10251406 Ga0207709_102514062 117
95 3300025937 Ga0207669_10355315 Ga0207669_103553152 117
96 3300025960 Ga0207651_10234105 Ga0207651_102341052 117
97 3300025981 Ga0207640_10382754 Ga0207640_103827542 117
98 3300026089 Ga0207648_10831402 Ga0207648_108314021 117
99 3300026095 Ga0207676_10015129 Ga0207676_100151295 117
100 3300031731 Ga0307405_10137143 Ga0307405_101371432 117
101 3300031824 Ga0307413_11056222 Ga0307413_110562222 117
102 3300031852 Ga0307410_10348062 Ga0307410_103480622 117
103 3300031903 Ga0307407_10261618 Ga0307407_102616182 117
104 3300031911 Ga0307412_10408707 Ga0307412_104087072 117
105 3300032002 Ga0307416_101450586 Ga0307416_1014505862 117
106 3300032002 Ga0307416_101896083 Ga0307416_1018960832 117
107 3300037471 Ga0395905_0086808 Ga0395905_0086808_1917_2294 117
108 3300046459 Ga0495629_0667924 Ga0495629_0667924_31_417 117
109 3300046683 Ga0495658_0154371 Ga0495658_0154371_31_417 117
110 3300046691 Ga0495670_0513380 Ga0495670_0513380_89_478 117
111 3300049522 Ga0501299_193370 Ga0501299_193370_85_474 117
112 3300049568 Ga0501031_0184597 Ga0501031_0184597_672_1049 117
113 3300049568 Ga0501031_0349833 Ga0501031_0349833_89_466 117
114 3300049570 Ga0501033_0175385 Ga0501033_0175385_196_573 117
115 3300049570 Ga0501033_0301623 Ga0501033_0301623_256_651 117
116 3300049572 Ga0501036_0135776 Ga0501036_0135776_897_1274 117
117 3300049572 Ga0501036_0475578 Ga0501036_0475578_111_488 117
118 3300049575 Ga0501039_0005800 Ga0501039_0005800_6923_7300 117
119 3300049575 Ga0501039_0089783 Ga0501039_0089783_745_1122 117
120 3300049576 Ga0501040_0040890 Ga0501040_0040890_730_1107 117
121 3300049576 Ga0501040_0081347 Ga0501040_0081347_685_1062 117
122 3300049577 Ga0501041_0018852 Ga0501041_0018852_706_1083 117
123 3300049577 Ga0501041_0035439 Ga0501041_0035439_828_1205 117
124 3300049577 Ga0501041_0074545 Ga0501041_0074545_890_1285 117
125 3300049577 Ga0501041_0098445 Ga0501041_0098445_35_430 117
126 3300049578 Ga0501042_0007208 Ga0501042_0007208_1998_2375 117
127 3300049578 Ga0501042_0210747 Ga0501042_0210747_606_983 117
128 3300049578 Ga0501042_0260715 Ga0501042_0260715_296_691 117
129 3300049579 Ga0501043_0026715 Ga0501043_0026715_1552_1929 117
130 3300049580 Ga0501046_0247233 Ga0501046_0247233_440_817 117
131 3300049582 Ga0501048_0031851 Ga0501048_0031851_2934_3311 117
132 3300049582 Ga0501048_0242449 Ga0501048_0242449_610_987 117
133 3300049582 Ga0501048_1249604 Ga0501048_1249604_129_506 117
134 3300049583 Ga0501067_0222873 Ga0501067_0222873_612_989 117
135 3300049584 Ga0501068_0091270 Ga0501068_0091270_1252_1629 117
136 3300049586 Ga0501070_0032346 Ga0501070_0032346_1898_2275 117
137 3300049586 Ga0501070_0954653 Ga0501070_0954653_224_601 117
138 3300049587 Ga0501071_0006712 Ga0501071_0006712_6004_6381 117
139 3300049587 Ga0501071_0070094 Ga0501071_0070094_1315_1692 117
140 3300049587 Ga0501071_0143861 Ga0501071_0143861_499_894 117
141 3300049588 Ga0501072_0005095 Ga0501072_0005095_3144_3521 117
142 3300049588 Ga0501072_0041583 Ga0501072_0041583_2174_2551 117
143 3300049588 Ga0501072_0061418 Ga0501072_0061418_580_975 117
144 3300049588 Ga0501072_0064661 Ga0501072_0064661_998_1393 117
145 3300049588 Ga0501072_0947136 Ga0501072_0947136_82_477 117
146 3300049589 Ga0501073_0094928 Ga0501073_0094928_751_1128 117
147 3300049589 Ga0501073_0434680 Ga0501073_0434680_400_777 117
148 3300049590 Ga0501074_0013225 Ga0501074_0013225_3087_3464 117
149 3300049590 Ga0501074_0035394 Ga0501074_0035394_2001_2378 117
150 3300049590 Ga0501074_0282885 Ga0501074_0282885_447_842 117
151 3300049591 Ga0501075_0006527 Ga0501075_0006527_7003_7380 117
152 3300049591 Ga0501075_0483603 Ga0501075_0483603_122_517 117
153 3300049591 Ga0501075_0610679 Ga0501075_0610679_322_717 117
154 3300049592 Ga0501076_0006003 Ga0501076_0006003_7004_7381 117
155 3300049592 Ga0501076_0008325 Ga0501076_0008325_347_742 117
156 3300049592 Ga0501076_0053642 Ga0501076_0053642_753_1130 117
157 3300049592 Ga0501076_0537126 Ga0501076_0537126_297_692 117
158 3300049592 Ga0501076_0952015 Ga0501076_0952015_58_435 117
159 3300049593 Ga0501077_0021866 Ga0501077_0021866_3021_3398 117
160 3300049593 Ga0501077_0086304 Ga0501077_0086304_1034_1411 117
161 3300049593 Ga0501077_0095370 Ga0501077_0095370_829_1206 117
162 3300049593 Ga0501077_0186839 Ga0501077_0186839_660_1055 117
163 3300049593 Ga0501077_0266468 Ga0501077_0266468_396_791 117
164 3300049659 Ga0501214_097818 Ga0501214_097818_38_427 117
165 3300049669 Ga0501235_033634 Ga0501235_033634_554_943 117
166 3300049670 Ga0501236_019746 Ga0501236_019746_51_440 117
167 3300049741 Ga0501079_0037158 Ga0501079_0037158_225_602 117
168 3300049741 Ga0501079_0043397 Ga0501079_0043397_1068_1463 117
169 3300049741 Ga0501079_0159507 Ga0501079_0159507_888_1265 117
170 3300049742 Ga0501080_0011401 Ga0501080_0011401_6855_7232 117
171 3300049742 Ga0501080_0073228 Ga0501080_0073228_2759_3154 117
172 3300049742 Ga0501080_0102029 Ga0501080_0102029_918_1313 117
173 3300049742 Ga0501080_1265206 Ga0501080_1265206_21_398 117
174 3300049743 Ga0501081_0000603 Ga0501081_0000603_4738_5115 117
175 3300049743 Ga0501081_0027309 Ga0501081_0027309_2073_2468 117
176 3300049743 Ga0501081_0269792 Ga0501081_0269792_350_745 117
177 3300049743 Ga0501081_0994221 Ga0501081_0994221_88_471 117
178 3300049744 Ga0501083_0094361 Ga0501083_0094361_1113_1490 117
179 3300049744 Ga0501083_0516786 Ga0501083_0516786_297_692 117
180 3300049822 Ga0501035_0123831 Ga0501035_0123831_1079_1456 117
181 3300049822 Ga0501035_0738543 Ga0501035_0738543_211_606 117
182 3300049823 Ga0501044_0841110 Ga0501044_0841110_292_669 117
183 3300049824 Ga0501045_0005964 Ga0501045_0005964_1439_1816 117
184 3300049824 Ga0501045_0950527 Ga0501045_0950527_38_415 117
185 3300050507 nmdc:mga05p37_359769_c1 nmdc:mga05p37_359769_c1_879_1256 117
186 3300050509 nmdc:mga0qj67_1550410_c1 nmdc:mga0qj67_1550410_c1_85_474 117
187 3300050510 nmdc:mga06r32_223308_c1 nmdc:mga06r32_223308_c1_725_1114 117
188 3300050511 nmdc:mga08y16_1356033_c1 nmdc:mga08y16_1356033_c1_144_521 117
189 3300050511 nmdc:mga08y16_1390810_c1 nmdc:mga08y16_1390810_c1_25_414 117
190 3300050512 nmdc:mga0n895_327285_c1 nmdc:mga0n895_327285_c1_558_935 117
191 3300050515 nmdc:mga0a205_410408_c1 nmdc:mga0a205_410408_c1_92_487 117
192 3300050515 nmdc:mga0a205_859233_c1 nmdc:mga0a205_859233_c1_235_618 117
193 3300054114 Ga0501084_0008989 Ga0501084_0008989_4854_5231 117
194 3300054114 Ga0501084_0020565 Ga0501084_0020565_5075_5470 117
195 3300054114 Ga0501084_0046728 Ga0501084_0046728_897_1274 117
196 3300054114 Ga0501084_0345171 Ga0501084_0345171_381_776 117
197 3300054114 Ga0501084_1324922 Ga0501084_1324922_11_406 117
198 3300060353 Ga0501082_0008904 Ga0501082_0008904_3733_4128 117
199 3300060353 Ga0501082_0027950 Ga0501082_0027950_1458_1835 117
200 3300060353 Ga0501082_0159341 Ga0501082_0159341_736_1113 117
201 3300061734 Ga0530510_0006927 Ga0530510_0006927_1164_1541 117
202 3300061734 Ga0530510_0034539 Ga0530510_0034539_2661_3056 117
203 3300002459 JGI24751J29686_10111555 JGI24751J29686_101115551 118
204 3300003320 rootH2_10204396 rootH2_102043962 118
205 3300004800 Ga0058861_11508585 Ga0058861_115085852 118
206 3300004801 Ga0058860_12021733 Ga0058860_120217332 118
207 3300005289 Ga0065704_10711919 Ga0065704_107119191 118
208 3300005293 Ga0065715_10099969 Ga0065715_100999693 118
209 3300005328 Ga0070676_10000324 Ga0070676_100003245 118
210 3300005328 Ga0070676_10227444 Ga0070676_102274442 118
211 3300005328 Ga0070676_10655868 Ga0070676_106558682 118
212 3300005330 Ga0070690_100148416 Ga0070690_1001484162 118
213 3300005331 Ga0070670_100009620 Ga0070670_1000096208 118
214 3300005334 Ga0068869_100000126 Ga0068869_10000012631 118
215 3300005334 Ga0068869_100240946 Ga0068869_1002409462 118
216 3300005334 Ga0068869_100713311 Ga0068869_1007133112 118
217 3300005334 Ga0068869_100827810 Ga0068869_1008278102 118
218 3300005335 Ga0070666_10493668 Ga0070666_104936682 118
219 3300005336 Ga0070680_100000915 Ga0070680_10000091520 118
220 3300005337 Ga0070682_100000272 Ga0070682_1000002725 118
221 3300005338 Ga0068868_100181526 Ga0068868_1001815262 118
222 3300005338 Ga0068868_101255881 Ga0068868_1012558812 118
223 3300005338 Ga0068868_101307550 Ga0068868_1013075501 118
224 3300005339 Ga0070660_100023336 Ga0070660_1000233364 118
225 3300005340 Ga0070689_100006875 Ga0070689_1000068757 118
226 3300005340 Ga0070689_100140265 Ga0070689_1001402652 118
227 3300005340 Ga0070689_101549433 Ga0070689_1015494332 118
228 3300005340 Ga0070689_101844731 Ga0070689_1018447311 118
229 3300005341 Ga0070691_10029329 Ga0070691_100293292 118
230 3300005341 Ga0070691_10274614 Ga0070691_102746142 118
231 3300005341 Ga0070691_10370509 Ga0070691_103705092 118
232 3300005344 Ga0070661_100006245 Ga0070661_1000062456 118
233 3300005345 Ga0070692_10010203 Ga0070692_100102032 118
234 3300005345 Ga0070692_10050982 Ga0070692_100509822 118
235 3300005345 Ga0070692_10230560 Ga0070692_102305602 118
236 3300005345 Ga0070692_10866542 Ga0070692_108665421 118
237 3300005353 Ga0070669_100161055 Ga0070669_1001610551 118
238 3300005353 Ga0070669_100232323 Ga0070669_1002323232 118
239 3300005354 Ga0070675_100064873 Ga0070675_1000648732 118
240 3300005354 Ga0070675_100449953 Ga0070675_1004499531 118
241 3300005355 Ga0070671_100296847 Ga0070671_1002968472 118
242 3300005356 Ga0070674_100293374 Ga0070674_1002933742 118
243 3300005356 Ga0070674_100755640 Ga0070674_1007556401 118
244 3300005364 Ga0070673_100005291 Ga0070673_1000052914 118
245 3300005364 Ga0070673_100629186 Ga0070673_1006291862 118
246 3300005365 Ga0070688_100367670 Ga0070688_1003676702 118
247 3300005365 Ga0070688_100507346 Ga0070688_1005073462 118
248 3300005366 Ga0070659_100001475 Ga0070659_10000147519 118
249 3300005366 Ga0070659_100060328 Ga0070659_1000603282 118
250 3300005366 Ga0070659_100326158 Ga0070659_1003261582 118
251 3300005367 Ga0070667_101450692 Ga0070667_1014506921 118
252 3300005406 Ga0070703_10002403 Ga0070703_100024036 118
253 3300005438 Ga0070701_10144918 Ga0070701_101449181 118
254 3300005440 Ga0070705_100044185 Ga0070705_1000441852 118
255 3300005440 Ga0070705_100048092 Ga0070705_1000480923 118
256 3300005440 Ga0070705_100068789 Ga0070705_1000687892 118
257 3300005440 Ga0070705_100134822 Ga0070705_1001348222 118
258 3300005440 Ga0070705_100273880 Ga0070705_1002738802 118
259 3300005440 Ga0070705_100766086 Ga0070705_1007660862 118
260 3300005440 Ga0070705_100856383 Ga0070705_1008563832 118
261 3300005444 Ga0070694_100000121 Ga0070694_10000012125 118
262 3300005444 Ga0070694_100000836 Ga0070694_10000083614 118
263 3300005444 Ga0070694_100025505 Ga0070694_1000255055 118
264 3300005444 Ga0070694_100050077 Ga0070694_1000500772 118
265 3300005444 Ga0070694_100139059 Ga0070694_1001390592 118
266 3300005444 Ga0070694_100148080 Ga0070694_1001480802 118
267 3300005445 Ga0070708_100010322 Ga0070708_1000103222 118
268 3300005445 Ga0070708_100033424 Ga0070708_1000334245 118
269 3300005445 Ga0070708_100033711 Ga0070708_1000337115 118
270 3300005445 Ga0070708_100058152 Ga0070708_1000581524 118
271 3300005445 Ga0070708_100091599 Ga0070708_1000915992 118
272 3300005445 Ga0070708_100131066 Ga0070708_1001310662 118
273 3300005445 Ga0070708_100233019 Ga0070708_1002330192 118
274 3300005445 Ga0070708_100242988 Ga0070708_1002429882 118
275 3300005445 Ga0070708_100333910 Ga0070708_1003339102 118
276 3300005445 Ga0070708_100514607 Ga0070708_1005146072 118
277 3300005445 Ga0070708_100592994 Ga0070708_1005929942 118
278 3300005445 Ga0070708_100609273 Ga0070708_1006092732 118
279 3300005445 Ga0070708_100973130 Ga0070708_1009731301 118
280 3300005445 Ga0070708_101518980 Ga0070708_1015189801 118
