F494783
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1563 | 584 | 3126 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0375240|Ga0395900_0375240_547_858 |
| Length | 103 |
| Sequence | MSLPGRPKGEHLQAQPEGAPVTVSIRYFASVREAVGQGSEAVQTRSETLGGLRDELIARGEPHASALARGKAVRMALDQVMSDESAALREGCEVAFFPPVTGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 24 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 25 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 101 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 115 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 131 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 233 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 234 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 235 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 236 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 237 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 238 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 239 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 240 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 241 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 242 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 243 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 247 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 265 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 266 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 267 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 268 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 269 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 270 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 271 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 272 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 273 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 274 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 282 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 283 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 284 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 285 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 286 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 287 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 288 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 289 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 290 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 291 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 292 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 293 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 294 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 295 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 296 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 297 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 298 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 299 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 300 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 301 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 302 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 303 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 304 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 305 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 306 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 307 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 308 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 309 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 310 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 311 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 312 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 313 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 314 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 315 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 316 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 317 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 318 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 319 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 320 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 321 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 322 | 3300044665 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC1E | Metagenome | Unclassified |
| 323 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 324 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 325 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 326 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 327 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 328 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 329 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 330 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 331 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 332 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 333 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 334 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 335 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 336 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 337 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 338 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 339 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 340 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 341 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 342 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 440 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 441 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 442 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 443 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 444 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 445 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 448 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 449 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 450 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 451 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 452 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 453 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 454 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 455 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 456 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 457 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 458 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 459 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 460 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 461 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 462 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 463 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 464 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 477 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 478 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 479 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 480 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 483 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 484 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 485 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 486 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 487 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 488 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 489 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 490 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 493 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 495 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 498 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 499 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 500 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 502 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 503 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 504 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 505 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 506 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 508 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 509 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 510 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 511 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 512 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 513 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 514 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 515 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 516 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 517 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 518 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 520 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 521 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 523 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 524 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 525 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 527 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 528 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 529 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 531 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 532 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 533 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 534 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 535 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 536 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 537 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 538 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 539 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 540 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 541 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 542 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 543 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 544 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 545 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 546 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 547 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 548 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 549 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 550 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 551 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 552 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 553 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 554 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 555 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 556 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 557 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 558 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 559 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 560 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 561 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 562 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 563 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 564 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 565 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 566 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 567 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 568 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 569 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 570 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 571 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 572 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 573 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 574 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 575 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 576 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 577 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 578 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 579 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 580 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 581 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 582 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 583 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 584 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.35 |
| Metatranscriptomes | 0.77 |
| Isolates | 2.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.46 |
| Nodule | 1.22 |
| Rhizoplane | 3.77 |
| Rhizosphere | 61.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0375240 | 3300037418 | Bacteria | 1391 |
| 2 | JGI24740J21852_10004178 | 3300001979 | Bacteria | 6235 |
| 3 | JGI24739J22299_10002177 | 3300001989 | Bacteria | 7516 |
| 4 | JGI24739J22299_10052521 | 3300001989 | Bacteria | 1311 |
| 5 | JGI24737J22298_10080653 | 3300001990 | Bacteria | 968 |
| 6 | JGI24737J22298_10134265 | 3300001990 | Bacteria | 731 |
| 7 | JGI24735J21928_10007831 | 3300002067 | Bacteria | 3472 |
| 8 | JGI24735J21928_10053098 | 3300002067 | Bacteria | 1169 |
| 9 | JGI24738J21930_10020114 | 3300002075 | Bacteria | 1388 |
| 10 | JGI25155J39150_1000074 | 3300002704 | Bacteria | 62438 |
| 11 | JGI25156J39149_1000002 | 3300002705 | Bacteria | 343501 |
| 12 | JGI25156J39149_1000832 | 3300002705 | Bacteria | 15585 |
| 13 | JGI25156J39149_1001354 | 3300002705 | Bacteria | 10510 |
| 14 | JGI25156J39149_1002530 | 3300002705 | Bacteria | 6504 |
| 15 | JGI25154J39366_1000010 | 3300002738 | Bacteria | 297985 |
| 16 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 17 | JGI25163J39215_1004817 | 3300002771 | Bacteria | 910 |
| 18 | JGI25152J39213_1004751 | 3300002773 | Bacteria | 4182 |
| 19 | JGI25152J39213_1018459 | 3300002773 | Bacteria | 1289 |
| 20 | JGI25150J39212_1001868 | 3300002774 | Bacteria | 5553 |
| 21 | JGI25159J45721_1000465 | 3300002987 | Bacteria | 18688 |
| 22 | JGI25159J45721_1005036 | 3300002987 | Bacteria | 4218 |
| 23 | JGI25159J45721_1008645 | 3300002987 | Bacteria | 2775 |
| 24 | JGI25159J45721_1010302 | 3300002987 | Bacteria | 2391 |
| 25 | JGI25151J46595_10004722 | 3300003187 | Bacteria | 7159 |
| 26 | JGI25151J46595_10007240 | 3300003187 | Bacteria | 5460 |
| 27 | JGI25151J46595_10011024 | 3300003187 | Bacteria | 4173 |
| 28 | JGI25151J46595_10025444 | 3300003187 | Bacteria | 2408 |
| 29 | JGI25151J46595_10048668 | 3300003187 | Bacteria | 1463 |
| 30 | JGI25151J46595_10055085 | 3300003187 | Bacteria | 1313 |
| 31 | JGI25151J46595_10055090 | 3300003187 | Bacteria | 1313 |
| 32 | JGI25151J46595_10095461 | 3300003187 | Bacteria | 815 |
| 33 | JGI25165J46597_1000122 | 3300003214 | Bacteria | 132559 |
| 34 | JGI25165J46597_1003773 | 3300003214 | Bacteria | 3562 |
| 35 | JGI25153J46596_10010535 | 3300003215 | Bacteria | 4173 |
| 36 | JGI25153J46596_10017438 | 3300003215 | Bacteria | 2829 |
| 37 | JGI25153J46596_10045306 | 3300003215 | Bacteria | 1313 |
| 38 | rootH1_10067293 | 3300003316 | Bacteria | 1590 |
| 39 | rootH2_10162484 | 3300003320 | Bacteria | 4537 |
| 40 | rootL2_10092707 | 3300003322 | Bacteria | 1589 |
| 41 | rootL2_10160743 | 3300003322 | Bacteria | 2000 |
| 42 | rootH1_10248647 | 3300003323 | Bacteria | 1572 |
| 43 | JGI25160J50197_1000192 | 3300003354 | Bacteria | 51376 |
| 44 | JGI25160J50197_1007623 | 3300003354 | Bacteria | 4218 |
| 45 | JGI25160J50197_1017692 | 3300003354 | Bacteria | 2248 |
| 46 | JGI25160J50197_1033752 | 3300003354 | Bacteria | 1282 |
| 47 | JGI25160J50197_1036495 | 3300003354 | Bacteria | 1191 |
| 48 | JGI25161J50226_1000043 | 3300003374 | Bacteria | 120741 |
| 49 | JGI25161J50226_1001441 | 3300003374 | Bacteria | 7147 |
| 50 | JGI25161J50226_1004787 | 3300003374 | Bacteria | 2769 |
| 51 | Ga0006562J51391_1157498 | 3300003578 | Bacteria | 4000 |
| 52 | Ga0006562J51391_1157500 | 3300003578 | Bacteria | 2940 |
| 53 | Ga0006562J51391_1170727 | 3300003578 | Bacteria | 2470 |
| 54 | Ga0006562J51391_1170728 | 3300003578 | Bacteria | 2250 |
| 55 | Ga0055538_1000048 | 3300003751 | Bacteria | 132559 |
| 56 | Ga0055539_1000070 | 3300003752 | Bacteria | 132559 |
| 57 | Ga0055533_1000078 | 3300003756 | Bacteria | 132559 |
| 58 | Ga0055533_1000217 | 3300003756 | Bacteria | 41969 |
| 59 | Ga0055533_1001154 | 3300003756 | Bacteria | 7476 |
| 60 | Ga0055532_1000027 | 3300003758 | Bacteria | 234571 |
| 61 | Ga0055532_1003249 | 3300003758 | Bacteria | 2883 |
| 62 | Ga0055525_1000106 | 3300003759 | Bacteria | 132559 |
| 63 | Ga0055527_1000019 | 3300003760 | Bacteria | 234571 |
| 64 | Ga0055527_1001078 | 3300003760 | Bacteria | 6431 |
| 65 | Ga0055535_1000021 | 3300003761 | Bacteria | 234571 |
| 66 | Ga0055535_1000392 | 3300003761 | Bacteria | 41361 |
| 67 | Ga0055535_1002465 | 3300003761 | Bacteria | 6431 |
| 68 | Ga0055542_1000032 | 3300003762 | Bacteria | 234571 |
| 69 | Ga0055542_1000033 | 3300003762 | Bacteria | 233997 |
| 70 | Ga0055542_1001104 | 3300003762 | Bacteria | 16252 |
| 71 | Ga0055529_1000038 | 3300003763 | Bacteria | 234571 |
| 72 | Ga0055529_1001039 | 3300003763 | Bacteria | 13080 |
| 73 | Ga0055526_1003998 | 3300003771 | Bacteria | 9074 |
| 74 | Ga0055526_1004562 | 3300003771 | Bacteria | 8269 |
| 75 | Ga0055526_1010656 | 3300003771 | Bacteria | 4248 |
| 76 | Ga0055526_1011784 | 3300003771 | Bacteria | 3889 |
| 77 | Ga0055526_1085415 | 3300003771 | Bacteria | 606 |
| 78 | Ga0055537_1000259 | 3300003773 | Bacteria | 38671 |
| 79 | Ga0055537_1001161 | 3300003773 | Bacteria | 11265 |
| 80 | Ga0055537_1004117 | 3300003773 | Bacteria | 4248 |
| 81 | Ga0055537_1004429 | 3300003773 | Bacteria | 4020 |
| 82 | Ga0055537_1012744 | 3300003773 | Bacteria | 1620 |
| 83 | Ga0055537_1012749 | 3300003773 | Bacteria | 1620 |
| 84 | Ga0055524_1000156 | 3300003775 | Bacteria | 79669 |
| 85 | Ga0055524_1008536 | 3300003775 | Bacteria | 4248 |
| 86 | Ga0055524_1009658 | 3300003775 | Bacteria | 3900 |
| 87 | Ga0055536_1000270 | 3300003781 | Bacteria | 39711 |
| 88 | Ga0055536_1003726 | 3300003781 | Bacteria | 8079 |
| 89 | Ga0055536_1008866 | 3300003781 | Bacteria | 4252 |
| 90 | Ga0055536_1009172 | 3300003781 | Bacteria | 4134 |
| 91 | Ga0055536_1072764 | 3300003781 | Bacteria | 673 |
| 92 | Ga0055536_1102973 | 3300003781 | Bacteria | 508 |
| 93 | Ga0055534_1001138 | 3300003784 | Bacteria | 11269 |
| 94 | Ga0055534_1004201 | 3300003784 | Bacteria | 4248 |
| 95 | Ga0055534_1005776 | 3300003784 | Bacteria | 3242 |
| 96 | Ga0055534_1006046 | 3300003784 | Bacteria | 3119 |
| 97 | Ga0055534_1016835 | 3300003784 | Bacteria | 1303 |
| 98 | Ga0055534_1018628 | 3300003784 | Bacteria | 1205 |
| 99 | Ga0055528_1002167 | 3300003790 | Bacteria | 10785 |
| 100 | Ga0055528_1008888 | 3300003790 | Bacteria | 4248 |
| 101 | Ga0055528_1012346 | 3300003790 | Bacteria | 3323 |
| 102 | Ga0055528_1012509 | 3300003790 | Bacteria | 3286 |
| 103 | Ga0055528_1027152 | 3300003790 | Bacteria | 1620 |
| 104 | Ga0055528_1027156 | 3300003790 | Bacteria | 1620 |
| 105 | Ga0055528_1042958 | 3300003790 | Bacteria | 988 |
| 106 | Ga0055530_10000408 | 3300003791 | Bacteria | 38218 |
| 107 | Ga0055530_10003951 | 3300003791 | Bacteria | 8020 |
| 108 | Ga0055530_10009348 | 3300003791 | Bacteria | 3781 |
| 109 | Ga0055530_10052631 | 3300003791 | Bacteria | 938 |
| 110 | Ga0055530_10066045 | 3300003791 | Bacteria | 793 |
| 111 | Ga0055540_1000033 | 3300003792 | Bacteria | 172048 |
| 112 | Ga0055540_1003778 | 3300003792 | Bacteria | 7139 |
| 113 | Ga0055540_1004106 | 3300003792 | Bacteria | 6743 |
| 114 | Ga0055540_1004580 | 3300003792 | Bacteria | 6150 |
| 115 | Ga0055540_1007340 | 3300003792 | Bacteria | 4183 |
| 116 | Ga0055540_1019358 | 3300003792 | Bacteria | 1835 |
| 117 | Ga0055531_10000273 | 3300003794 | Bacteria | 53570 |
| 118 | Ga0055531_10004865 | 3300003794 | Bacteria | 8006 |
| 119 | Ga0055531_10009016 | 3300003794 | Bacteria | 5158 |
| 120 | Ga0055531_10011825 | 3300003794 | Bacteria | 4166 |
| 121 | Ga0055531_10018627 | 3300003794 | Bacteria | 2857 |
