F494783

General Info

Members Datasets Scaffolds Average Seq Length
1563 584 3126 84

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0375240|Ga0395900_0375240_547_858
Length 103
Sequence MSLPGRPKGEHLQAQPEGAPVTVSIRYFASVREAVGQGSEAVQTRSETLGGLRDELIARGEPHASALARGKAVRMALDQVMSDESAALREGCEVAFFPPVTGG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
115 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
131 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
142 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
222 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
231 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
232 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
233 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
234 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
235 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
236 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
237 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
238 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
239 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
240 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
241 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
242 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
259 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
267 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
268 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
269 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
270 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
271 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
272 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
275 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
276 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
277 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
278 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
279 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
280 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
281 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
282 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
283 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
284 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
285 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
286 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
287 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
288 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
291 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
292 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
293 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
294 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
295 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
296 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
297 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
298 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
299 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
300 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
301 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
302 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
303 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
304 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
305 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
306 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
307 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
308 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
309 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
310 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
311 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
312 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
313 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
314 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
315 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
316 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
317 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
322 3300044665 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC1E Metagenome Unclassified
323 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
324 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
325 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
326 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
327 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
328 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
329 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
330 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
331 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
332 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
333 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
334 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
335 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
336 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
337 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
338 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
339 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
340 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
346 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
347 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
348 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
349 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
350 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
351 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
352 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
353 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
354 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
355 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
356 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
357 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
358 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
359 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
362 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
363 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
369 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
370 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
371 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
374 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
377 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
378 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
379 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
380 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
381 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
382 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
383 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
384 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
385 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
386 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
387 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
388 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
389 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
390 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
391 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
392 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
393 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
394 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
395 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
398 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
399 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
400 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
401 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
402 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
403 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
404 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
405 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
406 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
407 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
408 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
409 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
410 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
415 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
416 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
420 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
421 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
422 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
423 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
424 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
425 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
426 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
427 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
428 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
429 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
430 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
431 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
432 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
433 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
434 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
435 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
436 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
437 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
438 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
439 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
440 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
441 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
442 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
443 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
444 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