281 3300005455 Ga0070663_100000550 Ga0070663_1000005503 118
282 3300005456 Ga0070678_100696475 Ga0070678_1006964751 118
283 3300005457 Ga0070662_100006377 Ga0070662_1000063774 118
284 3300005457 Ga0070662_100112277 Ga0070662_1001122772 118
285 3300005457 Ga0070662_100637947 Ga0070662_1006379472 118
286 3300005457 Ga0070662_101763993 Ga0070662_1017639931 118
287 3300005457 Ga0070662_101767428 Ga0070662_1017674281 118
288 3300005459 Ga0068867_100001320 Ga0068867_10000132017 118
289 3300005459 Ga0068867_100213005 Ga0068867_1002130052 118
290 3300005466 Ga0070685_10895048 Ga0070685_108950481 118
291 3300005467 Ga0070706_100003251 Ga0070706_10000325116 118
292 3300005467 Ga0070706_100006513 Ga0070706_1000065134 118
293 3300005467 Ga0070706_100007006 Ga0070706_1000070064 118
294 3300005467 Ga0070706_100007175 Ga0070706_1000071757 118
295 3300005467 Ga0070706_100007727 Ga0070706_1000077278 118
296 3300005467 Ga0070706_100019195 Ga0070706_1000191953 118
297 3300005467 Ga0070706_100087216 Ga0070706_1000872163 118
298 3300005467 Ga0070706_100184545 Ga0070706_1001845452 118
299 3300005467 Ga0070706_100320796 Ga0070706_1003207961 118
300 3300005467 Ga0070706_100455536 Ga0070706_1004555362 118
301 3300005467 Ga0070706_100811030 Ga0070706_1008110302 118
302 3300005467 Ga0070706_100944121 Ga0070706_1009441212 118
303 3300005467 Ga0070706_101007337 Ga0070706_1010073372 118
304 3300005467 Ga0070706_101106769 Ga0070706_1011067692 118
305 3300005467 Ga0070706_101417170 Ga0070706_1014171702 118
306 3300005468 Ga0070707_100001015 Ga0070707_1000010154 118
307 3300005468 Ga0070707_100002728 Ga0070707_1000027288 118
308 3300005468 Ga0070707_100003755 Ga0070707_1000037558 118
309 3300005468 Ga0070707_100005537 Ga0070707_10000553712 118
310 3300005468 Ga0070707_100011866 Ga0070707_1000118665 118
311 3300005468 Ga0070707_100014128 Ga0070707_1000141282 118
312 3300005468 Ga0070707_100017303 Ga0070707_1000173037 118
313 3300005468 Ga0070707_100028741 Ga0070707_1000287413 118
314 3300005468 Ga0070707_100046802 Ga0070707_1000468023 118
315 3300005468 Ga0070707_100055203 Ga0070707_1000552032 118
316 3300005468 Ga0070707_100139554 Ga0070707_1001395542 118
317 3300005468 Ga0070707_100151472 Ga0070707_1001514722 118
318 3300005468 Ga0070707_100269866 Ga0070707_1002698662 118
319 3300005468 Ga0070707_100302366 Ga0070707_1003023662 118
320 3300005468 Ga0070707_100494679 Ga0070707_1004946792 118
321 3300005468 Ga0070707_100888329 Ga0070707_1008883292 118
322 3300005468 Ga0070707_101212556 Ga0070707_1012125562 118
323 3300005471 Ga0070698_100007218 Ga0070698_1000072185 118
324 3300005471 Ga0070698_100051947 Ga0070698_1000519472 118
325 3300005471 Ga0070698_100123727 Ga0070698_1001237272 118
326 3300005471 Ga0070698_100146576 Ga0070698_1001465763 118
327 3300005471 Ga0070698_100148073 Ga0070698_1001480733 118
328 3300005471 Ga0070698_100178881 Ga0070698_1001788812 118
329 3300005471 Ga0070698_100253215 Ga0070698_1002532152 118
330 3300005471 Ga0070698_100390354 Ga0070698_1003903542 118
331 3300005471 Ga0070698_100506991 Ga0070698_1005069912 118
332 3300005471 Ga0070698_100661489 Ga0070698_1006614892 118
333 3300005471 Ga0070698_100825504 Ga0070698_1008255042 118
334 3300005471 Ga0070698_100983801 Ga0070698_1009838012 118
335 3300005518 Ga0070699_100012878 Ga0070699_1000128783 118
336 3300005518 Ga0070699_100031344 Ga0070699_1000313442 118
337 3300005518 Ga0070699_100045107 Ga0070699_1000451072 118
338 3300005518 Ga0070699_100126289 Ga0070699_1001262892 118
339 3300005518 Ga0070699_100242059 Ga0070699_1002420592 118
340 3300005518 Ga0070699_100271470 Ga0070699_1002714702 118
341 3300005518 Ga0070699_100675952 Ga0070699_1006759522 118
342 3300005518 Ga0070699_100863222 Ga0070699_1008632222 118
343 3300005518 Ga0070699_101130637 Ga0070699_1011306372 118
344 3300005518 Ga0070699_101353065 Ga0070699_1013530651 118
345 3300005530 Ga0070679_100001430 Ga0070679_10000143020 118
346 3300005535 Ga0070684_100097264 Ga0070684_1000972642 118
347 3300005535 Ga0070684_100315761 Ga0070684_1003157612 118
348 3300005535 Ga0070684_101090408 Ga0070684_1010904082 118
349 3300005536 Ga0070697_100001444 Ga0070697_10000144410 118
350 3300005536 Ga0070697_100003594 Ga0070697_1000035946 118
351 3300005536 Ga0070697_100006376 Ga0070697_1000063762 118
352 3300005536 Ga0070697_100061278 Ga0070697_1000612783 118
353 3300005536 Ga0070697_100098103 Ga0070697_1000981032 118
354 3300005536 Ga0070697_100110711 Ga0070697_1001107112 118
355 3300005536 Ga0070697_100136337 Ga0070697_1001363372 118
356 3300005536 Ga0070697_100355561 Ga0070697_1003555612 118
357 3300005536 Ga0070697_100412028 Ga0070697_1004120282 118
358 3300005536 Ga0070697_100639076 Ga0070697_1006390762 118
359 3300005536 Ga0070697_101494636 Ga0070697_1014946361 118
360 3300005539 Ga0068853_100000538 Ga0068853_1000005382 118
361 3300005543 Ga0070672_100088248 Ga0070672_1000882483 118
362 3300005543 Ga0070672_100317429 Ga0070672_1003174292 118
363 3300005543 Ga0070672_100936737 Ga0070672_1009367372 118
364 3300005545 Ga0070695_100003926 Ga0070695_1000039267 118
365 3300005545 Ga0070695_100009344 Ga0070695_1000093444 118
366 3300005546 Ga0070696_100003484 Ga0070696_10000348410 118
367 3300005546 Ga0070696_100028449 Ga0070696_1000284493 118
368 3300005546 Ga0070696_100039703 Ga0070696_1000397033 118
369 3300005546 Ga0070696_100054982 Ga0070696_1000549823 118
370 3300005546 Ga0070696_100351561 Ga0070696_1003515612 118
371 3300005546 Ga0070696_100377004 Ga0070696_1003770042 118
372 3300005547 Ga0070693_100525960 Ga0070693_1005259602 118
373 3300005547 Ga0070693_100872673 Ga0070693_1008726731 118
374 3300005548 Ga0070665_102331064 Ga0070665_1023310642 118
375 3300005549 Ga0070704_100010169 Ga0070704_1000101692 118
376 3300005549 Ga0070704_100019769 Ga0070704_1000197693 118
377 3300005549 Ga0070704_100050097 Ga0070704_1000500974 118
378 3300005549 Ga0070704_100100711 Ga0070704_1001007112 118
379 3300005549 Ga0070704_100116427 Ga0070704_1001164272 118
380 3300005549 Ga0070704_100141383 Ga0070704_1001413832 118
381 3300005549 Ga0070704_100550700 Ga0070704_1005507001 118
382 3300005549 Ga0070704_100890600 Ga0070704_1008906002 118
383 3300005549 Ga0070704_100983307 Ga0070704_1009833072 118
384 3300005549 Ga0070704_101040994 Ga0070704_1010409941 118
385 3300005549 Ga0070704_101754633 Ga0070704_1017546331 118
386 3300005563 Ga0068855_100015829 Ga0068855_1000158294 118
387 3300005563 Ga0068855_100310120 Ga0068855_1003101202 118
388 3300005564 Ga0070664_100025974 Ga0070664_1000259744 118
389 3300005564 Ga0070664_100397439 Ga0070664_1003974392 118
390 3300005564 Ga0070664_100681563 Ga0070664_1006815632 118
391 3300005577 Ga0068857_100459067 Ga0068857_1004590672 118
392 3300005577 Ga0068857_100607761 Ga0068857_1006077612 118
393 3300005577 Ga0068857_100890649 Ga0068857_1008906492 118
394 3300005577 Ga0068857_100927494 Ga0068857_1009274942 118
395 3300005577 Ga0068857_101167272 Ga0068857_1011672722 118
396 3300005578 Ga0068854_100000401 Ga0068854_10000040115 118
397 3300005578 Ga0068854_100112262 Ga0068854_1001122622 118
398 3300005578 Ga0068854_100227380 Ga0068854_1002273802 118
399 3300005578 Ga0068854_100465265 Ga0068854_1004652652 118
400 3300005578 Ga0068854_101211582 Ga0068854_1012115822 118
401 3300005614 Ga0068856_100002147 Ga0068856_1000021477 118
402 3300005615 Ga0070702_100036983 Ga0070702_1000369833 118
403 3300005617 Ga0068859_100000796 Ga0068859_1000007966 118
404 3300005617 Ga0068859_100035169 Ga0068859_1000351692 118
405 3300005617 Ga0068859_100345890 Ga0068859_1003458902 118
406 3300005617 Ga0068859_101299979 Ga0068859_1012999792 118
407 3300005618 Ga0068864_100007093 Ga0068864_1000070937 118
408 3300005618 Ga0068864_100009696 Ga0068864_1000096965 118
409 3300005718 Ga0068866_10766399 Ga0068866_107663992 118
410 3300005719 Ga0068861_100346675 Ga0068861_1003466752 118
411 3300005719 Ga0068861_100347708 Ga0068861_1003477082 118
412 3300005719 Ga0068861_100407046 Ga0068861_1004070462 118
413 3300005719 Ga0068861_100448044 Ga0068861_1004480442 118
414 3300005834 Ga0068851_10752386 Ga0068851_107523861 118
415 3300005840 Ga0068870_10002546 Ga0068870_100025464 118
416 3300005841 Ga0068863_100003451 Ga0068863_10000345113 118
417 3300005841 Ga0068863_100035929 Ga0068863_1000359295 118
418 3300005841 Ga0068863_100841423 Ga0068863_1008414232 118
419 3300005842 Ga0068858_100120337 Ga0068858_1001203373 118
420 3300005842 Ga0068858_100247427 Ga0068858_1002474272 118
421 3300005842 Ga0068858_100486124 Ga0068858_1004861242 118
422 3300005842 Ga0068858_100537920 Ga0068858_1005379202 118
423 3300005842 Ga0068858_101538476 Ga0068858_1015384762 118
424 3300005843 Ga0068860_100065669 Ga0068860_1000656693 118
425 3300005843 Ga0068860_100419817 Ga0068860_1004198172 118
426 3300005843 Ga0068860_101396056 Ga0068860_1013960561 118
427 3300005844 Ga0068862_100002989 Ga0068862_1000029898 118
428 3300005844 Ga0068862_100029688 Ga0068862_1000296884 118
429 3300005844 Ga0068862_100041532 Ga0068862_1000415325 118
430 3300005844 Ga0068862_100198337 Ga0068862_1001983372 118
431 3300005844 Ga0068862_100335036 Ga0068862_1003350362 118
432 3300005844 Ga0068862_102067196 Ga0068862_1020671961 118
433 3300005937 Ga0081455_10002544 Ga0081455_1000254422 118
434 3300005937 Ga0081455_10232526 Ga0081455_102325262 118
435 3300005937 Ga0081455_10403683 Ga0081455_104036831 118
436 3300005981 Ga0081538_10001745 Ga0081538_100017457 118
437 3300005981 Ga0081538_10008167 Ga0081538_100081673 118
438 3300005985 Ga0081539_10000141 Ga0081539_1000014198 118
439 3300006058 Ga0075432_10076132 Ga0075432_100761322 118
440 3300006058 Ga0075432_10100971 Ga0075432_101009712 118
441 3300006058 Ga0075432_10393330 Ga0075432_103933302 118
442 3300006163 Ga0070715_10405669 Ga0070715_104056692 118
443 3300006173 Ga0070716_100752836 Ga0070716_1007528362 118
444 3300006237 Ga0097621_100258130 Ga0097621_1002581302 118
445 3300006237 Ga0097621_102123180 Ga0097621_1021231801 118
446 3300006358 Ga0068871_100953574 Ga0068871_1009535741 118
447 3300006358 Ga0068871_100973997 Ga0068871_1009739972 118
448 3300006844 Ga0075428_100000499 Ga0075428_10000049935 118
449 3300006844 Ga0075428_100001339 Ga0075428_10000133921 118
450 3300006844 Ga0075428_100004807 Ga0075428_10000480712 118
451 3300006844 Ga0075428_100013391 Ga0075428_1000133914 118
452 3300006844 Ga0075428_100027338 Ga0075428_1000273386 118
453 3300006844 Ga0075428_100056467 Ga0075428_1000564673 118
454 3300006844 Ga0075428_100246240 Ga0075428_1002462402 118
455 3300006844 Ga0075428_100317208 Ga0075428_1003172082 118
456 3300006844 Ga0075428_100380643 Ga0075428_1003806431 118
457 3300006844 Ga0075428_100498169 Ga0075428_1004981692 118
458 3300006844 Ga0075428_100739221 Ga0075428_1007392212 118
459 3300006844 Ga0075428_102434311 Ga0075428_1024343111 118
460 3300006846 Ga0075430_100000005 Ga0075430_10000000517 118
461 3300006846 Ga0075430_100011258 Ga0075430_1000112582 118
462 3300006846 Ga0075430_100080358 Ga0075430_1000803583 118
463 3300006846 Ga0075430_100131517 Ga0075430_1001315172 118
464 3300006846 Ga0075430_100356811 Ga0075430_1003568112 118
465 3300006847 Ga0075431_100000046 Ga0075431_10000004621 118
466 3300006847 Ga0075431_100000189 Ga0075431_10000018915 118
467 3300006847 Ga0075431_100000823 Ga0075431_10000082328 118
468 3300006847 Ga0075431_100001449 Ga0075431_10000144925 118
469 3300006847 Ga0075431_100002327 Ga0075431_1000023279 118
470 3300006847 Ga0075431_100032296 Ga0075431_1000322963 118
471 3300006847 Ga0075431_100044152 Ga0075431_1000441523 118
472 3300006847 Ga0075431_100117654 Ga0075431_1001176542 118
473 3300006847 Ga0075431_100387283 Ga0075431_1003872832 118