| 122 | Ga0055541_1000050 | 3300003841 | Bacteria | 132559 |
| 123 | Ga0055543_1000127 | 3300004625 | Bacteria | 63245 |
| 124 | Ga0055543_1003299 | 3300004625 | Bacteria | 4843 |
| 125 | Ga0055543_1003796 | 3300004625 | Bacteria | 4300 |
| 126 | Ga0055543_1060930 | 3300004625 | Bacteria | 605 |
| 127 | Ga0065165_1009736 | 3300005262 | Bacteria | 4256 |
| 128 | Ga0065165_1018503 | 3300005262 | Bacteria | 2519 |
| 129 | Ga0065165_1021250 | 3300005262 | Bacteria | 2260 |
| 130 | Ga0065165_1024886 | 3300005262 | Bacteria | 2001 |
| 131 | Ga0065165_1025051 | 3300005262 | Bacteria | 1992 |
| 132 | Ga0065165_1034242 | 3300005262 | Bacteria | 1572 |
| 133 | Ga0065165_1040701 | 3300005262 | Bacteria | 1383 |
| 134 | Ga0065714_10090017 | 3300005288 | Bacteria | 1955 |
| 135 | Ga0065704_10193152 | 3300005289 | Bacteria | 1180 |
| 136 | Ga0070658_10706465 | 3300005327 | Bacteria | 875 |
| 137 | Ga0070658_11158888 | 3300005327 | Bacteria | 672 |
| 138 | Ga0070658_11689752 | 3300005327 | Bacteria | 548 |
| 139 | Ga0070676_10341599 | 3300005328 | Bacteria | 1027 |
| 140 | Ga0070690_101777161 | 3300005330 | Bacteria | 502 |
| 141 | Ga0070677_10179772 | 3300005333 | Bacteria | 1006 |
| 142 | Ga0070666_10137585 | 3300005335 | Bacteria | 1700 |
| 143 | Ga0070680_100154059 | 3300005336 | Bacteria | 1930 |
| 144 | Ga0070660_100063427 | 3300005339 | Bacteria | 2873 |
| 145 | Ga0070660_100168320 | 3300005339 | Bacteria | 1769 |
| 146 | Ga0070660_100595492 | 3300005339 | Bacteria | 924 |
| 147 | Ga0070661_100083243 | 3300005344 | Bacteria | 2363 |
| 148 | Ga0070661_100299590 | 3300005344 | Bacteria | 1251 |
| 149 | Ga0070661_100328250 | 3300005344 | Bacteria | 1196 |
| 150 | Ga0070661_101265712 | 3300005344 | Bacteria | 618 |
| 151 | Ga0070668_100235812 | 3300005347 | Bacteria | 1514 |
| 152 | Ga0070675_100168276 | 3300005354 | Bacteria | 1889 |
| 153 | Ga0070671_100012785 | 3300005355 | Bacteria | 6770 |
| 154 | Ga0070674_101416088 | 3300005356 | Bacteria | 623 |
| 155 | Ga0070674_102189676 | 3300005356 | Unclassified | 505 |
| 156 | Ga0070673_100233226 | 3300005364 | Bacteria | 1597 |
| 157 | Ga0070673_100434155 | 3300005364 | Bacteria | 1179 |
| 158 | Ga0070659_100018367 | 3300005366 | Bacteria | 5278 |
| 159 | Ga0070659_100218480 | 3300005366 | Bacteria | 1572 |
| 160 | Ga0070667_100040522 | 3300005367 | Bacteria | 3906 |
| 161 | Ga0070667_100231746 | 3300005367 | Bacteria | 1647 |
| 162 | Ga0070667_100503547 | 3300005367 | Bacteria | 1110 |
| 163 | Ga0070667_100907643 | 3300005367 | Bacteria | 820 |
| 164 | Ga0070714_100375116 | 3300005435 | Bacteria | 1340 |
| 165 | Ga0070714_101404219 | 3300005435 | Bacteria | 682 |
| 166 | Ga0070710_11007259 | 3300005437 | Bacteria | 607 |
| 167 | Ga0070710_11543109 | 3300005437 | Bacteria | 500 |
| 168 | Ga0070711_101616090 | 3300005439 | Bacteria | 567 |
| 169 | Ga0070663_100245416 | 3300005455 | Bacteria | 1415 |
| 170 | Ga0070678_100064383 | 3300005456 | Bacteria | 2717 |
| 171 | Ga0070678_100073147 | 3300005456 | Bacteria | 2572 |
| 172 | Ga0070678_100105961 | 3300005456 | Bacteria | 2190 |
| 173 | Ga0070678_100412401 | 3300005456 | Bacteria | 1176 |
| 174 | Ga0070678_100666988 | 3300005456 | Bacteria | 934 |
| 175 | Ga0070678_101195886 | 3300005456 | Bacteria | 705 |
| 176 | Ga0070662_100036495 | 3300005457 | Bacteria | 3477 |
| 177 | Ga0068867_100425325 | 3300005459 | Bacteria | 1126 |
| 178 | Ga0068867_101568078 | 3300005459 | Bacteria | 615 |
| 179 | Ga0070685_10270880 | 3300005466 | Bacteria | 1133 |
| 180 | Ga0070685_10826288 | 3300005466 | Bacteria | 685 |
| 181 | Ga0070707_100096851 | 3300005468 | Bacteria | 2858 |
| 182 | Ga0070698_100924580 | 3300005471 | Bacteria | 818 |
| 183 | Ga0070679_100430201 | 3300005530 | Bacteria | 1265 |
| 184 | Ga0070679_101451882 | 3300005530 | Bacteria | 632 |
| 185 | Ga0068853_100278882 | 3300005539 | Bacteria | 1541 |
| 186 | Ga0068853_100793031 | 3300005539 | Bacteria | 907 |
| 187 | Ga0068853_100839791 | 3300005539 | Bacteria | 881 |
| 188 | Ga0068853_101463820 | 3300005539 | Bacteria | 661 |
| 189 | Ga0070672_100366925 | 3300005543 | Bacteria | 1230 |
| 190 | Ga0070665_100066688 | 3300005548 | Bacteria | 3610 |
| 191 | Ga0070665_100821073 | 3300005548 | Bacteria | 943 |
| 192 | Ga0070665_101999792 | 3300005548 | Unclassified | 585 |
| 193 | Ga0070665_102491187 | 3300005548 | Bacteria | 519 |
| 194 | Ga0068855_100000737 | 3300005563 | Bacteria | 40209 |
| 195 | Ga0068855_100076757 | 3300005563 | Bacteria | 3876 |
| 196 | Ga0068855_100093546 | 3300005563 | Bacteria | 3466 |
| 197 | Ga0068855_100417759 | 3300005563 | Bacteria | 1467 |
| 198 | Ga0068855_101465270 | 3300005563 | Bacteria | 702 |
| 199 | Ga0068855_101933906 | 3300005563 | Bacteria | 597 |
| 200 | Ga0070664_100013869 | 3300005564 | Bacteria | 6570 |
| 201 | Ga0068857_100892206 | 3300005577 | Bacteria | 852 |
| 202 | Ga0068857_102126836 | 3300005577 | Bacteria | 551 |
| 203 | Ga0068854_101185487 | 3300005578 | Bacteria | 684 |
| 204 | Ga0068856_100841290 | 3300005614 | Bacteria | 937 |
| 205 | Ga0068852_101221107 | 3300005616 | Bacteria | 773 |
| 206 | Ga0068852_101542359 | 3300005616 | Bacteria | 687 |
| 207 | Ga0068866_10710379 | 3300005718 | Bacteria | 690 |
| 208 | Ga0068851_10007730 | 3300005834 | Bacteria | 4945 |
| 209 | Ga0068851_10577226 | 3300005834 | Bacteria | 682 |
| 210 | Ga0068863_101123379 | 3300005841 | Bacteria | 791 |
| 211 | Ga0068863_101418965 | 3300005841 | Bacteria | 702 |
| 212 | Ga0075365_10009476 | 3300006038 | Bacteria | 5600 |
| 213 | Ga0075365_10017566 | 3300006038 | Bacteria | 4379 |
| 214 | Ga0075365_10228304 | 3300006038 | Bacteria | 1306 |
| 215 | Ga0075365_10245891 | 3300006038 | Bacteria | 1256 |
| 216 | Ga0075365_10420339 | 3300006038 | Bacteria | 944 |
| 217 | Ga0075365_11203830 | 3300006038 | Bacteria | 533 |
| 218 | Ga0075368_10045821 | 3300006042 | Bacteria | 1728 |
| 219 | Ga0075368_10183590 | 3300006042 | Bacteria | 882 |
| 220 | Ga0075363_100052346 | 3300006048 | Bacteria | 2179 |
| 221 | Ga0075363_100072252 | 3300006048 | Bacteria | 1876 |
| 222 | Ga0075363_100115150 | 3300006048 | Bacteria | 1497 |
| 223 | Ga0075363_100183871 | 3300006048 | Bacteria | 1190 |
| 224 | Ga0075363_100959450 | 3300006048 | Bacteria | 525 |
| 225 | Ga0075363_100959451 | 3300006048 | Bacteria | 525 |
| 226 | Ga0075364_10025580 | 3300006051 | Bacteria | 3758 |
| 227 | Ga0075364_10468983 | 3300006051 | Bacteria | 860 |
| 228 | Ga0075364_11013112 | 3300006051 | Bacteria | 564 |
| 229 | Ga0075432_10006000 | 3300006058 | Bacteria | 4137 |
| 230 | Ga0075432_10007261 | 3300006058 | Bacteria | 3773 |
| 231 | Ga0075432_10056602 | 3300006058 | Bacteria | 1390 |
| 232 | Ga0075362_10003943 | 3300006177 | Bacteria | 5271 |
| 233 | Ga0075362_10014025 | 3300006177 | Bacteria | 3224 |
| 234 | Ga0075362_10067478 | 3300006177 | Bacteria | 1628 |
| 235 | Ga0075362_10122063 | 3300006177 | Bacteria | 1234 |
| 236 | Ga0075362_10137647 | 3300006177 | Bacteria | 1165 |
| 237 | Ga0075362_10140701 | 3300006177 | Bacteria | 1153 |
| 238 | Ga0075362_10201601 | 3300006177 | Bacteria | 968 |
| 239 | Ga0075362_10296782 | 3300006177 | Bacteria | 801 |
| 240 | Ga0075362_10321744 | 3300006177 | Bacteria | 770 |
| 241 | Ga0075362_10636868 | 3300006177 | Bacteria | 553 |
| 242 | Ga0075367_10183859 | 3300006178 | Bacteria | 1303 |
| 243 | Ga0075367_10333240 | 3300006178 | Bacteria | 957 |
| 244 | Ga0075369_10070632 | 3300006186 | Bacteria | 1536 |
| 245 | Ga0075369_10227473 | 3300006186 | Bacteria | 864 |
| 246 | Ga0075366_10032783 | 3300006195 | Bacteria | 3058 |
| 247 | Ga0075366_10113454 | 3300006195 | Bacteria | 1632 |
| 248 | Ga0075366_10185666 | 3300006195 | Bacteria | 1263 |
| 249 | Ga0075366_10194858 | 3300006195 | Bacteria | 1232 |
| 250 | Ga0075366_10270166 | 3300006195 | Bacteria | 1038 |
| 251 | Ga0075366_10754209 | 3300006195 | Bacteria | 605 |
| 252 | Ga0097621_100393880 | 3300006237 | Bacteria | 1239 |
| 253 | Ga0097621_100540092 | 3300006237 | Bacteria | 1060 |
| 254 | Ga0075370_10000322 | 3300006353 | Bacteria | 17253 |
| 255 | Ga0075370_10003243 | 3300006353 | Bacteria | 7702 |
| 256 | Ga0075370_10004735 | 3300006353 | Bacteria | 6651 |
| 257 | Ga0075370_10022587 | 3300006353 | Bacteria | 3456 |
| 258 | Ga0075370_10035851 | 3300006353 | Bacteria | 2785 |
| 259 | Ga0075370_10050403 | 3300006353 | Bacteria | 2361 |
| 260 | Ga0075370_10165389 | 3300006353 | Bacteria | 1299 |
| 261 | Ga0075370_10248670 | 3300006353 | Bacteria | 1054 |
| 262 | Ga0075431_101588388 | 3300006847 | Bacteria | 612 |
| 263 | Ga0075429_100553458 | 3300006880 | Bacteria | 1008 |
| 264 | Ga0068865_100841441 | 3300006881 | Bacteria | 794 |
| 265 | Ga0068865_101000971 | 3300006881 | Bacteria | 732 |
| 266 | Ga0068865_101704897 | 3300006881 | Bacteria | 568 |
| 267 | Ga0079104_1047926 | 3300006946 | Bacteria | 965 |
| 268 | Ga0099826_10008499 | 3300006948 | Bacteria | 7640 |
| 269 | Ga0099826_10342267 | 3300006948 | Bacteria | 747 |
| 270 | Ga0105251_10000134 | 3300009011 | Bacteria | 74820 |
| 271 | Ga0105251_10367650 | 3300009011 | Bacteria | 658 |
| 272 | Ga0105244_10003000 | 3300009036 | Bacteria | 12386 |
| 273 | Ga0105244_10520543 | 3300009036 | Bacteria | 548 |
| 274 | Ga0105240_10004043 | 3300009093 | Bacteria | 22563 |
| 275 | Ga0105240_10207199 | 3300009093 | Bacteria | 2294 |
| 276 | Ga0105240_10852164 | 3300009093 | Bacteria | 984 |
| 277 | Ga0105245_10238339 | 3300009098 | Bacteria | 1762 |
| 278 | Ga0105245_10497804 | 3300009098 | Bacteria | 1234 |
| 279 | Ga0105243_10003757 | 3300009148 | Bacteria | 12169 |
| 280 | Ga0105243_10009638 | 3300009148 | Bacteria | 7353 |
| 281 | Ga0105243_10022421 | 3300009148 | Bacteria | 4799 |
| 282 | Ga0105243_10879036 | 3300009148 | Bacteria | 890 |
| 283 | Ga0105241_10176388 | 3300009174 | Bacteria | 1769 |
| 284 | Ga0105242_11165371 | 3300009176 | Bacteria | 788 |
| 285 | Ga0105242_11692939 | 3300009176 | Bacteria | 668 |
| 286 | Ga0105248_10083825 | 3300009177 | Bacteria | 3586 |
| 287 | Ga0105248_11216745 | 3300009177 | Bacteria | 852 |
| 288 | Ga0105237_10141822 | 3300009545 | Bacteria | 2397 |
| 289 | Ga0105237_10453383 | 3300009545 | Bacteria | 1288 |
| 290 | Ga0105237_11374432 | 3300009545 | Bacteria | 712 |
| 291 | Ga0105237_11458129 | 3300009545 | Bacteria | 691 |
| 292 | Ga0105238_10095250 | 3300009551 | Bacteria | 2964 |
| 293 | Ga0105238_10398710 | 3300009551 | Bacteria | 1369 |
| 294 | Ga0105238_10436156 | 3300009551 | Bacteria | 1306 |
| 295 | Ga0105238_10472465 | 3300009551 | Bacteria | 1252 |
| 296 | Ga0105238_10697818 | 3300009551 | Bacteria | 1027 |
| 297 | Ga0105239_10070385 | 3300010375 | Bacteria | 3843 |
| 298 | Ga0105239_10248446 | 3300010375 | Bacteria | 1998 |
| 299 | Ga0105239_10881047 | 3300010375 | Bacteria | 1027 |
| 300 | Ga0105246_10035641 | 3300011119 | Bacteria | 3327 |
| 301 | Ga0105246_10120637 | 3300011119 | Bacteria | 1942 |
| 302 | Ga0157347_1003287 | 3300012502 | Bacteria | 1441 |
| 303 | Ga0157347_1019559 | 3300012502 | Bacteria | 783 |
| 304 | Ga0157326_1031246 | 3300012513 | Bacteria | 706 |
| 305 | Ga0157373_10023683 | 3300013100 | Bacteria | 4450 |
| 306 | Ga0157373_10507222 | 3300013100 | Bacteria | 872 |
| 307 | Ga0157373_10742706 | 3300013100 | Bacteria | 721 |
| 308 | Ga0157373_10775436 | 3300013100 | Bacteria | 706 |
| 309 | Ga0157371_10104204 | 3300013102 | Bacteria | 2013 |
| 310 | Ga0157370_10001130 | 3300013104 | Bacteria | 33346 |
| 311 | Ga0157370_10072460 | 3300013104 | Bacteria | 3250 |
| 312 | Ga0157370_10114119 | 3300013104 | Bacteria | 2524 |
| 313 | Ga0157370_10128583 | 3300013104 | Bacteria | 2364 |
| 314 | Ga0157370_10155730 | 3300013104 | Bacteria | 2126 |
| 315 | Ga0157370_10293566 | 3300013104 | Bacteria | 1501 |
| 316 | Ga0157370_10538982 | 3300013104 | Bacteria | 1070 |
| 317 | Ga0157370_11759732 | 3300013104 | Bacteria | 556 |
| 318 | Ga0157369_10001199 | 3300013105 | Bacteria | 32259 |
| 319 | Ga0157369_10012328 | 3300013105 | Bacteria | 9710 |
| 320 | Ga0157369_10055356 | 3300013105 | Bacteria | 4282 |
| 321 | Ga0157369_10165285 | 3300013105 | Bacteria | 2334 |
| 322 | Ga0157369_10217194 | 3300013105 | Bacteria | 2002 |
| 323 | Ga0157369_12354772 | 3300013105 | Bacteria | 540 |
| 324 | Ga0157378_12588545 | 3300013297 | Bacteria | 560 |
| 325 | Ga0163162_10080040 | 3300013306 | Bacteria | 3334 |
| 326 | Ga0163162_10436581 | 3300013306 | Bacteria | 1441 |
| 327 | Ga0163162_12834001 | 3300013306 | Bacteria | 558 |
| 328 | Ga0163162_13452651 | 3300013306 | Unclassified | 503 |
| 329 | Ga0157372_10233361 | 3300013307 | Bacteria | 2133 |
| 330 | Ga0157372_10329234 | 3300013307 | Bacteria | 1779 |
| 331 | Ga0157372_11489577 | 3300013307 | Bacteria | 780 |
| 332 | Ga0157375_10432526 | 3300013308 | Bacteria | 1482 |
| 333 | Ga0163163_10104437 | 3300014325 | Bacteria | 2859 |
| 334 | Ga0182008_10001340 | 3300014497 | Bacteria | 16780 |
| 335 | Ga0182008_10016053 | 3300014497 | Bacteria | 3897 |
| 336 | Ga0182008_10023775 | 3300014497 | Bacteria | 3124 |
| 337 | Ga0182008_10036324 | 3300014497 | Bacteria | 2465 |
| 338 | Ga0182008_10053246 | 3300014497 | Bacteria | 2004 |
| 339 | Ga0182008_10533825 | 3300014497 | Bacteria | 650 |
| 340 | Ga0182008_10713512 | 3300014497 | Bacteria | 574 |
| 341 | Ga0157376_11162427 | 3300014969 | Bacteria | 799 |
| 342 | Ga0157376_11165887 | 3300014969 | Bacteria | 798 |
| 343 | Ga0157376_12051813 | 3300014969 | Bacteria | 610 |
| 344 | Ga0182006_1001145 | 3300015261 | Bacteria | 16830 |
| 345 | Ga0182006_1094962 | 3300015261 | Bacteria | 1066 |
| 346 | Ga0182006_1134847 | 3300015261 | Bacteria | 847 |
| 347 | Ga0182006_1155318 | 3300015261 | Bacteria | 774 |
| 348 | Ga0182007_10000512 | 3300015262 | Bacteria | 22905 |
| 349 | Ga0182007_10008474 | 3300015262 | Bacteria | 4222 |
| 350 | Ga0182007_10021431 | 3300015262 | Bacteria | 2295 |
| 351 | Ga0182007_10034980 | 3300015262 | Bacteria | 1694 |
| 352 | Ga0182007_10173045 | 3300015262 | Bacteria | 743 |
| 353 | Ga0182005_1000637 | 3300015265 | Bacteria | 16681 |
| 354 | Ga0182005_1125498 | 3300015265 | Bacteria | 733 |
| 355 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 356 | Ga0183361_10013 | 3300016635 | Bacteria | 179680 |
| 357 | Ga0163161_10000166 | 3300017792 | Bacteria | 60327 |
| 358 | Ga0163161_10010657 | 3300017792 | Bacteria | 6365 |
| 359 | Ga0163161_10015236 | 3300017792 | Bacteria | 5357 |
| 360 | Ga0163161_10017854 | 3300017792 | Bacteria | 4971 |
| 361 | Ga0163161_10270716 | 3300017792 | Bacteria | 1329 |
| 362 | Ga0197907_11469637 | 3300020069 | Bacteria | 2058 |
| 363 | Ga0206356_10241440 | 3300020070 | Bacteria | 7318 |
| 364 | Ga0206349_1941556 | 3300020075 | Bacteria | 1012 |
| 365 | Ga0206350_10621348 | 3300020080 | Bacteria | 1667 |
| 366 | Ga0206354_10082792 | 3300020081 | Bacteria | 1824 |
| 367 | Ga0206353_10915309 | 3300020082 | Bacteria | 5391 |
| 368 | Ga0213872_10432679 | 3300021361 | Bacteria | 530 |
| 369 | Ga0224712_10000080 | 3300022467 | Bacteria | 15095 |
| 370 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 371 | Ga0209760_100758 | 3300025207 | Bacteria | 4642 |
| 372 | Ga0209436_103077 | 3300025208 | Bacteria | 4593 |
| 373 | Ga0209436_104293 | 3300025208 | Bacteria | 3548 |
| 374 | Ga0209436_107685 | 3300025208 | Bacteria | 2223 |
| 375 | Ga0209784_100062 | 3300025224 | Bacteria | 162240 |
| 376 | Ga0209566_100023 | 3300025225 | Bacteria | 396571 |
| 377 | Ga0209566_104089 | 3300025225 | Bacteria | 2061 |
| 378 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 379 | Ga0209674_100040 | 3300025226 | Bacteria | 396571 |
| 380 | Ga0209674_100103 | 3300025226 | Bacteria | 154966 |
| 381 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 382 | Ga0209672_100014 | 3300025228 | Bacteria | 546252 |
| 383 | Ga0209672_110041 | 3300025228 | Bacteria | 1300 |
| 384 | Ga0209672_113083 | 3300025228 | Bacteria | 1008 |
| 385 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 386 | Ga0209147_100087 | 3300025229 | Bacteria | 179835 |
| 387 | Ga0209563_100096 | 3300025230 | Bacteria | 162240 |
| 388 | Ga0209563_105329 | 3300025230 | Bacteria | 2346 |
| 389 | Ga0207427_100852 | 3300025231 | Bacteria | 13595 |
| 390 | Ga0207427_101800 | 3300025231 | Bacteria | 6880 |
| 391 | Ga0209437_100146 | 3300025233 | Bacteria | 162240 |
| 392 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 393 | Ga0209258_100040 | 3300025242 | Bacteria | 385401 |
| 394 | Ga0209258_100089 | 3300025242 | Bacteria | 234040 |
| 395 | Ga0207425_1000603 | 3300025245 | Bacteria | 20837 |
| 396 | Ga0207425_1001556 | 3300025245 | Bacteria | 9346 |
| 397 | Ga0207425_1003911 | 3300025245 | Bacteria | 4616 |
| 398 | Ga0207425_1010384 | 3300025245 | Bacteria | 2268 |
| 399 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 400 | Ga0209646_1014494 | 3300025246 | Bacteria | 1185 |
| 401 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 402 | Ga0209677_100058 | 3300025253 | Bacteria | 162240 |
| 403 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 404 | Ga0209148_1000035 | 3300025254 | Bacteria | 548413 |
| 405 | Ga0209148_1000097 | 3300025254 | Bacteria | 234049 |
| 406 | Ga0209148_1000553 | 3300025254 | Bacteria | 35527 |
| 407 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 408 | Ga0209759_1000188 | 3300025256 | Bacteria | 99987 |
| 409 | Ga0209759_1000284 | 3300025256 | Bacteria | 70505 |
| 410 | Ga0209759_1000519 | 3300025256 | Bacteria | 41644 |
| 411 | Ga0209129_1000071 | 3300025258 | Bacteria | 210729 |
| 412 | Ga0209129_1008455 | 3300025258 | Bacteria | 2861 |
| 413 | Ga0209129_1010324 | 3300025258 | Bacteria | 2343 |
| 414 | Ga0209129_1011881 | 3300025258 | Bacteria | 2046 |
| 415 | Ga0209129_1018181 | 3300025258 | Bacteria | 1357 |
| 416 | Ga0209129_1030174 | 3300025258 | Bacteria | 909 |
| 417 | Ga0209233_1000043 | 3300025261 | Bacteria | 509723 |
| 418 | Ga0209233_1000159 | 3300025261 | Bacteria | 162240 |
| 419 | Ga0209233_1068469 | 3300025261 | Bacteria | 664 |
| 420 | Ga0209565_1000120 | 3300025263 | Bacteria | 111458 |
| 421 | Ga0209565_1000326 | 3300025263 | Bacteria | 42448 |
| 422 | Ga0209565_1000774 | 3300025263 | Bacteria | 18648 |
| 423 | Ga0209565_1001593 | 3300025263 | Bacteria | 9641 |
| 424 | Ga0209565_1004359 | 3300025263 | Bacteria | 4322 |
| 425 | Ga0209565_1014786 | 3300025263 | Bacteria | 1780 |
| 426 | Ga0209565_1019567 | 3300025263 | Bacteria | 1444 |
| 427 | Ga0209565_1069613 | 3300025263 | Bacteria | 596 |
| 428 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 429 | Ga0209455_1000200 | 3300025272 | Bacteria | 87009 |
| 430 | Ga0209673_1000030 | 3300025273 | Bacteria | 351933 |
| 431 | Ga0209673_1000099 | 3300025273 | Bacteria | 193248 |
| 432 | Ga0209673_1000839 | 3300025273 | Bacteria | 40180 |
| 433 | Ga0209673_1001338 | 3300025273 | Bacteria | 24643 |
| 434 | Ga0209673_1009171 | 3300025273 | Bacteria | 4318 |
| 435 | Ga0209673_1011116 | 3300025273 | Bacteria | 3736 |
| 436 | Ga0209673_1019100 | 3300025273 | Bacteria | 2472 |
| 437 | Ga0209673_1056619 | 3300025273 | Bacteria | 1002 |
| 438 | Ga0209130_1000041 | 3300025284 | Bacteria | 261078 |
| 439 | Ga0209130_1000456 | 3300025284 | Bacteria | 43000 |
| 440 | Ga0209130_1000952 | 3300025284 | Bacteria | 22937 |
| 441 | Ga0209130_1001771 | 3300025284 | Bacteria | 12746 |
| 442 | Ga0209130_1003498 | 3300025284 | Bacteria | 6602 |
| 443 | Ga0209130_1034515 | 3300025284 | Bacteria | 1018 |
| 444 | Ga0209675_1000054 | 3300025291 | Bacteria | 193248 |
| 445 | Ga0209675_1000290 | 3300025291 | Bacteria | 47338 |
| 446 | Ga0209675_1001678 | 3300025291 | Bacteria | 12312 |
| 447 | Ga0209675_1003556 | 3300025291 | Bacteria | 7349 |
| 448 | Ga0209675_1007178 | 3300025291 | Bacteria | 4319 |
| 449 | Ga0209675_1007222 | 3300025291 | Bacteria | 4300 |
| 450 | Ga0209675_1013320 | 3300025291 | Bacteria | 2580 |
| 451 | Ga0209675_1025130 | 3300025291 | Bacteria | 1507 |
| 452 | Ga0209675_1068071 | 3300025291 | Bacteria | 685 |
| 453 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 454 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 455 | Ga0209676_1000260 | 3300025292 | Bacteria | 111683 |