445 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
446 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
447 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
448 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
449 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
450 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
451 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
452 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
453 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
454 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
455 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
456 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
457 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
458 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
459 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
460 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
466 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
467 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
477 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
478 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
479 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
480 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
482 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
483 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
484 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
485 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
486 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
487 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
488 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
489 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
490 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
491 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
492 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
493 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
494 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
495 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
496 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
497 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
498 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
499 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
500 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
501 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
502 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
503 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
504 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
505 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
506 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
507 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
508 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
509 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
510 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
511 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
512 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
513 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
514 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
515 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
516 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
517 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
518 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
519 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
520 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
521 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
522 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
523 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
524 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
525 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
526 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
527 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
528 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
529 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
530 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
531 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
532 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
533 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
534 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
535 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
536 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
537 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
538 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
539 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
540 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
541 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
542 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
543 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
544 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
545 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
546 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
547 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
548 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
549 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
550 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
551 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
552 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
553 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
554 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
555 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
556 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
557 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
558 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
559 2738543013 Variovorax sp. BT01 Isolate Unclassified
560 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
561 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
562 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
563 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
564 2818991436 Collimonas arenae 515 Isolate Unclassified
565 2818991450 Burkholderia sp. 604 Isolate Unclassified
566 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
567 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
568 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
569 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
570 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
571 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
572 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
573 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
574 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
575 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
576 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
577 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
578 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
579 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
580 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
581 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
582 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
583 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
584 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 0.77
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.46
Nodule 1.22
Rhizoplane 3.77
Rhizosphere 61.23
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0375240 3300037418 Bacteria 1391
2 JGI24740J21852_10004178 3300001979 Bacteria 6235
3 JGI24739J22299_10002177 3300001989 Bacteria 7516
4 JGI24739J22299_10052521 3300001989 Bacteria 1311
5 JGI24737J22298_10080653 3300001990 Bacteria 968
6 JGI24737J22298_10134265 3300001990 Bacteria 731
7 JGI24735J21928_10007831 3300002067 Bacteria 3472
8 JGI24735J21928_10053098 3300002067 Bacteria 1169
9 JGI24738J21930_10020114 3300002075 Bacteria 1388
10 JGI25155J39150_1000074 3300002704 Bacteria 62438
11 JGI25156J39149_1000002 3300002705 Bacteria 343501
12 JGI25156J39149_1000832 3300002705 Bacteria 15585
13 JGI25156J39149_1001354 3300002705 Bacteria 10510
14 JGI25156J39149_1002530 3300002705 Bacteria 6504
15 JGI25154J39366_1000010 3300002738 Bacteria 297985
16 JGI25157J39369_1000001 3300002741 Bacteria 363277
17 JGI25163J39215_1004817 3300002771 Bacteria 910
18 JGI25152J39213_1004751 3300002773 Bacteria 4182
19 JGI25152J39213_1018459 3300002773 Bacteria 1289
20 JGI25150J39212_1001868 3300002774 Bacteria 5553
21 JGI25159J45721_1000465 3300002987 Bacteria 18688
22 JGI25159J45721_1005036 3300002987 Bacteria 4218
23 JGI25159J45721_1008645 3300002987 Bacteria 2775
24 JGI25159J45721_1010302 3300002987 Bacteria 2391
25 JGI25151J46595_10004722 3300003187 Bacteria 7159
26 JGI25151J46595_10007240 3300003187 Bacteria 5460
27 JGI25151J46595_10011024 3300003187 Bacteria 4173
28 JGI25151J46595_10025444 3300003187 Bacteria 2408
29 JGI25151J46595_10048668 3300003187 Bacteria 1463
30 JGI25151J46595_10055085 3300003187 Bacteria 1313
31 JGI25151J46595_10055090 3300003187 Bacteria 1313
32 JGI25151J46595_10095461 3300003187 Bacteria 815
33 JGI25165J46597_1000122 3300003214 Bacteria 132559
34 JGI25165J46597_1003773 3300003214 Bacteria 3562
35 JGI25153J46596_10010535 3300003215 Bacteria 4173
36 JGI25153J46596_10017438 3300003215 Bacteria 2829
37 JGI25153J46596_10045306 3300003215 Bacteria 1313
38 rootH1_10067293 3300003316 Bacteria 1590
39 rootH2_10162484 3300003320 Bacteria 4537
40 rootL2_10092707 3300003322 Bacteria 1589
41 rootL2_10160743 3300003322 Bacteria 2000
42 rootH1_10248647 3300003323 Bacteria 1572
43 JGI25160J50197_1000192 3300003354 Bacteria 51376
44 JGI25160J50197_1007623 3300003354 Bacteria 4218
45 JGI25160J50197_1017692 3300003354 Bacteria 2248
46 JGI25160J50197_1033752 3300003354 Bacteria 1282
47 JGI25160J50197_1036495 3300003354 Bacteria 1191
48 JGI25161J50226_1000043 3300003374 Bacteria 120741