474 3300006847 Ga0075431_100482950 Ga0075431_1004829502 118
475 3300006847 Ga0075431_100577257 Ga0075431_1005772572 118
476 3300006847 Ga0075431_100725082 Ga0075431_1007250822 118
477 3300006852 Ga0075433_10011024 Ga0075433_100110245 118
478 3300006852 Ga0075433_10023493 Ga0075433_100234932 118
479 3300006852 Ga0075433_10037136 Ga0075433_100371366 118
480 3300006852 Ga0075433_10050485 Ga0075433_100504853 118
481 3300006852 Ga0075433_10052223 Ga0075433_100522233 118
482 3300006852 Ga0075433_10061246 Ga0075433_100612464 118
483 3300006852 Ga0075433_10091221 Ga0075433_100912214 118
484 3300006852 Ga0075433_10149420 Ga0075433_101494203 118
485 3300006852 Ga0075433_10295431 Ga0075433_102954312 118
486 3300006852 Ga0075433_10649415 Ga0075433_106494152 118
487 3300006852 Ga0075433_11232549 Ga0075433_112325491 118
488 3300006852 Ga0075433_11340086 Ga0075433_113400861 118
489 3300006852 Ga0075433_11546811 Ga0075433_115468111 118
490 3300006871 Ga0075434_100040756 Ga0075434_1000407562 118
491 3300006871 Ga0075434_100053139 Ga0075434_1000531395 118
492 3300006871 Ga0075434_100054084 Ga0075434_1000540842 118
493 3300006871 Ga0075434_100091193 Ga0075434_1000911933 118
494 3300006871 Ga0075434_100127883 Ga0075434_1001278834 118
495 3300006871 Ga0075434_100154275 Ga0075434_1001542753 118
496 3300006871 Ga0075434_100286378 Ga0075434_1002863781 118
497 3300006871 Ga0075434_100322351 Ga0075434_1003223512 118
498 3300006871 Ga0075434_100513638 Ga0075434_1005136382 118
499 3300006871 Ga0075434_100623047 Ga0075434_1006230472 118
500 3300006871 Ga0075434_100748084 Ga0075434_1007480842 118
501 3300006871 Ga0075434_100851905 Ga0075434_1008519052 118
502 3300006880 Ga0075429_100000077 Ga0075429_10000007753 118
503 3300006880 Ga0075429_100025746 Ga0075429_1000257466 118
504 3300006880 Ga0075429_100028420 Ga0075429_1000284204 118
505 3300006880 Ga0075429_100093784 Ga0075429_1000937842 118
506 3300006880 Ga0075429_100115099 Ga0075429_1001150992 118
507 3300006880 Ga0075429_100123491 Ga0075429_1001234912 118
508 3300006880 Ga0075429_100140989 Ga0075429_1001409892 118
509 3300006880 Ga0075429_100249977 Ga0075429_1002499772 118
510 3300006880 Ga0075429_100425402 Ga0075429_1004254022 118
511 3300006880 Ga0075429_100432461 Ga0075429_1004324612 118
512 3300006880 Ga0075429_100813472 Ga0075429_1008134722 118
513 3300006880 Ga0075429_101242503 Ga0075429_1012425032 118
514 3300006880 Ga0075429_101481547 Ga0075429_1014815472 118
515 3300006881 Ga0068865_100186019 Ga0068865_1001860192 118
516 3300006881 Ga0068865_101124501 Ga0068865_1011245012 118
517 3300006914 Ga0075436_100001664 Ga0075436_10000166414 118
518 3300006914 Ga0075436_100243492 Ga0075436_1002434922 118
519 3300006914 Ga0075436_101268666 Ga0075436_1012686662 118
520 3300006931 Ga0097620_100000796 Ga0097620_1000007966 118
521 3300006931 Ga0097620_100035166 Ga0097620_1000351665 118
522 3300006931 Ga0097620_100345876 Ga0097620_1003458762 118
523 3300006931 Ga0097620_101299975 Ga0097620_1012999752 118
524 3300007076 Ga0075435_100024554 Ga0075435_1000245544 118
525 3300007076 Ga0075435_100179817 Ga0075435_1001798172 118
526 3300007076 Ga0075435_100182169 Ga0075435_1001821692 118
527 3300007076 Ga0075435_100297299 Ga0075435_1002972991 118
528 3300007076 Ga0075435_100360739 Ga0075435_1003607391 118
529 3300007076 Ga0075435_100543797 Ga0075435_1005437972 118
530 3300007076 Ga0075435_100744388 Ga0075435_1007443882 118
531 3300007076 Ga0075435_100871919 Ga0075435_1008719192 118
532 3300007265 Ga0099794_10018413 Ga0099794_100184132 118
533 3300007265 Ga0099794_10729771 Ga0099794_107297711 118
534 3300009011 Ga0105251_10113002 Ga0105251_101130022 118
535 3300009011 Ga0105251_10326333 Ga0105251_103263331 118
536 3300009092 Ga0105250_10547541 Ga0105250_105475411 118
537 3300009093 Ga0105240_10533475 Ga0105240_105334752 118
538 3300009094 Ga0111539_10000182 Ga0111539_1000018252 118
539 3300009094 Ga0111539_10073894 Ga0111539_100738943 118
540 3300009094 Ga0111539_10326872 Ga0111539_103268722 118
541 3300009094 Ga0111539_10603641 Ga0111539_106036412 118
542 3300009094 Ga0111539_10702336 Ga0111539_107023362 118
543 3300009094 Ga0111539_10839074 Ga0111539_108390742 118
544 3300009098 Ga0105245_10126955 Ga0105245_101269552 118
545 3300009098 Ga0105245_10396686 Ga0105245_103966862 118
546 3300009098 Ga0105245_10515454 Ga0105245_105154542 118
547 3300009098 Ga0105245_10741123 Ga0105245_107411232 118
548 3300009098 Ga0105245_10760777 Ga0105245_107607772 118
549 3300009098 Ga0105245_12715710 Ga0105245_127157102 118
550 3300009147 Ga0114129_10000129 Ga0114129_1000012943 118
551 3300009147 Ga0114129_10000144 Ga0114129_1000014436 118
552 3300009147 Ga0114129_10001890 Ga0114129_100018908 118
553 3300009147 Ga0114129_10011263 Ga0114129_100112633 118
554 3300009147 Ga0114129_10018527 Ga0114129_1001852711 118
555 3300009147 Ga0114129_10022634 Ga0114129_100226342 118
556 3300009147 Ga0114129_10044982 Ga0114129_100449825 118
557 3300009147 Ga0114129_10168323 Ga0114129_101683233 118
558 3300009147 Ga0114129_10173763 Ga0114129_101737632 118
559 3300009147 Ga0114129_10175529 Ga0114129_101755293 118
560 3300009147 Ga0114129_10204495 Ga0114129_102044952 118
561 3300009147 Ga0114129_10233952 Ga0114129_102339523 118
562 3300009147 Ga0114129_10304741 Ga0114129_103047412 118
563 3300009147 Ga0114129_10312776 Ga0114129_103127763 118
564 3300009147 Ga0114129_10382810 Ga0114129_103828102 118
565 3300009147 Ga0114129_10471291 Ga0114129_104712912 118
566 3300009147 Ga0114129_10489958 Ga0114129_104899582 118
567 3300009147 Ga0114129_10866564 Ga0114129_108665642 118
568 3300009147 Ga0114129_10926412 Ga0114129_109264122 118
569 3300009147 Ga0114129_12001015 Ga0114129_120010151 118
570 3300009148 Ga0105243_10029759 Ga0105243_100297593 118
571 3300009148 Ga0105243_10650649 Ga0105243_106506492 118
572 3300009148 Ga0105243_10990885 Ga0105243_109908852 118
573 3300009174 Ga0105241_10003595 Ga0105241_100035959 118
574 3300009176 Ga0105242_12110488 Ga0105242_121104881 118
575 3300009177 Ga0105248_10193111 Ga0105248_101931112 118
576 3300009177 Ga0105248_11858531 Ga0105248_118585311 118
577 3300009553 Ga0105249_10011527 Ga0105249_100115272 118
578 3300009553 Ga0105249_10039447 Ga0105249_100394473 118
579 3300009553 Ga0105249_10166427 Ga0105249_101664272 118
580 3300009553 Ga0105249_10284941 Ga0105249_102849412 118
581 3300009553 Ga0105249_10295678 Ga0105249_102956782 118
582 3300009553 Ga0105249_10582187 Ga0105249_105821872 118
583 3300009553 Ga0105249_11098278 Ga0105249_110982782 118
584 3300009553 Ga0105249_11279415 Ga0105249_112794152 118
585 3300009553 Ga0105249_11562558 Ga0105249_115625582 118
586 3300010375 Ga0105239_10663150 Ga0105239_106631502 118
587 3300010375 Ga0105239_10719966 Ga0105239_107199662 118
588 3300010375 Ga0105239_11326630 Ga0105239_113266302 118
589 3300013100 Ga0157373_10000102 Ga0157373_1000010257 118
590 3300013100 Ga0157373_10368460 Ga0157373_103684602 118
591 3300013102 Ga0157371_10026792 Ga0157371_100267923 118
592 3300013104 Ga0157370_10164441 Ga0157370_101644413 118
593 3300013105 Ga0157369_10009506 Ga0157369_100095064 118
594 3300013296 Ga0157374_10378894 Ga0157374_103788942 118
595 3300013297 Ga0157378_10279326 Ga0157378_102793262 118
596 3300013297 Ga0157378_10312200 Ga0157378_103122001 118
597 3300013297 Ga0157378_10669744 Ga0157378_106697442 118
598 3300013306 Ga0163162_10144047 Ga0163162_101440474 118
599 3300013306 Ga0163162_10955101 Ga0163162_109551012 118
600 3300013306 Ga0163162_10981280 Ga0163162_109812802 118
601 3300013306 Ga0163162_10990553 Ga0163162_109905532 118
602 3300013306 Ga0163162_11123842 Ga0163162_111238422 118
603 3300013306 Ga0163162_11435918 Ga0163162_114359181 118
604 3300013306 Ga0163162_12184369 Ga0163162_121843691 118
605 3300013307 Ga0157372_10055364 Ga0157372_100553642 118
606 3300013308 Ga0157375_10045690 Ga0157375_100456902 118
607 3300013308 Ga0157375_10160890 Ga0157375_101608903 118
608 3300013308 Ga0157375_10321429 Ga0157375_103214292 118
609 3300013308 Ga0157375_10686221 Ga0157375_106862212 118
610 3300014325 Ga0163163_10003752 Ga0163163_1000375210 118
611 3300014325 Ga0163163_10061302 Ga0163163_100613023 118
612 3300014325 Ga0163163_10457719 Ga0163163_104577192 118
613 3300014325 Ga0163163_12463666 Ga0163163_124636662 118
614 3300014326 Ga0157380_10176535 Ga0157380_101765352 118
615 3300014326 Ga0157380_10249278 Ga0157380_102492782 118
616 3300014326 Ga0157380_13234748 Ga0157380_132347481 118
617 3300014497 Ga0182008_10292381 Ga0182008_102923812 118
618 3300014497 Ga0182008_10475635 Ga0182008_104756352 118
619 3300014745 Ga0157377_10045565 Ga0157377_100455653 118
620 3300014745 Ga0157377_10096144 Ga0157377_100961442 118
621 3300014745 Ga0157377_10294734 Ga0157377_102947342 118
622 3300014745 Ga0157377_10424034 Ga0157377_104240342 118
623 3300014745 Ga0157377_10623537 Ga0157377_106235371 118
624 3300014968 Ga0157379_10016679 Ga0157379_100166795 118
625 3300014968 Ga0157379_10029831 Ga0157379_100298314 118
626 3300014968 Ga0157379_10079598 Ga0157379_100795982 118
627 3300014968 Ga0157379_10750790 Ga0157379_107507902 118
628 3300014969 Ga0157376_10358683 Ga0157376_103586832 118
629 3300015262 Ga0182007_10069582 Ga0182007_100695822 118
630 3300017792 Ga0163161_10500742 Ga0163161_105007422 118
631 3300017792 Ga0163161_10609531 Ga0163161_106095312 118
632 3300017792 Ga0163161_10849652 Ga0163161_108496522 118
633 3300020070 Ga0206356_10630729 Ga0206356_106307291 118
634 3300020082 Ga0206353_10815269 Ga0206353_108152692 118
635 3300025885 Ga0207653_10008914 Ga0207653_100089142 118
636 3300025885 Ga0207653_10034652 Ga0207653_100346522 118
637 3300025885 Ga0207653_10155409 Ga0207653_101554092 118
638 3300025899 Ga0207642_10556572 Ga0207642_105565722 118
639 3300025901 Ga0207688_10013673 Ga0207688_100136732 118
640 3300025901 Ga0207688_10151165 Ga0207688_101511652 118
641 3300025906 Ga0207699_11100942 Ga0207699_111009421 118
642 3300025907 Ga0207645_10000033 Ga0207645_1000003355 118
643 3300025907 Ga0207645_10184698 Ga0207645_101846982 118
644 3300025907 Ga0207645_10187271 Ga0207645_101872712 118
645 3300025907 Ga0207645_10361125 Ga0207645_103611252 118
646 3300025908 Ga0207643_10000641 Ga0207643_1000064119 118
647 3300025910 Ga0207684_10001908 Ga0207684_1000190818 118
648 3300025910 Ga0207684_10006750 Ga0207684_100067503 118
649 3300025910 Ga0207684_10013178 Ga0207684_100131782 118
650 3300025910 Ga0207684_10035398 Ga0207684_100353983 118
651 3300025910 Ga0207684_10039789 Ga0207684_100397893 118
652 3300025910 Ga0207684_10082654 Ga0207684_100826544 118
653 3300025910 Ga0207684_10103497 Ga0207684_101034972 118
654 3300025910 Ga0207684_10105513 Ga0207684_101055132 118
655 3300025910 Ga0207684_10139694 Ga0207684_101396942 118
656 3300025910 Ga0207684_10244803 Ga0207684_102448032 118
657 3300025910 Ga0207684_10340200 Ga0207684_103402002 118
658 3300025910 Ga0207684_10504934 Ga0207684_105049342 118
659 3300025910 Ga0207684_10732514 Ga0207684_107325142 118
660 3300025910 Ga0207684_10815151 Ga0207684_108151512 118
661 3300025910 Ga0207684_11390634 Ga0207684_113906341 118
662 3300025911 Ga0207654_10000903 Ga0207654_100009032 118
663 3300025911 Ga0207654_10447861 Ga0207654_104478612 118
664 3300025912 Ga0207707_10000162 Ga0207707_1000016261 118
665 3300025917 Ga0207660_10016617 Ga0207660_100166174 118
666 3300025917 Ga0207660_10947712 Ga0207660_109477122 118
667 3300025918 Ga0207662_10068634 Ga0207662_100686342 118
668 3300025919 Ga0207657_10001749 Ga0207657_1000174921 118
669 3300025920 Ga0207649_10007071 Ga0207649_100070712 118
670 3300025922 Ga0207646_10002616 Ga0207646_1000261615 118