| 456 | Ga0209676_1002320 | 3300025292 | Bacteria | 13793 |
| 457 | Ga0209676_1006861 | 3300025292 | Bacteria | 5513 |
| 458 | Ga0209676_1012219 | 3300025292 | Bacteria | 3396 |
| 459 | Ga0209676_1021448 | 3300025292 | Bacteria | 2169 |
| 460 | Ga0209676_1037652 | 3300025292 | Bacteria | 1393 |
| 461 | Ga0209676_1045732 | 3300025292 | Bacteria | 1189 |
| 462 | Ga0209676_1122175 | 3300025292 | Bacteria | 520 |
| 463 | Ga0209025_1001065 | 3300025294 | Bacteria | 39873 |
| 464 | Ga0209025_1001409 | 3300025294 | Bacteria | 31873 |
| 465 | Ga0209025_1001617 | 3300025294 | Bacteria | 28145 |
| 466 | Ga0209025_1005090 | 3300025294 | Bacteria | 10938 |
| 467 | Ga0209025_1010783 | 3300025294 | Bacteria | 6140 |
| 468 | Ga0209025_1013211 | 3300025294 | Bacteria | 5211 |
| 469 | Ga0209025_1014966 | 3300025294 | Bacteria | 4722 |
| 470 | Ga0209025_1017071 | 3300025294 | Bacteria | 4224 |
| 471 | Ga0209025_1023210 | 3300025294 | Bacteria | 3252 |
| 472 | Ga0209025_1029599 | 3300025294 | Bacteria | 2644 |
| 473 | Ga0209025_1032635 | 3300025294 | Bacteria | 2428 |
| 474 | Ga0209025_1070074 | 3300025294 | Bacteria | 1250 |
| 475 | Ga0209564_1000239 | 3300025295 | Bacteria | 119761 |
| 476 | Ga0209564_1000662 | 3300025295 | Bacteria | 50934 |
| 477 | Ga0209564_1000784 | 3300025295 | Bacteria | 44001 |
| 478 | Ga0209564_1000890 | 3300025295 | Bacteria | 39405 |
| 479 | Ga0209564_1008305 | 3300025295 | Bacteria | 5150 |
| 480 | Ga0209564_1050603 | 3300025295 | Bacteria | 1015 |
| 481 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 482 | Ga0209758_1010200 | 3300025297 | Bacteria | 5668 |
| 483 | Ga0209758_1024927 | 3300025297 | Bacteria | 2644 |
| 484 | Ga0209758_1054541 | 3300025297 | Bacteria | 1365 |
| 485 | Ga0209758_1058368 | 3300025297 | Bacteria | 1291 |
| 486 | Ga0209758_1097385 | 3300025297 | Bacteria | 845 |
| 487 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 488 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 489 | Ga0209050_1000954 | 3300025298 | Bacteria | 37580 |
| 490 | Ga0209050_1004569 | 3300025298 | Bacteria | 9285 |
| 491 | Ga0209050_1006735 | 3300025298 | Bacteria | 6709 |
| 492 | Ga0209050_1016241 | 3300025298 | Bacteria | 3060 |
| 493 | Ga0209050_1024718 | 3300025298 | Bacteria | 2067 |
| 494 | Ga0209050_1059225 | 3300025298 | Bacteria | 915 |
| 495 | Ga0209050_1096823 | 3300025298 | Bacteria | 592 |
| 496 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 497 | Ga0209256_1000081 | 3300025299 | Bacteria | 222908 |
| 498 | Ga0209256_1009348 | 3300025299 | Bacteria | 4319 |
| 499 | Ga0209256_1021256 | 3300025299 | Bacteria | 1999 |
| 500 | Ga0209256_1024404 | 3300025299 | Bacteria | 1781 |
| 501 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 502 | Ga0207426_1000061 | 3300025302 | Bacteria | 362507 |
| 503 | Ga0207426_1003593 | 3300025302 | Bacteria | 8238 |
| 504 | Ga0207426_1004649 | 3300025302 | Bacteria | 6602 |
| 505 | Ga0207426_1077340 | 3300025302 | Bacteria | 911 |
| 506 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 507 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 508 | Ga0209051_1000055 | 3300025303 | Bacteria | 277194 |
| 509 | Ga0209051_1000319 | 3300025303 | Bacteria | 72894 |
| 510 | Ga0209051_1000619 | 3300025303 | Bacteria | 40839 |
| 511 | Ga0209051_1005714 | 3300025303 | Bacteria | 7182 |
| 512 | Ga0209051_1019880 | 3300025303 | Bacteria | 2916 |
| 513 | Ga0209051_1050459 | 3300025303 | Bacteria | 1393 |
| 514 | Ga0209051_1085050 | 3300025303 | Bacteria | 899 |
| 515 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 516 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 517 | Ga0209257_1000873 | 3300025304 | Bacteria | 42738 |
| 518 | Ga0209257_1007556 | 3300025304 | Bacteria | 6522 |
| 519 | Ga0209257_1007934 | 3300025304 | Bacteria | 6227 |
| 520 | Ga0209257_1008583 | 3300025304 | Bacteria | 5754 |
| 521 | Ga0207656_10047010 | 3300025321 | Bacteria | 1854 |
| 522 | Ga0207655_1001368 | 3300025728 | Bacteria | 22829 |
| 523 | Ga0207713_1001542 | 3300025735 | Bacteria | 18104 |
| 524 | Ga0207642_10527042 | 3300025899 | Bacteria | 727 |
| 525 | Ga0207680_10441506 | 3300025903 | Bacteria | 923 |
| 526 | Ga0207647_10015129 | 3300025904 | Bacteria | 5300 |
| 527 | Ga0207647_10164889 | 3300025904 | Bacteria | 1292 |
| 528 | Ga0207647_10288894 | 3300025904 | Bacteria | 935 |
| 529 | Ga0207647_10763267 | 3300025904 | Bacteria | 523 |
| 530 | Ga0207645_10331383 | 3300025907 | Bacteria | 1017 |
| 531 | Ga0207643_11141600 | 3300025908 | Bacteria | 502 |
| 532 | Ga0207705_10162860 | 3300025909 | Bacteria | 1676 |
| 533 | Ga0207705_10221912 | 3300025909 | Bacteria | 1436 |
| 534 | Ga0207705_10528849 | 3300025909 | Bacteria | 916 |
| 535 | Ga0207705_11291761 | 3300025909 | Bacteria | 557 |
| 536 | Ga0207684_11260217 | 3300025910 | Bacteria | 610 |
| 537 | Ga0207707_10916240 | 3300025912 | Bacteria | 724 |
| 538 | Ga0207695_10125685 | 3300025913 | Bacteria | 2527 |
| 539 | Ga0207695_10190846 | 3300025913 | Bacteria | 1966 |
| 540 | Ga0207695_10635882 | 3300025913 | Bacteria | 948 |
| 541 | Ga0207695_11224963 | 3300025913 | Bacteria | 631 |
| 542 | Ga0207671_10090182 | 3300025914 | Bacteria | 2308 |
| 543 | Ga0207671_10393536 | 3300025914 | Bacteria | 1102 |
| 544 | Ga0207660_10038245 | 3300025917 | Bacteria | 3349 |
| 545 | Ga0207657_10229708 | 3300025919 | Bacteria | 1484 |
| 546 | Ga0207657_10321706 | 3300025919 | Bacteria | 1223 |
| 547 | Ga0207657_10488981 | 3300025919 | Bacteria | 964 |
| 548 | Ga0207649_10258561 | 3300025920 | Bacteria | 1257 |
| 549 | Ga0207652_10246622 | 3300025921 | Bacteria | 1610 |
| 550 | Ga0207652_10265241 | 3300025921 | Bacteria | 1549 |
| 551 | Ga0207681_10530770 | 3300025923 | Bacteria | 967 |
| 552 | Ga0207694_10197807 | 3300025924 | Bacteria | 1634 |
| 553 | Ga0207694_10347713 | 3300025924 | Bacteria | 1227 |
| 554 | Ga0207694_10440520 | 3300025924 | Bacteria | 1087 |
| 555 | Ga0207694_10857800 | 3300025924 | Bacteria | 767 |
| 556 | Ga0207650_11409626 | 3300025925 | Bacteria | 593 |
| 557 | Ga0207644_10022931 | 3300025931 | Bacteria | 4270 |
| 558 | Ga0207690_10014545 | 3300025932 | Bacteria | 4753 |
| 559 | Ga0207690_10184168 | 3300025932 | Bacteria | 1575 |
| 560 | Ga0207706_10017147 | 3300025933 | Bacteria | 6531 |
| 561 | Ga0207686_10149936 | 3300025934 | Bacteria | 1622 |
| 562 | Ga0207709_10000230 | 3300025935 | Bacteria | 70768 |
| 563 | Ga0207709_10002452 | 3300025935 | Bacteria | 11648 |
| 564 | Ga0207709_10005451 | 3300025935 | Bacteria | 7228 |
| 565 | Ga0207669_10489440 | 3300025937 | Bacteria | 982 |
| 566 | Ga0207704_11228917 | 3300025938 | Bacteria | 639 |
| 567 | Ga0207704_11918572 | 3300025938 | Bacteria | 509 |
| 568 | Ga0207691_10422459 | 3300025940 | Bacteria | 1136 |
| 569 | Ga0207711_10002819 | 3300025941 | Bacteria | 15267 |
| 570 | Ga0207711_10068904 | 3300025941 | Bacteria | 3065 |
| 571 | Ga0207711_10480700 | 3300025941 | Bacteria | 1157 |
| 572 | Ga0207689_11653182 | 3300025942 | Bacteria | 532 |
| 573 | Ga0207679_10008899 | 3300025945 | Bacteria | 6407 |
| 574 | Ga0207667_10000524 | 3300025949 | Bacteria | 50648 |
| 575 | Ga0207667_10061207 | 3300025949 | Bacteria | 3939 |
| 576 | Ga0207667_10710000 | 3300025949 | Bacteria | 1007 |
| 577 | Ga0207651_10346283 | 3300025960 | Bacteria | 1250 |
| 578 | Ga0207651_10421612 | 3300025960 | Bacteria | 1139 |
| 579 | Ga0207651_10546604 | 3300025960 | Bacteria | 1007 |
| 580 | Ga0207651_11306657 | 3300025960 | Bacteria | 652 |
| 581 | Ga0207712_12061780 | 3300025961 | Bacteria | 510 |
| 582 | Ga0207640_10842984 | 3300025981 | Bacteria | 797 |
| 583 | Ga0207658_10098455 | 3300025986 | Bacteria | 2285 |
| 584 | Ga0207658_10438015 | 3300025986 | Bacteria | 1155 |
| 585 | Ga0207658_10888663 | 3300025986 | Bacteria | 811 |
| 586 | Ga0207703_12046243 | 3300026035 | Bacteria | 549 |
| 587 | Ga0207639_10183989 | 3300026041 | Bacteria | 1779 |
| 588 | Ga0207639_10399927 | 3300026041 | Bacteria | 1237 |
| 589 | Ga0207639_10627406 | 3300026041 | Bacteria | 993 |
| 590 | Ga0207678_10410907 | 3300026067 | Bacteria | 1173 |
| 591 | Ga0207641_11070799 | 3300026088 | Bacteria | 804 |
| 592 | Ga0207641_11134785 | 3300026088 | Bacteria | 781 |
| 593 | Ga0207648_10442715 | 3300026089 | Bacteria | 1182 |
| 594 | Ga0207648_10603645 | 3300026089 | Bacteria | 1012 |
| 595 | Ga0207676_12084986 | 3300026095 | Bacteria | 566 |
| 596 | Ga0207676_12407124 | 3300026095 | Bacteria | 524 |
| 597 | Ga0207674_10901285 | 3300026116 | Bacteria | 852 |
| 598 | Ga0207675_101388449 | 3300026118 | Bacteria | 723 |
| 599 | Ga0207683_10070721 | 3300026121 | Bacteria | 3083 |
| 600 | Ga0207683_10078360 | 3300026121 | Bacteria | 2928 |
| 601 | Ga0207683_10873872 | 3300026121 | Bacteria | 835 |
| 602 | Ga0207683_10878083 | 3300026121 | Unclassified | 833 |
| 603 | Ga0207698_10817601 | 3300026142 | Bacteria | 935 |
| 604 | Ga0207698_12304859 | 3300026142 | Bacteria | 550 |
| 605 | Ga0209281_1030565 | 3300027111 | Bacteria | 966 |
| 606 | Ga0209371_1000267 | 3300027312 | Bacteria | 61088 |
| 607 | Ga0209371_1051233 | 3300027312 | Bacteria | 791 |
| 608 | Ga0209282_1000133 | 3300027666 | Bacteria | 44707 |
| 609 | Ga0209282_1403881 | 3300027666 | Bacteria | 535 |
| 610 | Ga0209813_10066296 | 3300027866 | Bacteria | 1164 |
| 611 | Ga0209813_10199242 | 3300027866 | Bacteria | 740 |
| 612 | Ga0209974_10002433 | 3300027876 | Bacteria | 6736 |
| 613 | Ga0207428_10223419 | 3300027907 | Bacteria | 1411 |
| 614 | Ga0207428_10406977 | 3300027907 | Bacteria | 996 |
| 615 | Ga0268266_10014251 | 3300028379 | Bacteria | 6837 |
| 616 | Ga0307517_10447730 | 3300028786 | Bacteria | 670 |
| 617 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 618 | Ga0307515_10001286 | 3300028794 | Bacteria | 56985 |
| 619 | Ga0265338_10000022 | 3300028800 | Bacteria | 308414 |
| 620 | Ga0268256_1000238 | 3300030500 | Bacteria | 57894 |
| 621 | Ga0268256_1057581 | 3300030500 | Bacteria | 791 |
| 622 | Ga0307512_10443111 | 3300030522 | Bacteria | 527 |
| 623 | Ga0316177_1041282 | 3300030731 | Bacteria | 765 |
| 624 | Ga0316177_1204318 | 3300030731 | Bacteria | 771 |
| 625 | Ga0316176_1023428 | 3300030732 | Bacteria | 1527 |
| 626 | Ga0314311_1134334 | 3300030733 | Bacteria | 4782 |
| 627 | Ga0316179_1116799 | 3300030734 | Bacteria | 921 |
| 628 | Ga0316178_1006481 | 3300030735 | Bacteria | 3873 |
| 629 | Ga0316180_1186828 | 3300030736 | Bacteria | 1216 |
| 630 | Ga0316183_1029454 | 3300030742 | Bacteria | 2323 |
| 631 | Ga0316181_1011855 | 3300030744 | Bacteria | 1460 |
| 632 | Ga0316181_1039412 | 3300030744 | Bacteria | 1238 |
| 633 | Ga0316182_1158883 | 3300030745 | Bacteria | 832 |
| 634 | Ga0316182_1159626 | 3300030745 | Bacteria | 1354 |
| 635 | Ga0265340_10046708 | 3300031247 | Bacteria | 2111 |
| 636 | Ga0265327_10002745 | 3300031251 | Bacteria | 17906 |
| 637 | Ga0265327_10003564 | 3300031251 | Bacteria | 14736 |
| 638 | Ga0307513_10000012 | 3300031456 | Bacteria | 328865 |
| 639 | Ga0307513_10000285 | 3300031456 | Bacteria | 73356 |
| 640 | Ga0307513_10080379 | 3300031456 | Bacteria | 3363 |
| 641 | Ga0307513_10097609 | 3300031456 | Bacteria | 2972 |
| 642 | Ga0307513_10977074 | 3300031456 | Bacteria | 556 |
| 643 | Ga0307513_11063927 | 3300031456 | Bacteria | 520 |
| 644 | Ga0307408_100022449 | 3300031548 | Bacteria | 4288 |
| 645 | Ga0307408_100144752 | 3300031548 | Bacteria | 1869 |
| 646 | Ga0307408_100287070 | 3300031548 | Bacteria | 1373 |
| 647 | Ga0307408_100306407 | 3300031548 | Bacteria | 1332 |
| 648 | Ga0307408_100339824 | 3300031548 | Bacteria | 1270 |
| 649 | Ga0307408_100344212 | 3300031548 | Bacteria | 1263 |
| 650 | Ga0307408_100389606 | 3300031548 | Bacteria | 1193 |
| 651 | Ga0307408_100422732 | 3300031548 | Bacteria | 1149 |
| 652 | Ga0307408_100575839 | 3300031548 | Bacteria | 997 |
| 653 | Ga0307408_100845409 | 3300031548 | Bacteria | 834 |
| 654 | Ga0307408_100922902 | 3300031548 | Bacteria | 800 |
| 655 | Ga0307408_101363430 | 3300031548 | Bacteria | 666 |
| 656 | Ga0307408_101538920 | 3300031548 | Bacteria | 630 |
| 657 | Ga0307514_10000319 | 3300031649 | Bacteria | 115327 |
| 658 | Ga0307514_10077326 | 3300031649 | Bacteria | 2476 |
| 659 | Ga0307516_10004265 | 3300031730 | Bacteria | 17778 |
| 660 | Ga0307516_10005283 | 3300031730 | Bacteria | 15538 |
| 661 | Ga0307516_10455501 | 3300031730 | Bacteria | 935 |
| 662 | Ga0307405_10091953 | 3300031731 | Bacteria | 2011 |
| 663 | Ga0307405_10152052 | 3300031731 | Bacteria | 1629 |
| 664 | Ga0307405_10166096 | 3300031731 | Bacteria | 1569 |
| 665 | Ga0307405_10796411 | 3300031731 | Bacteria | 791 |
| 666 | Ga0307405_10960008 | 3300031731 | Bacteria | 727 |
| 667 | Ga0307405_11057809 | 3300031731 | Bacteria | 695 |
| 668 | Ga0307405_11221953 | 3300031731 | Bacteria | 651 |
| 669 | Ga0307405_11310185 | 3300031731 | Bacteria | 630 |
| 670 | Ga0307405_11609000 | 3300031731 | Bacteria | 573 |
| 671 | Ga0307413_10989047 | 3300031824 | Bacteria | 720 |
| 672 | Ga0307413_11164686 | 3300031824 | Bacteria | 669 |
| 673 | Ga0307410_11495854 | 3300031852 | Bacteria | 595 |
| 674 | Ga0307406_10057413 | 3300031901 | Bacteria | 2496 |
| 675 | Ga0307406_10593293 | 3300031901 | Bacteria | 912 |
| 676 | Ga0307406_10842744 | 3300031901 | Bacteria | 777 |
| 677 | Ga0307406_11265238 | 3300031901 | Bacteria | 643 |
| 678 | Ga0307406_11510198 | 3300031901 | Bacteria | 591 |
| 679 | Ga0307406_11693511 | 3300031901 | Bacteria | 560 |
| 680 | Ga0307407_10471517 | 3300031903 | Bacteria | 915 |
| 681 | Ga0307407_11061265 | 3300031903 | Bacteria | 628 |
| 682 | Ga0307412_10000024 | 3300031911 | Bacteria | 235467 |
| 683 | Ga0307412_10022467 | 3300031911 | Bacteria | 3867 |
| 684 | Ga0307412_10035354 | 3300031911 | Bacteria | 3191 |
| 685 | Ga0307412_10045864 | 3300031911 | Bacteria | 2860 |
| 686 | Ga0307412_10189537 | 3300031911 | Bacteria | 1553 |
| 687 | Ga0307412_10641112 | 3300031911 | Bacteria | 905 |
| 688 | Ga0307412_10969697 | 3300031911 | Bacteria | 749 |
| 689 | Ga0307412_11369355 | 3300031911 | Bacteria | 639 |
| 690 | Ga0307412_11491952 | 3300031911 | Bacteria | 614 |
| 691 | Ga0307412_11539829 | 3300031911 | Bacteria | 605 |
| 692 | Ga0307412_11888259 | 3300031911 | Bacteria | 551 |
| 693 | Ga0307412_11984302 | 3300031911 | Bacteria | 538 |
| 694 | Ga0307412_12069128 | 3300031911 | Bacteria | 528 |
| 695 | Ga0307412_12255095 | 3300031911 | Bacteria | 507 |
| 696 | Ga0307409_102366496 | 3300031995 | Bacteria | 560 |
| 697 | Ga0307416_100089287 | 3300032002 | Bacteria | 2638 |
| 698 | Ga0307416_100755407 | 3300032002 | Bacteria | 1065 |
| 699 | Ga0307416_100903036 | 3300032002 | Bacteria | 983 |
| 700 | Ga0307416_102006290 | 3300032002 | Bacteria | 681 |
| 701 | Ga0307416_102419947 | 3300032002 | Bacteria | 624 |
| 702 | Ga0307416_102935774 | 3300032002 | Bacteria | 570 |
| 703 | Ga0307416_103070534 | 3300032002 | Bacteria | 559 |
| 704 | Ga0307414_10077611 | 3300032004 | Bacteria | 2418 |
| 705 | Ga0307414_10235109 | 3300032004 | Bacteria | 1513 |
| 706 | Ga0307414_10677726 | 3300032004 | Bacteria | 932 |
| 707 | Ga0307414_10701031 | 3300032004 | Bacteria | 916 |
| 708 | Ga0307414_11025195 | 3300032004 | Bacteria | 760 |
| 709 | Ga0307411_10194251 | 3300032005 | Bacteria | 1552 |
| 710 | Ga0307411_10298354 | 3300032005 | Bacteria | 1291 |
| 711 | Ga0307411_10624471 | 3300032005 | Bacteria | 929 |
| 712 | Ga0307411_10695041 | 3300032005 | Bacteria | 885 |
| 713 | Ga0307411_10701230 | 3300032005 | Bacteria | 882 |
| 714 | Ga0307411_10747772 | 3300032005 | Bacteria | 856 |
| 715 | Ga0307411_10871004 | 3300032005 | Bacteria | 798 |
| 716 | Ga0307411_10961341 | 3300032005 | Bacteria | 762 |
| 717 | Ga0307411_12063770 | 3300032005 | Bacteria | 533 |
| 718 | Ga0307411_12097333 | 3300032005 | Bacteria | 529 |
| 719 | Ga0307415_101845404 | 3300032126 | Bacteria | 586 |
| 720 | Ga0373952_0202494 | 3300035092 | Bacteria | 582 |
| 721 | Ga0395899_0000035 | 3300037312 | Bacteria | 295584 |
| 722 | Ga0395899_0002970 | 3300037312 | Bacteria | 13578 |
| 723 | Ga0395900_0000190 | 3300037418 | Bacteria | 98820 |
| 724 | Ga0395900_0001100 | 3300037418 | Bacteria | 34383 |
| 725 | Ga0395900_0044241 | 3300037418 | Bacteria | 4588 |
| 726 | Ga0395900_0185326 | 3300037418 | Bacteria | 2113 |
| 727 | Ga0395900_0834824 | 3300037418 | Bacteria | 848 |
| 728 | Ga0395898_0000199 | 3300037466 | Bacteria | 154631 |
| 729 | Ga0395898_0011627 | 3300037466 | Bacteria | 9135 |
| 730 | Ga0395898_0064652 | 3300037466 | Bacteria | 3548 |
| 731 | Ga0395905_0000041 | 3300037471 | Bacteria | 250958 |
| 732 | Ga0395905_0030123 | 3300037471 | Bacteria | 5114 |
| 733 | Ga0395905_0042337 | 3300037471 | Bacteria | 4273 |
| 734 | Ga0395905_0052258 | 3300037471 | Bacteria | 3825 |
| 735 | Ga0395905_0336351 | 3300037471 | Bacteria | 1401 |
| 736 | Ga0395905_0425313 | 3300037471 | Bacteria | 1224 |
| 737 | Ga0395905_0526805 | 3300037471 | Bacteria | 1082 |
| 738 | Ga0395901_0000062 | 3300038443 | Bacteria | 150171 |
| 739 | Ga0395901_0001105 | 3300038443 | Bacteria | 28682 |
| 740 | Ga0395901_0073845 | 3300038443 | Bacteria | 3557 |
| 741 | Ga0395901_0217320 | 3300038443 | Bacteria | 1998 |
| 742 | Ga0395901_0293677 | 3300038443 | Bacteria | 1686 |
| 743 | Ga0395901_0576659 | 3300038443 | Bacteria | 1137 |
| 744 | Ga0436360_0553837 | 3300039438 | Bacteria | 1495 |
| 745 | Ga0436361_0120393 | 3300039447 | Bacteria | 1104 |
| 746 | Ga0436361_0171963 | 3300039447 | Bacteria | 777 |
| 747 | Ga0436361_0355371 | 3300039447 | Bacteria | 1252 |
| 748 | Ga0439436_0001379 | 3300041404 | Bacteria | 7004 |
| 749 | Ga0439436_0046759 | 3300041404 | Bacteria | 1229 |
| 750 | Ga0439436_0095607 | 3300041404 | Bacteria | 828 |
| 751 | Ga0439436_0173445 | 3300041404 | Bacteria | 612 |
| 752 | Ga0439438_105692 | 3300041405 | Bacteria | 681 |
| 753 | Ga0439438_131656 | 3300041405 | Bacteria | 600 |
| 754 | Ga0439439_0005352 | 3300041406 | Bacteria | 2928 |
| 755 | Ga0439439_0077318 | 3300041406 | Bacteria | 897 |
| 756 | Ga0439439_0087749 | 3300041406 | Bacteria | 847 |
| 757 | Ga0439447_017937 | 3300041407 | Bacteria | 1919 |
| 758 | Ga0439447_056389 | 3300041407 | Bacteria | 930 |
| 759 | Ga0439447_069056 | 3300041407 | Bacteria | 823 |
| 760 | Ga0439453_0112318 | 3300041408 | Bacteria | 617 |
| 761 | Ga0439461_0007295 | 3300041410 | Bacteria | 1953 |
| 762 | Ga0439461_0039529 | 3300041410 | Bacteria | 1014 |
| 763 | Ga0439466_0002724 | 3300041411 | Bacteria | 6923 |
| 764 | Ga0439466_0029059 | 3300041411 | Bacteria | 1904 |
| 765 | Ga0439465_0000697 | 3300041413 | Bacteria | 10311 |
| 766 | Ga0439465_0158898 | 3300041413 | Bacteria | 810 |
| 767 | Ga0451791_0048952 | 3300041451 | Bacteria | 611 |
| 768 | Ga0451791_0161335 | 3300041451 | Bacteria | 524 |
| 769 | Ga0451791_0556048 | 3300041451 | Bacteria | 660 |
| 770 | Ga0451795_0737557 | 3300041456 | Bacteria | 659 |
| 771 | Ga0451798_0323142 | 3300041458 | Bacteria | 1102 |
| 772 | Ga0451798_0874703 | 3300041458 | Bacteria | 1715 |
| 773 | Ga0451800_1002931 | 3300041459 | Bacteria | 1095 |
| 774 | Ga0451802_0951491 | 3300041460 | Bacteria | 699 |
| 775 | Ga0451804_0177276 | 3300041463 | Bacteria | 1023 |
| 776 | Ga0451807_0702505 | 3300041486 | Bacteria | 1137 |
| 777 | Ga0451807_2769446 | 3300041486 | Bacteria | 799 |
| 778 | Ga0451837_0270258 | 3300041494 | Bacteria | 725 |
| 779 | Ga0451841_0605841 | 3300041498 | Bacteria | 730 |
| 780 | Ga0451853_0781326 | 3300041512 | Bacteria | 856 |
| 781 | Ga0451853_1406326 | 3300041512 | Bacteria | 1009 |
| 782 | Ga0439431_0000916 | 3300041997 | Bacteria | 6385 |
| 783 | Ga0439433_0000360 | 3300041999 | Bacteria | 8072 |
| 784 | Ga0439442_043551 | 3300042002 | Bacteria | 945 |
| 785 | Ga0439445_0000835 | 3300042004 | Bacteria | 6503 |
| 786 | Ga0439432_003052 | 3300042006 | Bacteria | 6232 |
| 787 | Ga0439432_041101 | 3300042006 | Bacteria | 1465 |
| 788 | Ga0439432_058874 | 3300042006 | Bacteria | 1187 |
| 789 | Ga0439432_095902 | 3300042006 | Bacteria | 890 |
| 790 | Ga0439449_0001800 | 3300042007 | Bacteria | 8435 |