49 JGI25161J50226_1001441 3300003374 Bacteria 7147
50 JGI25161J50226_1004787 3300003374 Bacteria 2769
51 Ga0006562J51391_1157498 3300003578 Bacteria 4000
52 Ga0006562J51391_1157500 3300003578 Bacteria 2940
53 Ga0006562J51391_1170727 3300003578 Bacteria 2470
54 Ga0006562J51391_1170728 3300003578 Bacteria 2250
55 Ga0055538_1000048 3300003751 Bacteria 132559
56 Ga0055539_1000070 3300003752 Bacteria 132559
57 Ga0055533_1000078 3300003756 Bacteria 132559
58 Ga0055533_1000217 3300003756 Bacteria 41969
59 Ga0055533_1001154 3300003756 Bacteria 7476
60 Ga0055532_1000027 3300003758 Bacteria 234571
61 Ga0055532_1003249 3300003758 Bacteria 2883
62 Ga0055525_1000106 3300003759 Bacteria 132559
63 Ga0055527_1000019 3300003760 Bacteria 234571
64 Ga0055527_1001078 3300003760 Bacteria 6431
65 Ga0055535_1000021 3300003761 Bacteria 234571
66 Ga0055535_1000392 3300003761 Bacteria 41361
67 Ga0055535_1002465 3300003761 Bacteria 6431
68 Ga0055542_1000032 3300003762 Bacteria 234571
69 Ga0055542_1000033 3300003762 Bacteria 233997
70 Ga0055542_1001104 3300003762 Bacteria 16252
71 Ga0055529_1000038 3300003763 Bacteria 234571
72 Ga0055529_1001039 3300003763 Bacteria 13080
73 Ga0055526_1003998 3300003771 Bacteria 9074
74 Ga0055526_1004562 3300003771 Bacteria 8269
75 Ga0055526_1010656 3300003771 Bacteria 4248
76 Ga0055526_1011784 3300003771 Bacteria 3889
77 Ga0055526_1085415 3300003771 Bacteria 606
78 Ga0055537_1000259 3300003773 Bacteria 38671
79 Ga0055537_1001161 3300003773 Bacteria 11265
80 Ga0055537_1004117 3300003773 Bacteria 4248
81 Ga0055537_1004429 3300003773 Bacteria 4020
82 Ga0055537_1012744 3300003773 Bacteria 1620
83 Ga0055537_1012749 3300003773 Bacteria 1620
84 Ga0055524_1000156 3300003775 Bacteria 79669
85 Ga0055524_1008536 3300003775 Bacteria 4248
86 Ga0055524_1009658 3300003775 Bacteria 3900
87 Ga0055536_1000270 3300003781 Bacteria 39711
88 Ga0055536_1003726 3300003781 Bacteria 8079
89 Ga0055536_1008866 3300003781 Bacteria 4252
90 Ga0055536_1009172 3300003781 Bacteria 4134
91 Ga0055536_1072764 3300003781 Bacteria 673
92 Ga0055536_1102973 3300003781 Bacteria 508
93 Ga0055534_1001138 3300003784 Bacteria 11269
94 Ga0055534_1004201 3300003784 Bacteria 4248
95 Ga0055534_1005776 3300003784 Bacteria 3242
96 Ga0055534_1006046 3300003784 Bacteria 3119
97 Ga0055534_1016835 3300003784 Bacteria 1303
98 Ga0055534_1018628 3300003784 Bacteria 1205
99 Ga0055528_1002167 3300003790 Bacteria 10785
100 Ga0055528_1008888 3300003790 Bacteria 4248
101 Ga0055528_1012346 3300003790 Bacteria 3323
102 Ga0055528_1012509 3300003790 Bacteria 3286
103 Ga0055528_1027152 3300003790 Bacteria 1620
104 Ga0055528_1027156 3300003790 Bacteria 1620
105 Ga0055528_1042958 3300003790 Bacteria 988
106 Ga0055530_10000408 3300003791 Bacteria 38218
107 Ga0055530_10003951 3300003791 Bacteria 8020
108 Ga0055530_10009348 3300003791 Bacteria 3781
109 Ga0055530_10052631 3300003791 Bacteria 938
110 Ga0055530_10066045 3300003791 Bacteria 793
111 Ga0055540_1000033 3300003792 Bacteria 172048
112 Ga0055540_1003778 3300003792 Bacteria 7139
113 Ga0055540_1004106 3300003792 Bacteria 6743
114 Ga0055540_1004580 3300003792 Bacteria 6150
115 Ga0055540_1007340 3300003792 Bacteria 4183
116 Ga0055540_1019358 3300003792 Bacteria 1835
117 Ga0055531_10000273 3300003794 Bacteria 53570
118 Ga0055531_10004865 3300003794 Bacteria 8006
119 Ga0055531_10009016 3300003794 Bacteria 5158
120 Ga0055531_10011825 3300003794 Bacteria 4166
121 Ga0055531_10018627 3300003794 Bacteria 2857
122 Ga0055541_1000050 3300003841 Bacteria 132559
123 Ga0055543_1000127 3300004625 Bacteria 63245
124 Ga0055543_1003299 3300004625 Bacteria 4843
125 Ga0055543_1003796 3300004625 Bacteria 4300
126 Ga0055543_1060930 3300004625 Bacteria 605
127 Ga0065165_1009736 3300005262 Bacteria 4256
128 Ga0065165_1018503 3300005262 Bacteria 2519
129 Ga0065165_1021250 3300005262 Bacteria 2260
130 Ga0065165_1024886 3300005262 Bacteria 2001
131 Ga0065165_1025051 3300005262 Bacteria 1992
132 Ga0065165_1034242 3300005262 Bacteria 1572
133 Ga0065165_1040701 3300005262 Bacteria 1383
134 Ga0065714_10090017 3300005288 Bacteria 1955
135 Ga0065704_10193152 3300005289 Bacteria 1180
136 Ga0070658_10706465 3300005327 Bacteria 875
137 Ga0070658_11158888 3300005327 Bacteria 672
138 Ga0070658_11689752 3300005327 Bacteria 548
139 Ga0070676_10341599 3300005328 Bacteria 1027
140 Ga0070690_101777161 3300005330 Bacteria 502
141 Ga0070677_10179772 3300005333 Bacteria 1006
142 Ga0070666_10137585 3300005335 Bacteria 1700
143 Ga0070680_100154059 3300005336 Bacteria 1930
144 Ga0070660_100063427 3300005339 Bacteria 2873
145 Ga0070660_100168320 3300005339 Bacteria 1769
146 Ga0070660_100595492 3300005339 Bacteria 924
147 Ga0070661_100083243 3300005344 Bacteria 2363
148 Ga0070661_100299590 3300005344 Bacteria 1251
149 Ga0070661_100328250 3300005344 Bacteria 1196
150 Ga0070661_101265712 3300005344 Bacteria 618
151 Ga0070668_100235812 3300005347 Bacteria 1514