671 3300025922 Ga0207646_10002778 Ga0207646_1000277821 118
672 3300025922 Ga0207646_10003964 Ga0207646_100039647 118
673 3300025922 Ga0207646_10012707 Ga0207646_100127073 118
674 3300025922 Ga0207646_10013330 Ga0207646_100133302 118
675 3300025922 Ga0207646_10017167 Ga0207646_100171673 118
676 3300025922 Ga0207646_10069350 Ga0207646_100693503 118
677 3300025922 Ga0207646_10160209 Ga0207646_101602092 118
678 3300025922 Ga0207646_10318142 Ga0207646_103181422 118
679 3300025922 Ga0207646_10328250 Ga0207646_103282502 118
680 3300025922 Ga0207646_10395618 Ga0207646_103956182 118
681 3300025922 Ga0207646_10400724 Ga0207646_104007242 118
682 3300025922 Ga0207646_10420015 Ga0207646_104200152 118
683 3300025922 Ga0207646_10609101 Ga0207646_106091012 118
684 3300025922 Ga0207646_11024191 Ga0207646_110241912 118
685 3300025922 Ga0207646_11314377 Ga0207646_113143771 118
686 3300025922 Ga0207646_11617974 Ga0207646_116179741 118
687 3300025923 Ga0207681_10336034 Ga0207681_103360342 118
688 3300025923 Ga0207681_10509389 Ga0207681_105093892 118
689 3300025923 Ga0207681_11092972 Ga0207681_110929721 118
690 3300025924 Ga0207694_11161253 Ga0207694_111612532 118
691 3300025925 Ga0207650_10247145 Ga0207650_102471452 118
692 3300025925 Ga0207650_11580534 Ga0207650_115805341 118
693 3300025926 Ga0207659_10245184 Ga0207659_102451842 118
694 3300025926 Ga0207659_10447034 Ga0207659_104470342 118
695 3300025926 Ga0207659_11112780 Ga0207659_111127802 118
696 3300025926 Ga0207659_11233786 Ga0207659_112337861 118
697 3300025927 Ga0207687_10106256 Ga0207687_101062563 118
698 3300025927 Ga0207687_10229444 Ga0207687_102294442 118
699 3300025927 Ga0207687_10529410 Ga0207687_105294102 118
700 3300025927 Ga0207687_10633040 Ga0207687_106330402 118
701 3300025927 Ga0207687_10675034 Ga0207687_106750342 118
702 3300025931 Ga0207644_10580906 Ga0207644_105809062 118
703 3300025932 Ga0207690_10005168 Ga0207690_100051684 118
704 3300025932 Ga0207690_10342174 Ga0207690_103421742 118
705 3300025932 Ga0207690_10749631 Ga0207690_107496311 118
706 3300025933 Ga0207706_10003550 Ga0207706_1000355012 118
707 3300025933 Ga0207706_10095003 Ga0207706_100950033 118
708 3300025934 Ga0207686_10158004 Ga0207686_101580042 118
709 3300025935 Ga0207709_10239773 Ga0207709_102397732 118
710 3300025935 Ga0207709_10978210 Ga0207709_109782102 118
711 3300025936 Ga0207670_10012307 Ga0207670_100123076 118
712 3300025936 Ga0207670_10176365 Ga0207670_101763652 118
713 3300025936 Ga0207670_10368483 Ga0207670_103684832 118
714 3300025937 Ga0207669_10219628 Ga0207669_102196282 118
715 3300025938 Ga0207704_11413447 Ga0207704_114134472 118
716 3300025939 Ga0207665_10173190 Ga0207665_101731902 118
717 3300025939 Ga0207665_10299406 Ga0207665_102994061 118
718 3300025940 Ga0207691_10200645 Ga0207691_102006452 118
719 3300025940 Ga0207691_10646949 Ga0207691_106469492 118
720 3300025940 Ga0207691_10777322 Ga0207691_107773222 118
721 3300025940 Ga0207691_11462171 Ga0207691_114621711 118
722 3300025942 Ga0207689_10000139 Ga0207689_1000013918 118
723 3300025942 Ga0207689_10150162 Ga0207689_101501622 118
724 3300025942 Ga0207689_10789938 Ga0207689_107899382 118
725 3300025944 Ga0207661_11022204 Ga0207661_110222042 118
726 3300025945 Ga0207679_10000655 Ga0207679_1000065519 118
727 3300025949 Ga0207667_10033052 Ga0207667_100330523 118
728 3300025949 Ga0207667_10470988 Ga0207667_104709882 118
729 3300025960 Ga0207651_10004737 Ga0207651_100047373 118
730 3300025960 Ga0207651_10644061 Ga0207651_106440612 118
731 3300025961 Ga0207712_10138444 Ga0207712_101384442 118
732 3300025961 Ga0207712_10154018 Ga0207712_101540182 118
733 3300025961 Ga0207712_10156626 Ga0207712_101566262 118
734 3300025961 Ga0207712_10187855 Ga0207712_101878552 118
735 3300025961 Ga0207712_10253930 Ga0207712_102539302 118
736 3300025972 Ga0207668_10370206 Ga0207668_103702062 118
737 3300025981 Ga0207640_10003202 Ga0207640_1000320210 118
738 3300025981 Ga0207640_10186252 Ga0207640_101862521 118
739 3300025986 Ga0207658_10983340 Ga0207658_109833402 118
740 3300026023 Ga0207677_10077079 Ga0207677_100770792 118
741 3300026023 Ga0207677_10160303 Ga0207677_101603032 118
742 3300026023 Ga0207677_10751408 Ga0207677_107514082 118
743 3300026035 Ga0207703_10104847 Ga0207703_101048472 118
744 3300026035 Ga0207703_10512888 Ga0207703_105128882 118
745 3300026035 Ga0207703_10627472 Ga0207703_106274722 118
746 3300026035 Ga0207703_10834083 Ga0207703_108340831 118
747 3300026035 Ga0207703_11059140 Ga0207703_110591402 118
748 3300026041 Ga0207639_10891660 Ga0207639_108916601 118
749 3300026067 Ga0207678_10000479 Ga0207678_1000047928 118
750 3300026067 Ga0207678_10423257 Ga0207678_104232572 118
751 3300026067 Ga0207678_10636342 Ga0207678_106363422 118
752 3300026067 Ga0207678_11176464 Ga0207678_111764642 118
753 3300026075 Ga0207708_10155546 Ga0207708_101555462 118
754 3300026075 Ga0207708_10979574 Ga0207708_109795741 118
755 3300026088 Ga0207641_10027137 Ga0207641_100271372 118
756 3300026088 Ga0207641_10124577 Ga0207641_101245772 118
757 3300026089 Ga0207648_10101596 Ga0207648_101015962 118
758 3300026089 Ga0207648_10699564 Ga0207648_106995642 118
759 3300026089 Ga0207648_10839432 Ga0207648_108394322 118
760 3300026095 Ga0207676_10000947 Ga0207676_100009478 118
761 3300026095 Ga0207676_10022751 Ga0207676_100227515 118
762 3300026095 Ga0207676_11727044 Ga0207676_117270442 118
763 3300026116 Ga0207674_10000976 Ga0207674_1000097622 118
764 3300026116 Ga0207674_10150873 Ga0207674_101508732 118
765 3300026118 Ga0207675_100013335 Ga0207675_1000133359 118
766 3300026118 Ga0207675_100146992 Ga0207675_1001469922 118
767 3300026118 Ga0207675_100191955 Ga0207675_1001919552 118
768 3300026118 Ga0207675_100280366 Ga0207675_1002803662 118
769 3300026118 Ga0207675_100363659 Ga0207675_1003636592 118
770 3300026118 Ga0207675_100624917 Ga0207675_1006249172 118
771 3300026142 Ga0207698_11494138 Ga0207698_114941382 118
772 3300026142 Ga0207698_12066501 Ga0207698_120665012 118
773 3300027252 Ga0209973_1068824 Ga0209973_10688241 118
774 3300027252 Ga0209973_1080000 Ga0209973_10800001 118
775 3300027471 Ga0209995_1083802 Ga0209995_10838021 118
776 3300027543 Ga0209999_1069820 Ga0209999_10698201 118
777 3300027552 Ga0209982_1008968 Ga0209982_10089682 118
778 3300027614 Ga0209970_1004724 Ga0209970_10047241 118
779 3300027614 Ga0209970_1011043 Ga0209970_10110432 118
780 3300027617 Ga0210002_1061489 Ga0210002_10614892 118
781 3300027665 Ga0209983_1007130 Ga0209983_10071303 118
782 3300027671 Ga0209588_1068802 Ga0209588_10688021 118
783 3300027671 Ga0209588_1132519 Ga0209588_11325191 118
784 3300027671 Ga0209588_1183116 Ga0209588_11831162 118
785 3300027682 Ga0209971_1053872 Ga0209971_10538722 118
786 3300027695 Ga0209966_1025761 Ga0209966_10257612 118
787 3300027717 Ga0209998_10000033 Ga0209998_100000339 118
788 3300027717 Ga0209998_10004684 Ga0209998_100046843 118
789 3300027876 Ga0209974_10004944 Ga0209974_100049443 118
790 3300027876 Ga0209974_10046309 Ga0209974_100463092 118
791 3300027907 Ga0207428_10001231 Ga0207428_100012312 118
792 3300027907 Ga0207428_10006171 Ga0207428_1000617110 118
793 3300027907 Ga0207428_10416125 Ga0207428_104161252 118
794 3300027907 Ga0207428_10652072 Ga0207428_106520721 118
795 3300028379 Ga0268266_10834383 Ga0268266_108343832 118
796 3300028380 Ga0268265_10022581 Ga0268265_100225813 118
797 3300028380 Ga0268265_10073601 Ga0268265_100736013 118
798 3300028380 Ga0268265_10504020 Ga0268265_105040201 118
799 3300028381 Ga0268264_10012105 Ga0268264_100121052 118
800 3300028381 Ga0268264_10025410 Ga0268264_100254105 118
801 3300028381 Ga0268264_10166724 Ga0268264_101667242 118
802 3300028381 Ga0268264_10239075 Ga0268264_102390752 118
803 3300028381 Ga0268264_10264437 Ga0268264_102644372 118
804 3300028381 Ga0268264_10317707 Ga0268264_103177072 118
805 3300028381 Ga0268264_10822558 Ga0268264_108225582 118
806 3300028381 Ga0268264_10839492 Ga0268264_108394922 118
807 3300028558 Ga0265326_10062699 Ga0265326_100626992 118
808 3300028558 Ga0265326_10139494 Ga0265326_101394942 118
809 3300028573 Ga0265334_10043538 Ga0265334_100435382 118
810 3300028573 Ga0265334_10218149 Ga0265334_102181491 118
811 3300028573 Ga0265334_10319722 Ga0265334_103197221 118
812 3300028653 Ga0265323_10041686 Ga0265323_100416862 118
813 3300031235 Ga0265330_10030303 Ga0265330_100303033 118
814 3300031241 Ga0265325_10067385 Ga0265325_100673852 118
815 3300031242 Ga0265329_10003882 Ga0265329_100038823 118
816 3300031242 Ga0265329_10138309 Ga0265329_101383092 118
817 3300031249 Ga0265339_10390981 Ga0265339_103909812 118
818 3300031250 Ga0265331_10415132 Ga0265331_104151322 118
819 3300031344 Ga0265316_10401842 Ga0265316_104018422 118
820 3300031548 Ga0307408_100031382 Ga0307408_1000313823 118
821 3300031548 Ga0307408_100033898 Ga0307408_1000338985 118
822 3300031548 Ga0307408_100144256 Ga0307408_1001442562 118
823 3300031548 Ga0307408_100285801 Ga0307408_1002858012 118
824 3300031548 Ga0307408_100298633 Ga0307408_1002986332 118
825 3300031727 Ga0316576_10101550 Ga0316576_101015502 118
826 3300031728 Ga0316578_10178691 Ga0316578_101786912 118
827 3300031731 Ga0307405_10344546 Ga0307405_103445461 118
828 3300031824 Ga0307413_11260188 Ga0307413_112601882 118
829 3300031852 Ga0307410_10144141 Ga0307410_101441412 118
830 3300031901 Ga0307406_10272831 Ga0307406_102728312 118
831 3300031901 Ga0307406_10461961 Ga0307406_104619612 118
832 3300031903 Ga0307407_10316454 Ga0307407_103164541 118
833 3300031911 Ga0307412_10413370 Ga0307412_104133702 118
834 3300031911 Ga0307412_11098661 Ga0307412_110986612 118
835 3300031911 Ga0307412_12035751 Ga0307412_120357511 118
836 3300031995 Ga0307409_100482044 Ga0307409_1004820442 118
837 3300031995 Ga0307409_100719521 Ga0307409_1007195212 118
838 3300031995 Ga0307409_100791322 Ga0307409_1007913222 118
839 3300031995 Ga0307409_100813077 Ga0307409_1008130772 118
840 3300031995 Ga0307409_101121213 Ga0307409_1011212131 118
841 3300032002 Ga0307416_100134480 Ga0307416_1001344802 118
842 3300032002 Ga0307416_100775697 Ga0307416_1007756972 118
843 3300032002 Ga0307416_101792640 Ga0307416_1017926402 118
844 3300032002 Ga0307416_102849089 Ga0307416_1028490891 118
845 3300032002 Ga0307416_103557515 Ga0307416_1035575152 118
846 3300032004 Ga0307414_10654697 Ga0307414_106546972 118
847 3300032005 Ga0307411_10053072 Ga0307411_100530723 118
848 3300032005 Ga0307411_10671177 Ga0307411_106711771 118
849 3300032126 Ga0307415_100246364 Ga0307415_1002463642 118
850 3300032126 Ga0307415_101576067 Ga0307415_1015760672 118
851 3300032126 Ga0307415_101803246 Ga0307415_1018032461 118
852 3300034820 Ga0373959_0004617 Ga0373959_0004617_315_707 118
853 3300035085 Ga0373929_0157631 Ga0373929_0157631_171_563 118
854 3300035088 Ga0373940_0042618 Ga0373940_0042618_628_1020 118
855 3300035090 Ga0373949_0067099 Ga0373949_0067099_111_503 118
856 3300035114 Ga0373939_0384918 Ga0373939_0384918_181_561 118
857 3300035121 Ga0373960_0009905 Ga0373960_0009905_367_759 118
858 3300035121 Ga0373960_0172378 Ga0373960_0172378_327_707 118
859 3300035241 Ga0373961_0014163 Ga0373961_0014163_116_508 118
860 3300035242 Ga0373962_0042926 Ga0373962_0042926_92_472 118
861 3300035242 Ga0373962_0063244 Ga0373962_0063244_233_625 118
862 3300035691 Ga0373931_0751515 Ga0373931_0751515_100_480 118
863 3300035725 Ga0373947_0464824 Ga0373947_0464824_440_820 118
864 3300037312 Ga0395899_0017851 Ga0395899_0017851_630_1022 118
865 3300037312 Ga0395899_0198132 Ga0395899_0198132_709_1101 118
866 3300037418 Ga0395900_0000746 Ga0395900_0000746_28089_28481 118
867 3300037418 Ga0395900_0018449 Ga0395900_0018449_2997_3389 118
868 3300037418 Ga0395900_0276187 Ga0395900_0276187_20_418 118