| 791 | Ga0439449_0002084 | 3300042007 | Bacteria | 7861 |
| 792 | Ga0439449_0003898 | 3300042007 | Bacteria | 5783 |
| 793 | Ga0439449_0045493 | 3300042007 | Bacteria | 1626 |
| 794 | Ga0439449_0117015 | 3300042007 | Bacteria | 989 |
| 795 | Ga0439449_0129349 | 3300042007 | Bacteria | 938 |
| 796 | Ga0439452_005500 | 3300042010 | Bacteria | 4070 |
| 797 | Ga0439457_050696 | 3300042014 | Bacteria | 932 |
| 798 | Ga0439457_148692 | 3300042014 | Bacteria | 563 |
| 799 | Ga0439462_0010232 | 3300042015 | Bacteria | 2376 |
| 800 | Ga0439462_0012214 | 3300042015 | Bacteria | 2193 |
| 801 | Ga0439462_0016788 | 3300042015 | Bacteria | 1894 |
| 802 | Ga0439462_0043086 | 3300042015 | Bacteria | 1206 |
| 803 | Ga0450911_015379 | 3300042115 | Bacteria | 1014 |
| 804 | Ga0450923_007796 | 3300042125 | Bacteria | 1824 |
| 805 | Ga0450923_026232 | 3300042125 | Bacteria | 1166 |
| 806 | Ga0450890_017336 | 3300042127 | Bacteria | 958 |
| 807 | Ga0450897_002880 | 3300042128 | Bacteria | 1334 |
| 808 | Ga0450892_031216 | 3300042130 | Bacteria | 560 |
| 809 | Ga0450896_035602 | 3300042133 | Bacteria | 765 |
| 810 | Ga0450896_073046 | 3300042133 | Bacteria | 570 |
| 811 | Ga0450898_021840 | 3300042134 | Bacteria | 1130 |
| 812 | Ga0450898_024326 | 3300042134 | Bacteria | 1082 |
| 813 | Ga0450898_060237 | 3300042134 | Bacteria | 746 |
| 814 | Ga0450899_056040 | 3300042135 | Bacteria | 508 |
| 815 | Ga0450900_064598 | 3300042136 | Bacteria | 575 |
| 816 | Ga0450903_028032 | 3300042138 | Bacteria | 855 |
| 817 | Ga0450889_010034 | 3300042144 | Bacteria | 975 |
| 818 | Ga0450906_057370 | 3300042145 | Bacteria | 690 |
| 819 | Ga0450907_076734 | 3300042146 | Bacteria | 579 |
| 820 | Ga0450910_029232 | 3300042147 | Bacteria | 860 |
| 821 | Ga0439446_0030800 | 3300042156 | Bacteria | 1551 |
| 822 | Ga0439458_0208192 | 3300042157 | Bacteria | 536 |
| 823 | Ga0450908_027994 | 3300042184 | Bacteria | 982 |
| 824 | Ga0450908_029324 | 3300042184 | Bacteria | 957 |
| 825 | Ga0450909_018325 | 3300042185 | Bacteria | 1039 |
| 826 | Ga0450909_025797 | 3300042185 | Bacteria | 885 |
| 827 | Ga0439434_0006641 | 3300042435 | Bacteria | 3383 |
| 828 | Ga0439434_0015679 | 3300042435 | Bacteria | 2260 |
| 829 | Ga0439434_0239773 | 3300042435 | Bacteria | 618 |
| 830 | Ga0439435_0122893 | 3300042436 | Bacteria | 815 |
| 831 | Ga0439459_0126576 | 3300042438 | Bacteria | 649 |
| 832 | Ga0439464_0045092 | 3300042439 | Bacteria | 1264 |
| 833 | Ga0450916_071534 | 3300042530 | Bacteria | 580 |
| 834 | Ga0450918_008838 | 3300042531 | Bacteria | 1767 |
| 835 | Ga0450918_015446 | 3300042531 | Bacteria | 1327 |
| 836 | Ga0450893_0008574 | 3300042532 | Bacteria | 1664 |
| 837 | Ga0451577_0102644 | 3300042876 | Bacteria | 2555 |
| 838 | Ga0466969_0001061 | 3300044656 | Bacteria | 14838 |
| 839 | Ga0466969_0028559 | 3300044656 | Bacteria | 2851 |
| 840 | Ga0466969_0044262 | 3300044656 | Bacteria | 2215 |
| 841 | Ga0466969_0114007 | 3300044656 | Bacteria | 1263 |
| 842 | Ga0466969_0164122 | 3300044656 | Bacteria | 1020 |
| 843 | Ga0466972_0013487 | 3300044658 | Bacteria | 4103 |
| 844 | Ga0466972_0083032 | 3300044658 | Bacteria | 1524 |
| 845 | Ga0466973_0033105 | 3300044659 | Bacteria | 4926 |
| 846 | Ga0466987_0380323 | 3300044665 | Bacteria | 776 |
| 847 | Ga0466977_0003105 | 3300044666 | Bacteria | 7904 |
| 848 | Ga0466980_0377899 | 3300044668 | Bacteria | 810 |
| 849 | Ga0466978_0205280 | 3300044671 | Bacteria | 1172 |
| 850 | Ga0453683_0001701 | 3300044673 | Bacteria | 18336 |
| 851 | Ga0453683_0044583 | 3300044673 | Bacteria | 2782 |
| 852 | Ga0466965_0000058 | 3300044683 | Bacteria | 36392 |
| 853 | Ga0466965_0015986 | 3300044683 | Bacteria | 3565 |
| 854 | Ga0466965_0027458 | 3300044683 | Bacteria | 2764 |
| 855 | Ga0466965_0137171 | 3300044683 | Bacteria | 1272 |
| 856 | Ga0466965_0382410 | 3300044683 | Bacteria | 775 |
| 857 | Ga0466966_0000105 | 3300044684 | Bacteria | 51259 |
| 858 | Ga0466966_0002891 | 3300044684 | Bacteria | 11322 |
| 859 | Ga0466966_0003848 | 3300044684 | Bacteria | 9909 |
| 860 | Ga0466966_0145163 | 3300044684 | Bacteria | 1449 |
| 861 | Ga0466966_0169162 | 3300044684 | Bacteria | 1329 |
| 862 | Ga0466966_0505440 | 3300044684 | Bacteria | 727 |
| 863 | Ga0466961_0000830 | 3300044693 | Bacteria | 19308 |
| 864 | Ga0466961_0003527 | 3300044693 | Bacteria | 9755 |
| 865 | Ga0466961_0031401 | 3300044693 | Bacteria | 3414 |
| 866 | Ga0466961_0060402 | 3300044693 | Bacteria | 2410 |
| 867 | Ga0466961_0242885 | 3300044693 | Bacteria | 1107 |
| 868 | Ga0466961_0367344 | 3300044693 | Bacteria | 875 |
| 869 | Ga0466961_0473454 | 3300044693 | Bacteria | 757 |
| 870 | Ga0466963_0001295 | 3300044694 | Bacteria | 13287 |
| 871 | Ga0466963_0009593 | 3300044694 | Bacteria | 5833 |
| 872 | Ga0466963_0011977 | 3300044694 | Bacteria | 5297 |
| 873 | Ga0466964_0000916 | 3300044706 | Bacteria | 9690 |
| 874 | Ga0466964_0143271 | 3300044706 | Bacteria | 1101 |
| 875 | Ga0466964_0480707 | 3300044706 | Bacteria | 664 |
| 876 | Ga0453684_0186703 | 3300044712 | Bacteria | 2428 |
| 877 | Ga0466971_0000697 | 3300044719 | Bacteria | 13439 |
| 878 | Ga0466971_0014817 | 3300044719 | Bacteria | 3431 |
| 879 | Ga0466971_0164014 | 3300044719 | Bacteria | 1041 |
| 880 | Ga0466968_0015116 | 3300044735 | Bacteria | 3058 |
| 881 | Ga0466968_0134829 | 3300044735 | Bacteria | 1126 |
| 882 | Ga0466968_0528445 | 3300044735 | Bacteria | 590 |
| 883 | Ga0466970_0009409 | 3300044765 | Bacteria | 4939 |
| 884 | Ga0466970_0069899 | 3300044765 | Bacteria | 1887 |
| 885 | Ga0466970_0507568 | 3300044765 | Bacteria | 695 |
| 886 | Ga0466970_0969497 | 3300044765 | Bacteria | 501 |
| 887 | Ga0466957_0044912 | 3300044842 | Bacteria | 2678 |
| 888 | Ga0466957_0055259 | 3300044842 | Bacteria | 2426 |
| 889 | Ga0466957_0224488 | 3300044842 | Bacteria | 1241 |
| 890 | Ga0466957_0778328 | 3300044842 | Bacteria | 679 |
| 891 | Ga0466957_0799191 | 3300044842 | Bacteria | 670 |
| 892 | Ga0466960_0047904 | 3300044901 | Bacteria | 2052 |
| 893 | Ga0466960_0114997 | 3300044901 | Bacteria | 1402 |
| 894 | Ga0466960_0238987 | 3300044901 | Bacteria | 1005 |
| 895 | Ga0466959_0002991 | 3300045049 | Bacteria | 10920 |
| 896 | Ga0466959_0019940 | 3300045049 | Bacteria | 4936 |
| 897 | Ga0466959_0071272 | 3300045049 | Bacteria | 2516 |
| 898 | Ga0466959_0350891 | 3300045049 | Bacteria | 1006 |
| 899 | Ga0466959_0482242 | 3300045049 | Bacteria | 839 |
| 900 | Ga0466959_0601687 | 3300045049 | Bacteria | 739 |
| 901 | Ga0466959_0753550 | 3300045049 | Bacteria | 652 |
| 902 | Ga0466959_0823296 | 3300045049 | Bacteria | 620 |
| 903 | Ga0466959_1188036 | 3300045049 | Bacteria | 507 |
| 904 | Ga0451576_0003667 | 3300045051 | Bacteria | 20840 |
| 905 | Ga0451576_0039875 | 3300045051 | Bacteria | 4971 |
| 906 | Ga0451576_1623204 | 3300045051 | Bacteria | 670 |
| 907 | Ga0466958_0000397 | 3300045836 | Bacteria | 17823 |
| 908 | Ga0466958_0003121 | 3300045836 | Bacteria | 8519 |
| 909 | Ga0466958_0012111 | 3300045836 | Bacteria | 4876 |
| 910 | Ga0466958_0180950 | 3300045836 | Bacteria | 1337 |
| 911 | Ga0466958_1161891 | 3300045836 | Bacteria | 504 |
| 912 | Ga0466967_0700689 | 3300045976 | Bacteria | 1003 |
| 913 | Ga0495627_008497 | 3300046453 | Bacteria | 3845 |
| 914 | Ga0495627_048891 | 3300046453 | Bacteria | 1278 |
| 915 | Ga0495592_0008371 | 3300046454 | Bacteria | 7759 |
| 916 | Ga0495592_0015483 | 3300046454 | Bacteria | 5785 |
| 917 | Ga0495592_0024836 | 3300046454 | Bacteria | 4554 |
| 918 | Ga0495592_0029704 | 3300046454 | Bacteria | 4138 |
| 919 | Ga0495603_0014573 | 3300046455 | Bacteria | 4754 |
| 920 | Ga0495603_0014730 | 3300046455 | Bacteria | 4729 |
| 921 | Ga0495603_0018732 | 3300046455 | Bacteria | 4189 |
| 922 | Ga0495603_0459911 | 3300046455 | Bacteria | 729 |
| 923 | Ga0495603_0730520 | 3300046455 | Bacteria | 566 |
| 924 | Ga0495590_0003526 | 3300046457 | Bacteria | 6377 |
| 925 | Ga0495590_0014357 | 3300046457 | Bacteria | 2891 |
| 926 | Ga0495590_0114282 | 3300046457 | Bacteria | 965 |
| 927 | Ga0495591_006545 | 3300046458 | Bacteria | 5128 |
| 928 | Ga0495629_0000699 | 3300046459 | Bacteria | 27173 |
| 929 | Ga0495629_0004896 | 3300046459 | Bacteria | 10049 |
| 930 | Ga0495629_0007518 | 3300046459 | Bacteria | 8034 |
| 931 | Ga0495629_0014090 | 3300046459 | Bacteria | 5759 |
| 932 | Ga0495629_0161581 | 3300046459 | Bacteria | 1556 |
| 933 | Ga0495629_0293790 | 3300046459 | Bacteria | 1113 |
| 934 | Ga0495638_0020717 | 3300046460 | Bacteria | 4341 |
| 935 | Ga0495638_0025340 | 3300046460 | Bacteria | 3857 |
| 936 | Ga0495641_0018430 | 3300046461 | Bacteria | 3602 |
| 937 | Ga0495641_0032203 | 3300046461 | Bacteria | 2497 |
| 938 | Ga0495651_0010951 | 3300046462 | Bacteria | 6977 |
| 939 | Ga0495651_0035257 | 3300046462 | Bacteria | 3897 |
| 940 | Ga0495651_0096325 | 3300046462 | Bacteria | 2211 |
| 941 | Ga0495651_0367885 | 3300046462 | Bacteria | 946 |
| 942 | Ga0495651_0427811 | 3300046462 | Bacteria | 859 |
| 943 | Ga0495651_0454344 | 3300046462 | Bacteria | 827 |
| 944 | Ga0495651_0606477 | 3300046462 | Bacteria | 690 |
| 945 | Ga0495651_0649296 | 3300046462 | Bacteria | 661 |
| 946 | Ga0495653_0004371 | 3300046463 | Bacteria | 11421 |
| 947 | Ga0495653_0019073 | 3300046463 | Bacteria | 5564 |
| 948 | Ga0495653_0020344 | 3300046463 | Bacteria | 5381 |
| 949 | Ga0495653_0023382 | 3300046463 | Bacteria | 4994 |
| 950 | Ga0495653_0038116 | 3300046463 | Bacteria | 3773 |
| 951 | Ga0495653_0041534 | 3300046463 | Bacteria | 3589 |
| 952 | Ga0495653_0128482 | 3300046463 | Bacteria | 1797 |
| 953 | Ga0495650_0005860 | 3300046471 | Bacteria | 7822 |
| 954 | Ga0495650_0006791 | 3300046471 | Bacteria | 7061 |
| 955 | Ga0495650_0069930 | 3300046471 | Bacteria | 1380 |
| 956 | Ga0495650_0187419 | 3300046471 | Bacteria | 724 |
| 957 | Ga0495580_0005845 | 3300046472 | Bacteria | 10092 |
| 958 | Ga0495580_0015501 | 3300046472 | Bacteria | 5746 |
| 959 | Ga0495580_0019975 | 3300046472 | Bacteria | 4965 |
| 960 | Ga0495580_0035742 | 3300046472 | Bacteria | 3571 |
| 961 | Ga0495580_0039103 | 3300046472 | Bacteria | 3394 |
| 962 | Ga0495580_0046673 | 3300046472 | Bacteria | 3073 |
| 963 | Ga0495580_0313640 | 3300046472 | Bacteria | 1066 |
| 964 | Ga0495580_0642145 | 3300046472 | Bacteria | 698 |
| 965 | Ga0495580_0780620 | 3300046472 | Bacteria | 620 |
| 966 | Ga0495580_0935165 | 3300046472 | Bacteria | 555 |
| 967 | Ga0495582_0006818 | 3300046473 | Bacteria | 6355 |
| 968 | Ga0495582_0006929 | 3300046473 | Bacteria | 6302 |
| 969 | Ga0495582_0021021 | 3300046473 | Bacteria | 3574 |
| 970 | Ga0495605_0003385 | 3300046474 | Bacteria | 9515 |
| 971 | Ga0495605_0052863 | 3300046474 | Bacteria | 1972 |
| 972 | Ga0495605_0116674 | 3300046474 | Bacteria | 1213 |
| 973 | Ga0495605_0209240 | 3300046474 | Bacteria | 847 |
| 974 | Ga0495639_0007187 | 3300046475 | Bacteria | 4780 |
| 975 | Ga0495662_0030353 | 3300046476 | Bacteria | 2609 |
| 976 | Ga0495662_0033594 | 3300046476 | Bacteria | 2478 |
| 977 | Ga0495664_0001134 | 3300046477 | Bacteria | 13822 |
| 978 | Ga0495664_0032759 | 3300046477 | Bacteria | 3051 |
| 979 | Ga0495664_0137099 | 3300046477 | Bacteria | 1483 |
| 980 | Ga0495584_0381463 | 3300046491 | Bacteria | 716 |
| 981 | Ga0495584_0582433 | 3300046491 | Bacteria | 570 |
| 982 | Ga0495594_0066235 | 3300046499 | Bacteria | 2004 |
| 983 | Ga0495596_0087053 | 3300046500 | Bacteria | 1212 |
| 984 | Ga0495596_0132519 | 3300046500 | Bacteria | 967 |
| 985 | Ga0495596_0189257 | 3300046500 | Bacteria | 800 |
| 986 | Ga0495596_0240131 | 3300046500 | Bacteria | 703 |
| 987 | Ga0495596_0260129 | 3300046500 | Bacteria | 673 |
| 988 | Ga0495607_0195157 | 3300046501 | Bacteria | 1006 |
| 989 | Ga0495607_0428878 | 3300046501 | Bacteria | 597 |
| 990 | Ga0495583_0010369 | 3300046506 | Bacteria | 5440 |
| 991 | Ga0495583_0125616 | 3300046506 | Bacteria | 1076 |
| 992 | Ga0495606_0022364 | 3300046507 | Bacteria | 4608 |
| 993 | Ga0495606_0051212 | 3300046507 | Bacteria | 2694 |
| 994 | Ga0495606_0152487 | 3300046507 | Bacteria | 1355 |
| 995 | Ga0495606_0323529 | 3300046507 | Bacteria | 828 |
| 996 | Ga0495608_0000977 | 3300046511 | Bacteria | 20193 |
| 997 | Ga0495608_0002097 | 3300046511 | Bacteria | 14364 |
| 998 | Ga0495608_0006540 | 3300046511 | Bacteria | 8267 |
| 999 | Ga0495608_0200744 | 3300046511 | Bacteria | 1257 |
| 1000 | Ga0495610_0000715 | 3300046512 | Bacteria | 31576 |
| 1001 | Ga0495610_0018746 | 3300046512 | Bacteria | 3894 |
| 1002 | Ga0495616_0112983 | 3300046513 | Bacteria | 1260 |
| 1003 | Ga0495618_0002666 | 3300046514 | Bacteria | 11372 |
| 1004 | Ga0495618_0005178 | 3300046514 | Bacteria | 7969 |
| 1005 | Ga0495618_0252310 | 3300046514 | Bacteria | 1106 |
| 1006 | Ga0495618_0384772 | 3300046514 | Bacteria | 860 |
| 1007 | Ga0495620_0027211 | 3300046515 | Bacteria | 2678 |
| 1008 | Ga0495620_0053589 | 3300046515 | Bacteria | 1707 |
| 1009 | Ga0495620_0109892 | 3300046515 | Bacteria | 1093 |
| 1010 | Ga0495628_0001590 | 3300046516 | Bacteria | 20832 |
| 1011 | Ga0495628_0027909 | 3300046516 | Bacteria | 4589 |
| 1012 | Ga0495628_0062966 | 3300046516 | Bacteria | 2906 |
| 1013 | Ga0495628_0075213 | 3300046516 | Bacteria | 2630 |
| 1014 | Ga0495628_0264069 | 3300046516 | Bacteria | 1282 |
| 1015 | Ga0495628_0510859 | 3300046516 | Bacteria | 866 |
| 1016 | Ga0495628_0559908 | 3300046516 | Bacteria | 820 |
| 1017 | Ga0495628_1045263 | 3300046516 | Bacteria | 560 |
| 1018 | Ga0495630_0012575 | 3300046517 | Bacteria | 6151 |
| 1019 | Ga0495630_0040223 | 3300046517 | Bacteria | 3494 |
| 1020 | Ga0495630_0051980 | 3300046517 | Bacteria | 3067 |
| 1021 | Ga0495630_1039274 | 3300046517 | Bacteria | 622 |
| 1022 | Ga0495630_1126923 | 3300046517 | Bacteria | 594 |
| 1023 | Ga0495631_0004184 | 3300046518 | Bacteria | 7719 |
| 1024 | Ga0495632_0370925 | 3300046519 | Bacteria | 628 |
| 1025 | Ga0495637_0033627 | 3300046520 | Bacteria | 2250 |
| 1026 | Ga0495637_0059393 | 3300046520 | Bacteria | 1573 |
| 1027 | Ga0495637_0061714 | 3300046520 | Bacteria | 1536 |
| 1028 | Ga0495643_0069608 | 3300046522 | Bacteria | 1849 |
| 1029 | Ga0495643_0206400 | 3300046522 | Bacteria | 940 |
| 1030 | Ga0495644_0246061 | 3300046523 | Bacteria | 694 |
| 1031 | Ga0495644_0367726 | 3300046523 | Bacteria | 567 |
| 1032 | Ga0495648_0020262 | 3300046524 | Bacteria | 4643 |
| 1033 | Ga0495648_0037684 | 3300046524 | Bacteria | 3103 |
| 1034 | Ga0495648_0249495 | 3300046524 | Bacteria | 857 |
| 1035 | Ga0495648_0302585 | 3300046524 | Bacteria | 748 |
| 1036 | Ga0495663_0173443 | 3300046525 | Bacteria | 744 |
| 1037 | Ga0495666_0002472 | 3300046526 | Bacteria | 9180 |
| 1038 | Ga0495666_0016275 | 3300046526 | Bacteria | 3703 |
| 1039 | Ga0495666_0026285 | 3300046526 | Bacteria | 2870 |
| 1040 | Ga0495666_0117402 | 3300046526 | Bacteria | 1247 |
| 1041 | Ga0495666_0260108 | 3300046526 | Bacteria | 790 |
| 1042 | Ga0495666_0264378 | 3300046526 | Bacteria | 782 |
| 1043 | Ga0495642_0036207 | 3300046528 | Bacteria | 1994 |
| 1044 | Ga0495652_0009989 | 3300046529 | Bacteria | 8601 |
| 1045 | Ga0495652_0024538 | 3300046529 | Bacteria | 5336 |
| 1046 | Ga0495652_0045692 | 3300046529 | Bacteria | 3762 |
| 1047 | Ga0495652_0047731 | 3300046529 | Bacteria | 3671 |
| 1048 | Ga0495652_0280039 | 3300046529 | Bacteria | 1221 |
| 1049 | Ga0495652_0783465 | 3300046529 | Bacteria | 636 |
| 1050 | Ga0495654_0274783 | 3300046530 | Bacteria | 695 |
| 1051 | Ga0495654_0430366 | 3300046530 | Bacteria | 521 |
| 1052 | Ga0495665_0006454 | 3300046531 | Bacteria | 6332 |
| 1053 | Ga0495665_0026900 | 3300046531 | Bacteria | 3088 |
| 1054 | Ga0495665_0104699 | 3300046531 | Bacteria | 1484 |
| 1055 | Ga0495665_0303959 | 3300046531 | Bacteria | 816 |
| 1056 | Ga0495640_0000851 | 3300046533 | Bacteria | 23338 |
| 1057 | Ga0495640_0004804 | 3300046533 | Bacteria | 10758 |
| 1058 | Ga0495640_0016285 | 3300046533 | Bacteria | 5564 |
| 1059 | Ga0495640_0409452 | 3300046533 | Bacteria | 832 |
| 1060 | Ga0495586_0021076 | 3300046535 | Bacteria | 3473 |
| 1061 | Ga0495586_0038693 | 3300046535 | Bacteria | 2562 |
| 1062 | Ga0495586_0247494 | 3300046535 | Bacteria | 1017 |
| 1063 | Ga0495586_0554778 | 3300046535 | Bacteria | 663 |
| 1064 | Ga0495587_0000960 | 3300046536 | Bacteria | 18892 |
| 1065 | Ga0495587_0011859 | 3300046536 | Bacteria | 5509 |
| 1066 | Ga0495587_0361621 | 3300046536 | Bacteria | 808 |
| 1067 | Ga0495598_0148486 | 3300046537 | Bacteria | 816 |
| 1068 | Ga0495598_0163957 | 3300046537 | Bacteria | 784 |
| 1069 | Ga0495609_0222275 | 3300046538 | Bacteria | 784 |
| 1070 | Ga0495621_0005377 | 3300046539 | Bacteria | 3676 |
| 1071 | Ga0495621_0021528 | 3300046539 | Bacteria | 2126 |
| 1072 | Ga0495621_0095242 | 3300046539 | Bacteria | 1127 |
| 1073 | Ga0495621_0105052 | 3300046539 | Bacteria | 1078 |
| 1074 | Ga0495621_0154444 | 3300046539 | Bacteria | 904 |
| 1075 | Ga0495597_0054590 | 3300046542 | Bacteria | 1754 |
| 1076 | Ga0495597_0088918 | 3300046542 | Bacteria | 1313 |
| 1077 | Ga0495645_0015174 | 3300046543 | Bacteria | 5477 |
| 1078 | Ga0495645_0054506 | 3300046543 | Bacteria | 2905 |
| 1079 | Ga0495645_0169307 | 3300046543 | Bacteria | 1504 |
| 1080 | Ga0495645_0196372 | 3300046543 | Bacteria | 1372 |
| 1081 | Ga0495645_0585237 | 3300046543 | Bacteria | 688 |
| 1082 | Ga0495622_0000227 | 3300046557 | Bacteria | 44370 |
| 1083 | Ga0495622_0039221 | 3300046557 | Bacteria | 2205 |
| 1084 | Ga0495622_0196771 | 3300046557 | Bacteria | 899 |
| 1085 | Ga0495622_0219706 | 3300046557 | Bacteria | 842 |
| 1086 | Ga0495633_0299127 | 3300046558 | Bacteria | 731 |
| 1087 | Ga0495667_0056929 | 3300046559 | Bacteria | 2570 |
| 1088 | Ga0495667_0102806 | 3300046559 | Bacteria | 1848 |
| 1089 | Ga0495656_0003255 | 3300046615 | Bacteria | 5478 |
| 1090 | Ga0495656_0083694 | 3300046615 | Bacteria | 1445 |
| 1091 | Ga0495656_0578374 | 3300046615 | Bacteria | 600 |
| 1092 | Ga0495668_0111648 | 3300046616 | Bacteria | 1495 |
| 1093 | Ga0495668_0322559 | 3300046616 | Bacteria | 847 |
| 1094 | Ga0495634_0032070 | 3300046642 | Bacteria | 3615 |
| 1095 | Ga0495634_0085634 | 3300046642 | Bacteria | 2053 |
| 1096 | Ga0495634_0373293 | 3300046642 | Bacteria | 851 |
| 1097 | Ga0495634_0519592 | 3300046642 | Bacteria | 696 |
| 1098 | Ga0495611_0078845 | 3300046648 | Bacteria | 1512 |
| 1099 | Ga0495611_0282706 | 3300046648 | Bacteria | 766 |
| 1100 | Ga0495625_0000896 | 3300046660 | Bacteria | 40225 |
| 1101 | Ga0495625_0098277 | 3300046660 | Bacteria | 2014 |
| 1102 | Ga0495625_0195788 | 3300046660 | Bacteria | 1336 |
| 1103 | Ga0495625_0371481 | 3300046660 | Bacteria | 899 |
| 1104 | Ga0495625_0610611 | 3300046660 | Bacteria | 654 |
| 1105 | Ga0495635_0004478 | 3300046663 | Bacteria | 9677 |
| 1106 | Ga0495635_0102750 | 3300046663 | Bacteria | 1953 |
| 1107 | Ga0495635_0147442 | 3300046663 | Bacteria | 1602 |
| 1108 | Ga0495635_0356059 | 3300046663 | Bacteria | 976 |
| 1109 | Ga0495661_0003464 | 3300046665 | Bacteria | 11647 |
| 1110 | Ga0495661_0006964 | 3300046665 | Bacteria | 7904 |
| 1111 | Ga0495661_0021872 | 3300046665 | Bacteria | 4163 |
| 1112 | Ga0495588_0021438 | 3300046674 | Bacteria | 3183 |
| 1113 | Ga0495588_0056225 | 3300046674 | Bacteria | 2031 |
| 1114 | Ga0495588_0080144 | 3300046674 | Bacteria | 1704 |
| 1115 | Ga0495588_0150641 | 3300046674 | Bacteria | 1229 |
| 1116 | Ga0495657_0032871 | 3300046675 | Bacteria | 3616 |
| 1117 | Ga0495657_0101119 | 3300046675 | Bacteria | 1837 |
| 1118 | Ga0495657_0313682 | 3300046675 | Bacteria | 933 |
| 1119 | Ga0495657_0828138 | 3300046675 | Bacteria | 528 |
| 1120 | Ga0495599_0005836 | 3300046678 | Bacteria | 7394 |
| 1121 | Ga0495599_0006011 | 3300046678 | Bacteria | 7303 |
| 1122 | Ga0495599_0033983 | 3300046678 | Bacteria | 3205 |
| 1123 | Ga0495599_0142099 | 3300046678 | Bacteria | 1489 |
| 1124 | Ga0495599_0626782 | 3300046678 | Bacteria | 625 |
| 1125 | Ga0495599_0835747 | 3300046678 | Bacteria | 524 |
| 1126 | Ga0495623_0009259 | 3300046679 | Bacteria | 6393 |
| 1127 | Ga0495623_0009921 | 3300046679 | Bacteria | 6168 |