152 Ga0070675_100168276 3300005354 Bacteria 1889
153 Ga0070671_100012785 3300005355 Bacteria 6770
154 Ga0070674_101416088 3300005356 Bacteria 623
155 Ga0070674_102189676 3300005356 Unclassified 505
156 Ga0070673_100233226 3300005364 Bacteria 1597
157 Ga0070673_100434155 3300005364 Bacteria 1179
158 Ga0070659_100018367 3300005366 Bacteria 5278
159 Ga0070659_100218480 3300005366 Bacteria 1572
160 Ga0070667_100040522 3300005367 Bacteria 3906
161 Ga0070667_100231746 3300005367 Bacteria 1647
162 Ga0070667_100503547 3300005367 Bacteria 1110
163 Ga0070667_100907643 3300005367 Bacteria 820
164 Ga0070714_100375116 3300005435 Bacteria 1340
165 Ga0070714_101404219 3300005435 Bacteria 682
166 Ga0070710_11007259 3300005437 Bacteria 607
167 Ga0070710_11543109 3300005437 Bacteria 500
168 Ga0070711_101616090 3300005439 Bacteria 567
169 Ga0070663_100245416 3300005455 Bacteria 1415
170 Ga0070678_100064383 3300005456 Bacteria 2717
171 Ga0070678_100073147 3300005456 Bacteria 2572
172 Ga0070678_100105961 3300005456 Bacteria 2190
173 Ga0070678_100412401 3300005456 Bacteria 1176
174 Ga0070678_100666988 3300005456 Bacteria 934
175 Ga0070678_101195886 3300005456 Bacteria 705
176 Ga0070662_100036495 3300005457 Bacteria 3477
177 Ga0068867_100425325 3300005459 Bacteria 1126
178 Ga0068867_101568078 3300005459 Bacteria 615
179 Ga0070685_10270880 3300005466 Bacteria 1133
180 Ga0070685_10826288 3300005466 Bacteria 685
181 Ga0070707_100096851 3300005468 Bacteria 2858
182 Ga0070698_100924580 3300005471 Bacteria 818
183 Ga0070679_100430201 3300005530 Bacteria 1265
184 Ga0070679_101451882 3300005530 Bacteria 632
185 Ga0068853_100278882 3300005539 Bacteria 1541
186 Ga0068853_100793031 3300005539 Bacteria 907
187 Ga0068853_100839791 3300005539 Bacteria 881
188 Ga0068853_101463820 3300005539 Bacteria 661
189 Ga0070672_100366925 3300005543 Bacteria 1230
190 Ga0070665_100066688 3300005548 Bacteria 3610
191 Ga0070665_100821073 3300005548 Bacteria 943
192 Ga0070665_101999792 3300005548 Unclassified 585
193 Ga0070665_102491187 3300005548 Bacteria 519
194 Ga0068855_100000737 3300005563 Bacteria 40209
195 Ga0068855_100076757 3300005563 Bacteria 3876
196 Ga0068855_100093546 3300005563 Bacteria 3466
197 Ga0068855_100417759 3300005563 Bacteria 1467
198 Ga0068855_101465270 3300005563 Bacteria 702
199 Ga0068855_101933906 3300005563 Bacteria 597
200 Ga0070664_100013869 3300005564 Bacteria 6570
201 Ga0068857_100892206 3300005577 Bacteria 852
202 Ga0068857_102126836 3300005577 Bacteria 551
203 Ga0068854_101185487 3300005578 Bacteria 684
204 Ga0068856_100841290 3300005614 Bacteria 937
205 Ga0068852_101221107 3300005616 Bacteria 773
206 Ga0068852_101542359 3300005616 Bacteria 687
207 Ga0068866_10710379 3300005718 Bacteria 690
208 Ga0068851_10007730 3300005834 Bacteria 4945
209 Ga0068851_10577226 3300005834 Bacteria 682
210 Ga0068863_101123379 3300005841 Bacteria 791
211 Ga0068863_101418965 3300005841 Bacteria 702
212 Ga0075365_10009476 3300006038 Bacteria 5600
213 Ga0075365_10017566 3300006038 Bacteria 4379
214 Ga0075365_10228304 3300006038 Bacteria 1306
215 Ga0075365_10245891 3300006038 Bacteria 1256
216 Ga0075365_10420339 3300006038 Bacteria 944
217 Ga0075365_11203830 3300006038 Bacteria 533
218 Ga0075368_10045821 3300006042 Bacteria 1728
219 Ga0075368_10183590 3300006042 Bacteria 882
220 Ga0075363_100052346 3300006048 Bacteria 2179
221 Ga0075363_100072252 3300006048 Bacteria 1876
222 Ga0075363_100115150 3300006048 Bacteria 1497
223 Ga0075363_100183871 3300006048 Bacteria 1190
224 Ga0075363_100959450 3300006048 Bacteria 525
225 Ga0075363_100959451 3300006048 Bacteria 525
226 Ga0075364_10025580 3300006051 Bacteria 3758
227 Ga0075364_10468983 3300006051 Bacteria 860
228 Ga0075364_11013112 3300006051 Bacteria 564
229 Ga0075432_10006000 3300006058 Bacteria 4137
230 Ga0075432_10007261 3300006058 Bacteria 3773
231 Ga0075432_10056602 3300006058 Bacteria 1390
232 Ga0075362_10003943 3300006177 Bacteria 5271
233 Ga0075362_10014025 3300006177 Bacteria 3224
234 Ga0075362_10067478 3300006177 Bacteria 1628
235 Ga0075362_10122063 3300006177 Bacteria 1234
236 Ga0075362_10137647 3300006177 Bacteria 1165
237 Ga0075362_10140701 3300006177 Bacteria 1153
238 Ga0075362_10201601 3300006177 Bacteria 968
239 Ga0075362_10296782 3300006177 Bacteria 801
240 Ga0075362_10321744 3300006177 Bacteria 770
241 Ga0075362_10636868 3300006177 Bacteria 553
242 Ga0075367_10183859 3300006178 Bacteria 1303
243 Ga0075367_10333240 3300006178 Bacteria 957
244 Ga0075369_10070632 3300006186 Bacteria 1536
245 Ga0075369_10227473 3300006186 Bacteria 864
246 Ga0075366_10032783 3300006195 Bacteria 3058
247 Ga0075366_10113454 3300006195 Bacteria 1632
248 Ga0075366_10185666 3300006195 Bacteria 1263
249 Ga0075366_10194858 3300006195 Bacteria 1232
250 Ga0075366_10270166 3300006195 Bacteria 1038
251 Ga0075366_10754209 3300006195 Bacteria 605
252 Ga0097621_100393880 3300006237 Bacteria 1239
253 Ga0097621_100540092 3300006237 Bacteria 1060