869 3300037466 Ga0395898_0029991 Ga0395898_0029991_1687_2079 118
870 3300037466 Ga0395898_1776218 Ga0395898_1776218_79_471 118
871 3300037471 Ga0395905_0354268 Ga0395905_0354268_83_475 118
872 3300037471 Ga0395905_1110518 Ga0395905_1110518_230_622 118
873 3300038443 Ga0395901_0001043 Ga0395901_0001043_22982_23374 118
874 3300038443 Ga0395901_0889184 Ga0395901_0889184_459_851 118
875 3300038443 Ga0395901_1194720 Ga0395901_1194720_109_501 118
876 3300038996 Ga0242420_035022 Ga0242420_035022_134_526 118
877 3300038996 Ga0242420_043835 Ga0242420_043835_349_741 118
878 3300038996 Ga0242420_053324 Ga0242420_053324_95_487 118
879 3300041408 Ga0439453_0078180 Ga0439453_0078180_281_667 118
880 3300041411 Ga0439466_0042083 Ga0439466_0042083_1048_1428 118
881 3300041452 Ga0451793_0444071 Ga0451793_0444071_223_603 118
882 3300041458 Ga0451798_1149648 Ga0451798_1149648_121_501 118
883 3300041459 Ga0451800_0820853 Ga0451800_0820853_123_503 118
884 3300041463 Ga0451804_1164747 Ga0451804_1164747_13_393 118
885 3300041486 Ga0451807_0409845 Ga0451807_0409845_249_629 118
886 3300041486 Ga0451807_2391327 Ga0451807_2391327_549_929 118
887 3300041505 Ga0451849_1106345 Ga0451849_1106345_354_734 118
888 3300041507 Ga0451851_0504347 Ga0451851_0504347_153_533 118
889 3300041511 Ga0451855_0646559 Ga0451855_0646559_206_601 118
890 3300041512 Ga0451853_0993859 Ga0451853_0993859_158_538 118
891 3300042002 Ga0439442_044452 Ga0439442_044452_224_604 118
892 3300042008 Ga0439450_095862 Ga0439450_095862_154_546 118
893 3300042121 Ga0450919_001995 Ga0450919_001995_2231_2617 118
894 3300042122 Ga0450920_007538 Ga0450920_007538_815_1201 118
895 3300042123 Ga0450921_016431 Ga0450921_016431_35_421 118
896 3300042125 Ga0450923_098248 Ga0450923_098248_251_637 118
897 3300042147 Ga0450910_002440 Ga0450910_002440_792_1178 118
898 3300042157 Ga0439458_0003437 Ga0439458_0003437_2108_2500 118
899 3300042184 Ga0450908_038110 Ga0450908_038110_301_687 118
900 3300042436 Ga0439435_0004487 Ga0439435_0004487_2192_2584 118
901 3300042438 Ga0439459_0000781 Ga0439459_0000781_868_1260 118
902 3300042461 Ga0439460_0060508 Ga0439460_0060508_423_815 118
903 3300042461 Ga0439460_0066005 Ga0439460_0066005_502_897 118
904 3300042461 Ga0439460_0122098 Ga0439460_0122098_122_502 118
905 3300042461 Ga0439460_0186128 Ga0439460_0186128_181_567 118
906 3300042876 Ga0451577_0004126 Ga0451577_0004126_118_510 118
907 3300042876 Ga0451577_0086611 Ga0451577_0086611_2290_2682 118
908 3300042876 Ga0451577_0120015 Ga0451577_0120015_1856_2248 118
909 3300042876 Ga0451577_0681400 Ga0451577_0681400_412_792 118
910 3300044673 Ga0453683_0033756 Ga0453683_0033756_1750_2142 118
911 3300044673 Ga0453683_0261074 Ga0453683_0261074_51_446 118
912 3300044712 Ga0453684_0046535 Ga0453684_0046535_3063_3455 118
913 3300044712 Ga0453684_0914737 Ga0453684_0914737_89_469 118
914 3300045051 Ga0451576_0018548 Ga0451576_0018548_4933_5325 118
915 3300045051 Ga0451576_0029953 Ga0451576_0029953_1536_1928 118
916 3300045051 Ga0451576_0036653 Ga0451576_0036653_3421_3813 118
917 3300045051 Ga0451576_0946372 Ga0451576_0946372_418_810 118
918 3300045051 Ga0451576_2206537 Ga0451576_2206537_11_403 118
919 3300045051 Ga0451576_2604002 Ga0451576_2604002_91_471 118
920 3300045836 Ga0466958_1044198 Ga0466958_1044198_63_455 118
921 3300046455 Ga0495603_0563135 Ga0495603_0563135_19_411 118
922 3300046459 Ga0495629_0278000 Ga0495629_0278000_196_576 118
923 3300046461 Ga0495641_0186682 Ga0495641_0186682_472_852 118
924 3300046461 Ga0495641_0378146 Ga0495641_0378146_100_480 118
925 3300046491 Ga0495584_0142086 Ga0495584_0142086_755_1147 118
926 3300046491 Ga0495584_0277479 Ga0495584_0277479_457_837 118
927 3300046499 Ga0495594_0311626 Ga0495594_0311626_72_452 118
928 3300046516 Ga0495628_0483684 Ga0495628_0483684_189_569 118
929 3300046517 Ga0495630_0268865 Ga0495630_0268865_749_1129 118
930 3300046517 Ga0495630_1517003 Ga0495630_1517003_73_453 118
931 3300046523 Ga0495644_0055901 Ga0495644_0055901_532_912 118
932 3300046523 Ga0495644_0379692 Ga0495644_0379692_11_391 118
933 3300046528 Ga0495642_0177562 Ga0495642_0177562_131_523 118
934 3300046533 Ga0495640_0216001 Ga0495640_0216001_709_1089 118
935 3300046537 Ga0495598_0070179 Ga0495598_0070179_498_890 118
936 3300046543 Ga0495645_0599719 Ga0495645_0599719_54_434 118
937 3300046558 Ga0495633_0093328 Ga0495633_0093328_973_1365 118
938 3300046615 Ga0495656_0042852 Ga0495656_0042852_167_559 118
939 3300046615 Ga0495656_0126235 Ga0495656_0126235_419_799 118
940 3300046642 Ga0495634_0344026 Ga0495634_0344026_276_656 118
941 3300046642 Ga0495634_0397470 Ga0495634_0397470_232_612 118
942 3300046664 Ga0495659_0010045 Ga0495659_0010045_1589_1981 118
943 3300046675 Ga0495657_0560667 Ga0495657_0560667_129_509 118
944 3300046681 Ga0495647_0128779 Ga0495647_0128779_395_775 118
945 3300046683 Ga0495658_0744590 Ga0495658_0744590_116_496 118
946 3300046684 Ga0495669_0525801 Ga0495669_0525801_40_432 118
947 3300047318 Ga0495636_0615305 Ga0495636_0615305_37_438 118
948 3300047319 Ga0495674_0131145 Ga0495674_0131145_1068_1448 118
949 3300047321 Ga0495676_0412443 Ga0495676_0412443_483_863 118
950 3300047321 Ga0495676_1095893 Ga0495676_1095893_59_439 118
951 3300047322 Ga0495680_0466720 Ga0495680_0466720_71_451 118
952 3300047444 Ga0495675_0788568 Ga0495675_0788568_25_405 118
953 3300047673 Ga0495593_0311452 Ga0495593_0311452_270_650 118
954 3300048089 Ga0495614_0598942 Ga0495614_0598942_77_457 118
955 3300048903 Ga0496100_0435783 Ga0496100_0435783_206_586 118
956 3300048904 Ga0496101_0172398 Ga0496101_0172398_752_1132 118
957 3300048904 Ga0496101_0691772 Ga0496101_0691772_188_568 118
958 3300048905 Ga0496102_0002927 Ga0496102_0002927_11155_11535 118
959 3300048905 Ga0496102_0201554 Ga0496102_0201554_406_786 118
960 3300048905 Ga0496102_0437761 Ga0496102_0437761_660_1040 118
961 3300048906 Ga0496103_0038810 Ga0496103_0038810_1622_2002 118
962 3300048906 Ga0496103_0246704 Ga0496103_0246704_326_706 118
963 3300048907 Ga0496104_0046083 Ga0496104_0046083_3101_3481 118
964 3300048908 Ga0496105_0056039 Ga0496105_0056039_752_1132 118
965 3300048908 Ga0496105_0078974 Ga0496105_0078974_1493_1873 118
966 3300048908 Ga0496105_0652075 Ga0496105_0652075_132_512 118
967 3300048909 Ga0496106_0026511 Ga0496106_0026511_3721_4101 118
968 3300048909 Ga0496106_0429381 Ga0496106_0429381_101_481 118
969 3300048909 Ga0496106_0436720 Ga0496106_0436720_453_833 118
970 3300048910 Ga0496107_0011048 Ga0496107_0011048_803_1183 118
971 3300048910 Ga0496107_0114402 Ga0496107_0114402_1102_1482 118
972 3300048911 Ga0496108_0172864 Ga0496108_0172864_566_946 118
973 3300048911 Ga0496108_0203199 Ga0496108_0203199_1068_1448 118
974 3300048911 Ga0496108_0225282 Ga0496108_0225282_1148_1540 118
975 3300048911 Ga0496108_1081512 Ga0496108_1081512_245_625 118
976 3300048911 Ga0496108_1462832 Ga0496108_1462832_141_521 118
977 3300048911 Ga0496108_1672400 Ga0496108_1672400_105_491 118
978 3300048912 Ga0496109_0004228 Ga0496109_0004228_9515_9895 118
979 3300048912 Ga0496109_0190412 Ga0496109_0190412_918_1310 118
980 3300048912 Ga0496109_0665783 Ga0496109_0665783_78_458 118
981 3300048912 Ga0496109_0808767 Ga0496109_0808767_247_627 118
982 3300048912 Ga0496109_1040798 Ga0496109_1040798_132_512 118
983 3300048912 Ga0496109_1283023 Ga0496109_1283023_117_497 118
984 3300048913 Ga0496110_0151375 Ga0496110_0151375_321_713 118
985 3300048913 Ga0496110_0620278 Ga0496110_0620278_529_909 118
986 3300048913 Ga0496110_0907567 Ga0496110_0907567_263_643 118
987 3300048914 Ga0496111_0145415 Ga0496111_0145415_409_789 118
988 3300048914 Ga0496111_0439125 Ga0496111_0439125_187_567 118
989 3300048914 Ga0496111_0726040 Ga0496111_0726040_91_483 118
990 3300048915 Ga0496112_0031692 Ga0496112_0031692_2213_2593 118
991 3300048915 Ga0496112_0103091 Ga0496112_0103091_378_758 118
992 3300048915 Ga0496112_0187098 Ga0496112_0187098_1066_1446 118
993 3300048916 Ga0496113_0003033 Ga0496113_0003033_8694_9074 118
994 3300048916 Ga0496113_0068001 Ga0496113_0068001_2261_2641 118
995 3300048916 Ga0496113_0092907 Ga0496113_0092907_134_514 118
996 3300048916 Ga0496113_0100148 Ga0496113_0100148_1395_1787 118
997 3300048917 Ga0496114_0245722 Ga0496114_0245722_722_1102 118
998 3300048917 Ga0496114_0877890 Ga0496114_0877890_121_501 118
999 3300048917 Ga0496114_1223204 Ga0496114_1223204_116_508 118
1000 3300048917 Ga0496114_1335711 Ga0496114_1335711_120_500 118
1001 3300048918 Ga0496115_0903741 Ga0496115_0903741_134_514 118
1002 3300049514 Ga0501291_152622 Ga0501291_152622_81_473 118
1003 3300049521 Ga0501298_104912 Ga0501298_104912_204_596 118
1004 3300049568 Ga0501031_0001102 Ga0501031_0001102_11079_11465 118
1005 3300049568 Ga0501031_0066354 Ga0501031_0066354_616_996 118
1006 3300049568 Ga0501031_0107588 Ga0501031_0107588_995_1387 118
1007 3300049568 Ga0501031_0673821 Ga0501031_0673821_149_535 118
1008 3300049569 Ga0501032_0046191 Ga0501032_0046191_348_728 118
1009 3300049569 Ga0501032_0137787 Ga0501032_0137787_254_640 118
1010 3300049569 Ga0501032_0356349 Ga0501032_0356349_458_844 118
1011 3300049570 Ga0501033_0098027 Ga0501033_0098027_576_956 118
1012 3300049571 Ga0501034_0112774 Ga0501034_0112774_1374_1760 118
1013 3300049571 Ga0501034_0306340 Ga0501034_0306340_906_1286 118
1014 3300049572 Ga0501036_0014639 Ga0501036_0014639_4887_5267 118
1015 3300049572 Ga0501036_0018529 Ga0501036_0018529_3291_3677 118
1016 3300049572 Ga0501036_0118983 Ga0501036_0118983_962_1354 118
1017 3300049572 Ga0501036_0143810 Ga0501036_0143810_948_1340 118
1018 3300049572 Ga0501036_0167949 Ga0501036_0167949_75_467 118
1019 3300049572 Ga0501036_0421848 Ga0501036_0421848_367_759 118
1020 3300049572 Ga0501036_1218461 Ga0501036_1218461_175_555 118
1021 3300049573 Ga0501037_0023877 Ga0501037_0023877_4051_4431 118
1022 3300049573 Ga0501037_0141957 Ga0501037_0141957_167_553 118
1023 3300049573 Ga0501037_0916106 Ga0501037_0916106_11_403 118
1024 3300049574 Ga0501038_0029771 Ga0501038_0029771_465_845 118
1025 3300049574 Ga0501038_0034839 Ga0501038_0034839_3643_4029 118
1026 3300049574 Ga0501038_0043208 Ga0501038_0043208_3160_3552 118
1027 3300049574 Ga0501038_0296463 Ga0501038_0296463_723_1118 118
1028 3300049575 Ga0501039_0005907 Ga0501039_0005907_7385_7771 118
1029 3300049575 Ga0501039_0022988 Ga0501039_0022988_648_1040 118
1030 3300049575 Ga0501039_0160545 Ga0501039_0160545_385_777 118
1031 3300049575 Ga0501039_0180448 Ga0501039_0180448_108_500 118
1032 3300049575 Ga0501039_0353834 Ga0501039_0353834_109_522 118
1033 3300049575 Ga0501039_0399536 Ga0501039_0399536_587_979 118
1034 3300049575 Ga0501039_0457064 Ga0501039_0457064_69_455 118
1035 3300049575 Ga0501039_0725711 Ga0501039_0725711_203_583 118
1036 3300049576 Ga0501040_0027705 Ga0501040_0027705_1706_2098 118
1037 3300049576 Ga0501040_0030257 Ga0501040_0030257_2573_2953 118
1038 3300049576 Ga0501040_0053109 Ga0501040_0053109_260_646 118
1039 3300049576 Ga0501040_0131315 Ga0501040_0131315_1182_1574 118
1040 3300049576 Ga0501040_0132299 Ga0501040_0132299_841_1233 118
1041 3300049576 Ga0501040_0316013 Ga0501040_0316013_648_1040 118
1042 3300049576 Ga0501040_0434878 Ga0501040_0434878_81_476 118
1043 3300049576 Ga0501040_0662735 Ga0501040_0662735_218_604 118
1044 3300049576 Ga0501040_0972659 Ga0501040_0972659_128_511 118
1045 3300049577 Ga0501041_0037954 Ga0501041_0037954_1356_1742 118
1046 3300049577 Ga0501041_0040238 Ga0501041_0040238_272_664 118
1047 3300049577 Ga0501041_0056330 Ga0501041_0056330_657_1049 118
1048 3300049577 Ga0501041_0074163 Ga0501041_0074163_591_971 118
1049 3300049577 Ga0501041_0090099 Ga0501041_0090099_849_1241 118
1050 3300049577 Ga0501041_0153951 Ga0501041_0153951_936_1328 118