| 1128 | Ga0495623_0013984 | 3300046679 | Bacteria | 5199 |
| 1129 | Ga0495623_0027409 | 3300046679 | Bacteria | 3666 |
| 1130 | Ga0495623_0034735 | 3300046679 | Bacteria | 3233 |
| 1131 | Ga0495646_0006968 | 3300046680 | Bacteria | 7176 |
| 1132 | Ga0495646_0008406 | 3300046680 | Bacteria | 6557 |
| 1133 | Ga0495646_0012704 | 3300046680 | Bacteria | 5350 |
| 1134 | Ga0495646_0015901 | 3300046680 | Bacteria | 4776 |
| 1135 | Ga0495646_0019173 | 3300046680 | Bacteria | 4332 |
| 1136 | Ga0495646_0123552 | 3300046680 | Bacteria | 1463 |
| 1137 | Ga0495646_0278287 | 3300046680 | Bacteria | 890 |
| 1138 | Ga0495646_0477850 | 3300046680 | Bacteria | 641 |
| 1139 | Ga0495646_0689624 | 3300046680 | Bacteria | 514 |
| 1140 | Ga0495658_0377724 | 3300046683 | Bacteria | 902 |
| 1141 | Ga0495658_0556919 | 3300046683 | Bacteria | 734 |
| 1142 | Ga0495669_0071226 | 3300046684 | Bacteria | 1585 |
| 1143 | Ga0495669_0131520 | 3300046684 | Bacteria | 1178 |
| 1144 | Ga0495669_0326367 | 3300046684 | Bacteria | 741 |
| 1145 | Ga0495669_0403404 | 3300046684 | Bacteria | 663 |
| 1146 | Ga0495613_0000727 | 3300046689 | Bacteria | 25810 |
| 1147 | Ga0495613_0075915 | 3300046689 | Bacteria | 2446 |
| 1148 | Ga0495613_0095415 | 3300046689 | Bacteria | 2151 |
| 1149 | Ga0495613_0124829 | 3300046689 | Bacteria | 1847 |
| 1150 | Ga0495624_0002244 | 3300046690 | Bacteria | 14729 |
| 1151 | Ga0495624_0009113 | 3300046690 | Bacteria | 6882 |
| 1152 | Ga0495624_0015384 | 3300046690 | Bacteria | 5166 |
| 1153 | Ga0495624_0018007 | 3300046690 | Bacteria | 4730 |
| 1154 | Ga0495624_0020073 | 3300046690 | Bacteria | 4452 |
| 1155 | Ga0495624_0035525 | 3300046690 | Bacteria | 3217 |
| 1156 | Ga0495624_0434387 | 3300046690 | Bacteria | 787 |
| 1157 | Ga0495624_0643852 | 3300046690 | Bacteria | 631 |
| 1158 | Ga0495670_0477969 | 3300046691 | Bacteria | 676 |
| 1159 | Ga0495671_0009212 | 3300046692 | Bacteria | 5519 |
| 1160 | Ga0495671_0012054 | 3300046692 | Bacteria | 4727 |
| 1161 | Ga0495671_0144411 | 3300046692 | Bacteria | 1159 |
| 1162 | Ga0495671_0251807 | 3300046692 | Bacteria | 852 |
| 1163 | Ga0495649_0015513 | 3300046694 | Bacteria | 4335 |
| 1164 | Ga0495649_0053783 | 3300046694 | Bacteria | 2179 |
| 1165 | Ga0495649_0095199 | 3300046694 | Bacteria | 1585 |
| 1166 | Ga0495649_0121404 | 3300046694 | Bacteria | 1381 |
| 1167 | Ga0495649_0355832 | 3300046694 | Bacteria | 739 |
| 1168 | Ga0495589_0001853 | 3300046794 | Bacteria | 11990 |
| 1169 | Ga0495589_0082302 | 3300046794 | Bacteria | 1565 |
| 1170 | Ga0495589_0087777 | 3300046794 | Bacteria | 1510 |
| 1171 | Ga0495600_0000837 | 3300046809 | Bacteria | 16388 |
| 1172 | Ga0495600_0040137 | 3300046809 | Bacteria | 3048 |
| 1173 | Ga0495600_0108769 | 3300046809 | Bacteria | 1805 |
| 1174 | Ga0495600_0238148 | 3300046809 | Bacteria | 1160 |
| 1175 | Ga0495600_0300147 | 3300046809 | Bacteria | 1013 |
| 1176 | Ga0495660_0096851 | 3300046810 | Bacteria | 1524 |
| 1177 | Ga0495660_0207985 | 3300046810 | Bacteria | 930 |
| 1178 | Ga0495660_0455873 | 3300046810 | Bacteria | 552 |
| 1179 | Ga0495581_0000459 | 3300047315 | Bacteria | 20871 |
| 1180 | Ga0495581_0013072 | 3300047315 | Bacteria | 4812 |
| 1181 | Ga0495581_0237450 | 3300047315 | Bacteria | 1066 |
| 1182 | Ga0495604_0001208 | 3300047317 | Bacteria | 21323 |
| 1183 | Ga0495604_0017126 | 3300047317 | Bacteria | 5796 |
| 1184 | Ga0495604_0025084 | 3300047317 | Bacteria | 4753 |
| 1185 | Ga0495604_0063217 | 3300047317 | Bacteria | 2824 |
| 1186 | Ga0495604_0100869 | 3300047317 | Bacteria | 2121 |
| 1187 | Ga0495604_0229972 | 3300047317 | Bacteria | 1272 |
| 1188 | Ga0495604_0432499 | 3300047317 | Bacteria | 862 |
| 1189 | Ga0495604_0552236 | 3300047317 | Bacteria | 742 |
| 1190 | Ga0495604_0639677 | 3300047317 | Bacteria | 679 |
| 1191 | Ga0495674_0062259 | 3300047319 | Bacteria | 3249 |
| 1192 | Ga0495674_0086127 | 3300047319 | Bacteria | 2690 |
| 1193 | Ga0495674_0087641 | 3300047319 | Bacteria | 2664 |
| 1194 | Ga0495674_0107707 | 3300047319 | Bacteria | 2365 |
| 1195 | Ga0495674_0111436 | 3300047319 | Bacteria | 2319 |
| 1196 | Ga0495674_0171456 | 3300047319 | Bacteria | 1810 |
| 1197 | Ga0495674_0510485 | 3300047319 | Bacteria | 960 |
| 1198 | Ga0495672_0032972 | 3300047320 | Bacteria | 3214 |
| 1199 | Ga0495672_0060806 | 3300047320 | Bacteria | 2180 |
| 1200 | Ga0495672_0216212 | 3300047320 | Bacteria | 949 |
| 1201 | Ga0495672_0256739 | 3300047320 | Bacteria | 845 |
| 1202 | Ga0495672_0539221 | 3300047320 | Bacteria | 513 |
| 1203 | Ga0495676_0000690 | 3300047321 | Bacteria | 28135 |
| 1204 | Ga0495676_0010669 | 3300047321 | Bacteria | 8321 |
| 1205 | Ga0495676_0026895 | 3300047321 | Bacteria | 4942 |
| 1206 | Ga0495676_0297396 | 3300047321 | Bacteria | 1089 |
| 1207 | Ga0495676_0475453 | 3300047321 | Bacteria | 822 |
| 1208 | Ga0495676_0659560 | 3300047321 | Bacteria | 678 |
| 1209 | Ga0495676_0771182 | 3300047321 | Bacteria | 620 |
| 1210 | Ga0495680_0001210 | 3300047322 | Bacteria | 28304 |
| 1211 | Ga0495680_0005577 | 3300047322 | Bacteria | 11806 |
| 1212 | Ga0495680_0010573 | 3300047322 | Bacteria | 8231 |
| 1213 | Ga0495680_0021462 | 3300047322 | Bacteria | 5406 |
| 1214 | Ga0495680_0537162 | 3300047322 | Bacteria | 789 |
| 1215 | Ga0495683_0004492 | 3300047323 | Bacteria | 7903 |
| 1216 | Ga0495683_0008226 | 3300047323 | Bacteria | 5592 |
| 1217 | Ga0495683_0011154 | 3300047323 | Bacteria | 4736 |
| 1218 | Ga0495683_0033199 | 3300047323 | Bacteria | 2627 |
| 1219 | Ga0495683_0080549 | 3300047323 | Bacteria | 1588 |
| 1220 | Ga0495683_0087622 | 3300047323 | Bacteria | 1512 |
| 1221 | Ga0495683_0314224 | 3300047323 | Bacteria | 669 |
| 1222 | Ga0495687_025522 | 3300047443 | Bacteria | 2791 |
| 1223 | Ga0495687_027539 | 3300047443 | Bacteria | 2658 |
| 1224 | Ga0495687_078157 | 3300047443 | Bacteria | 1304 |
| 1225 | Ga0495687_098960 | 3300047443 | Bacteria | 1099 |
| 1226 | Ga0495675_0004622 | 3300047444 | Bacteria | 8359 |
| 1227 | Ga0495675_0006887 | 3300047444 | Bacteria | 6979 |
| 1228 | Ga0495675_0011293 | 3300047444 | Bacteria | 5604 |
| 1229 | Ga0495675_0088294 | 3300047444 | Bacteria | 1947 |
| 1230 | Ga0495675_0857074 | 3300047444 | Bacteria | 500 |
| 1231 | Ga0495677_0122407 | 3300047445 | Bacteria | 993 |
| 1232 | Ga0495677_0253758 | 3300047445 | Bacteria | 688 |
| 1233 | Ga0495677_0440598 | 3300047445 | Bacteria | 516 |
| 1234 | Ga0495679_000782 | 3300047446 | Bacteria | 20150 |
| 1235 | Ga0495679_001796 | 3300047446 | Bacteria | 11701 |
| 1236 | Ga0495679_009381 | 3300047446 | Bacteria | 3920 |
| 1237 | Ga0495679_048958 | 3300047446 | Bacteria | 1276 |
| 1238 | Ga0495673_0016174 | 3300047469 | Bacteria | 3821 |
| 1239 | Ga0495673_0026376 | 3300047469 | Bacteria | 2779 |
| 1240 | Ga0495673_0289396 | 3300047469 | Bacteria | 589 |
| 1241 | Ga0495681_0046925 | 3300047470 | Bacteria | 2057 |
| 1242 | Ga0495681_0191278 | 3300047470 | Bacteria | 835 |
| 1243 | Ga0495684_0019826 | 3300047471 | Bacteria | 5182 |
| 1244 | Ga0495686_0031854 | 3300047472 | Bacteria | 3416 |
| 1245 | Ga0495686_0033165 | 3300047472 | Bacteria | 3336 |
| 1246 | Ga0495593_0004404 | 3300047673 | Bacteria | 8370 |
| 1247 | Ga0495593_0026770 | 3300047673 | Bacteria | 3180 |
| 1248 | Ga0495593_0047170 | 3300047673 | Bacteria | 2292 |
| 1249 | Ga0495593_0065165 | 3300047673 | Bacteria | 1900 |
| 1250 | Ga0495593_0104860 | 3300047673 | Bacteria | 1447 |
| 1251 | Ga0495593_0120960 | 3300047673 | Bacteria | 1332 |
| 1252 | Ga0495602_0004187 | 3300048088 | Bacteria | 15010 |
| 1253 | Ga0495602_0006799 | 3300048088 | Bacteria | 12008 |
| 1254 | Ga0495602_0026312 | 3300048088 | Bacteria | 5613 |
| 1255 | Ga0495602_0066379 | 3300048088 | Bacteria | 3108 |
| 1256 | Ga0495602_0114076 | 3300048088 | Bacteria | 2189 |
| 1257 | Ga0495602_0125755 | 3300048088 | Bacteria | 2054 |
| 1258 | Ga0495602_0173576 | 3300048088 | Bacteria | 1670 |
| 1259 | Ga0495602_0238847 | 3300048088 | Bacteria | 1360 |
| 1260 | Ga0495602_0373330 | 3300048088 | Bacteria | 1023 |
| 1261 | Ga0495602_0551317 | 3300048088 | Bacteria | 799 |
| 1262 | Ga0495614_0003278 | 3300048089 | Bacteria | 7230 |
| 1263 | Ga0495614_0003316 | 3300048089 | Bacteria | 7200 |
| 1264 | Ga0495614_0008194 | 3300048089 | Bacteria | 4648 |
| 1265 | Ga0495614_0044355 | 3300048089 | Bacteria | 1907 |
| 1266 | Ga0495614_0197018 | 3300048089 | Bacteria | 910 |
| 1267 | Ga0495615_0287790 | 3300048090 | Bacteria | 529 |
| 1268 | Ga0495615_0290350 | 3300048090 | Bacteria | 527 |
| 1269 | Ga0495626_0021459 | 3300048091 | Bacteria | 3205 |
| 1270 | Ga0495626_0035111 | 3300048091 | Bacteria | 2394 |
| 1271 | Ga0496100_0007340 | 3300048903 | Bacteria | 6072 |
| 1272 | Ga0496101_0010034 | 3300048904 | Bacteria | 6239 |
| 1273 | Ga0496101_0031149 | 3300048904 | Bacteria | 3746 |
| 1274 | Ga0496101_0134927 | 3300048904 | Bacteria | 1877 |
| 1275 | Ga0496101_0470949 | 3300048904 | Bacteria | 992 |
| 1276 | Ga0496102_0027035 | 3300048905 | Bacteria | 5123 |
| 1277 | Ga0496102_0037838 | 3300048905 | Bacteria | 4353 |
| 1278 | Ga0496102_0105008 | 3300048905 | Bacteria | 2628 |
| 1279 | Ga0496102_0435824 | 3300048905 | Bacteria | 1230 |
| 1280 | Ga0496102_0503617 | 3300048905 | Bacteria | 1133 |
| 1281 | Ga0496102_0878975 | 3300048905 | Bacteria | 818 |
| 1282 | Ga0496102_1194916 | 3300048905 | Bacteria | 680 |
| 1283 | Ga0496103_0003901 | 3300048906 | Bacteria | 9069 |
| 1284 | Ga0496103_0011464 | 3300048906 | Bacteria | 5253 |
| 1285 | Ga0496103_0011709 | 3300048906 | Bacteria | 5203 |
| 1286 | Ga0496103_0108330 | 3300048906 | Bacteria | 1763 |
| 1287 | Ga0496103_0684404 | 3300048906 | Bacteria | 650 |
| 1288 | Ga0496104_0013570 | 3300048907 | Bacteria | 7343 |
| 1289 | Ga0496104_0020850 | 3300048907 | Bacteria | 6010 |
| 1290 | Ga0496104_0243519 | 3300048907 | Bacteria | 1710 |
| 1291 | Ga0496104_0666406 | 3300048907 | Unclassified | 949 |
| 1292 | Ga0496105_0003439 | 3300048908 | Bacteria | 11726 |
| 1293 | Ga0496105_0204184 | 3300048908 | Bacteria | 1612 |
| 1294 | Ga0496106_0000029 | 3300048909 | Bacteria | 141097 |
| 1295 | Ga0496106_0016044 | 3300048909 | Bacteria | 5538 |
| 1296 | Ga0496106_0128344 | 3300048909 | Bacteria | 1987 |
| 1297 | Ga0496107_0073245 | 3300048910 | Bacteria | 2491 |
| 1298 | Ga0496107_0176569 | 3300048910 | Bacteria | 1586 |
| 1299 | Ga0496107_0552325 | 3300048910 | Bacteria | 853 |
| 1300 | Ga0496107_0740350 | 3300048910 | Bacteria | 722 |
| 1301 | Ga0496108_0063024 | 3300048911 | Bacteria | 3122 |
| 1302 | Ga0496108_0154733 | 3300048911 | Bacteria | 1980 |
| 1303 | Ga0496108_1355200 | 3300048911 | Bacteria | 597 |
| 1304 | Ga0496109_0773107 | 3300048912 | Bacteria | 898 |
| 1305 | Ga0496109_1894690 | 3300048912 | Bacteria | 529 |
| 1306 | Ga0496110_0139448 | 3300048913 | Bacteria | 2192 |
| 1307 | Ga0496110_0201515 | 3300048913 | Bacteria | 1808 |
| 1308 | Ga0496110_0705675 | 3300048913 | Bacteria | 910 |
| 1309 | Ga0496111_0403099 | 3300048914 | Bacteria | 1010 |
| 1310 | Ga0496112_0052273 | 3300048915 | Bacteria | 4009 |
| 1311 | Ga0496112_0101870 | 3300048915 | Bacteria | 2841 |
| 1312 | Ga0496112_0936938 | 3300048915 | Bacteria | 787 |
| 1313 | Ga0496113_0020740 | 3300048916 | Bacteria | 4626 |
| 1314 | Ga0496114_0289103 | 3300048917 | Bacteria | 1446 |
| 1315 | Ga0496114_0391590 | 3300048917 | Bacteria | 1230 |
| 1316 | Ga0496115_0464063 | 3300048918 | Bacteria | 1021 |
| 1317 | Ga0496115_0486097 | 3300048918 | Bacteria | 994 |
| 1318 | Ga0496116_0011329 | 3300048919 | Bacteria | 7395 |
| 1319 | Ga0496116_0129945 | 3300048919 | Bacteria | 1438 |
| 1320 | Ga0496116_0130601 | 3300048919 | Bacteria | 1433 |
| 1321 | Ga0496116_0141146 | 3300048919 | Bacteria | 1355 |
| 1322 | Ga0496116_0176674 | 3300048919 | Bacteria | 1149 |
| 1323 | Ga0496116_0179001 | 3300048919 | Bacteria | 1138 |
| 1324 | Ga0496116_0417694 | 3300048919 | Bacteria | 587 |
| 1325 | Ga0496117_0024726 | 3300048920 | Bacteria | 4738 |
| 1326 | Ga0496117_0028598 | 3300048920 | Bacteria | 4315 |
| 1327 | Ga0496117_0048496 | 3300048920 | Bacteria | 3033 |
| 1328 | Ga0496117_0097767 | 3300048920 | Bacteria | 1868 |
| 1329 | Ga0496117_0119509 | 3300048920 | Bacteria | 1622 |
| 1330 | Ga0496117_0174184 | 3300048920 | Bacteria | 1245 |
| 1331 | Ga0496117_0212771 | 3300048920 | Bacteria | 1082 |
| 1332 | Ga0496117_0230533 | 3300048920 | Bacteria | 1024 |
| 1333 | Ga0496117_0373914 | 3300048920 | Bacteria | 728 |
| 1334 | Ga0496118_0003596 | 3300048921 | Bacteria | 19293 |
| 1335 | Ga0496118_0004215 | 3300048921 | Bacteria | 17260 |
| 1336 | Ga0496118_0010125 | 3300048921 | Bacteria | 9371 |
| 1337 | Ga0496118_0010300 | 3300048921 | Bacteria | 9272 |
| 1338 | Ga0496118_0023632 | 3300048921 | Bacteria | 5331 |
| 1339 | Ga0496118_0030038 | 3300048921 | Bacteria | 4545 |
| 1340 | Ga0496118_0103671 | 3300048921 | Bacteria | 1912 |
| 1341 | Ga0496118_0254597 | 3300048921 | Bacteria | 995 |
| 1342 | Ga0496118_0372407 | 3300048921 | Bacteria | 753 |
| 1343 | Ga0496118_0452901 | 3300048921 | Bacteria | 651 |
| 1344 | Ga0496119_0060099 | 3300048922 | Bacteria | 2278 |
| 1345 | Ga0496120_0086576 | 3300048923 | Bacteria | 1684 |
| 1346 | Ga0496120_0314958 | 3300048923 | Bacteria | 713 |
| 1347 | Ga0496121_0017765 | 3300048924 | Bacteria | 7232 |
| 1348 | Ga0496121_0033036 | 3300048924 | Bacteria | 4691 |
| 1349 | Ga0496121_0052767 | 3300048924 | Bacteria | 3410 |
| 1350 | Ga0496121_0055271 | 3300048924 | Bacteria | 3309 |
| 1351 | Ga0496121_0066491 | 3300048924 | Bacteria | 2927 |
| 1352 | Ga0496121_0070584 | 3300048924 | Bacteria | 2813 |
| 1353 | Ga0496121_0195498 | 3300048924 | Bacteria | 1446 |
| 1354 | Ga0496121_0276966 | 3300048924 | Bacteria | 1150 |
| 1355 | Ga0496121_0637886 | 3300048924 | Bacteria | 651 |
| 1356 | Ga0496122_0064753 | 3300048925 | Bacteria | 2657 |
| 1357 | Ga0496122_0191029 | 3300048925 | Bacteria | 1209 |
| 1358 | Ga0496122_0446430 | 3300048925 | Bacteria | 643 |
| 1359 | Ga0496122_0556998 | 3300048925 | Bacteria | 545 |
| 1360 | Ga0496123_0049882 | 3300048926 | Bacteria | 2802 |
| 1361 | Ga0496123_0053888 | 3300048926 | Bacteria | 2654 |
| 1362 | Ga0496123_0170044 | 3300048926 | Bacteria | 1151 |
| 1363 | Ga0496123_0272488 | 3300048926 | Bacteria | 823 |
| 1364 | Ga0496124_0108059 | 3300048927 | Bacteria | 2244 |
| 1365 | Ga0496124_0145910 | 3300048927 | Bacteria | 1862 |
| 1366 | Ga0496124_0162783 | 3300048927 | Bacteria | 1737 |
| 1367 | Ga0496124_0253740 | 3300048927 | Bacteria | 1299 |
| 1368 | Ga0496124_0253926 | 3300048927 | Bacteria | 1298 |
| 1369 | Ga0496125_0020173 | 3300048928 | Bacteria | 6264 |
| 1370 | Ga0496125_0035025 | 3300048928 | Bacteria | 4414 |
| 1371 | Ga0496125_0399100 | 3300048928 | Bacteria | 804 |
| 1372 | Ga0496125_0663273 | 3300048928 | Bacteria | 559 |
| 1373 | Ga0496125_0731488 | 3300048928 | Bacteria | 521 |
| 1374 | Ga0496126_0000192 | 3300048929 | Bacteria | 136536 |
| 1375 | Ga0496126_0015457 | 3300048929 | Bacteria | 7676 |
| 1376 | Ga0496126_0019787 | 3300048929 | Bacteria | 6623 |
| 1377 | Ga0501310_073528 | 3300049130 | Bacteria | 527 |
| 1378 | Ga0495678_019117 | 3300049459 | Bacteria | 3065 |
| 1379 | Ga0495678_040459 | 3300049459 | Bacteria | 1874 |
| 1380 | Ga0495682_0043650 | 3300049460 | Bacteria | 1641 |
| 1381 | Ga0495682_0051269 | 3300049460 | Bacteria | 1501 |
| 1382 | Ga0495682_0065984 | 3300049460 | Bacteria | 1305 |
| 1383 | Ga0495682_0184191 | 3300049460 | Bacteria | 742 |
| 1384 | Ga0501031_0130976 | 3300049568 | Bacteria | 1639 |
| 1385 | Ga0501032_0214316 | 3300049569 | Bacteria | 1255 |
| 1386 | Ga0501032_0332404 | 3300049569 | Bacteria | 980 |
| 1387 | Ga0501034_0965199 | 3300049571 | Bacteria | 737 |
| 1388 | Ga0501036_0067942 | 3300049572 | Bacteria | 3016 |
| 1389 | Ga0501037_0375569 | 3300049573 | Bacteria | 978 |
| 1390 | Ga0501043_0141444 | 3300049579 | Bacteria | 1884 |
| 1391 | Ga0501043_0546238 | 3300049579 | Bacteria | 861 |
| 1392 | Ga0501046_0388601 | 3300049580 | Bacteria | 1009 |
| 1393 | Ga0501046_0573466 | 3300049580 | Bacteria | 803 |
| 1394 | Ga0501047_0048109 | 3300049581 | Bacteria | 4119 |
| 1395 | Ga0501047_0787930 | 3300049581 | Bacteria | 766 |
| 1396 | Ga0501047_0875914 | 3300049581 | Bacteria | 712 |
| 1397 | Ga0501048_0923800 | 3300049582 | Bacteria | 628 |
| 1398 | Ga0501249_011563 | 3300049679 | Bacteria | 1855 |
| 1399 | Ga0501225_0090908 | 3300049705 | Bacteria | 884 |
| 1400 | Ga0501262_000153 | 3300049759 | Bacteria | 8442 |
| 1401 | Ga0501266_006089 | 3300049763 | Bacteria | 1500 |
| 1402 | Ga0501035_0590911 | 3300049822 | Bacteria | 906 |
| 1403 | Ga0501044_0127969 | 3300049823 | Bacteria | 2536 |
| 1404 | Ga0501044_0154548 | 3300049823 | Bacteria | 2274 |
| 1405 | Ga0501044_0344799 | 3300049823 | Bacteria | 1410 |
| 1406 | Ga0501044_0457318 | 3300049823 | Bacteria | 1182 |
| 1407 | Ga0501044_0615653 | 3300049823 | Bacteria | 978 |
| 1408 | Ga0501044_1323512 | 3300049823 | Bacteria | 587 |
| 1409 | Ga0501044_1448993 | 3300049823 | Bacteria | 552 |
| 1410 | nmdc:mga03683_10250_c1 | 3300050489 | Bacteria | 3358 |
| 1411 | nmdc:mga03683_122491_c1 | 3300050489 | Bacteria | 1157 |
| 1412 | nmdc:mga03683_132698_c1 | 3300050489 | Bacteria | 1115 |
| 1413 | nmdc:mga03683_134288_c1 | 3300050489 | Bacteria | 1109 |
| 1414 | nmdc:mga03683_55542_c1 | 3300050489 | Bacteria | 1663 |
| 1415 | nmdc:mga03683_571549_c1 | 3300050489 | Bacteria | 552 |
| 1416 | nmdc:mga03683_7155_c1 | 3300050489 | Bacteria | 3860 |
| 1417 | nmdc:mga03n38_195531_c1 | 3300050490 | Bacteria | 1044 |
| 1418 | nmdc:mga03n38_48437_c1 | 3300050490 | Bacteria | 1885 |
| 1419 | nmdc:mga03n38_574910_c1 | 3300050490 | Bacteria | 640 |
| 1420 | nmdc:mga03n38_728230_c1 | 3300050490 | Bacteria | 573 |
| 1421 | nmdc:mga00v17_120674_c1 | 3300050491 | Bacteria | 1669 |
| 1422 | nmdc:mga00v17_21047_c1 | 3300050491 | Bacteria | 1139 |
| 1423 | nmdc:mga00v17_485302_c1 | 3300050491 | Bacteria | 801 |
| 1424 | nmdc:mga00v17_78656_c1 | 3300050491 | Bacteria | 2055 |
| 1425 | nmdc:mga00v17_869000_c1 | 3300050491 | Bacteria | 572 |
| 1426 | nmdc:mga00v17_964515_c1 | 3300050491 | Bacteria | 538 |
| 1427 | nmdc:mga0yw44_20195_c1 | 3300050492 | Bacteria | 3691 |
| 1428 | nmdc:mga0yw44_24525_c1 | 3300050492 | Bacteria | 3415 |
| 1429 | nmdc:mga0yw44_28625_c1 | 3300050492 | Bacteria | 3207 |
| 1430 | nmdc:mga0yw44_58591_c1 | 3300050492 | Bacteria | 2353 |
| 1431 | nmdc:mga0k408_120636_c1 | 3300050493 | Bacteria | 1553 |
| 1432 | nmdc:mga0k408_175015_c1 | 3300050493 | Bacteria | 1279 |
| 1433 | nmdc:mga0k408_31432_c1 | 3300050493 | Bacteria | 3031 |
| 1434 | nmdc:mga0k408_41811_c1 | 3300050493 | Bacteria | 2639 |
| 1435 | nmdc:mga0k408_425399_c1 | 3300050493 | Bacteria | 789 |
| 1436 | nmdc:mga0k408_53897_c1 | 3300050493 | Bacteria | 2028 |
| 1437 | nmdc:mga06z11_277517_c1 | 3300050494 | Bacteria | 992 |
| 1438 | nmdc:mga06z11_57687_c1 | 3300050494 | Bacteria | 2012 |
| 1439 | nmdc:mga06z11_939509_c1 | 3300050494 | Bacteria | 527 |
| 1440 | nmdc:mga04h51_139923_c1 | 3300050495 | Bacteria | 917 |
| 1441 | nmdc:mga04h51_36942_c1 | 3300050495 | Bacteria | 1574 |
| 1442 | nmdc:mga07m45_132318_c1 | 3300050496 | Bacteria | 1443 |
| 1443 | nmdc:mga07m45_348594_c1 | 3300050496 | Bacteria | 860 |
| 1444 | nmdc:mga07m45_395746_c1 | 3300050496 | Bacteria | 802 |
| 1445 | nmdc:mga07m45_4880_c1 | 3300050496 | Bacteria | 6606 |
| 1446 | nmdc:mga07m45_49399_c1 | 3300050496 | Bacteria | 1878 |
| 1447 | nmdc:mga07m45_499_c2 | 3300050496 | Bacteria | 3411 |
| 1448 | nmdc:mga07m45_546254_c1 | 3300050496 | Bacteria | 670 |
| 1449 | nmdc:mga07m45_5785_c1 | 3300050496 | Bacteria | 6194 |
| 1450 | nmdc:mga07m45_8907_c1 | 3300050496 | Bacteria | 5182 |
| 1451 | nmdc:mga07m45_91600_c1 | 3300050496 | Bacteria | 1742 |
| 1452 | nmdc:mga09592_490666_c1 | 3300050508 | Bacteria | 1058 |
| 1453 | nmdc:mga0qj67_534819_c1 | 3300050509 | Bacteria | 941 |
| 1454 | nmdc:mga0sz30_158742_c1 | 3300050516 | Bacteria | 1001 |
| 1455 | nmdc:mga0sz30_172506_c1 | 3300050516 | Bacteria | 959 |
| 1456 | Ga0495601_0009150 | 3300053077 | Bacteria | 5850 |