254 Ga0075370_10000322 3300006353 Bacteria 17253
255 Ga0075370_10003243 3300006353 Bacteria 7702
256 Ga0075370_10004735 3300006353 Bacteria 6651
257 Ga0075370_10022587 3300006353 Bacteria 3456
258 Ga0075370_10035851 3300006353 Bacteria 2785
259 Ga0075370_10050403 3300006353 Bacteria 2361
260 Ga0075370_10165389 3300006353 Bacteria 1299
261 Ga0075370_10248670 3300006353 Bacteria 1054
262 Ga0075431_101588388 3300006847 Bacteria 612
263 Ga0075429_100553458 3300006880 Bacteria 1008
264 Ga0068865_100841441 3300006881 Bacteria 794
265 Ga0068865_101000971 3300006881 Bacteria 732
266 Ga0068865_101704897 3300006881 Bacteria 568
267 Ga0079104_1047926 3300006946 Bacteria 965
268 Ga0099826_10008499 3300006948 Bacteria 7640
269 Ga0099826_10342267 3300006948 Bacteria 747
270 Ga0105251_10000134 3300009011 Bacteria 74820
271 Ga0105251_10367650 3300009011 Bacteria 658
272 Ga0105244_10003000 3300009036 Bacteria 12386
273 Ga0105244_10520543 3300009036 Bacteria 548
274 Ga0105240_10004043 3300009093 Bacteria 22563
275 Ga0105240_10207199 3300009093 Bacteria 2294
276 Ga0105240_10852164 3300009093 Bacteria 984
277 Ga0105245_10238339 3300009098 Bacteria 1762
278 Ga0105245_10497804 3300009098 Bacteria 1234
279 Ga0105243_10003757 3300009148 Bacteria 12169
280 Ga0105243_10009638 3300009148 Bacteria 7353
281 Ga0105243_10022421 3300009148 Bacteria 4799
282 Ga0105243_10879036 3300009148 Bacteria 890
283 Ga0105241_10176388 3300009174 Bacteria 1769
284 Ga0105242_11165371 3300009176 Bacteria 788
285 Ga0105242_11692939 3300009176 Bacteria 668
286 Ga0105248_10083825 3300009177 Bacteria 3586
287 Ga0105248_11216745 3300009177 Bacteria 852
288 Ga0105237_10141822 3300009545 Bacteria 2397
289 Ga0105237_10453383 3300009545 Bacteria 1288
290 Ga0105237_11374432 3300009545 Bacteria 712
291 Ga0105237_11458129 3300009545 Bacteria 691
292 Ga0105238_10095250 3300009551 Bacteria 2964
293 Ga0105238_10398710 3300009551 Bacteria 1369
294 Ga0105238_10436156 3300009551 Bacteria 1306
295 Ga0105238_10472465 3300009551 Bacteria 1252
296 Ga0105238_10697818 3300009551 Bacteria 1027
297 Ga0105239_10070385 3300010375 Bacteria 3843
298 Ga0105239_10248446 3300010375 Bacteria 1998
299 Ga0105239_10881047 3300010375 Bacteria 1027
300 Ga0105246_10035641 3300011119 Bacteria 3327
301 Ga0105246_10120637 3300011119 Bacteria 1942
302 Ga0157347_1003287 3300012502 Bacteria 1441
303 Ga0157347_1019559 3300012502 Bacteria 783
304 Ga0157326_1031246 3300012513 Bacteria 706
305 Ga0157373_10023683 3300013100 Bacteria 4450
306 Ga0157373_10507222 3300013100 Bacteria 872
307 Ga0157373_10742706 3300013100 Bacteria 721
308 Ga0157373_10775436 3300013100 Bacteria 706
309 Ga0157371_10104204 3300013102 Bacteria 2013
310 Ga0157370_10001130 3300013104 Bacteria 33346
311 Ga0157370_10072460 3300013104 Bacteria 3250
312 Ga0157370_10114119 3300013104 Bacteria 2524
313 Ga0157370_10128583 3300013104 Bacteria 2364
314 Ga0157370_10155730 3300013104 Bacteria 2126
315 Ga0157370_10293566 3300013104 Bacteria 1501
316 Ga0157370_10538982 3300013104 Bacteria 1070
317 Ga0157370_11759732 3300013104 Bacteria 556
318 Ga0157369_10001199 3300013105 Bacteria 32259
319 Ga0157369_10012328 3300013105 Bacteria 9710
320 Ga0157369_10055356 3300013105 Bacteria 4282
321 Ga0157369_10165285 3300013105 Bacteria 2334
322 Ga0157369_10217194 3300013105 Bacteria 2002
323 Ga0157369_12354772 3300013105 Bacteria 540
324 Ga0157378_12588545 3300013297 Bacteria 560
325 Ga0163162_10080040 3300013306 Bacteria 3334
326 Ga0163162_10436581 3300013306 Bacteria 1441
327 Ga0163162_12834001 3300013306 Bacteria 558
328 Ga0163162_13452651 3300013306 Unclassified 503
329 Ga0157372_10233361 3300013307 Bacteria 2133
330 Ga0157372_10329234 3300013307 Bacteria 1779
331 Ga0157372_11489577 3300013307 Bacteria 780
332 Ga0157375_10432526 3300013308 Bacteria 1482
333 Ga0163163_10104437 3300014325 Bacteria 2859
334 Ga0182008_10001340 3300014497 Bacteria 16780
335 Ga0182008_10016053 3300014497 Bacteria 3897
336 Ga0182008_10023775 3300014497 Bacteria 3124
337 Ga0182008_10036324 3300014497 Bacteria 2465
338 Ga0182008_10053246 3300014497 Bacteria 2004
339 Ga0182008_10533825 3300014497 Bacteria 650
340 Ga0182008_10713512 3300014497 Bacteria 574
341 Ga0157376_11162427 3300014969 Bacteria 799
342 Ga0157376_11165887 3300014969 Bacteria 798
343 Ga0157376_12051813 3300014969 Bacteria 610
344 Ga0182006_1001145 3300015261 Bacteria 16830
345 Ga0182006_1094962 3300015261 Bacteria 1066
346 Ga0182006_1134847 3300015261 Bacteria 847
347 Ga0182006_1155318 3300015261 Bacteria 774
348 Ga0182007_10000512 3300015262 Bacteria 22905
349 Ga0182007_10008474 3300015262 Bacteria 4222
350 Ga0182007_10021431 3300015262 Bacteria 2295
351 Ga0182007_10034980 3300015262 Bacteria 1694
352 Ga0182007_10173045 3300015262 Bacteria 743
353 Ga0182005_1000637 3300015265 Bacteria 16681
354 Ga0182005_1125498 3300015265 Bacteria 733
355 Ga0183362_10001 3300015683 Bacteria 2046624
356 Ga0183361_10013 3300016635 Bacteria 179680