1051 3300049577 Ga0501041_0323453 Ga0501041_0323453_192_584 118
1052 3300049577 Ga0501041_0347514 Ga0501041_0347514_454_846 118
1053 3300049577 Ga0501041_0462888 Ga0501041_0462888_112_504 118
1054 3300049577 Ga0501041_0642233 Ga0501041_0642233_84_470 118
1055 3300049577 Ga0501041_0930215 Ga0501041_0930215_110_490 118
1056 3300049577 Ga0501041_1080647 Ga0501041_1080647_97_480 118
1057 3300049578 Ga0501042_0015115 Ga0501042_0015115_3122_3508 118
1058 3300049578 Ga0501042_0057888 Ga0501042_0057888_948_1328 118
1059 3300049578 Ga0501042_0066250 Ga0501042_0066250_1331_1723 118
1060 3300049578 Ga0501042_0181707 Ga0501042_0181707_585_977 118
1061 3300049578 Ga0501042_1007529 Ga0501042_1007529_45_437 118
1062 3300049578 Ga0501042_1299690 Ga0501042_1299690_36_428 118
1063 3300049579 Ga0501043_0052487 Ga0501043_0052487_1191_1577 118
1064 3300049580 Ga0501046_0025165 Ga0501046_0025165_2937_3317 118
1065 3300049580 Ga0501046_0034844 Ga0501046_0034844_1809_2195 118
1066 3300049580 Ga0501046_0074596 Ga0501046_0074596_134_526 118
1067 3300049580 Ga0501046_0088073 Ga0501046_0088073_1553_1945 118
1068 3300049580 Ga0501046_0128316 Ga0501046_0128316_1165_1557 118
1069 3300049580 Ga0501046_0757552 Ga0501046_0757552_26_418 118
1070 3300049582 Ga0501048_0006684 Ga0501048_0006684_7034_7420 118
1071 3300049582 Ga0501048_0035284 Ga0501048_0035284_1729_2121 118
1072 3300049582 Ga0501048_0077748 Ga0501048_0077748_1405_1797 118
1073 3300049582 Ga0501048_0122662 Ga0501048_0122662_968_1348 118
1074 3300049582 Ga0501048_0183580 Ga0501048_0183580_419_811 118
1075 3300049582 Ga0501048_0247696 Ga0501048_0247696_10_402 118
1076 3300049582 Ga0501048_0424844 Ga0501048_0424844_533_919 118
1077 3300049582 Ga0501048_0976484 Ga0501048_0976484_101_493 118
1078 3300049583 Ga0501067_0010581 Ga0501067_0010581_4249_4635 118
1079 3300049583 Ga0501067_0019689 Ga0501067_0019689_1979_2371 118
1080 3300049583 Ga0501067_0495584 Ga0501067_0495584_114_500 118
1081 3300049584 Ga0501068_0022009 Ga0501068_0022009_1302_1682 118
1082 3300049584 Ga0501068_0023799 Ga0501068_0023799_873_1259 118
1083 3300049584 Ga0501068_0054677 Ga0501068_0054677_1469_1855 118
1084 3300049584 Ga0501068_0088356 Ga0501068_0088356_1213_1593 118
1085 3300049584 Ga0501068_0114285 Ga0501068_0114285_467_859 118
1086 3300049584 Ga0501068_0322134 Ga0501068_0322134_365_748 118
1087 3300049584 Ga0501068_0385517 Ga0501068_0385517_437_829 118
1088 3300049585 Ga0501069_0042709 Ga0501069_0042709_1715_2101 118
1089 3300049585 Ga0501069_0091422 Ga0501069_0091422_1114_1506 118
1090 3300049585 Ga0501069_0113912 Ga0501069_0113912_1075_1467 118
1091 3300049585 Ga0501069_0144433 Ga0501069_0144433_896_1276 118
1092 3300049585 Ga0501069_0225722 Ga0501069_0225722_348_728 118
1093 3300049585 Ga0501069_0442458 Ga0501069_0442458_138_518 118
1094 3300049585 Ga0501069_0643694 Ga0501069_0643694_185_565 118
1095 3300049586 Ga0501070_0064055 Ga0501070_0064055_1313_1699 118
1096 3300049586 Ga0501070_0144315 Ga0501070_0144315_253_639 118
1097 3300049586 Ga0501070_0173569 Ga0501070_0173569_691_1071 118
1098 3300049586 Ga0501070_0396889 Ga0501070_0396889_124_516 118
1099 3300049586 Ga0501070_0399408 Ga0501070_0399408_335_718 118
1100 3300049586 Ga0501070_0883372 Ga0501070_0883372_10_402 118
1101 3300049587 Ga0501071_0061077 Ga0501071_0061077_1571_1951 118
1102 3300049587 Ga0501071_0069813 Ga0501071_0069813_297_683 118
1103 3300049587 Ga0501071_0070969 Ga0501071_0070969_1470_1856 118
1104 3300049587 Ga0501071_0083857 Ga0501071_0083857_945_1337 118
1105 3300049587 Ga0501071_0117501 Ga0501071_0117501_1506_1895 118
1106 3300049587 Ga0501071_0261877 Ga0501071_0261877_112_492 118
1107 3300049587 Ga0501071_0266426 Ga0501071_0266426_274_666 118
1108 3300049587 Ga0501071_0300236 Ga0501071_0300236_285_671 118
1109 3300049587 Ga0501071_0359289 Ga0501071_0359289_549_938 118
1110 3300049587 Ga0501071_0822134 Ga0501071_0822134_59_445 118
1111 3300049588 Ga0501072_0004990 Ga0501072_0004990_1210_1596 118
1112 3300049588 Ga0501072_0006661 Ga0501072_0006661_5757_6149 118
1113 3300049588 Ga0501072_0031968 Ga0501072_0031968_325_717 118
1114 3300049588 Ga0501072_0035339 Ga0501072_0035339_3067_3459 118
1115 3300049588 Ga0501072_0128528 Ga0501072_0128528_192_584 118
1116 3300049588 Ga0501072_0177774 Ga0501072_0177774_131_523 118
1117 3300049588 Ga0501072_0374657 Ga0501072_0374657_665_1045 118
1118 3300049588 Ga0501072_0593191 Ga0501072_0593191_104_490 118
1119 3300049588 Ga0501072_0620424 Ga0501072_0620424_86_478 118
1120 3300049589 Ga0501073_0101177 Ga0501073_0101177_696_1082 118
1121 3300049589 Ga0501073_0104471 Ga0501073_0104471_1186_1566 118
1122 3300049589 Ga0501073_0143797 Ga0501073_0143797_386_778 118
1123 3300049590 Ga0501074_0018600 Ga0501074_0018600_4192_4572 118
1124 3300049590 Ga0501074_0047789 Ga0501074_0047789_1325_1717 118
1125 3300049590 Ga0501074_0163681 Ga0501074_0163681_255_647 118
1126 3300049590 Ga0501074_0205306 Ga0501074_0205306_201_587 118
1127 3300049590 Ga0501074_0243635 Ga0501074_0243635_493_885 118
1128 3300049590 Ga0501074_1274508 Ga0501074_1274508_42_437 118
1129 3300049591 Ga0501075_0003686 Ga0501075_0003686_351_737 118
1130 3300049591 Ga0501075_0032553 Ga0501075_0032553_1640_2032 118
1131 3300049591 Ga0501075_0045044 Ga0501075_0045044_2710_3090 118
1132 3300049591 Ga0501075_0048619 Ga0501075_0048619_165_557 118
1133 3300049591 Ga0501075_0054210 Ga0501075_0054210_1301_1693 118
1134 3300049591 Ga0501075_0096087 Ga0501075_0096087_822_1208 118
1135 3300049591 Ga0501075_0129687 Ga0501075_0129687_503_892 118
1136 3300049591 Ga0501075_0133394 Ga0501075_0133394_715_1110 118
1137 3300049591 Ga0501075_0166070 Ga0501075_0166070_974_1360 118
1138 3300049591 Ga0501075_0294179 Ga0501075_0294179_143_532 118
1139 3300049591 Ga0501075_0295006 Ga0501075_0295006_198_590 118
1140 3300049591 Ga0501075_0303232 Ga0501075_0303232_504_896 118
1141 3300049591 Ga0501075_0341325 Ga0501075_0341325_532_915 118
1142 3300049591 Ga0501075_1214346 Ga0501075_1214346_160_555 118
1143 3300049592 Ga0501076_0000828 Ga0501076_0000828_8619_9005 118
1144 3300049592 Ga0501076_0010568 Ga0501076_0010568_5031_5423 118
1145 3300049592 Ga0501076_0025463 Ga0501076_0025463_2402_2794 118
1146 3300049592 Ga0501076_0030364 Ga0501076_0030364_2569_2961 118
1147 3300049592 Ga0501076_0198082 Ga0501076_0198082_82_474 118
1148 3300049592 Ga0501076_0239018 Ga0501076_0239018_834_1229 118
1149 3300049592 Ga0501076_0266810 Ga0501076_0266810_24_416 118
1150 3300049592 Ga0501076_0310524 Ga0501076_0310524_222_614 118
1151 3300049592 Ga0501076_0327149 Ga0501076_0327149_24_416 118
1152 3300049592 Ga0501076_0571261 Ga0501076_0571261_223_603 118
1153 3300049592 Ga0501076_1541642 Ga0501076_1541642_60_446 118
1154 3300049593 Ga0501077_0002228 Ga0501077_0002228_5638_6030 118
1155 3300049593 Ga0501077_0007973 Ga0501077_0007973_3198_3584 118
1156 3300049593 Ga0501077_0008664 Ga0501077_0008664_465_845 118
1157 3300049593 Ga0501077_0015616 Ga0501077_0015616_870_1262 118
1158 3300049593 Ga0501077_0092745 Ga0501077_0092745_974_1366 118
1159 3300049593 Ga0501077_0093040 Ga0501077_0093040_600_995 118
1160 3300049593 Ga0501077_0292983 Ga0501077_0292983_442_834 118
1161 3300049593 Ga0501077_0853332 Ga0501077_0853332_168_557 118
1162 3300049593 Ga0501077_1132275 Ga0501077_1132275_88_480 118
1163 3300049704 Ga0501221_259428 Ga0501221_259428_20_412 118
1164 3300049741 Ga0501079_0007693 Ga0501079_0007693_871_1254 118
1165 3300049741 Ga0501079_0008408 Ga0501079_0008408_5670_6056 118
1166 3300049741 Ga0501079_0012882 Ga0501079_0012882_4694_5086 118
1167 3300049741 Ga0501079_0015423 Ga0501079_0015423_4984_5364 118
1168 3300049741 Ga0501079_0028355 Ga0501079_0028355_3443_3835 118
1169 3300049741 Ga0501079_0050019 Ga0501079_0050019_1300_1692 118
1170 3300049741 Ga0501079_0535217 Ga0501079_0535217_350_742 118
1171 3300049742 Ga0501080_0007716 Ga0501080_0007716_1236_1622 118
1172 3300049742 Ga0501080_0013087 Ga0501080_0013087_4324_4704 118
1173 3300049742 Ga0501080_0252128 Ga0501080_0252128_1104_1487 118
1174 3300049742 Ga0501080_0275938 Ga0501080_0275938_707_1099 118
1175 3300049742 Ga0501080_0919146 Ga0501080_0919146_357_743 118
1176 3300049742 Ga0501080_1183785 Ga0501080_1183785_89_481 118
1177 3300049743 Ga0501081_0002842 Ga0501081_0002842_6116_6508 118
1178 3300049743 Ga0501081_0004264 Ga0501081_0004264_348_728 118
1179 3300049743 Ga0501081_0006863 Ga0501081_0006863_1973_2365 118
1180 3300049743 Ga0501081_0030008 Ga0501081_0030008_1684_2070 118
1181 3300049743 Ga0501081_0042769 Ga0501081_0042769_1058_1450 118
1182 3300049743 Ga0501081_0056784 Ga0501081_0056784_961_1353 118
1183 3300049743 Ga0501081_0061300 Ga0501081_0061300_160_546 118
1184 3300049743 Ga0501081_0119600 Ga0501081_0119600_129_515 118
1185 3300049743 Ga0501081_0710963 Ga0501081_0710963_183_578 118
1186 3300049744 Ga0501083_0085258 Ga0501083_0085258_48_440 118
1187 3300049744 Ga0501083_0086258 Ga0501083_0086258_676_1056 118
1188 3300049744 Ga0501083_0201990 Ga0501083_0201990_478_870 118
1189 3300049744 Ga0501083_0331268 Ga0501083_0331268_529_921 118
1190 3300049822 Ga0501035_0012454 Ga0501035_0012454_1292_1678 118
1191 3300049822 Ga0501035_0222552 Ga0501035_0222552_350_742 118
1192 3300049822 Ga0501035_0477590 Ga0501035_0477590_464_844 118
1193 3300049822 Ga0501035_0795923 Ga0501035_0795923_132_524 118
1194 3300049823 Ga0501044_0434746 Ga0501044_0434746_273_653 118
1195 3300049824 Ga0501045_0013281 Ga0501045_0013281_2357_2749 118
1196 3300049824 Ga0501045_0020637 Ga0501045_0020637_1541_1927 118
1197 3300049824 Ga0501045_0050570 Ga0501045_0050570_460_840 118
1198 3300049824 Ga0501045_0066560 Ga0501045_0066560_1671_2063 118
1199 3300049824 Ga0501045_0067339 Ga0501045_0067339_1215_1607 118
1200 3300049824 Ga0501045_0115015 Ga0501045_0115015_511_906 118
1201 3300049824 Ga0501045_0177509 Ga0501045_0177509_1092_1484 118
1202 3300049824 Ga0501045_0475234 Ga0501045_0475234_112_504 118
1203 3300049824 Ga0501045_0588383 Ga0501045_0588383_236_628 118
1204 3300049824 Ga0501045_0765706 Ga0501045_0765706_87_473 118
1205 3300049824 Ga0501045_0772861 Ga0501045_0772861_228_620 118
1206 3300050507 nmdc:mga05p37_1273147_c1 nmdc:mga05p37_1273147_c1_53_445 118
1207 3300050507 nmdc:mga05p37_127_c1 nmdc:mga05p37_127_c1_45384_45776 118
1208 3300050507 nmdc:mga05p37_132836_c1 nmdc:mga05p37_132836_c1_76_468 118
1209 3300050507 nmdc:mga05p37_1614121_c1 nmdc:mga05p37_1614121_c1_97_477 118
1210 3300050507 nmdc:mga05p37_1771_c1 nmdc:mga05p37_1771_c1_5983_6381 118
1211 3300050507 nmdc:mga05p37_237152_c1 nmdc:mga05p37_237152_c1_402_803 118
1212 3300050507 nmdc:mga05p37_239_c1 nmdc:mga05p37_239_c1_26358_26756 118
1213 3300050507 nmdc:mga05p37_3711_c3 nmdc:mga05p37_3711_c3_737_1129 118
1214 3300050507 nmdc:mga05p37_41349_c1 nmdc:mga05p37_41349_c1_2141_2533 118
1215 3300050507 nmdc:mga05p37_41677_c1 nmdc:mga05p37_41677_c1_2692_3084 118
1216 3300050507 nmdc:mga05p37_449685_c1 nmdc:mga05p37_449685_c1_173_568 118
1217 3300050507 nmdc:mga05p37_465675_c1 nmdc:mga05p37_465675_c1_706_1098 118
1218 3300050507 nmdc:mga05p37_46567_c1 nmdc:mga05p37_46567_c1_859_1251 118
1219 3300050507 nmdc:mga05p37_48588_c1 nmdc:mga05p37_48588_c1_3583_3978 118
1220 3300050507 nmdc:mga05p37_633329_c1 nmdc:mga05p37_633329_c1_394_786 118
1221 3300050507 nmdc:mga05p37_7507_c1 nmdc:mga05p37_7507_c1_6086_6466 118
1222 3300050507 nmdc:mga05p37_82059_c1 nmdc:mga05p37_82059_c1_2787_3182 118
1223 3300050507 nmdc:mga05p37_87223_c1 nmdc:mga05p37_87223_c1_2227_2619 118
1224 3300050507 nmdc:mga05p37_99945_c1 nmdc:mga05p37_99945_c1_2389_2769 118
1225 3300050508 nmdc:mga09592_100912_c1 nmdc:mga09592_100912_c1_456_851 118