| 1457 | Ga0500610_0006171 | 3300053079 | Bacteria | 5001 |
| 1458 | Ga0500610_0006176 | 3300053079 | Bacteria | 5000 |
| 1459 | Ga0500610_0013178 | 3300053079 | Bacteria | 3837 |
| 1460 | Ga0495655_0246682 | 3300053083 | Bacteria | 599 |
| 1461 | Ga0495619_0853236 | 3300053085 | Bacteria | 614 |
| 1462 | Ga0500643_026394 | 3300053087 | Bacteria | 1819 |
| 1463 | Ga0500644_0002098 | 3300053088 | Bacteria | 5060 |
| 1464 | Ga0500651_0000449 | 3300053093 | Bacteria | 21984 |
| 1465 | Ga0500651_0027085 | 3300053093 | Bacteria | 3604 |
| 1466 | Ga0500566_0022690 | 3300053094 | Bacteria | 3686 |
| 1467 | Ga0500566_0235304 | 3300053094 | Bacteria | 901 |
| 1468 | Ga0500641_0265634 | 3300053096 | Bacteria | 715 |
| 1469 | Ga0500650_0290196 | 3300053098 | Bacteria | 726 |
| 1470 | Ga0500560_065982 | 3300053107 | Bacteria | 1187 |
| 1471 | Ga0500562_036326 | 3300053108 | Bacteria | 1306 |
| 1472 | Ga0500569_099361 | 3300053109 | Bacteria | 952 |
| 1473 | Ga0500571_000954 | 3300053110 | Bacteria | 12703 |
| 1474 | Ga0500572_191414 | 3300053111 | Bacteria | 670 |
| 1475 | Ga0500593_003907 | 3300053117 | Bacteria | 5717 |
| 1476 | Ga0500593_008376 | 3300053117 | Bacteria | 4245 |
| 1477 | Ga0500594_0030544 | 3300053118 | Bacteria | 1415 |
| 1478 | Ga0500595_003291 | 3300053119 | Bacteria | 7612 |
| 1479 | Ga0500597_116440 | 3300053120 | Bacteria | 1159 |
| 1480 | Ga0500607_004990 | 3300053121 | Bacteria | 8825 |
| 1481 | Ga0500607_166797 | 3300053121 | Bacteria | 998 |
| 1482 | Ga0500608_004926 | 3300053122 | Bacteria | 5233 |
| 1483 | Ga0500608_006421 | 3300053122 | Bacteria | 4786 |
| 1484 | Ga0500626_083514 | 3300053128 | Bacteria | 1409 |
| 1485 | Ga0500628_009378 | 3300053129 | Bacteria | 1724 |
| 1486 | Ga0500652_389968 | 3300053131 | Bacteria | 518 |
| 1487 | Ga0500655_000523 | 3300053133 | Bacteria | 7736 |
| 1488 | Ga0500658_0002041 | 3300053134 | Bacteria | 7872 |
| 1489 | Ga0500659_0332007 | 3300053135 | Bacteria | 672 |
| 1490 | Ga0500561_0026946 | 3300053137 | Bacteria | 1413 |
| 1491 | Ga0500574_000756 | 3300053141 | Bacteria | 4325 |
| 1492 | Ga0500574_006374 | 3300053141 | Bacteria | 2370 |
| 1493 | Ga0500586_167286 | 3300053145 | Bacteria | 742 |
| 1494 | Ga0500588_0069659 | 3300053146 | Bacteria | 1150 |
| 1495 | Ga0500604_0050128 | 3300053151 | Bacteria | 1286 |
| 1496 | Ga0500616_0091761 | 3300053153 | Bacteria | 1503 |
| 1497 | Ga0500619_001546 | 3300053154 | Bacteria | 4117 |
| 1498 | Ga0500619_097310 | 3300053154 | Bacteria | 997 |
| 1499 | Ga0500620_280797 | 3300053155 | Bacteria | 545 |
| 1500 | Ga0500624_009867 | 3300053157 | Bacteria | 1365 |
| 1501 | Ga0500627_0000962 | 3300053158 | Bacteria | 7800 |
| 1502 | Ga0500633_0184266 | 3300053160 | Bacteria | 783 |
| 1503 | Ga0500634_0006145 | 3300053161 | Bacteria | 5783 |
| 1504 | Ga0500634_0013201 | 3300053161 | Bacteria | 4327 |
| 1505 | Ga0500638_003903 | 3300053162 | Bacteria | 5628 |
| 1506 | Ga0500636_0077064 | 3300053177 | Bacteria | 1926 |
| 1507 | Ga0500625_149092 | 3300053729 | Bacteria | 884 |
| 1508 | Ga0500645_002856 | 3300053730 | Bacteria | 7416 |
| 1509 | Ga0500645_011518 | 3300053730 | Bacteria | 2884 |
| 1510 | Ga0500645_013521 | 3300053730 | Bacteria | 2618 |
| 1511 | Ga0500645_042612 | 3300053730 | Bacteria | 1338 |
| 1512 | Ga0500565_006966 | 3300053734 | Bacteria | 1056 |
| 1513 | Ga0500596_037598 | 3300053735 | Bacteria | 766 |
| 1514 | Ga0500661_010597 | 3300055283 | Bacteria | 1677 |
| 1515 | Ga0466962_0001204 | 3300061719 | Bacteria | 11881 |
| 1516 | Ga0466962_0010772 | 3300061719 | Bacteria | 4394 |
| 1517 | Ga0466962_0360735 | 3300061719 | Bacteria | 724 |
| 1518 | Ga0466962_0637543 | 3300061719 | Bacteria | 544 |
| 1519 | 2501082222 | 2501025502 | Bacteria | 9641094 |
| 1520 | 2509128682 | 2508501125 | Bacteria | 7208311 |
| 1521 | 2510250893 | 2510065045 | Bacteria | 7761063 |
| 1522 | 2511086431 | 2510917013 | Bacteria | 9951648 |
| 1523 | 2512346213 | 2512047030 | Bacteria | 9031815 |
| 1524 | 2513960922 | 2513237151 | Bacteria | 6309801 |
| 1525 | 2514048113 | 2513237166 | Bacteria | 10373764 |
| 1526 | 2515679665 | 2515154122 | Bacteria | 8609520 |
| 1527 | 2515692518 | 2515154123 | Bacteria | 6387382 |
| 1528 | 2516020346 | 2515154189 | Bacteria | 9629850 |
| 1529 | 2527075159 | 2526164713 | Bacteria | 6780608 |
| 1530 | 2563062991 | 2562617112 | Bacteria | 10918404 |
| 1531 | 2713477190 | 2711768613 | Bacteria | 11048459 |
| 1532 | 2719640028 | 2718217991 | Bacteria | 7829542 |
| 1533 | 2738820769 | 2738541296 | Bacteria | 7285013 |
| 1534 | 2738833249 | 2738541298 | Bacteria | 7286732 |
| 1535 | 2738874777 | 2738541306 | Bacteria | 7284992 |
| 1536 | 2739186406 | 2738543002 | Bacteria | 7284546 |
| 1537 | 2739221375 | 2738543008 | Bacteria | 7282815 |
| 1538 | 2739252175 | 2738543013 | Bacteria | 5618633 |
| 1539 | 2746089644 | 2744054900 | Bacteria | 8399525 |
| 1540 | 2746097899 | 2744054901 | Bacteria | 8397047 |
| 1541 | 2753570346 | 2751185846 | Bacteria | 7242164 |
| 1542 | 2792836436 | 2791355137 | Bacteria | 9654227 |
| 1543 | 2819541476 | 2818991436 | Bacteria | 5376622 |
| 1544 | 2819620210 | 2818991450 | Bacteria | 6962147 |
| 1545 | 2883088896 | 2883087390 | Bacteria | 9532701 |
| 1546 | 2885278733 | 2885270888 | Bacteria | 9831543 |
| 1547 | 2900635047 | 2900634093 | Bacteria | 10263517 |
| 1548 | 2902689687 | 2902682994 | Bacteria | 8951596 |
| 1549 | 2904484925 | 2904483920 | Bacteria | 7545285 |
| 1550 | 2904617114 | 2904615490 | Bacteria | 10047340 |
| 1551 | 2919530648 | 2919527303 | Bacteria | 7718827 |
| 1552 | 2928110231 | 2928108538 | Bacteria | 7360024 |
| 1553 | 2928138635 | 2928135762 | Bacteria | 7259641 |
| 1554 | 2928505279 | 2928503688 | Bacteria | 7268108 |
| 1555 | 2945936946 | 2945934425 | Bacteria | 7444609 |
| 1556 | 2974322607 | 2974320154 | Bacteria | 4571377 |
| 1557 | 2990706329 | 2990703756 | Bacteria | 7715990 |
| 1558 | 642423150 | 641736151 | Bacteria | 7477263 |
| 1559 | 642592710 | 642555112 | Bacteria | 8676562 |
| 1560 | 642621372 | 642555113 | Bacteria | 8214658 |
| 1561 | 8003955446 | 8003955200 | Bacteria | 8601927 |
| 1562 | 8055268275 | 8055266321 | Bacteria | 7999742 |
| 1563 | 8055302407 | 8055301274 | Bacteria | 8587385 |
| 1564 | Ga0395900_0375240 | |||
| 1565 | JGI24740J21852_10004178 | |||
| 1566 | JGI24739J22299_10002177 | |||
| 1567 | JGI24739J22299_10052521 | |||
| 1568 | JGI24737J22298_10080653 | |||
| 1569 | JGI24737J22298_10134265 | |||
| 1570 | JGI24735J21928_10007831 | |||
| 1571 | JGI24735J21928_10053098 | |||
| 1572 | JGI24738J21930_10020114 | |||
| 1573 | JGI25155J39150_1000074 | |||
| 1574 | JGI25156J39149_1000002 | |||
| 1575 | JGI25156J39149_1000832 | |||
| 1576 | JGI25156J39149_1001354 | |||
| 1577 | JGI25156J39149_1002530 | |||
| 1578 | JGI25154J39366_1000010 | |||
| 1579 | JGI25157J39369_1000001 | |||
| 1580 | JGI25163J39215_1004817 | |||
| 1581 | JGI25152J39213_1004751 | |||
| 1582 | JGI25152J39213_1018459 | |||
| 1583 | JGI25150J39212_1001868 | |||
| 1584 | JGI25159J45721_1000465 | |||
| 1585 | JGI25159J45721_1005036 | |||
| 1586 | JGI25159J45721_1008645 | |||
| 1587 | JGI25159J45721_1010302 | |||
| 1588 | JGI25151J46595_10004722 | |||
| 1589 | JGI25151J46595_10007240 | |||
| 1590 | JGI25151J46595_10011024 | |||
| 1591 | JGI25151J46595_10025444 | |||
| 1592 | JGI25151J46595_10048668 | |||
| 1593 | JGI25151J46595_10055085 | |||
| 1594 | JGI25151J46595_10055090 | |||
| 1595 | JGI25151J46595_10095461 | |||
| 1596 | JGI25165J46597_1000122 | |||
| 1597 | JGI25165J46597_1003773 | |||
| 1598 | JGI25153J46596_10010535 | |||
| 1599 | JGI25153J46596_10017438 | |||
| 1600 | JGI25153J46596_10045306 | |||
| 1601 | rootH1_10067293 | |||
| 1602 | rootH2_10162484 | |||
| 1603 | rootL2_10092707 | |||
| 1604 | rootL2_10160743 | |||
| 1605 | rootH1_10248647 | |||
| 1606 | JGI25160J50197_1000192 | |||
| 1607 | JGI25160J50197_1007623 | |||
| 1608 | JGI25160J50197_1017692 | |||
| 1609 | JGI25160J50197_1033752 | |||
| 1610 | JGI25160J50197_1036495 | |||
| 1611 | JGI25161J50226_1000043 | |||
| 1612 | JGI25161J50226_1001441 | |||
| 1613 | JGI25161J50226_1004787 | |||
| 1614 | Ga0006562J51391_1157498 | |||
| 1615 | Ga0006562J51391_1157500 | |||
| 1616 | Ga0006562J51391_1170727 | |||
| 1617 | Ga0006562J51391_1170728 | |||
| 1618 | Ga0055538_1000048 | |||
| 1619 | Ga0055539_1000070 | |||
| 1620 | Ga0055533_1000078 | |||
| 1621 | Ga0055533_1000217 | |||
| 1622 | Ga0055533_1001154 | |||
| 1623 | Ga0055532_1000027 | |||
| 1624 | Ga0055532_1003249 | |||
| 1625 | Ga0055525_1000106 | |||
| 1626 | Ga0055527_1000019 | |||
| 1627 | Ga0055527_1001078 | |||
| 1628 | Ga0055535_1000021 | |||
| 1629 | Ga0055535_1000392 | |||
| 1630 | Ga0055535_1002465 | |||
| 1631 | Ga0055542_1000032 | |||
| 1632 | Ga0055542_1000033 | |||
| 1633 | Ga0055542_1001104 | |||
| 1634 | Ga0055529_1000038 | |||
| 1635 | Ga0055529_1001039 | |||
| 1636 | Ga0055526_1003998 | |||
| 1637 | Ga0055526_1004562 | |||
| 1638 | Ga0055526_1010656 | |||
| 1639 | Ga0055526_1011784 | |||
| 1640 | Ga0055526_1085415 | |||
| 1641 | Ga0055537_1000259 | |||
| 1642 | Ga0055537_1001161 | |||
| 1643 | Ga0055537_1004117 | |||
| 1644 | Ga0055537_1004429 | |||
| 1645 | Ga0055537_1012744 | |||
| 1646 | Ga0055537_1012749 | |||
| 1647 | Ga0055524_1000156 | |||
| 1648 | Ga0055524_1008536 | |||
| 1649 | Ga0055524_1009658 | |||
| 1650 | Ga0055536_1000270 | |||
| 1651 | Ga0055536_1003726 | |||
| 1652 | Ga0055536_1008866 | |||
| 1653 | Ga0055536_1009172 | |||
| 1654 | Ga0055536_1072764 | |||
| 1655 | Ga0055536_1102973 | |||
| 1656 | Ga0055534_1001138 | |||
| 1657 | Ga0055534_1004201 | |||
| 1658 | Ga0055534_1005776 | |||
| 1659 | Ga0055534_1006046 | |||
| 1660 | Ga0055534_1016835 | |||
| 1661 | Ga0055534_1018628 | |||
| 1662 | Ga0055528_1002167 | |||
| 1663 | Ga0055528_1008888 | |||
| 1664 | Ga0055528_1012346 | |||
| 1665 | Ga0055528_1012509 | |||
| 1666 | Ga0055528_1027152 | |||
| 1667 | Ga0055528_1027156 | |||
| 1668 | Ga0055528_1042958 | |||
| 1669 | Ga0055530_10000408 | |||
| 1670 | Ga0055530_10003951 | |||
| 1671 | Ga0055530_10009348 | |||
| 1672 | Ga0055530_10052631 | |||
| 1673 | Ga0055530_10066045 | |||
| 1674 | Ga0055540_1000033 | |||
| 1675 | Ga0055540_1003778 | |||
| 1676 | Ga0055540_1004106 | |||
| 1677 | Ga0055540_1004580 | |||
| 1678 | Ga0055540_1007340 | |||
| 1679 | Ga0055540_1019358 | |||
| 1680 | Ga0055531_10000273 | |||
| 1681 | Ga0055531_10004865 | |||
| 1682 | Ga0055531_10009016 | |||
| 1683 | Ga0055531_10011825 | |||
| 1684 | Ga0055531_10018627 | |||
| 1685 | Ga0055541_1000050 | |||
| 1686 | Ga0055543_1000127 | |||
| 1687 | Ga0055543_1003299 | |||
| 1688 | Ga0055543_1003796 | |||
| 1689 | Ga0055543_1060930 | |||
| 1690 | Ga0065165_1009736 | |||
| 1691 | Ga0065165_1018503 | |||
| 1692 | Ga0065165_1021250 | |||
| 1693 | Ga0065165_1024886 | |||
| 1694 | Ga0065165_1025051 | |||
| 1695 | Ga0065165_1034242 | |||
| 1696 | Ga0065165_1040701 | |||
| 1697 | Ga0065714_10090017 | |||
| 1698 | Ga0065704_10193152 | |||
| 1699 | Ga0070658_10706465 | |||
| 1700 | Ga0070658_11158888 | |||
| 1701 | Ga0070658_11689752 | |||
| 1702 | Ga0070676_10341599 | |||
| 1703 | Ga0070690_101777161 | |||
| 1704 | Ga0070677_10179772 | |||
| 1705 | Ga0070666_10137585 | |||
| 1706 | Ga0070680_100154059 | |||
| 1707 | Ga0070660_100063427 | |||
| 1708 | Ga0070660_100168320 | |||
| 1709 | Ga0070660_100595492 | |||
| 1710 | Ga0070661_100083243 | |||
| 1711 | Ga0070661_100299590 | |||
| 1712 | Ga0070661_100328250 | |||
| 1713 | Ga0070661_101265712 | |||
| 1714 | Ga0070668_100235812 | |||
| 1715 | Ga0070675_100168276 | |||
| 1716 | Ga0070671_100012785 | |||
| 1717 | Ga0070674_101416088 | |||
| 1718 | Ga0070674_102189676 | |||
| 1719 | Ga0070673_100233226 | |||
| 1720 | Ga0070673_100434155 | |||
| 1721 | Ga0070659_100018367 | |||
| 1722 | Ga0070659_100218480 | |||
| 1723 | Ga0070667_100040522 | |||
| 1724 | Ga0070667_100231746 | |||
| 1725 | Ga0070667_100503547 | |||
| 1726 | Ga0070667_100907643 | |||
| 1727 | Ga0070714_100375116 | |||
| 1728 | Ga0070714_101404219 | |||
| 1729 | Ga0070710_11007259 | |||
| 1730 | Ga0070710_11543109 | |||
| 1731 | Ga0070711_101616090 | |||
| 1732 | Ga0070663_100245416 | |||
| 1733 | Ga0070678_100064383 | |||
| 1734 | Ga0070678_100073147 | |||
| 1735 | Ga0070678_100105961 | |||
| 1736 | Ga0070678_100412401 | |||
| 1737 | Ga0070678_100666988 | |||
| 1738 | Ga0070678_101195886 | |||
| 1739 | Ga0070662_100036495 | |||
| 1740 | Ga0068867_100425325 | |||
| 1741 | Ga0068867_101568078 | |||
| 1742 | Ga0070685_10270880 | |||
| 1743 | Ga0070685_10826288 | |||
| 1744 | Ga0070707_100096851 | |||
| 1745 | Ga0070698_100924580 | |||
| 1746 | Ga0070679_100430201 | |||
| 1747 | Ga0070679_101451882 | |||
| 1748 | Ga0068853_100278882 | |||
| 1749 | Ga0068853_100793031 | |||
| 1750 | Ga0068853_100839791 | |||
| 1751 | Ga0068853_101463820 | |||
| 1752 | Ga0070672_100366925 | |||
| 1753 | Ga0070665_100066688 | |||
| 1754 | Ga0070665_100821073 | |||
| 1755 | Ga0070665_101999792 | |||
| 1756 | Ga0070665_102491187 | |||
| 1757 | Ga0068855_100000737 | |||
| 1758 | Ga0068855_100076757 | |||
| 1759 | Ga0068855_100093546 | |||
| 1760 | Ga0068855_100417759 | |||
| 1761 | Ga0068855_101465270 | |||
| 1762 | Ga0068855_101933906 | |||
| 1763 | Ga0070664_100013869 | |||
| 1764 | Ga0068857_100892206 | |||
| 1765 | Ga0068857_102126836 | |||
| 1766 | Ga0068854_101185487 | |||
| 1767 | Ga0068856_100841290 | |||
| 1768 | Ga0068852_101221107 | |||
| 1769 | Ga0068852_101542359 | |||
| 1770 | Ga0068866_10710379 | |||
| 1771 | Ga0068851_10007730 | |||
| 1772 | Ga0068851_10577226 | |||
| 1773 | Ga0068863_101123379 | |||
| 1774 | Ga0068863_101418965 | |||
| 1775 | Ga0075365_10009476 | |||
| 1776 | Ga0075365_10017566 | |||
| 1777 | Ga0075365_10228304 | |||
| 1778 | Ga0075365_10245891 | |||
| 1779 | Ga0075365_10420339 | |||
| 1780 | Ga0075365_11203830 | |||
| 1781 | Ga0075368_10045821 | |||
| 1782 | Ga0075368_10183590 | |||
| 1783 | Ga0075363_100052346 | |||
| 1784 | Ga0075363_100072252 | |||
| 1785 | Ga0075363_100115150 | |||
| 1786 | Ga0075363_100183871 | |||
| 1787 | Ga0075363_100959450 | |||
| 1788 | Ga0075363_100959451 | |||
| 1789 | Ga0075364_10025580 | |||
| 1790 | Ga0075364_10468983 | |||
| 1791 | Ga0075364_11013112 | |||
| 1792 | Ga0075432_10006000 | |||
| 1793 | Ga0075432_10007261 | |||
| 1794 | Ga0075432_10056602 | |||
| 1795 | Ga0075362_10003943 | |||
| 1796 | Ga0075362_10014025 | |||
| 1797 | Ga0075362_10067478 | |||
| 1798 | Ga0075362_10122063 | |||
| 1799 | Ga0075362_10137647 | |||
| 1800 | Ga0075362_10140701 | |||
| 1801 | Ga0075362_10201601 | |||
| 1802 | Ga0075362_10296782 | |||
| 1803 | Ga0075362_10321744 | |||
| 1804 | Ga0075362_10636868 | |||
| 1805 | Ga0075367_10183859 | |||
| 1806 | Ga0075367_10333240 | |||
| 1807 | Ga0075369_10070632 | |||
| 1808 | Ga0075369_10227473 | |||
| 1809 | Ga0075366_10032783 | |||
| 1810 | Ga0075366_10113454 | |||
| 1811 | Ga0075366_10185666 | |||
| 1812 | Ga0075366_10194858 | |||
| 1813 | Ga0075366_10270166 | |||
| 1814 | Ga0075366_10754209 | |||
| 1815 | Ga0097621_100393880 | |||
| 1816 | Ga0097621_100540092 | |||
| 1817 | Ga0075370_10000322 | |||
| 1818 | Ga0075370_10003243 | |||
| 1819 | Ga0075370_10004735 | |||
| 1820 | Ga0075370_10022587 | |||
| 1821 | Ga0075370_10035851 | |||
| 1822 | Ga0075370_10050403 | |||
| 1823 | Ga0075370_10165389 | |||
| 1824 | Ga0075370_10248670 | |||
| 1825 | Ga0075431_101588388 | |||
| 1826 | Ga0075429_100553458 | |||
| 1827 | Ga0068865_100841441 | |||
| 1828 | Ga0068865_101000971 | |||
| 1829 | Ga0068865_101704897 | |||
| 1830 | Ga0079104_1047926 | |||
| 1831 | Ga0099826_10008499 | |||
| 1832 | Ga0099826_10342267 | |||
| 1833 | Ga0105251_10000134 | |||
| 1834 | Ga0105251_10367650 | |||
| 1835 | Ga0105244_10003000 | |||
| 1836 | Ga0105244_10520543 | |||
| 1837 | Ga0105240_10004043 | |||
| 1838 | Ga0105240_10207199 | |||
| 1839 | Ga0105240_10852164 | |||
| 1840 | Ga0105245_10238339 | |||
| 1841 | Ga0105245_10497804 | |||
| 1842 | Ga0105243_10003757 | |||
| 1843 | Ga0105243_10009638 | |||
| 1844 | Ga0105243_10022421 | |||
| 1845 | Ga0105243_10879036 | |||
| 1846 | Ga0105241_10176388 | |||
| 1847 | Ga0105242_11165371 | |||
| 1848 | Ga0105242_11692939 | |||
| 1849 | Ga0105248_10083825 | |||
| 1850 | Ga0105248_11216745 | |||
| 1851 | Ga0105237_10141822 | |||
| 1852 | Ga0105237_10453383 | |||
| 1853 | Ga0105237_11374432 | |||
| 1854 | Ga0105237_11458129 | |||
| 1855 | Ga0105238_10095250 | |||
| 1856 | Ga0105238_10398710 | |||
| 1857 | Ga0105238_10436156 | |||
| 1858 | Ga0105238_10472465 | |||
| 1859 | Ga0105238_10697818 | |||
| 1860 | Ga0105239_10070385 | |||
| 1861 | Ga0105239_10248446 | |||
| 1862 | Ga0105239_10881047 | |||
| 1863 | Ga0105246_10035641 | |||
| 1864 | Ga0105246_10120637 | |||
| 1865 | Ga0157347_1003287 | |||
| 1866 | Ga0157347_1019559 | |||
| 1867 | Ga0157326_1031246 | |||
| 1868 | Ga0157373_10023683 | |||
| 1869 | Ga0157373_10507222 | |||
| 1870 | Ga0157373_10742706 | |||
| 1871 | Ga0157373_10775436 | |||
| 1872 | Ga0157371_10104204 | |||
| 1873 | Ga0157370_10001130 | |||
| 1874 | Ga0157370_10072460 | |||
| 1875 | Ga0157370_10114119 | |||
| 1876 | Ga0157370_10128583 | |||
| 1877 | Ga0157370_10155730 | |||
| 1878 | Ga0157370_10293566 | |||
| 1879 | Ga0157370_10538982 | |||
| 1880 | Ga0157370_11759732 | |||
| 1881 | Ga0157369_10001199 | |||
| 1882 | Ga0157369_10012328 | |||
| 1883 | Ga0157369_10055356 | |||
| 1884 | Ga0157369_10165285 | |||
| 1885 | Ga0157369_10217194 | |||
| 1886 | Ga0157369_12354772 | |||
| 1887 | Ga0157378_12588545 | |||
| 1888 | Ga0163162_10080040 | |||
| 1889 | Ga0163162_10436581 | |||
| 1890 | Ga0163162_12834001 | |||
| 1891 | Ga0163162_13452651 | |||
| 1892 | Ga0157372_10233361 | |||
| 1893 | Ga0157372_10329234 | |||
| 1894 | Ga0157372_11489577 | |||
| 1895 | Ga0157375_10432526 | |||
| 1896 | Ga0163163_10104437 | |||
| 1897 | Ga0182008_10001340 | |||
| 1898 | Ga0182008_10016053 | |||
| 1899 | Ga0182008_10023775 | |||
| 1900 | Ga0182008_10036324 | |||
| 1901 | Ga0182008_10053246 | |||
| 1902 | Ga0182008_10533825 | |||
| 1903 | Ga0182008_10713512 | |||
| 1904 | Ga0157376_11162427 | |||
| 1905 | Ga0157376_11165887 | |||
| 1906 | Ga0157376_12051813 | |||
| 1907 | Ga0182006_1001145 | |||
| 1908 | Ga0182006_1094962 | |||
| 1909 | Ga0182006_1134847 | |||
| 1910 | Ga0182006_1155318 | |||
| 1911 | Ga0182007_10000512 | |||
| 1912 | Ga0182007_10008474 | |||
| 1913 | Ga0182007_10021431 | |||
| 1914 | Ga0182007_10034980 | |||
| 1915 | Ga0182007_10173045 | |||
| 1916 | Ga0182005_1000637 | |||
| 1917 | Ga0182005_1125498 | |||
| 1918 | Ga0183362_10001 | |||
| 1919 | Ga0183361_10013 | |||
| 1920 | Ga0163161_10000166 | |||
| 1921 | Ga0163161_10010657 | |||
| 1922 | Ga0163161_10015236 | |||
| 1923 | Ga0163161_10017854 | |||
| 1924 | Ga0163161_10270716 | |||
| 1925 | Ga0197907_11469637 | |||
| 1926 | Ga0206356_10241440 | |||
| 1927 | Ga0206349_1941556 | |||
| 1928 | Ga0206350_10621348 | |||
| 1929 | Ga0206354_10082792 | |||
| 1930 | Ga0206353_10915309 | |||
| 1931 | Ga0213872_10432679 | |||
| 1932 | Ga0224712_10000080 | |||
| 1933 | Ga0209435_100001 | |||
| 1934 | Ga0209760_100758 | |||
| 1935 | Ga0209436_103077 | |||
| 1936 | Ga0209436_104293 | |||
| 1937 | Ga0209436_107685 | |||
| 1938 | Ga0209784_100062 | |||
| 1939 | Ga0209566_100023 | |||
| 1940 | Ga0209566_104089 | |||
| 1941 | Ga0209674_100005 | |||
| 1942 | Ga0209674_100040 | |||
| 1943 | Ga0209674_100103 | |||
| 1944 | Ga0209672_100001 | |||
| 1945 | Ga0209672_100014 | |||
| 1946 | Ga0209672_110041 | |||
| 1947 | Ga0209672_113083 | |||
| 1948 | Ga0209147_100001 | |||
| 1949 | Ga0209147_100087 | |||
| 1950 | Ga0209563_100096 | |||
| 1951 | Ga0209563_105329 | |||
| 1952 | Ga0207427_100852 | |||
| 1953 | Ga0207427_101800 | |||
| 1954 | Ga0209437_100146 | |||
| 1955 | Ga0209258_100001 | |||
| 1956 | Ga0209258_100040 | |||
| 1957 | Ga0209258_100089 | |||
| 1958 | Ga0207425_1000603 | |||
| 1959 | Ga0207425_1001556 | |||
| 1960 | Ga0207425_1003911 | |||
| 1961 | Ga0207425_1010384 | |||
| 1962 | Ga0209646_1000001 | |||
| 1963 | Ga0209646_1014494 | |||
| 1964 | Ga0209026_1000001 | |||
| 1965 | Ga0209677_100058 | |||
| 1966 | Ga0209148_1000003 | |||
| 1967 | Ga0209148_1000035 | |||
| 1968 | Ga0209148_1000097 | |||
| 1969 | Ga0209148_1000553 | |||
| 1970 | Ga0209759_1000001 | |||
| 1971 | Ga0209759_1000188 | |||
| 1972 | Ga0209759_1000284 | |||
| 1973 | Ga0209759_1000519 | |||
| 1974 | Ga0209129_1000071 | |||
| 1975 | Ga0209129_1008455 | |||
| 1976 | Ga0209129_1010324 | |||
| 1977 | Ga0209129_1011881 | |||
| 1978 | Ga0209129_1018181 | |||
| 1979 | Ga0209129_1030174 | |||
| 1980 | Ga0209233_1000043 | |||
| 1981 | Ga0209233_1000159 | |||
| 1982 | Ga0209233_1068469 | |||
| 1983 | Ga0209565_1000120 | |||
| 1984 | Ga0209565_1000326 | |||
| 1985 | Ga0209565_1000774 | |||
| 1986 | Ga0209565_1001593 | |||
| 1987 | Ga0209565_1004359 | |||
| 1988 | Ga0209565_1014786 | |||
| 1989 | Ga0209565_1019567 | |||
| 1990 | Ga0209565_1069613 | |||
| 1991 | Ga0209455_1000001 | |||
| 1992 | Ga0209455_1000200 | |||
| 1993 | Ga0209673_1000030 | |||
| 1994 | Ga0209673_1000099 | |||
| 1995 | Ga0209673_1000839 | |||
| 1996 | Ga0209673_1001338 | |||
| 1997 | Ga0209673_1009171 | |||
| 1998 | Ga0209673_1011116 | |||
| 1999 | Ga0209673_1019100 | |||
| 2000 | Ga0209673_1056619 | |||
| 2001 | Ga0209130_1000041 | |||
| 2002 | Ga0209130_1000456 | |||
| 2003 | Ga0209130_1000952 | |||
| 2004 | Ga0209130_1001771 | |||
| 2005 | Ga0209130_1003498 | |||
| 2006 | Ga0209130_1034515 | |||
| 2007 | Ga0209675_1000054 | |||
| 2008 | Ga0209675_1000290 | |||
| 2009 | Ga0209675_1001678 | |||
| 2010 | Ga0209675_1003556 | |||
| 2011 | Ga0209675_1007178 | |||
| 2012 | Ga0209675_1007222 | |||
| 2013 | Ga0209675_1013320 | |||
| 2014 | Ga0209675_1025130 | |||
| 2015 | Ga0209675_1068071 | |||
| 2016 | Ga0209676_1000005 | |||
| 2017 | Ga0209676_1000054 | |||
| 2018 | Ga0209676_1000260 | |||
| 2019 | Ga0209676_1002320 | |||
| 2020 | Ga0209676_1006861 | |||
| 2021 | Ga0209676_1012219 | |||
| 2022 | Ga0209676_1021448 | |||
| 2023 | Ga0209676_1037652 | |||
| 2024 | Ga0209676_1045732 | |||
| 2025 | Ga0209676_1122175 | |||
| 2026 | Ga0209025_1001065 | |||
| 2027 | Ga0209025_1001409 | |||
| 2028 | Ga0209025_1001617 | |||
| 2029 | Ga0209025_1005090 | |||
| 2030 | Ga0209025_1010783 | |||
| 2031 | Ga0209025_1013211 | |||
| 2032 | Ga0209025_1014966 | |||
| 2033 | Ga0209025_1017071 | |||
| 2034 | Ga0209025_1023210 | |||
| 2035 | Ga0209025_1029599 | |||
| 2036 | Ga0209025_1032635 | |||
| 2037 | Ga0209025_1070074 | |||
| 2038 | Ga0209564_1000239 | |||
| 2039 | Ga0209564_1000662 | |||
| 2040 | Ga0209564_1000784 | |||
| 2041 | Ga0209564_1000890 | |||
| 2042 | Ga0209564_1008305 | |||
| 2043 | Ga0209564_1050603 | |||
| 2044 | Ga0209758_1000027 | |||
| 2045 | Ga0209758_1010200 | |||
| 2046 | Ga0209758_1024927 | |||
| 2047 | Ga0209758_1054541 | |||
| 2048 | Ga0209758_1058368 | |||
| 2049 | Ga0209758_1097385 | |||
| 2050 | Ga0209050_1000003 | |||
| 2051 | Ga0209050_1000007 | |||
| 2052 | Ga0209050_1000954 | |||
| 2053 | Ga0209050_1004569 | |||
| 2054 | Ga0209050_1006735 | |||
| 2055 | Ga0209050_1016241 | |||
| 2056 | Ga0209050_1024718 | |||
| 2057 | Ga0209050_1059225 | |||
| 2058 | Ga0209050_1096823 | |||
| 2059 | Ga0209256_1000001 | |||
| 2060 | Ga0209256_1000081 | |||
| 2061 | Ga0209256_1009348 | |||
| 2062 | Ga0209256_1021256 | |||
| 2063 | Ga0209256_1024404 | |||
| 2064 | Ga0207426_1000027 | |||
| 2065 | Ga0207426_1000061 | |||
| 2066 | Ga0207426_1003593 | |||
| 2067 | Ga0207426_1004649 | |||
| 2068 | Ga0207426_1077340 | |||
| 2069 | Ga0209051_1000003 | |||
| 2070 | Ga0209051_1000009 | |||
| 2071 | Ga0209051_1000055 | |||
| 2072 | Ga0209051_1000319 | |||
| 2073 | Ga0209051_1000619 | |||
| 2074 | Ga0209051_1005714 | |||
| 2075 | Ga0209051_1019880 | |||
| 2076 | Ga0209051_1050459 | |||
| 2077 | Ga0209051_1085050 | |||
| 2078 | Ga0209257_1000018 | |||
| 2079 | Ga0209257_1000045 | |||
| 2080 | Ga0209257_1000873 | |||
| 2081 | Ga0209257_1007556 | |||
| 2082 | Ga0209257_1007934 | |||
| 2083 | Ga0209257_1008583 | |||
| 2084 | Ga0207656_10047010 | |||
| 2085 | Ga0207655_1001368 | |||
| 2086 | Ga0207713_1001542 | |||
| 2087 | Ga0207642_10527042 | |||
| 2088 | Ga0207680_10441506 | |||
| 2089 | Ga0207647_10015129 | |||
| 2090 | Ga0207647_10164889 | |||
| 2091 | Ga0207647_10288894 | |||
| 2092 | Ga0207647_10763267 | |||
| 2093 | Ga0207645_10331383 | |||
| 2094 | Ga0207643_11141600 | |||
| 2095 | Ga0207705_10162860 | |||
| 2096 | Ga0207705_10221912 | |||
| 2097 | Ga0207705_10528849 | |||
| 2098 | Ga0207705_11291761 | |||
| 2099 | Ga0207684_11260217 | |||
| 2100 | Ga0207707_10916240 | |||
| 2101 | Ga0207695_10125685 | |||
| 2102 | Ga0207695_10190846 | |||
| 2103 | Ga0207695_10635882 | |||
| 2104 | Ga0207695_11224963 | |||
| 2105 | Ga0207671_10090182 | |||
| 2106 | Ga0207671_10393536 | |||
| 2107 | Ga0207660_10038245 | |||
| 2108 | Ga0207657_10229708 | |||
| 2109 | Ga0207657_10321706 | |||
| 2110 | Ga0207657_10488981 | |||
| 2111 | Ga0207649_10258561 | |||
| 2112 | Ga0207652_10246622 | |||
| 2113 | Ga0207652_10265241 | |||
| 2114 | Ga0207681_10530770 | |||
| 2115 | Ga0207694_10197807 | |||
| 2116 | Ga0207694_10347713 | |||
| 2117 | Ga0207694_10440520 | |||
| 2118 | Ga0207694_10857800 | |||
| 2119 | Ga0207650_11409626 | |||
| 2120 | Ga0207644_10022931 | |||
| 2121 | Ga0207690_10014545 | |||
| 2122 | Ga0207690_10184168 | |||
| 2123 | Ga0207706_10017147 | |||
| 2124 | Ga0207686_10149936 | |||
| 2125 | Ga0207709_10000230 | |||
| 2126 | Ga0207709_10002452 | |||
| 2127 | Ga0207709_10005451 | |||
| 2128 | Ga0207669_10489440 | |||
| 2129 | Ga0207704_11228917 | |||
| 2130 | Ga0207704_11918572 | |||
| 2131 | Ga0207691_10422459 | |||
| 2132 | Ga0207711_10002819 | |||
| 2133 | Ga0207711_10068904 | |||
| 2134 | Ga0207711_10480700 | |||
| 2135 | Ga0207689_11653182 | |||
| 2136 | Ga0207679_10008899 | |||
| 2137 | Ga0207667_10000524 | |||
| 2138 | Ga0207667_10061207 | |||
| 2139 | Ga0207667_10710000 | |||
| 2140 | Ga0207651_10346283 | |||
| 2141 | Ga0207651_10421612 | |||
| 2142 | Ga0207651_10546604 | |||
| 2143 | Ga0207651_11306657 | |||
| 2144 | Ga0207712_12061780 | |||
| 2145 | Ga0207640_10842984 | |||
| 2146 | Ga0207658_10098455 | |||
| 2147 | Ga0207658_10438015 | |||
| 2148 | Ga0207658_10888663 | |||
| 2149 | Ga0207703_12046243 | |||
| 2150 | Ga0207639_10183989 | |||
| 2151 | Ga0207639_10399927 | |||
| 2152 | Ga0207639_10627406 | |||
| 2153 | Ga0207678_10410907 | |||
| 2154 | Ga0207641_11070799 | |||
| 2155 | Ga0207641_11134785 | |||
| 2156 | Ga0207648_10442715 | |||
| 2157 | Ga0207648_10603645 | |||
| 2158 | Ga0207676_12084986 | |||
| 2159 | Ga0207676_12407124 | |||
| 2160 | Ga0207674_10901285 | |||
| 2161 | Ga0207675_101388449 | |||
| 2162 | Ga0207683_10070721 | |||
| 2163 | Ga0207683_10078360 | |||
| 2164 | Ga0207683_10873872 | |||
| 2165 | Ga0207683_10878083 | |||
| 2166 | Ga0207698_10817601 | |||
| 2167 | Ga0207698_12304859 | |||
| 2168 | Ga0209281_1030565 | |||
| 2169 | Ga0209371_1000267 | |||
| 2170 | Ga0209371_1051233 | |||
| 2171 | Ga0209282_1000133 | |||
| 2172 | Ga0209282_1403881 | |||
| 2173 | Ga0209813_10066296 | |||
| 2174 | Ga0209813_10199242 | |||
| 2175 | Ga0209974_10002433 | |||
| 2176 | Ga0207428_10223419 | |||
| 2177 | Ga0207428_10406977 | |||
| 2178 | Ga0268266_10014251 | |||
| 2179 | Ga0307517_10447730 | |||
| 2180 | Ga0307515_10000084 | |||
| 2181 | Ga0307515_10001286 | |||
| 2182 | Ga0265338_10000022 | |||
| 2183 | Ga0268256_1000238 | |||
| 2184 | Ga0268256_1057581 | |||
| 2185 | Ga0307512_10443111 | |||
| 2186 | Ga0316177_1041282 | |||
| 2187 | Ga0316177_1204318 | |||
| 2188 | Ga0316176_1023428 | |||
| 2189 | Ga0314311_1134334 | |||
| 2190 | Ga0316179_1116799 | |||
| 2191 | Ga0316178_1006481 | |||
| 2192 | Ga0316180_1186828 | |||
| 2193 | Ga0316183_1029454 | |||
| 2194 | Ga0316181_1011855 | |||
| 2195 | Ga0316181_1039412 | |||
| 2196 | Ga0316182_1158883 | |||
| 2197 | Ga0316182_1159626 | |||
| 2198 | Ga0265340_10046708 | |||
| 2199 | Ga0265327_10002745 | |||
| 2200 | Ga0265327_10003564 | |||
| 2201 | Ga0307513_10000012 | |||
| 2202 | Ga0307513_10000285 | |||
| 2203 | Ga0307513_10080379 | |||
| 2204 | Ga0307513_10097609 | |||
| 2205 | Ga0307513_10977074 | |||
| 2206 | Ga0307513_11063927 | |||
| 2207 | Ga0307408_100022449 | |||
| 2208 | Ga0307408_100144752 | |||
| 2209 | Ga0307408_100287070 | |||
| 2210 | Ga0307408_100306407 | |||
| 2211 | Ga0307408_100339824 | |||
| 2212 | Ga0307408_100344212 | |||
| 2213 | Ga0307408_100389606 | |||
| 2214 | Ga0307408_100422732 | |||
| 2215 | Ga0307408_100575839 | |||
| 2216 | Ga0307408_100845409 | |||
| 2217 | Ga0307408_100922902 | |||
| 2218 | Ga0307408_101363430 | |||
| 2219 | Ga0307408_101538920 | |||
| 2220 | Ga0307514_10000319 | |||
| 2221 | Ga0307514_10077326 | |||
| 2222 | Ga0307516_10004265 | |||
| 2223 | Ga0307516_10005283 | |||
| 2224 | Ga0307516_10455501 | |||
| 2225 | Ga0307405_10091953 | |||
| 2226 | Ga0307405_10152052 | |||
| 2227 | Ga0307405_10166096 | |||
| 2228 | Ga0307405_10796411 | |||
| 2229 | Ga0307405_10960008 | |||
| 2230 | Ga0307405_11057809 | |||
| 2231 | Ga0307405_11221953 | |||
| 2232 | Ga0307405_11310185 | |||
| 2233 | Ga0307405_11609000 | |||
| 2234 | Ga0307413_10989047 | |||
| 2235 | Ga0307413_11164686 | |||
| 2236 | Ga0307410_11495854 | |||
| 2237 | Ga0307406_10057413 | |||
| 2238 | Ga0307406_10593293 | |||
| 2239 | Ga0307406_10842744 | |||
| 2240 | Ga0307406_11265238 | |||
| 2241 | Ga0307406_11510198 | |||
| 2242 | Ga0307406_11693511 | |||
| 2243 | Ga0307407_10471517 | |||
| 2244 | Ga0307407_11061265 | |||
| 2245 | Ga0307412_10000024 | |||
| 2246 | Ga0307412_10022467 | |||
| 2247 | Ga0307412_10035354 | |||
| 2248 | Ga0307412_10045864 | |||
| 2249 | Ga0307412_10189537 | |||
| 2250 | Ga0307412_10641112 | |||
| 2251 | Ga0307412_10969697 | |||
| 2252 | Ga0307412_11369355 | |||
| 2253 | Ga0307412_11491952 | |||
| 2254 | Ga0307412_11539829 | |||
| 2255 | Ga0307412_11888259 | |||
| 2256 | Ga0307412_11984302 | |||
| 2257 | Ga0307412_12069128 | |||
| 2258 | Ga0307412_12255095 | |||
| 2259 | Ga0307409_102366496 | |||
| 2260 | Ga0307416_100089287 | |||
| 2261 | Ga0307416_100755407 | |||
| 2262 | Ga0307416_100903036 | |||
| 2263 | Ga0307416_102006290 | |||
| 2264 | Ga0307416_102419947 | |||
| 2265 | Ga0307416_102935774 | |||
| 2266 | Ga0307416_103070534 | |||
| 2267 | Ga0307414_10077611 | |||
| 2268 | Ga0307414_10235109 | |||
| 2269 | Ga0307414_10677726 | |||
| 2270 | Ga0307414_10701031 | |||
| 2271 | Ga0307414_11025195 | |||
| 2272 | Ga0307411_10194251 | |||
| 2273 | Ga0307411_10298354 | |||
| 2274 | Ga0307411_10624471 | |||
| 2275 | Ga0307411_10695041 | |||
| 2276 | Ga0307411_10701230 | |||
| 2277 | Ga0307411_10747772 | |||
| 2278 | Ga0307411_10871004 | |||
| 2279 | Ga0307411_10961341 | |||
| 2280 | Ga0307411_12063770 | |||
| 2281 | Ga0307411_12097333 | |||
| 2282 | Ga0307415_101845404 | |||
| 2283 | Ga0373952_0202494 | |||
| 2284 | Ga0395899_0000035 | |||
| 2285 | Ga0395899_0002970 | |||
| 2286 | Ga0395900_0000190 | |||
| 2287 | Ga0395900_0001100 | |||
| 2288 | Ga0395900_0044241 | |||
| 2289 | Ga0395900_0185326 | |||
| 2290 | Ga0395900_0834824 | |||
| 2291 | Ga0395898_0000199 | |||
| 2292 | Ga0395898_0011627 | |||
| 2293 | Ga0395898_0064652 | |||
| 2294 | Ga0395905_0000041 | |||
| 2295 | Ga0395905_0030123 | |||
| 2296 | Ga0395905_0042337 | |||
| 2297 | Ga0395905_0052258 | |||
| 2298 | Ga0395905_0336351 | |||
| 2299 | Ga0395905_0425313 | |||
| 2300 | Ga0395905_0526805 | |||
| 2301 | Ga0395901_0000062 | |||
| 2302 | Ga0395901_0001105 | |||
| 2303 | Ga0395901_0073845 | |||
| 2304 | Ga0395901_0217320 | |||
| 2305 | Ga0395901_0293677 | |||
| 2306 | Ga0395901_0576659 | |||
| 2307 | Ga0436360_0553837 | |||
| 2308 | Ga0436361_0120393 | |||
| 2309 | Ga0436361_0171963 | |||
| 2310 | Ga0436361_0355371 | |||
| 2311 | Ga0439436_0001379 | |||
| 2312 | Ga0439436_0046759 | |||
| 2313 | Ga0439436_0095607 | |||
| 2314 | Ga0439436_0173445 | |||
| 2315 | Ga0439438_105692 | |||
| 2316 | Ga0439438_131656 | |||
| 2317 | Ga0439439_0005352 | |||
| 2318 | Ga0439439_0077318 | |||
| 2319 | Ga0439439_0087749 | |||
| 2320 | Ga0439447_017937 | |||
| 2321 | Ga0439447_056389 | |||
| 2322 | Ga0439447_069056 | |||
| 2323 | Ga0439453_0112318 | |||
| 2324 | Ga0439461_0007295 | |||
| 2325 | Ga0439461_0039529 | |||
| 2326 | Ga0439466_0002724 | |||
| 2327 | Ga0439466_0029059 | |||
| 2328 | Ga0439465_0000697 | |||
| 2329 | Ga0439465_0158898 | |||
| 2330 | Ga0451791_0048952 | |||
| 2331 | Ga0451791_0161335 | |||
| 2332 | Ga0451791_0556048 | |||
| 2333 | Ga0451795_0737557 | |||
| 2334 | Ga0451798_0323142 | |||
| 2335 | Ga0451798_0874703 | |||
| 2336 | Ga0451800_1002931 | |||
| 2337 | Ga0451802_0951491 | |||
| 2338 | Ga0451804_0177276 | |||
| 2339 | Ga0451807_0702505 | |||
| 2340 | Ga0451807_2769446 | |||
| 2341 | Ga0451837_0270258 | |||
| 2342 | Ga0451841_0605841 | |||
| 2343 | Ga0451853_0781326 | |||
| 2344 | Ga0451853_1406326 | |||
| 2345 | Ga0439431_0000916 | |||
| 2346 | Ga0439433_0000360 | |||
| 2347 | Ga0439442_043551 | |||
| 2348 | Ga0439445_0000835 | |||
| 2349 | Ga0439432_003052 | |||
| 2350 | Ga0439432_041101 | |||
| 2351 | Ga0439432_058874 | |||
| 2352 | Ga0439432_095902 | |||
| 2353 | Ga0439449_0001800 | |||
| 2354 | Ga0439449_0002084 | |||
| 2355 | Ga0439449_0003898 | |||
| 2356 | Ga0439449_0045493 | |||
| 2357 | Ga0439449_0117015 | |||
| 2358 | Ga0439449_0129349 | |||
| 2359 | Ga0439452_005500 | |||
| 2360 | Ga0439457_050696 | |||
| 2361 | Ga0439457_148692 | |||
| 2362 | Ga0439462_0010232 | |||
| 2363 | Ga0439462_0012214 | |||
| 2364 | Ga0439462_0016788 | |||
| 2365 | Ga0439462_0043086 | |||
| 2366 | Ga0450911_015379 | |||
| 2367 | Ga0450923_007796 | |||
| 2368 | Ga0450923_026232 | |||
| 2369 | Ga0450890_017336 | |||
| 2370 | Ga0450897_002880 | |||
| 2371 | Ga0450892_031216 | |||
| 2372 | Ga0450896_035602 | |||
| 2373 | Ga0450896_073046 | |||
| 2374 | Ga0450898_021840 | |||
| 2375 | Ga0450898_024326 | |||
| 2376 | Ga0450898_060237 | |||
| 2377 | Ga0450899_056040 | |||
| 2378 | Ga0450900_064598 | |||
| 2379 | Ga0450903_028032 | |||
| 2380 | Ga0450889_010034 | |||
| 2381 | Ga0450906_057370 | |||
| 2382 | Ga0450907_076734 | |||
| 2383 | Ga0450910_029232 | |||
| 2384 | Ga0439446_0030800 | |||
| 2385 | Ga0439458_0208192 | |||
| 2386 | Ga0450908_027994 | |||
| 2387 | Ga0450908_029324 | |||
| 2388 | Ga0450909_018325 | |||
| 2389 | Ga0450909_025797 | |||
| 2390 | Ga0439434_0006641 | |||
| 2391 | Ga0439434_0015679 | |||
| 2392 | Ga0439434_0239773 | |||
| 2393 | Ga0439435_0122893 | |||
| 2394 | Ga0439459_0126576 | |||
| 2395 | Ga0439464_0045092 | |||
| 2396 | Ga0450916_071534 | |||
| 2397 | Ga0450918_008838 | |||
| 2398 | Ga0450918_015446 | |||
| 2399 | Ga0450893_0008574 | |||
| 2400 | Ga0451577_0102644 | |||
| 2401 | Ga0466969_0001061 | |||
| 2402 | Ga0466969_0028559 | |||
| 2403 | Ga0466969_0044262 | |||
| 2404 | Ga0466969_0114007 | |||
| 2405 | Ga0466969_0164122 | |||
| 2406 | Ga0466972_0013487 | |||
| 2407 | Ga0466972_0083032 | |||
| 2408 | Ga0466973_0033105 | |||
| 2409 | Ga0466987_0380323 | |||
| 2410 | Ga0466977_0003105 | |||
| 2411 | Ga0466980_0377899 | |||
| 2412 | Ga0466978_0205280 | |||
| 2413 | Ga0453683_0001701 | |||
| 2414 | Ga0453683_0044583 | |||
| 2415 | Ga0466965_0000058 | |||
| 2416 | Ga0466965_0015986 | |||
| 2417 | Ga0466965_0027458 | |||
| 2418 | Ga0466965_0137171 | |||
| 2419 | Ga0466965_0382410 | |||
| 2420 | Ga0466966_0000105 | |||
| 2421 | Ga0466966_0002891 | |||
| 2422 | Ga0466966_0003848 | |||
| 2423 | Ga0466966_0145163 | |||
| 2424 | Ga0466966_0169162 | |||
| 2425 | Ga0466966_0505440 | |||
| 2426 | Ga0466961_0000830 | |||
| 2427 | Ga0466961_0003527 | |||
| 2428 | Ga0466961_0031401 | |||
| 2429 | Ga0466961_0060402 | |||
| 2430 | Ga0466961_0242885 | |||
| 2431 | Ga0466961_0367344 | |||
| 2432 | Ga0466961_0473454 | |||
| 2433 | Ga0466963_0001295 | |||
| 2434 | Ga0466963_0009593 | |||
| 2435 | Ga0466963_0011977 | |||
| 2436 | Ga0466964_0000916 | |||
| 2437 | Ga0466964_0143271 | |||
| 2438 | Ga0466964_0480707 | |||
| 2439 | Ga0453684_0186703 | |||
| 2440 | Ga0466971_0000697 | |||
| 2441 | Ga0466971_0014817 | |||
| 2442 | Ga0466971_0164014 | |||
| 2443 | Ga0466968_0015116 | |||
| 2444 | Ga0466968_0134829 | |||
| 2445 | Ga0466968_0528445 | |||
| 2446 | Ga0466970_0009409 | |||
| 2447 | Ga0466970_0069899 | |||
| 2448 | Ga0466970_0507568 | |||
| 2449 | Ga0466970_0969497 | |||
| 2450 | Ga0466957_0044912 | |||
| 2451 | Ga0466957_0055259 | |||
| 2452 | Ga0466957_0224488 | |||
| 2453 | Ga0466957_0778328 | |||
| 2454 | Ga0466957_0799191 | |||
| 2455 | Ga0466960_0047904 | |||
| 2456 | Ga0466960_0114997 | |||
| 2457 | Ga0466960_0238987 | |||
| 2458 | Ga0466959_0002991 | |||
| 2459 | Ga0466959_0019940 | |||
| 2460 | Ga0466959_0071272 | |||
| 2461 | Ga0466959_0350891 | |||
| 2462 | Ga0466959_0482242 | |||
| 2463 | Ga0466959_0601687 | |||
| 2464 | Ga0466959_0753550 | |||
| 2465 | Ga0466959_0823296 | |||
| 2466 | Ga0466959_1188036 | |||
| 2467 | Ga0451576_0003667 | |||
| 2468 | Ga0451576_0039875 | |||
| 2469 | Ga0451576_1623204 | |||
| 2470 | Ga0466958_0000397 | |||
| 2471 | Ga0466958_0003121 | |||
| 2472 | Ga0466958_0012111 | |||
| 2473 | Ga0466958_0180950 | |||
| 2474 | Ga0466958_1161891 | |||
| 2475 | Ga0466967_0700689 | |||
| 2476 | Ga0495627_008497 | |||
| 2477 | Ga0495627_048891 | |||
| 2478 | Ga0495592_0008371 | |||
| 2479 | Ga0495592_0015483 | |||
| 2480 | Ga0495592_0024836 | |||
| 2481 | Ga0495592_0029704 | |||
| 2482 | Ga0495603_0014573 | |||
| 2483 | Ga0495603_0014730 | |||
| 2484 | Ga0495603_0018732 | |||
| 2485 | Ga0495603_0459911 | |||
| 2486 | Ga0495603_0730520 | |||
| 2487 | Ga0495590_0003526 | |||
| 2488 | Ga0495590_0014357 | |||
| 2489 | Ga0495590_0114282 | |||
| 2490 | Ga0495591_006545 | |||
| 2491 | Ga0495629_0000699 | |||
| 2492 | Ga0495629_0004896 | |||
| 2493 | Ga0495629_0007518 | |||
| 2494 | Ga0495629_0014090 | |||
| 2495 | Ga0495629_0161581 | |||
| 2496 | Ga0495629_0293790 | |||
| 2497 | Ga0495638_0020717 | |||
| 2498 | Ga0495638_0025340 | |||
| 2499 | Ga0495641_0018430 | |||
| 2500 | Ga0495641_0032203 | |||
| 2501 | Ga0495651_0010951 | |||
| 2502 | Ga0495651_0035257 | |||
| 2503 | Ga0495651_0096325 | |||
| 2504 | Ga0495651_0367885 | |||
| 2505 | Ga0495651_0427811 | |||
| 2506 | Ga0495651_0454344 | |||
| 2507 | Ga0495651_0606477 | |||
| 2508 | Ga0495651_0649296 | |||
| 2509 | Ga0495653_0004371 | |||
| 2510 | Ga0495653_0019073 | |||
| 2511 | Ga0495653_0020344 | |||
| 2512 | Ga0495653_0023382 | |||
| 2513 | Ga0495653_0038116 | |||
| 2514 | Ga0495653_0041534 | |||
| 2515 | Ga0495653_0128482 | |||
| 2516 | Ga0495650_0005860 | |||
| 2517 | Ga0495650_0006791 | |||
| 2518 | Ga0495650_0069930 | |||
| 2519 | Ga0495650_0187419 | |||
| 2520 | Ga0495580_0005845 | |||
| 2521 | Ga0495580_0015501 | |||
| 2522 | Ga0495580_0019975 | |||
| 2523 | Ga0495580_0035742 | |||
| 2524 | Ga0495580_0039103 | |||
| 2525 | Ga0495580_0046673 | |||
| 2526 | Ga0495580_0313640 | |||
| 2527 | Ga0495580_0642145 | |||
| 2528 | Ga0495580_0780620 | |||
| 2529 | Ga0495580_0935165 | |||
| 2530 | Ga0495582_0006818 | |||
| 2531 | Ga0495582_0006929 | |||
| 2532 | Ga0495582_0021021 | |||
| 2533 | Ga0495605_0003385 | |||
| 2534 | Ga0495605_0052863 | |||
| 2535 | Ga0495605_0116674 | |||
| 2536 | Ga0495605_0209240 | |||
| 2537 | Ga0495639_0007187 | |||
| 2538 | Ga0495662_0030353 | |||
| 2539 | Ga0495662_0033594 | |||
| 2540 | Ga0495664_0001134 | |||
| 2541 | Ga0495664_0032759 | |||
| 2542 | Ga0495664_0137099 | |||
| 2543 | Ga0495584_0381463 | |||
| 2544 | Ga0495584_0582433 | |||
| 2545 | Ga0495594_0066235 | |||
| 2546 | Ga0495596_0087053 | |||
| 2547 | Ga0495596_0132519 | |||
| 2548 | Ga0495596_0189257 | |||
| 2549 | Ga0495596_0240131 | |||
| 2550 | Ga0495596_0260129 | |||
| 2551 | Ga0495607_0195157 | |||
| 2552 | Ga0495607_0428878 | |||
| 2553 | Ga0495583_0010369 | |||
| 2554 | Ga0495583_0125616 | |||
| 2555 | Ga0495606_0022364 | |||
| 2556 | Ga0495606_0051212 | |||
| 2557 | Ga0495606_0152487 | |||
| 2558 | Ga0495606_0323529 | |||
| 2559 | Ga0495608_0000977 | |||
| 2560 | Ga0495608_0002097 | |||