1226 3300050508 nmdc:mga09592_3272_c1 nmdc:mga09592_3272_c1_8527_8919 118
1227 3300050508 nmdc:mga09592_395144_c1 nmdc:mga09592_395144_c1_186_581 118
1228 3300050508 nmdc:mga09592_427_c1 nmdc:mga09592_427_c1_16055_16447 118
1229 3300050508 nmdc:mga09592_4396_c1 nmdc:mga09592_4396_c1_190_588 118
1230 3300050508 nmdc:mga09592_50910_c1 nmdc:mga09592_50910_c1_1985_2377 118
1231 3300050508 nmdc:mga09592_8665_c1 nmdc:mga09592_8665_c1_7258_7650 118
1232 3300050508 nmdc:mga09592_94679_c1 nmdc:mga09592_94679_c1_1259_1639 118
1233 3300050509 nmdc:mga0qj67_11105_c1 nmdc:mga0qj67_11105_c1_4983_5375 118
1234 3300050509 nmdc:mga0qj67_151458_c1 nmdc:mga0qj67_151458_c1_443_838 118
1235 3300050509 nmdc:mga0qj67_343909_c1 nmdc:mga0qj67_343909_c1_787_1176 118
1236 3300050509 nmdc:mga0qj67_4377_c1 nmdc:mga0qj67_4377_c1_9739_10131 118
1237 3300050509 nmdc:mga0qj67_67987_c1 nmdc:mga0qj67_67987_c1_1577_1972 118
1238 3300050509 nmdc:mga0qj67_70580_c1 nmdc:mga0qj67_70580_c1_1376_1771 118
1239 3300050509 nmdc:mga0qj67_823880_c1 nmdc:mga0qj67_823880_c1_44_439 118
1240 3300050509 nmdc:mga0qj67_85671_c1 nmdc:mga0qj67_85671_c1_2060_2452 118
1241 3300050510 nmdc:mga06r32_116907_c1 nmdc:mga06r32_116907_c1_680_1075 118
1242 3300050510 nmdc:mga06r32_173288_c1 nmdc:mga06r32_173288_c1_675_1067 118
1243 3300050510 nmdc:mga06r32_221351_c1 nmdc:mga06r32_221351_c1_1086_1481 118
1244 3300050510 nmdc:mga06r32_3037_c1 nmdc:mga06r32_3037_c1_2874_3266 118
1245 3300050510 nmdc:mga06r32_339939_c1 nmdc:mga06r32_339939_c1_470_865 118
1246 3300050510 nmdc:mga06r32_366437_c1 nmdc:mga06r32_366437_c1_669_1061 118
1247 3300050510 nmdc:mga06r32_443_c2 nmdc:mga06r32_443_c2_12112_12507 118
1248 3300050510 nmdc:mga06r32_46009_c1 nmdc:mga06r32_46009_c1_185_565 118
1249 3300050510 nmdc:mga06r32_4884_c1 nmdc:mga06r32_4884_c1_2988_3386 118
1250 3300050510 nmdc:mga06r32_56447_c1 nmdc:mga06r32_56447_c1_801_1193 118
1251 3300050510 nmdc:mga06r32_58216_c1 nmdc:mga06r32_58216_c1_3044_3436 118
1252 3300050510 nmdc:mga06r32_622833_c1 nmdc:mga06r32_622833_c1_263_655 118
1253 3300050511 nmdc:mga08y16_1476_c1 nmdc:mga08y16_1476_c1_19473_19865 118
1254 3300050511 nmdc:mga08y16_157784_c1 nmdc:mga08y16_157784_c1_1383_1775 118
1255 3300050511 nmdc:mga08y16_1725416_c1 nmdc:mga08y16_1725416_c1_153_548 118
1256 3300050511 nmdc:mga08y16_320611_c1 nmdc:mga08y16_320611_c1_643_1023 118
1257 3300050511 nmdc:mga08y16_430421_c1 nmdc:mga08y16_430421_c1_783_1163 118
1258 3300050511 nmdc:mga08y16_4404_c1 nmdc:mga08y16_4404_c1_5459_5851 118
1259 3300050511 nmdc:mga08y16_606536_c1 nmdc:mga08y16_606536_c1_592_984 118
1260 3300050511 nmdc:mga08y16_852381_c1 nmdc:mga08y16_852381_c1_255_647 118
1261 3300050511 nmdc:mga08y16_94351_c1 nmdc:mga08y16_94351_c1_2078_2473 118
1262 3300050512 nmdc:mga0n895_10071_c1 nmdc:mga0n895_10071_c1_4466_4858 118
1263 3300050512 nmdc:mga0n895_115875_c1 nmdc:mga0n895_115875_c1_566_958 118
1264 3300050512 nmdc:mga0n895_12425_c1 nmdc:mga0n895_12425_c1_3160_3552 118
1265 3300050512 nmdc:mga0n895_125307_c1 nmdc:mga0n895_125307_c1_858_1238 118
1266 3300050512 nmdc:mga0n895_19695_c1 nmdc:mga0n895_19695_c1_2339_2731 118
1267 3300050512 nmdc:mga0n895_241394_c1 nmdc:mga0n895_241394_c1_402_794 118
1268 3300050512 nmdc:mga0n895_2780_c1 nmdc:mga0n895_2780_c1_13388_13786 118
1269 3300050512 nmdc:mga0n895_29836_c1 nmdc:mga0n895_29836_c1_2269_2661 118
1270 3300050512 nmdc:mga0n895_618867_c1 nmdc:mga0n895_618867_c1_316_696 118
1271 3300050512 nmdc:mga0n895_66139_c1 nmdc:mga0n895_66139_c1_1447_1842 118
1272 3300050512 nmdc:mga0n895_735210_c1 nmdc:mga0n895_735210_c1_415_807 118
1273 3300050512 nmdc:mga0n895_765352_c1 nmdc:mga0n895_765352_c1_474_866 118
1274 3300050513 nmdc:mga0rr50_1004031_c1 nmdc:mga0rr50_1004031_c1_243_635 118
1275 3300050513 nmdc:mga0rr50_110997_c1 nmdc:mga0rr50_110997_c1_1264_1656 118
1276 3300050513 nmdc:mga0rr50_1255723_c1 nmdc:mga0rr50_1255723_c1_177_578 118
1277 3300050513 nmdc:mga0rr50_193_c1 nmdc:mga0rr50_193_c1_7556_7954 118
1278 3300050513 nmdc:mga0rr50_342580_c1 nmdc:mga0rr50_342580_c1_771_1166 118
1279 3300050513 nmdc:mga0rr50_396286_c1 nmdc:mga0rr50_396286_c1_476_868 118
1280 3300050513 nmdc:mga0rr50_44168_c1 nmdc:mga0rr50_44168_c1_2466_2858 118
1281 3300050513 nmdc:mga0rr50_594369_c1 nmdc:mga0rr50_594369_c1_182_574 118
1282 3300050513 nmdc:mga0rr50_647439_c1 nmdc:mga0rr50_647439_c1_403_795 118
1283 3300050514 nmdc:mga08x19_134704_c1 nmdc:mga08x19_134704_c1_302_694 118
1284 3300050514 nmdc:mga08x19_201954_c1 nmdc:mga08x19_201954_c1_448_840 118
1285 3300050514 nmdc:mga08x19_29139_c1 nmdc:mga08x19_29139_c1_2843_3235 118
1286 3300050514 nmdc:mga08x19_382_c1 nmdc:mga08x19_382_c1_1475_1873 118
1287 3300050514 nmdc:mga08x19_434834_c1 nmdc:mga08x19_434834_c1_448_840 118
1288 3300050515 nmdc:mga0a205_1045541_c1 nmdc:mga0a205_1045541_c1_239_631 118
1289 3300050515 nmdc:mga0a205_117324_c1 nmdc:mga0a205_117324_c1_404_796 118
1290 3300050515 nmdc:mga0a205_1220759_c1 nmdc:mga0a205_1220759_c1_90_470 118
1291 3300050515 nmdc:mga0a205_1525_c1 nmdc:mga0a205_1525_c1_19222_19614 118
1292 3300050515 nmdc:mga0a205_167925_c1 nmdc:mga0a205_167925_c1_101_496 118
1293 3300050515 nmdc:mga0a205_175729_c1 nmdc:mga0a205_175729_c1_1456_1848 118
1294 3300050515 nmdc:mga0a205_193959_c1 nmdc:mga0a205_193959_c1_972_1364 118
1295 3300050515 nmdc:mga0a205_3226_c1 nmdc:mga0a205_3226_c1_9218_9610 118
1296 3300050515 nmdc:mga0a205_335988_c1 nmdc:mga0a205_335988_c1_40_435 118
1297 3300050515 nmdc:mga0a205_4157_c1 nmdc:mga0a205_4157_c1_200_598 118
1298 3300050515 nmdc:mga0a205_4728_c1 nmdc:mga0a205_4728_c1_10195_10587 118
1299 3300050515 nmdc:mga0a205_55968_c1 nmdc:mga0a205_55968_c1_2873_3265 118
1300 3300050515 nmdc:mga0a205_88158_c1 nmdc:mga0a205_88158_c1_257_652 118
1301 3300053084 Ga0495595_0472939 Ga0495595_0472939_48_428 118
1302 3300054114 Ga0501084_0003108 Ga0501084_0003108_5852_6235 118
1303 3300054114 Ga0501084_0007770 Ga0501084_0007770_495_887 118
1304 3300054114 Ga0501084_0034405 Ga0501084_0034405_791_1183 118
1305 3300054114 Ga0501084_0088522 Ga0501084_0088522_621_1007 118
1306 3300054114 Ga0501084_0225189 Ga0501084_0225189_552_944 118
1307 3300054114 Ga0501084_0268415 Ga0501084_0268415_105_500 118
1308 3300054114 Ga0501084_0281811 Ga0501084_0281811_725_1105 118
1309 3300054114 Ga0501084_0361739 Ga0501084_0361739_406_798 118
1310 3300054114 Ga0501084_0400080 Ga0501084_0400080_325_711 118
1311 3300054114 Ga0501084_0949467 Ga0501084_0949467_324_710 118
1312 3300060353 Ga0501082_0003994 Ga0501082_0003994_10932_11318 118
1313 3300060353 Ga0501082_0004439 Ga0501082_0004439_11412_11804 118
1314 3300060353 Ga0501082_0098452 Ga0501082_0098452_869_1255 118
1315 3300060353 Ga0501082_0147365 Ga0501082_0147365_11_403 118
1316 3300060353 Ga0501082_0216463 Ga0501082_0216463_193_573 118
1317 3300060353 Ga0501082_0252935 Ga0501082_0252935_367_750 118
1318 3300060353 Ga0501082_0263594 Ga0501082_0263594_217_606 118
1319 3300060353 Ga0501082_0358531 Ga0501082_0358531_360_752 118
1320 3300060353 Ga0501082_0695532 Ga0501082_0695532_179_571 118
1321 3300061734 Ga0530510_0009546 Ga0530510_0009546_5235_5627 118
1322 3300061734 Ga0530510_0011881 Ga0530510_0011881_5208_5597 118
1323 3300061734 Ga0530510_0023614 Ga0530510_0023614_3600_3986 118
1324 3300061734 Ga0530510_0053095 Ga0530510_0053095_1597_1983 118
1325 3300061734 Ga0530510_0054905 Ga0530510_0054905_986_1378 118
1326 3300061734 Ga0530510_0059549 Ga0530510_0059549_1681_2073 118
1327 3300061734 Ga0530510_0255763 Ga0530510_0255763_243_623 118
1328 3300061734 Ga0530510_0258933 Ga0530510_0258933_568_948 118
1329 3300061734 Ga0530510_0266857 Ga0530510_0266857_431_811 118
1330 3300061734 Ga0530510_0311972 Ga0530510_0311972_719_1111 118
1331 3300061734 Ga0530510_0434912 Ga0530510_0434912_416_808 118
1332 3300061734 Ga0530510_0723744 Ga0530510_0723744_198_584 118
1333 3300001977 JGI24746J21847_1032975 JGI24746J21847_10329752 119
1334 3300001991 JGI24743J22301_10077328 JGI24743J22301_100773282 119
1335 3300002076 JGI24749J21850_1009988 JGI24749J21850_10099882 119
1336 3300002155 JGI24033J26618_1024710 JGI24033J26618_10247102 119
1337 3300002239 JGI24034J26672_10041353 JGI24034J26672_100413532 119
1338 3300002244 JGI24742J22300_10056306 JGI24742J22300_100563062 119
1339 3300002459 JGI24751J29686_10074371 JGI24751J29686_100743711 119
1340 3300004801 Ga0058860_11420570 Ga0058860_114205702 119
1341 3300005327 Ga0070658_11142660 Ga0070658_111426601 119
1342 3300005328 Ga0070676_11343770 Ga0070676_113437701 119
1343 3300005329 Ga0070683_100031589 Ga0070683_1000315893 119
1344 3300005329 Ga0070683_101206059 Ga0070683_1012060591 119
1345 3300005330 Ga0070690_100037980 Ga0070690_1000379802 119
1346 3300005331 Ga0070670_100054886 Ga0070670_1000548862 119
1347 3300005333 Ga0070677_10172165 Ga0070677_101721652 119
1348 3300005334 Ga0068869_100053183 Ga0068869_1000531832 119
1349 3300005334 Ga0068869_101399102 Ga0068869_1013991021 119
1350 3300005335 Ga0070666_10083773 Ga0070666_100837733 119
1351 3300005336 Ga0070680_100804256 Ga0070680_1008042562 119
1352 3300005337 Ga0070682_100047799 Ga0070682_1000477994 119
1353 3300005338 Ga0068868_100314824 Ga0068868_1003148242 119
1354 3300005339 Ga0070660_100011088 Ga0070660_1000110884 119
1355 3300005340 Ga0070689_100005582 Ga0070689_1000055823 119
1356 3300005340 Ga0070689_100334816 Ga0070689_1003348162 119
1357 3300005341 Ga0070691_10118797 Ga0070691_101187972 119
1358 3300005341 Ga0070691_10711641 Ga0070691_107116411 119
1359 3300005341 Ga0070691_10725060 Ga0070691_107250602 119
1360 3300005343 Ga0070687_100013100 Ga0070687_1000131004 119
1361 3300005344 Ga0070661_100030662 Ga0070661_1000306622 119
1362 3300005347 Ga0070668_100028676 Ga0070668_1000286763 119
1363 3300005347 Ga0070668_101810618 Ga0070668_1018106181 119
1364 3300005353 Ga0070669_100195130 Ga0070669_1001951302 119
1365 3300005354 Ga0070675_100006518 Ga0070675_1000065185 119
1366 3300005354 Ga0070675_100958301 Ga0070675_1009583012 119
1367 3300005355 Ga0070671_100315082 Ga0070671_1003150822 119
1368 3300005355 Ga0070671_100681613 Ga0070671_1006816132 119
1369 3300005356 Ga0070674_100009702 Ga0070674_1000097021 119
1370 3300005364 Ga0070673_100019962 Ga0070673_1000199623 119
1371 3300005365 Ga0070688_100008141 Ga0070688_1000081415 119
1372 3300005365 Ga0070688_100684425 Ga0070688_1006844252 119
1373 3300005366 Ga0070659_100005593 Ga0070659_1000055936 119
1374 3300005366 Ga0070659_100617763 Ga0070659_1006177632 119
1375 3300005367 Ga0070667_100193913 Ga0070667_1001939132 119
1376 3300005438 Ga0070701_11062343 Ga0070701_110623431 119
1377 3300005440 Ga0070705_100893771 Ga0070705_1008937712 119
1378 3300005440 Ga0070705_101012083 Ga0070705_1010120832 119
1379 3300005441 Ga0070700_100002175 Ga0070700_1000021752 119
1380 3300005441 Ga0070700_100602809 Ga0070700_1006028091 119
1381 3300005444 Ga0070694_100550165 Ga0070694_1005501652 119
1382 3300005445 Ga0070708_100257215 Ga0070708_1002572152 119
1383 3300005455 Ga0070663_100056350 Ga0070663_1000563501 119
1384 3300005455 Ga0070663_100976957 Ga0070663_1009769572 119
1385 3300005456 Ga0070678_100038315 Ga0070678_1000383151 119
1386 3300005457 Ga0070662_100023708 Ga0070662_1000237082 119
1387 3300005459 Ga0068867_100046416 Ga0068867_1000464164 119
1388 3300005466 Ga0070685_10001459 Ga0070685_100014598 119
1389 3300005466 Ga0070685_10451525 Ga0070685_104515252 119
1390 3300005530 Ga0070679_100106146 Ga0070679_1001061462 119
1391 3300005530 Ga0070679_101324679 Ga0070679_1013246791 119
1392 3300005535 Ga0070684_100020991 Ga0070684_1000209914 119
1393 3300005539 Ga0068853_100713495 Ga0068853_1007134952 119
1394 3300005543 Ga0070672_100192084 Ga0070672_1001920842 119