| 2561 | Ga0495608_0006540 | |||
| 2562 | Ga0495608_0200744 | |||
| 2563 | Ga0495610_0000715 | |||
| 2564 | Ga0495610_0018746 | |||
| 2565 | Ga0495616_0112983 | |||
| 2566 | Ga0495618_0002666 | |||
| 2567 | Ga0495618_0005178 | |||
| 2568 | Ga0495618_0252310 | |||
| 2569 | Ga0495618_0384772 | |||
| 2570 | Ga0495620_0027211 | |||
| 2571 | Ga0495620_0053589 | |||
| 2572 | Ga0495620_0109892 | |||
| 2573 | Ga0495628_0001590 | |||
| 2574 | Ga0495628_0027909 | |||
| 2575 | Ga0495628_0062966 | |||
| 2576 | Ga0495628_0075213 | |||
| 2577 | Ga0495628_0264069 | |||
| 2578 | Ga0495628_0510859 | |||
| 2579 | Ga0495628_0559908 | |||
| 2580 | Ga0495628_1045263 | |||
| 2581 | Ga0495630_0012575 | |||
| 2582 | Ga0495630_0040223 | |||
| 2583 | Ga0495630_0051980 | |||
| 2584 | Ga0495630_1039274 | |||
| 2585 | Ga0495630_1126923 | |||
| 2586 | Ga0495631_0004184 | |||
| 2587 | Ga0495632_0370925 | |||
| 2588 | Ga0495637_0033627 | |||
| 2589 | Ga0495637_0059393 | |||
| 2590 | Ga0495637_0061714 | |||
| 2591 | Ga0495643_0069608 | |||
| 2592 | Ga0495643_0206400 | |||
| 2593 | Ga0495644_0246061 | |||
| 2594 | Ga0495644_0367726 | |||
| 2595 | Ga0495648_0020262 | |||
| 2596 | Ga0495648_0037684 | |||
| 2597 | Ga0495648_0249495 | |||
| 2598 | Ga0495648_0302585 | |||
| 2599 | Ga0495663_0173443 | |||
| 2600 | Ga0495666_0002472 | |||
| 2601 | Ga0495666_0016275 | |||
| 2602 | Ga0495666_0026285 | |||
| 2603 | Ga0495666_0117402 | |||
| 2604 | Ga0495666_0260108 | |||
| 2605 | Ga0495666_0264378 | |||
| 2606 | Ga0495642_0036207 | |||
| 2607 | Ga0495652_0009989 | |||
| 2608 | Ga0495652_0024538 | |||
| 2609 | Ga0495652_0045692 | |||
| 2610 | Ga0495652_0047731 | |||
| 2611 | Ga0495652_0280039 | |||
| 2612 | Ga0495652_0783465 | |||
| 2613 | Ga0495654_0274783 | |||
| 2614 | Ga0495654_0430366 | |||
| 2615 | Ga0495665_0006454 | |||
| 2616 | Ga0495665_0026900 | |||
| 2617 | Ga0495665_0104699 | |||
| 2618 | Ga0495665_0303959 | |||
| 2619 | Ga0495640_0000851 | |||
| 2620 | Ga0495640_0004804 | |||
| 2621 | Ga0495640_0016285 | |||
| 2622 | Ga0495640_0409452 | |||
| 2623 | Ga0495586_0021076 | |||
| 2624 | Ga0495586_0038693 | |||
| 2625 | Ga0495586_0247494 | |||
| 2626 | Ga0495586_0554778 | |||
| 2627 | Ga0495587_0000960 | |||
| 2628 | Ga0495587_0011859 | |||
| 2629 | Ga0495587_0361621 | |||
| 2630 | Ga0495598_0148486 | |||
| 2631 | Ga0495598_0163957 | |||
| 2632 | Ga0495609_0222275 | |||
| 2633 | Ga0495621_0005377 | |||
| 2634 | Ga0495621_0021528 | |||
| 2635 | Ga0495621_0095242 | |||
| 2636 | Ga0495621_0105052 | |||
| 2637 | Ga0495621_0154444 | |||
| 2638 | Ga0495597_0054590 | |||
| 2639 | Ga0495597_0088918 | |||
| 2640 | Ga0495645_0015174 | |||
| 2641 | Ga0495645_0054506 | |||
| 2642 | Ga0495645_0169307 | |||
| 2643 | Ga0495645_0196372 | |||
| 2644 | Ga0495645_0585237 | |||
| 2645 | Ga0495622_0000227 | |||
| 2646 | Ga0495622_0039221 | |||
| 2647 | Ga0495622_0196771 | |||
| 2648 | Ga0495622_0219706 | |||
| 2649 | Ga0495633_0299127 | |||
| 2650 | Ga0495667_0056929 | |||
| 2651 | Ga0495667_0102806 | |||
| 2652 | Ga0495656_0003255 | |||
| 2653 | Ga0495656_0083694 | |||
| 2654 | Ga0495656_0578374 | |||
| 2655 | Ga0495668_0111648 | |||
| 2656 | Ga0495668_0322559 | |||
| 2657 | Ga0495634_0032070 | |||
| 2658 | Ga0495634_0085634 | |||
| 2659 | Ga0495634_0373293 | |||
| 2660 | Ga0495634_0519592 | |||
| 2661 | Ga0495611_0078845 | |||
| 2662 | Ga0495611_0282706 | |||
| 2663 | Ga0495625_0000896 | |||
| 2664 | Ga0495625_0098277 | |||
| 2665 | Ga0495625_0195788 | |||
| 2666 | Ga0495625_0371481 | |||
| 2667 | Ga0495625_0610611 | |||
| 2668 | Ga0495635_0004478 | |||
| 2669 | Ga0495635_0102750 | |||
| 2670 | Ga0495635_0147442 | |||
| 2671 | Ga0495635_0356059 | |||
| 2672 | Ga0495661_0003464 | |||
| 2673 | Ga0495661_0006964 | |||
| 2674 | Ga0495661_0021872 | |||
| 2675 | Ga0495588_0021438 | |||
| 2676 | Ga0495588_0056225 | |||
| 2677 | Ga0495588_0080144 | |||
| 2678 | Ga0495588_0150641 | |||
| 2679 | Ga0495657_0032871 | |||
| 2680 | Ga0495657_0101119 | |||
| 2681 | Ga0495657_0313682 | |||
| 2682 | Ga0495657_0828138 | |||
| 2683 | Ga0495599_0005836 | |||
| 2684 | Ga0495599_0006011 | |||
| 2685 | Ga0495599_0033983 | |||
| 2686 | Ga0495599_0142099 | |||
| 2687 | Ga0495599_0626782 | |||
| 2688 | Ga0495599_0835747 | |||
| 2689 | Ga0495623_0009259 | |||
| 2690 | Ga0495623_0009921 | |||
| 2691 | Ga0495623_0013984 | |||
| 2692 | Ga0495623_0027409 | |||
| 2693 | Ga0495623_0034735 | |||
| 2694 | Ga0495646_0006968 | |||
| 2695 | Ga0495646_0008406 | |||
| 2696 | Ga0495646_0012704 | |||
| 2697 | Ga0495646_0015901 | |||
| 2698 | Ga0495646_0019173 | |||
| 2699 | Ga0495646_0123552 | |||
| 2700 | Ga0495646_0278287 | |||
| 2701 | Ga0495646_0477850 | |||
| 2702 | Ga0495646_0689624 | |||
| 2703 | Ga0495658_0377724 | |||
| 2704 | Ga0495658_0556919 | |||
| 2705 | Ga0495669_0071226 | |||
| 2706 | Ga0495669_0131520 | |||
| 2707 | Ga0495669_0326367 | |||
| 2708 | Ga0495669_0403404 | |||
| 2709 | Ga0495613_0000727 | |||
| 2710 | Ga0495613_0075915 | |||
| 2711 | Ga0495613_0095415 | |||
| 2712 | Ga0495613_0124829 | |||
| 2713 | Ga0495624_0002244 | |||
| 2714 | Ga0495624_0009113 | |||
| 2715 | Ga0495624_0015384 | |||
| 2716 | Ga0495624_0018007 | |||
| 2717 | Ga0495624_0020073 | |||
| 2718 | Ga0495624_0035525 | |||
| 2719 | Ga0495624_0434387 | |||
| 2720 | Ga0495624_0643852 | |||
| 2721 | Ga0495670_0477969 | |||
| 2722 | Ga0495671_0009212 | |||
| 2723 | Ga0495671_0012054 | |||
| 2724 | Ga0495671_0144411 | |||
| 2725 | Ga0495671_0251807 | |||
| 2726 | Ga0495649_0015513 | |||
| 2727 | Ga0495649_0053783 | |||
| 2728 | Ga0495649_0095199 | |||
| 2729 | Ga0495649_0121404 | |||
| 2730 | Ga0495649_0355832 | |||
| 2731 | Ga0495589_0001853 | |||
| 2732 | Ga0495589_0082302 | |||
| 2733 | Ga0495589_0087777 | |||
| 2734 | Ga0495600_0000837 | |||
| 2735 | Ga0495600_0040137 | |||
| 2736 | Ga0495600_0108769 | |||
| 2737 | Ga0495600_0238148 | |||
| 2738 | Ga0495600_0300147 | |||
| 2739 | Ga0495660_0096851 | |||
| 2740 | Ga0495660_0207985 | |||
| 2741 | Ga0495660_0455873 | |||
| 2742 | Ga0495581_0000459 | |||
| 2743 | Ga0495581_0013072 | |||
| 2744 | Ga0495581_0237450 | |||
| 2745 | Ga0495604_0001208 | |||
| 2746 | Ga0495604_0017126 | |||
| 2747 | Ga0495604_0025084 | |||
| 2748 | Ga0495604_0063217 | |||
| 2749 | Ga0495604_0100869 | |||
| 2750 | Ga0495604_0229972 | |||
| 2751 | Ga0495604_0432499 | |||
| 2752 | Ga0495604_0552236 | |||
| 2753 | Ga0495604_0639677 | |||
| 2754 | Ga0495674_0062259 | |||
| 2755 | Ga0495674_0086127 | |||
| 2756 | Ga0495674_0087641 | |||
| 2757 | Ga0495674_0107707 | |||
| 2758 | Ga0495674_0111436 | |||
| 2759 | Ga0495674_0171456 | |||
| 2760 | Ga0495674_0510485 | |||
| 2761 | Ga0495672_0032972 | |||
| 2762 | Ga0495672_0060806 | |||
| 2763 | Ga0495672_0216212 | |||
| 2764 | Ga0495672_0256739 | |||
| 2765 | Ga0495672_0539221 | |||
| 2766 | Ga0495676_0000690 | |||
| 2767 | Ga0495676_0010669 | |||
| 2768 | Ga0495676_0026895 | |||
| 2769 | Ga0495676_0297396 | |||
| 2770 | Ga0495676_0475453 | |||
| 2771 | Ga0495676_0659560 | |||
| 2772 | Ga0495676_0771182 | |||
| 2773 | Ga0495680_0001210 | |||
| 2774 | Ga0495680_0005577 | |||
| 2775 | Ga0495680_0010573 | |||
| 2776 | Ga0495680_0021462 | |||
| 2777 | Ga0495680_0537162 | |||
| 2778 | Ga0495683_0004492 | |||
| 2779 | Ga0495683_0008226 | |||
| 2780 | Ga0495683_0011154 | |||
| 2781 | Ga0495683_0033199 | |||
| 2782 | Ga0495683_0080549 | |||
| 2783 | Ga0495683_0087622 | |||
| 2784 | Ga0495683_0314224 | |||
| 2785 | Ga0495687_025522 | |||
| 2786 | Ga0495687_027539 | |||
| 2787 | Ga0495687_078157 | |||
| 2788 | Ga0495687_098960 | |||
| 2789 | Ga0495675_0004622 | |||
| 2790 | Ga0495675_0006887 | |||
| 2791 | Ga0495675_0011293 | |||
| 2792 | Ga0495675_0088294 | |||
| 2793 | Ga0495675_0857074 | |||
| 2794 | Ga0495677_0122407 | |||
| 2795 | Ga0495677_0253758 | |||
| 2796 | Ga0495677_0440598 | |||
| 2797 | Ga0495679_000782 | |||
| 2798 | Ga0495679_001796 | |||
| 2799 | Ga0495679_009381 | |||
| 2800 | Ga0495679_048958 | |||
| 2801 | Ga0495673_0016174 | |||
| 2802 | Ga0495673_0026376 | |||
| 2803 | Ga0495673_0289396 | |||
| 2804 | Ga0495681_0046925 | |||
| 2805 | Ga0495681_0191278 | |||
| 2806 | Ga0495684_0019826 | |||
| 2807 | Ga0495686_0031854 | |||
| 2808 | Ga0495686_0033165 | |||
| 2809 | Ga0495593_0004404 | |||
| 2810 | Ga0495593_0026770 | |||
| 2811 | Ga0495593_0047170 | |||
| 2812 | Ga0495593_0065165 | |||
| 2813 | Ga0495593_0104860 | |||
| 2814 | Ga0495593_0120960 | |||
| 2815 | Ga0495602_0004187 | |||
| 2816 | Ga0495602_0006799 | |||
| 2817 | Ga0495602_0026312 | |||
| 2818 | Ga0495602_0066379 | |||
| 2819 | Ga0495602_0114076 | |||
| 2820 | Ga0495602_0125755 | |||
| 2821 | Ga0495602_0173576 | |||
| 2822 | Ga0495602_0238847 | |||
| 2823 | Ga0495602_0373330 | |||
| 2824 | Ga0495602_0551317 | |||
| 2825 | Ga0495614_0003278 | |||
| 2826 | Ga0495614_0003316 | |||
| 2827 | Ga0495614_0008194 | |||
| 2828 | Ga0495614_0044355 | |||
| 2829 | Ga0495614_0197018 | |||
| 2830 | Ga0495615_0287790 | |||
| 2831 | Ga0495615_0290350 | |||
| 2832 | Ga0495626_0021459 | |||
| 2833 | Ga0495626_0035111 | |||
| 2834 | Ga0496100_0007340 | |||
| 2835 | Ga0496101_0010034 | |||
| 2836 | Ga0496101_0031149 | |||
| 2837 | Ga0496101_0134927 | |||
| 2838 | Ga0496101_0470949 | |||
| 2839 | Ga0496102_0027035 | |||
| 2840 | Ga0496102_0037838 | |||
| 2841 | Ga0496102_0105008 | |||
| 2842 | Ga0496102_0435824 | |||
| 2843 | Ga0496102_0503617 | |||
| 2844 | Ga0496102_0878975 | |||
| 2845 | Ga0496102_1194916 | |||
| 2846 | Ga0496103_0003901 | |||
| 2847 | Ga0496103_0011464 | |||
| 2848 | Ga0496103_0011709 | |||
| 2849 | Ga0496103_0108330 | |||
| 2850 | Ga0496103_0684404 | |||
| 2851 | Ga0496104_0013570 | |||
| 2852 | Ga0496104_0020850 | |||
| 2853 | Ga0496104_0243519 | |||
| 2854 | Ga0496104_0666406 | |||
| 2855 | Ga0496105_0003439 | |||
| 2856 | Ga0496105_0204184 | |||
| 2857 | Ga0496106_0000029 | |||
| 2858 | Ga0496106_0016044 | |||
| 2859 | Ga0496106_0128344 | |||
| 2860 | Ga0496107_0073245 | |||
| 2861 | Ga0496107_0176569 | |||
| 2862 | Ga0496107_0552325 | |||
| 2863 | Ga0496107_0740350 | |||
| 2864 | Ga0496108_0063024 | |||
| 2865 | Ga0496108_0154733 | |||
| 2866 | Ga0496108_1355200 | |||
| 2867 | Ga0496109_0773107 | |||
| 2868 | Ga0496109_1894690 | |||
| 2869 | Ga0496110_0139448 | |||
| 2870 | Ga0496110_0201515 | |||
| 2871 | Ga0496110_0705675 | |||
| 2872 | Ga0496111_0403099 | |||
| 2873 | Ga0496112_0052273 | |||
| 2874 | Ga0496112_0101870 | |||
| 2875 | Ga0496112_0936938 | |||
| 2876 | Ga0496113_0020740 | |||
| 2877 | Ga0496114_0289103 | |||
| 2878 | Ga0496114_0391590 | |||
| 2879 | Ga0496115_0464063 | |||
| 2880 | Ga0496115_0486097 | |||
| 2881 | Ga0496116_0011329 | |||
| 2882 | Ga0496116_0129945 | |||
| 2883 | Ga0496116_0130601 | |||
| 2884 | Ga0496116_0141146 | |||
| 2885 | Ga0496116_0176674 | |||
| 2886 | Ga0496116_0179001 | |||
| 2887 | Ga0496116_0417694 | |||
| 2888 | Ga0496117_0024726 | |||
| 2889 | Ga0496117_0028598 | |||
| 2890 | Ga0496117_0048496 | |||
| 2891 | Ga0496117_0097767 | |||
| 2892 | Ga0496117_0119509 | |||
| 2893 | Ga0496117_0174184 | |||
| 2894 | Ga0496117_0212771 | |||
| 2895 | Ga0496117_0230533 | |||
| 2896 | Ga0496117_0373914 | |||
| 2897 | Ga0496118_0003596 | |||
| 2898 | Ga0496118_0004215 | |||
| 2899 | Ga0496118_0010125 | |||
| 2900 | Ga0496118_0010300 | |||
| 2901 | Ga0496118_0023632 | |||
| 2902 | Ga0496118_0030038 | |||
| 2903 | Ga0496118_0103671 | |||
| 2904 | Ga0496118_0254597 | |||
| 2905 | Ga0496118_0372407 | |||
| 2906 | Ga0496118_0452901 | |||
| 2907 | Ga0496119_0060099 | |||
| 2908 | Ga0496120_0086576 | |||
| 2909 | Ga0496120_0314958 | |||
| 2910 | Ga0496121_0017765 | |||
| 2911 | Ga0496121_0033036 | |||
| 2912 | Ga0496121_0052767 | |||
| 2913 | Ga0496121_0055271 | |||
| 2914 | Ga0496121_0066491 | |||
| 2915 | Ga0496121_0070584 | |||
| 2916 | Ga0496121_0195498 | |||
| 2917 | Ga0496121_0276966 | |||
| 2918 | Ga0496121_0637886 | |||
| 2919 | Ga0496122_0064753 | |||
| 2920 | Ga0496122_0191029 | |||
| 2921 | Ga0496122_0446430 | |||
| 2922 | Ga0496122_0556998 | |||
| 2923 | Ga0496123_0049882 | |||
| 2924 | Ga0496123_0053888 | |||
| 2925 | Ga0496123_0170044 | |||
| 2926 | Ga0496123_0272488 | |||
| 2927 | Ga0496124_0108059 | |||
| 2928 | Ga0496124_0145910 | |||
| 2929 | Ga0496124_0162783 | |||
| 2930 | Ga0496124_0253740 | |||
| 2931 | Ga0496124_0253926 | |||
| 2932 | Ga0496125_0020173 | |||
| 2933 | Ga0496125_0035025 | |||
| 2934 | Ga0496125_0399100 | |||
| 2935 | Ga0496125_0663273 | |||
| 2936 | Ga0496125_0731488 | |||
| 2937 | Ga0496126_0000192 | |||
| 2938 | Ga0496126_0015457 | |||
| 2939 | Ga0496126_0019787 | |||
| 2940 | Ga0501310_073528 | |||
| 2941 | Ga0495678_019117 | |||
| 2942 | Ga0495678_040459 | |||
| 2943 | Ga0495682_0043650 | |||
| 2944 | Ga0495682_0051269 | |||
| 2945 | Ga0495682_0065984 | |||
| 2946 | Ga0495682_0184191 | |||
| 2947 | Ga0501031_0130976 | |||
| 2948 | Ga0501032_0214316 | |||
| 2949 | Ga0501032_0332404 | |||
| 2950 | Ga0501034_0965199 | |||
| 2951 | Ga0501036_0067942 | |||
| 2952 | Ga0501037_0375569 | |||
| 2953 | Ga0501043_0141444 | |||
| 2954 | Ga0501043_0546238 | |||
| 2955 | Ga0501046_0388601 | |||
| 2956 | Ga0501046_0573466 | |||
| 2957 | Ga0501047_0048109 | |||
| 2958 | Ga0501047_0787930 | |||
| 2959 | Ga0501047_0875914 | |||
| 2960 | Ga0501048_0923800 | |||
| 2961 | Ga0501249_011563 | |||
| 2962 | Ga0501225_0090908 | |||
| 2963 | Ga0501262_000153 | |||
| 2964 | Ga0501266_006089 | |||
| 2965 | Ga0501035_0590911 | |||
| 2966 | Ga0501044_0127969 | |||
| 2967 | Ga0501044_0154548 | |||
| 2968 | Ga0501044_0344799 | |||
| 2969 | Ga0501044_0457318 | |||
| 2970 | Ga0501044_0615653 | |||
| 2971 | Ga0501044_1323512 | |||
| 2972 | Ga0501044_1448993 | |||
| 2973 | nmdc:mga03683_10250_c1 | |||
| 2974 | nmdc:mga03683_122491_c1 | |||
| 2975 | nmdc:mga03683_132698_c1 | |||
| 2976 | nmdc:mga03683_134288_c1 | |||
| 2977 | nmdc:mga03683_55542_c1 | |||
| 2978 | nmdc:mga03683_571549_c1 | |||
| 2979 | nmdc:mga03683_7155_c1 | |||
| 2980 | nmdc:mga03n38_195531_c1 | |||
| 2981 | nmdc:mga03n38_48437_c1 | |||
| 2982 | nmdc:mga03n38_574910_c1 | |||
| 2983 | nmdc:mga03n38_728230_c1 | |||
| 2984 | nmdc:mga00v17_120674_c1 | |||
| 2985 | nmdc:mga00v17_21047_c1 | |||
| 2986 | nmdc:mga00v17_485302_c1 | |||
| 2987 | nmdc:mga00v17_78656_c1 | |||
| 2988 | nmdc:mga00v17_869000_c1 | |||
| 2989 | nmdc:mga00v17_964515_c1 | |||
| 2990 | nmdc:mga0yw44_20195_c1 | |||
| 2991 | nmdc:mga0yw44_24525_c1 | |||
| 2992 | nmdc:mga0yw44_28625_c1 | |||
| 2993 | nmdc:mga0yw44_58591_c1 | |||
| 2994 | nmdc:mga0k408_120636_c1 | |||
| 2995 | nmdc:mga0k408_175015_c1 | |||
| 2996 | nmdc:mga0k408_31432_c1 | |||
| 2997 | nmdc:mga0k408_41811_c1 | |||
| 2998 | nmdc:mga0k408_425399_c1 | |||
| 2999 | nmdc:mga0k408_53897_c1 | |||
| 3000 | nmdc:mga06z11_277517_c1 | |||
| 3001 | nmdc:mga06z11_57687_c1 | |||
| 3002 | nmdc:mga06z11_939509_c1 | |||
| 3003 | nmdc:mga04h51_139923_c1 | |||
| 3004 | nmdc:mga04h51_36942_c1 | |||
| 3005 | nmdc:mga07m45_132318_c1 | |||
| 3006 | nmdc:mga07m45_348594_c1 | |||
| 3007 | nmdc:mga07m45_395746_c1 | |||
| 3008 | nmdc:mga07m45_4880_c1 | |||
| 3009 | nmdc:mga07m45_49399_c1 | |||
| 3010 | nmdc:mga07m45_499_c2 | |||
| 3011 | nmdc:mga07m45_546254_c1 | |||
| 3012 | nmdc:mga07m45_5785_c1 | |||
| 3013 | nmdc:mga07m45_8907_c1 | |||
| 3014 | nmdc:mga07m45_91600_c1 | |||
| 3015 | nmdc:mga09592_490666_c1 | |||
| 3016 | nmdc:mga0qj67_534819_c1 | |||
| 3017 | nmdc:mga0sz30_158742_c1 | |||
| 3018 | nmdc:mga0sz30_172506_c1 | |||
| 3019 | Ga0495601_0009150 | |||
| 3020 | Ga0500610_0006171 | |||
| 3021 | Ga0500610_0006176 | |||
| 3022 | Ga0500610_0013178 | |||
| 3023 | Ga0495655_0246682 | |||
| 3024 | Ga0495619_0853236 | |||
| 3025 | Ga0500643_026394 | |||
| 3026 | Ga0500644_0002098 | |||
| 3027 | Ga0500651_0000449 | |||
| 3028 | Ga0500651_0027085 | |||
| 3029 | Ga0500566_0022690 | |||
| 3030 | Ga0500566_0235304 | |||
| 3031 | Ga0500641_0265634 | |||
| 3032 | Ga0500650_0290196 | |||
| 3033 | Ga0500560_065982 | |||
| 3034 | Ga0500562_036326 | |||
| 3035 | Ga0500569_099361 | |||
| 3036 | Ga0500571_000954 | |||
| 3037 | Ga0500572_191414 | |||
| 3038 | Ga0500593_003907 | |||
| 3039 | Ga0500593_008376 | |||
| 3040 | Ga0500594_0030544 | |||
| 3041 | Ga0500595_003291 | |||
| 3042 | Ga0500597_116440 | |||
| 3043 | Ga0500607_004990 | |||
| 3044 | Ga0500607_166797 | |||
| 3045 | Ga0500608_004926 | |||
| 3046 | Ga0500608_006421 | |||
| 3047 | Ga0500626_083514 | |||
| 3048 | Ga0500628_009378 | |||
| 3049 | Ga0500652_389968 | |||
| 3050 | Ga0500655_000523 | |||
| 3051 | Ga0500658_0002041 | |||
| 3052 | Ga0500659_0332007 | |||
| 3053 | Ga0500561_0026946 | |||
| 3054 | Ga0500574_000756 | |||
| 3055 | Ga0500574_006374 | |||
| 3056 | Ga0500586_167286 | |||
| 3057 | Ga0500588_0069659 | |||
| 3058 | Ga0500604_0050128 | |||
| 3059 | Ga0500616_0091761 | |||
| 3060 | Ga0500619_001546 | |||
| 3061 | Ga0500619_097310 | |||
| 3062 | Ga0500620_280797 | |||
| 3063 | Ga0500624_009867 | |||
| 3064 | Ga0500627_0000962 | |||
| 3065 | Ga0500633_0184266 | |||
| 3066 | Ga0500634_0006145 | |||
| 3067 | Ga0500634_0013201 | |||
| 3068 | Ga0500638_003903 | |||
| 3069 | Ga0500636_0077064 | |||
| 3070 | Ga0500625_149092 | |||
| 3071 | Ga0500645_002856 | |||
| 3072 | Ga0500645_011518 | |||
| 3073 | Ga0500645_013521 | |||
| 3074 | Ga0500645_042612 | |||
| 3075 | Ga0500565_006966 | |||
| 3076 | Ga0500596_037598 | |||
| 3077 | Ga0500661_010597 | |||
| 3078 | Ga0466962_0001204 | |||
| 3079 | Ga0466962_0010772 | |||
| 3080 | Ga0466962_0360735 | |||
| 3081 | Ga0466962_0637543 | |||
| 3082 | 2501082222 | |||
| 3083 | 2509128682 | |||
| 3084 | 2510250893 | |||
| 3085 | 2511086431 | |||
| 3086 | 2512346213 | |||
| 3087 | 2513960922 | |||
| 3088 | 2514048113 | |||
| 3089 | 2515679665 | |||
| 3090 | 2515692518 | |||
| 3091 | 2516020346 | |||
| 3092 | 2527075159 | |||
| 3093 | 2563062991 | |||
| 3094 | 2713477190 | |||
| 3095 | 2719640028 | |||
| 3096 | 2738820769 | |||
| 3097 | 2738833249 | |||
| 3098 | 2738874777 | |||
| 3099 | 2739186406 | |||
| 3100 | 2739221375 | |||
| 3101 | 2739252175 | |||
| 3102 | 2746089644 | |||
| 3103 | 2746097899 | |||
| 3104 | 2753570346 | |||
| 3105 | 2792836436 | |||
| 3106 | 2819541476 | |||
| 3107 | 2819620210 | |||
| 3108 | 2883088896 | |||
| 3109 | 2885278733 | |||
| 3110 | 2900635047 | |||
| 3111 | 2902689687 | |||
| 3112 | 2904484925 | |||
| 3113 | 2904617114 | |||
| 3114 | 2919530648 | |||
| 3115 | 2928110231 | |||
| 3116 | 2928138635 | |||
| 3117 | 2928505279 | |||
| 3118 | 2945936946 | |||
| 3119 | 2974322607 | |||
| 3120 | 2990706329 | |||
| 3121 | 642423150 | |||
| 3122 | 642592710 | |||
| 3123 | 642621372 | |||
| 3124 | 8003955446 | |||
| 3125 | 8055268275 | |||
| 3126 | 8055302407 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8595 | 4 | 85 |
| 5djo-assembly1.cif.gz_A | crystal structure of the cc1-fha tandem of kinesin-3 kif13a | 0.8427 | 55 | 78 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.842 | 1 | 85 |
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8399 | 4 | 85 |
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8344 | 2 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9068 | 3 | 85 | 3.10.20.30 |
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8857 | 3 | 85 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8792 | 4 | 82 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8582 | 4 | 82 | 3.10.20.30 |
| af_A0A0B4J391_26_106_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8552 | 1 | 85 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2Q0Y1-F1-model_v4 | Molybdopterin synthase subunit MoaD | 1.005 | 1 | 85 |
|
| AF-A0A226WK61-F1-model_v4 | Molybdenum cofactor biosynthesis protein MoaD | 1.003 | 1 | 85 |
|
| AF-A0A658R4Q9-F1-model_v4 | Molybdopterin converting factor subunit 1 | 1.003 | 1 | 85 |
|
| AF-A0A3A0F957-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 1.003 | 1 | 85 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A4R5W6M9-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 1.002 | 1 | 85 |
GO:0000166
GO:0006777 GO:1990133 |