1395 3300005544 Ga0070686_100029257 Ga0070686_1000292574 119
1396 3300005544 Ga0070686_100117024 Ga0070686_1001170242 119
1397 3300005544 Ga0070686_100427794 Ga0070686_1004277942 119
1398 3300005546 Ga0070696_100206725 Ga0070696_1002067252 119
1399 3300005546 Ga0070696_100809180 Ga0070696_1008091802 119
1400 3300005547 Ga0070693_100011840 Ga0070693_1000118402 119
1401 3300005549 Ga0070704_100165080 Ga0070704_1001650802 119
1402 3300005549 Ga0070704_101105864 Ga0070704_1011058641 119
1403 3300005563 Ga0068855_100359603 Ga0068855_1003596031 119
1404 3300005564 Ga0070664_100033101 Ga0070664_1000331012 119
1405 3300005577 Ga0068857_100183692 Ga0068857_1001836922 119
1406 3300005578 Ga0068854_100111516 Ga0068854_1001115162 119
1407 3300005578 Ga0068854_100263739 Ga0068854_1002637392 119
1408 3300005578 Ga0068854_100482733 Ga0068854_1004827332 119
1409 3300005615 Ga0070702_100022544 Ga0070702_1000225443 119
1410 3300005615 Ga0070702_100147612 Ga0070702_1001476122 119
1411 3300005616 Ga0068852_100078052 Ga0068852_1000780522 119
1412 3300005617 Ga0068859_100010613 Ga0068859_1000106135 119
1413 3300005617 Ga0068859_100524209 Ga0068859_1005242091 119
1414 3300005618 Ga0068864_100020057 Ga0068864_1000200575 119
1415 3300005718 Ga0068866_10009623 Ga0068866_100096232 119
1416 3300005840 Ga0068870_10050037 Ga0068870_100500372 119
1417 3300005842 Ga0068858_100074985 Ga0068858_1000749852 119
1418 3300005842 Ga0068858_100269301 Ga0068858_1002693011 119
1419 3300005843 Ga0068860_100042599 Ga0068860_1000425992 119
1420 3300005843 Ga0068860_100495313 Ga0068860_1004953132 119
1421 3300005844 Ga0068862_100052986 Ga0068862_1000529862 119
1422 3300006038 Ga0075365_10247793 Ga0075365_102477932 119
1423 3300006358 Ga0068871_100237057 Ga0068871_1002370572 119
1424 3300006871 Ga0075434_100468001 Ga0075434_1004680012 119
1425 3300006871 Ga0075434_101238497 Ga0075434_1012384972 119
1426 3300006881 Ga0068865_100042382 Ga0068865_1000423822 119
1427 3300006881 Ga0068865_100514588 Ga0068865_1005145881 119
1428 3300006931 Ga0097620_100010613 Ga0097620_1000106135 119
1429 3300006931 Ga0097620_100524244 Ga0097620_1005242441 119
1430 3300009094 Ga0111539_10096923 Ga0111539_100969233 119
1431 3300009094 Ga0111539_10317252 Ga0111539_103172522 119
1432 3300009094 Ga0111539_10359159 Ga0111539_103591594 119
1433 3300009147 Ga0114129_10070080 Ga0114129_100700802 119
1434 3300009176 Ga0105242_11193918 Ga0105242_111939182 119
1435 3300009177 Ga0105248_11504736 Ga0105248_115047362 119
1436 3300009553 Ga0105249_10228649 Ga0105249_102286492 119
1437 3300009553 Ga0105249_10318628 Ga0105249_103186282 119
1438 3300010375 Ga0105239_10032185 Ga0105239_100321853 119
1439 3300011119 Ga0105246_10359739 Ga0105246_103597392 119
1440 3300012487 Ga0157321_1007243 Ga0157321_10072432 119
1441 3300013297 Ga0157378_13080173 Ga0157378_130801732 119
1442 3300013306 Ga0163162_10831400 Ga0163162_108314002 119
1443 3300013306 Ga0163162_12011314 Ga0163162_120113142 119
1444 3300014325 Ga0163163_10079267 Ga0163163_100792672 119
1445 3300014325 Ga0163163_10314098 Ga0163163_103140981 119
1446 3300014326 Ga0157380_10134129 Ga0157380_101341291 119
1447 3300014326 Ga0157380_12600944 Ga0157380_126009442 119
1448 3300014326 Ga0157380_13248918 Ga0157380_132489181 119
1449 3300014968 Ga0157379_11354733 Ga0157379_113547332 119
1450 3300017792 Ga0163161_10157397 Ga0163161_101573972 119
1451 3300017792 Ga0163161_10926651 Ga0163161_109266512 119
1452 3300025899 Ga0207642_10007518 Ga0207642_100075185 119
1453 3300025901 Ga0207688_10484965 Ga0207688_104849652 119
1454 3300025908 Ga0207643_10019158 Ga0207643_100191583 119
1455 3300025908 Ga0207643_10434809 Ga0207643_104348091 119
1456 3300025912 Ga0207707_10091371 Ga0207707_100913711 119
1457 3300025917 Ga0207660_10455675 Ga0207660_104556752 119
1458 3300025918 Ga0207662_10014313 Ga0207662_100143134 119
1459 3300025919 Ga0207657_10055850 Ga0207657_100558502 119
1460 3300025920 Ga0207649_10037996 Ga0207649_100379964 119
1461 3300025921 Ga0207652_10139350 Ga0207652_101393502 119
1462 3300025921 Ga0207652_10659047 Ga0207652_106590471 119
1463 3300025925 Ga0207650_10056190 Ga0207650_100561904 119
1464 3300025926 Ga0207659_10021648 Ga0207659_100216482 119
1465 3300025926 Ga0207659_11362760 Ga0207659_113627602 119
1466 3300025927 Ga0207687_10020512 Ga0207687_100205122 119
1467 3300025931 Ga0207644_10421882 Ga0207644_104218822 119
1468 3300025932 Ga0207690_10059291 Ga0207690_100592913 119
1469 3300025932 Ga0207690_10958076 Ga0207690_109580762 119
1470 3300025933 Ga0207706_10008080 Ga0207706_100080802 119
1471 3300025935 Ga0207709_10036343 Ga0207709_100363432 119
1472 3300025935 Ga0207709_10529142 Ga0207709_105291422 119
1473 3300025936 Ga0207670_10049824 Ga0207670_100498242 119
1474 3300025937 Ga0207669_10005809 Ga0207669_100058092 119
1475 3300025938 Ga0207704_10016192 Ga0207704_100161924 119
1476 3300025940 Ga0207691_10030181 Ga0207691_100301815 119
1477 3300025940 Ga0207691_11628670 Ga0207691_116286701 119
1478 3300025942 Ga0207689_10085623 Ga0207689_100856232 119
1479 3300025944 Ga0207661_10386395 Ga0207661_103863952 119
1480 3300025945 Ga0207679_11122730 Ga0207679_111227302 119
1481 3300025960 Ga0207651_10134811 Ga0207651_101348112 119
1482 3300025972 Ga0207668_10308872 Ga0207668_103088722 119
1483 3300025972 Ga0207668_11585364 Ga0207668_115853641 119
1484 3300025981 Ga0207640_10270625 Ga0207640_102706252 119
1485 3300026023 Ga0207677_10895923 Ga0207677_108959231 119
1486 3300026035 Ga0207703_10038357 Ga0207703_100383572 119
1487 3300026041 Ga0207639_10743500 Ga0207639_107435002 119
1488 3300026067 Ga0207678_10004666 Ga0207678_100046666 119
1489 3300026075 Ga0207708_10001488 Ga0207708_100014887 119
1490 3300026088 Ga0207641_10082849 Ga0207641_100828492 119
1491 3300026089 Ga0207648_10013007 Ga0207648_100130072 119
1492 3300026089 Ga0207648_10351197 Ga0207648_103511972 119
1493 3300026095 Ga0207676_10986433 Ga0207676_109864332 119
1494 3300026116 Ga0207674_10020864 Ga0207674_100208642 119
1495 3300026118 Ga0207675_100012320 Ga0207675_1000123206 119
1496 3300027526 Ga0209968_1079422 Ga0209968_10794221 119
1497 3300027695 Ga0209966_1032498 Ga0209966_10324982 119
1498 3300027876 Ga0209974_10036354 Ga0209974_100363542 119
1499 3300027907 Ga0207428_10152289 Ga0207428_101522892 119
1500 3300028380 Ga0268265_10117820 Ga0268265_101178202 119
1501 3300028381 Ga0268264_10432311 Ga0268264_104323112 119
1502 3300032002 Ga0307416_100868487 Ga0307416_1008684872 119
1503 3300035398 Ga0316574_0255009 Ga0316574_0255009_488_874 119
1504 3300035410 Ga0373924_0175689 Ga0373924_0175689_336_749 119
1505 3300035724 Ga0373933_0247907 Ga0373933_0247907_396_809 119
1506 3300042461 Ga0439460_0008194 Ga0439460_0008194_1166_1555 119
1507 3300046517 Ga0495630_0420422 Ga0495630_0420422_458_871 119
1508 3300046794 Ga0495589_0528986 Ga0495589_0528986_19_402 119
1509 3300048905 Ga0496102_0642523 Ga0496102_0642523_295_678 119
1510 3300048905 Ga0496102_1002751 Ga0496102_1002751_196_588 119
1511 3300048906 Ga0496103_0118691 Ga0496103_0118691_276_659 119
1512 3300048909 Ga0496106_0716067 Ga0496106_0716067_349_735 119
1513 3300048912 Ga0496109_0478361 Ga0496109_0478361_255_647 119
1514 3300048912 Ga0496109_1116776 Ga0496109_1116776_68_454 119
1515 3300049572 Ga0501036_0020368 Ga0501036_0020368_2935_3318 119
1516 3300049572 Ga0501036_0607291 Ga0501036_0607291_203_586 119
1517 3300049575 Ga0501039_0687475 Ga0501039_0687475_83_466 119
1518 3300049576 Ga0501040_0178112 Ga0501040_0178112_1110_1493 119
1519 3300049576 Ga0501040_1378340 Ga0501040_1378340_37_420 119
1520 3300049577 Ga0501041_0018777 Ga0501041_0018777_1110_1493 119
1521 3300049578 Ga0501042_0529207 Ga0501042_0529207_254_637 119
1522 3300049579 Ga0501043_0238518 Ga0501043_0238518_211_594 119
1523 3300049580 Ga0501046_1027082 Ga0501046_1027082_11_394 119
1524 3300049582 Ga0501048_0038877 Ga0501048_0038877_1971_2354 119
1525 3300049582 Ga0501048_1375103 Ga0501048_1375103_77_460 119
1526 3300049584 Ga0501068_0233171 Ga0501068_0233171_135_518 119
1527 3300049587 Ga0501071_0111146 Ga0501071_0111146_356_739 119
1528 3300049587 Ga0501071_0620029 Ga0501071_0620029_12_395 119
1529 3300049588 Ga0501072_0133693 Ga0501072_0133693_1056_1439 119
1530 3300049588 Ga0501072_0167980 Ga0501072_0167980_500_883 119
1531 3300049589 Ga0501073_0407421 Ga0501073_0407421_421_804 119
1532 3300049590 Ga0501074_0880006 Ga0501074_0880006_20_403 119
1533 3300049591 Ga0501075_0054941 Ga0501075_0054941_2186_2569 119
1534 3300049591 Ga0501075_0595012 Ga0501075_0595012_185_568 119
1535 3300049592 Ga0501076_0033732 Ga0501076_0033732_2533_2916 119
1536 3300049592 Ga0501076_0284374 Ga0501076_0284374_822_1205 119
1537 3300049592 Ga0501076_0946884 Ga0501076_0946884_138_521 119
1538 3300049593 Ga0501077_0122826 Ga0501077_0122826_916_1299 119
1539 3300049741 Ga0501079_0011385 Ga0501079_0011385_3150_3533 119
1540 3300049742 Ga0501080_0008862 Ga0501080_0008862_2848_3231 119
1541 3300049742 Ga0501080_0665037 Ga0501080_0665037_182_565 119
1542 3300049743 Ga0501081_0025611 Ga0501081_0025611_1972_2355 119
1543 3300049744 Ga0501083_0258197 Ga0501083_0258197_717_1100 119
1544 3300049824 Ga0501045_0005861 Ga0501045_0005861_4991_5374 119
1545 3300049824 Ga0501045_0731929 Ga0501045_0731929_166_549 119
1546 3300050507 nmdc:mga05p37_749680_c1 nmdc:mga05p37_749680_c1_580_963 119
1547 3300050511 nmdc:mga08y16_462407_c1 nmdc:mga08y16_462407_c1_384_767 119
1548 3300050512 nmdc:mga0n895_487472_c1 nmdc:mga0n895_487472_c1_549_932 119
1549 3300050515 nmdc:mga0a205_389725_c1 nmdc:mga0a205_389725_c1_265_648 119
1550 3300053077 Ga0495601_0291029 Ga0495601_0291029_368_781 119
1551 3300054114 Ga0501084_0007825 Ga0501084_0007825_7212_7595 119
1552 3300054114 Ga0501084_0150328 Ga0501084_0150328_273_656 119
1553 3300059421 Ga0590071_000379 Ga0590071_000379_9772_10155 119
1554 3300059423 Ga0590074_004807 Ga0590074_004807_1416_1799 119
1555 3300059424 Ga0590075_005853 Ga0590075_005853_2307_2690 119
1556 3300059426 Ga0590077_001676 Ga0590077_001676_3256_3639 119
1557 3300060353 Ga0501082_0072005 Ga0501082_0072005_1837_2220 119
1558 3300061734 Ga0530510_0040894 Ga0530510_0040894_2365_2748 119
1559 3300061734 Ga0530510_1049876 Ga0530510_1049876_75_458 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

118

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9127 7 118
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.8954 4 119
2ka7-assembly1.cif.gz_A nmr solution structure of tm0212 at 40 c 0.8901 7 119
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.8851 7 117
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.8826 4 118
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9123 7 118 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8944 7 116 2.40.50.100
af_Q4DSF5_91_183_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8913 56 98 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8873 3 115 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8828 4 116 2.40.50.100
ID Description Score Start End GO Terms
AF-C7IY93-F1-model_v4 Glycine cleavage system H protein 0.9332 4 118 GO:0005739
GO:0005960
GO:0019464
AF-A0A0D9VCQ6-F1-model_v4 Lipoyl-binding domain-containing protein 0.9312 4 118 GO:0005739
GO:0005960
GO:0019464
AF-B8AII4-F1-model_v4 Lipoyl-binding domain-containing protein 0.9311 4 118 GO:0005739
GO:0005960
GO:0019464
AF-A0A0D9YMW3-F1-model_v4 Lipoyl-binding domain-containing protein 0.9297 4 118 GO:0005739
GO:0005960
GO:0010265
GO:0019464
AF-B9F398-F1-model_v4 Lipoyl-binding domain-containing protein 0.9295 4 118 GO:0005739
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
83.5 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map