357 Ga0163161_10000166 3300017792 Bacteria 60327
358 Ga0163161_10010657 3300017792 Bacteria 6365
359 Ga0163161_10015236 3300017792 Bacteria 5357
360 Ga0163161_10017854 3300017792 Bacteria 4971
361 Ga0163161_10270716 3300017792 Bacteria 1329
362 Ga0197907_11469637 3300020069 Bacteria 2058
363 Ga0206356_10241440 3300020070 Bacteria 7318
364 Ga0206349_1941556 3300020075 Bacteria 1012
365 Ga0206350_10621348 3300020080 Bacteria 1667
366 Ga0206354_10082792 3300020081 Bacteria 1824
367 Ga0206353_10915309 3300020082 Bacteria 5391
368 Ga0213872_10432679 3300021361 Bacteria 530
369 Ga0224712_10000080 3300022467 Bacteria 15095
370 Ga0209435_100001 3300025206 Bacteria 1424171
371 Ga0209760_100758 3300025207 Bacteria 4642
372 Ga0209436_103077 3300025208 Bacteria 4593
373 Ga0209436_104293 3300025208 Bacteria 3548
374 Ga0209436_107685 3300025208 Bacteria 2223
375 Ga0209784_100062 3300025224 Bacteria 162240
376 Ga0209566_100023 3300025225 Bacteria 396571
377 Ga0209566_104089 3300025225 Bacteria 2061
378 Ga0209674_100005 3300025226 Bacteria 1708125
379 Ga0209674_100040 3300025226 Bacteria 396571
380 Ga0209674_100103 3300025226 Bacteria 154966
381 Ga0209672_100001 3300025228 Bacteria 2828210
382 Ga0209672_100014 3300025228 Bacteria 546252
383 Ga0209672_110041 3300025228 Bacteria 1300
384 Ga0209672_113083 3300025228 Bacteria 1008
385 Ga0209147_100001 3300025229 Bacteria 2384371
386 Ga0209147_100087 3300025229 Bacteria 179835
387 Ga0209563_100096 3300025230 Bacteria 162240
388 Ga0209563_105329 3300025230 Bacteria 2346
389 Ga0207427_100852 3300025231 Bacteria 13595
390 Ga0207427_101800 3300025231 Bacteria 6880
391 Ga0209437_100146 3300025233 Bacteria 162240
392 Ga0209258_100001 3300025242 Bacteria 2384269
393 Ga0209258_100040 3300025242 Bacteria 385401
394 Ga0209258_100089 3300025242 Bacteria 234040
395 Ga0207425_1000603 3300025245 Bacteria 20837
396 Ga0207425_1001556 3300025245 Bacteria 9346
397 Ga0207425_1003911 3300025245 Bacteria 4616
398 Ga0207425_1010384 3300025245 Bacteria 2268
399 Ga0209646_1000001 3300025246 Bacteria 3092932
400 Ga0209646_1014494 3300025246 Bacteria 1185
401 Ga0209026_1000001 3300025250 Bacteria 1228671
402 Ga0209677_100058 3300025253 Bacteria 162240
403 Ga0209148_1000003 3300025254 Bacteria 2384288
404 Ga0209148_1000035 3300025254 Bacteria 548413
405 Ga0209148_1000097 3300025254 Bacteria 234049
406 Ga0209148_1000553 3300025254 Bacteria 35527
407 Ga0209759_1000001 3300025256 Bacteria 2799452
408 Ga0209759_1000188 3300025256 Bacteria 99987
409 Ga0209759_1000284 3300025256 Bacteria 70505
410 Ga0209759_1000519 3300025256 Bacteria 41644
411 Ga0209129_1000071 3300025258 Bacteria 210729
412 Ga0209129_1008455 3300025258 Bacteria 2861
413 Ga0209129_1010324 3300025258 Bacteria 2343
414 Ga0209129_1011881 3300025258 Bacteria 2046
415 Ga0209129_1018181 3300025258 Bacteria 1357
416 Ga0209129_1030174 3300025258 Bacteria 909
417 Ga0209233_1000043 3300025261 Bacteria 509723
418 Ga0209233_1000159 3300025261 Bacteria 162240
419 Ga0209233_1068469 3300025261 Bacteria 664
420 Ga0209565_1000120 3300025263 Bacteria 111458
421 Ga0209565_1000326 3300025263 Bacteria 42448
422 Ga0209565_1000774 3300025263 Bacteria 18648
423 Ga0209565_1001593 3300025263 Bacteria 9641
424 Ga0209565_1004359 3300025263 Bacteria 4322
425 Ga0209565_1014786 3300025263 Bacteria 1780
426 Ga0209565_1019567 3300025263 Bacteria 1444
427 Ga0209565_1069613 3300025263 Bacteria 596
428 Ga0209455_1000001 3300025272 Bacteria 2384278
429 Ga0209455_1000200 3300025272 Bacteria 87009
430 Ga0209673_1000030 3300025273 Bacteria 351933
431 Ga0209673_1000099 3300025273 Bacteria 193248
432 Ga0209673_1000839 3300025273 Bacteria 40180
433 Ga0209673_1001338 3300025273 Bacteria 24643
434 Ga0209673_1009171 3300025273 Bacteria 4318
435 Ga0209673_1011116 3300025273 Bacteria 3736
436 Ga0209673_1019100 3300025273 Bacteria 2472
437 Ga0209673_1056619 3300025273 Bacteria 1002
438 Ga0209130_1000041 3300025284 Bacteria 261078
439 Ga0209130_1000456 3300025284 Bacteria 43000
440 Ga0209130_1000952 3300025284 Bacteria 22937
441 Ga0209130_1001771 3300025284 Bacteria 12746
442 Ga0209130_1003498 3300025284 Bacteria 6602
443 Ga0209130_1034515 3300025284 Bacteria 1018
444 Ga0209675_1000054 3300025291 Bacteria 193248
445 Ga0209675_1000290 3300025291 Bacteria 47338
446 Ga0209675_1001678 3300025291 Bacteria 12312
447 Ga0209675_1003556 3300025291 Bacteria 7349
448 Ga0209675_1007178 3300025291 Bacteria 4319
449 Ga0209675_1007222 3300025291 Bacteria 4300
450 Ga0209675_1013320 3300025291 Bacteria 2580
451 Ga0209675_1025130 3300025291 Bacteria 1507
452 Ga0209675_1068071 3300025291 Bacteria 685
453 Ga0209676_1000005 3300025292 Bacteria 1076001
454 Ga0209676_1000054 3300025292 Bacteria 365890
455 Ga0209676_1000260 3300025292 Bacteria 111683
456 Ga0209676_1002320 3300025292 Bacteria 13793
457 Ga0209676_1006861 3300025292 Bacteria 5513
458 Ga0209676_1012219 3300025292 Bacteria 3396
459 Ga0209676_1021448 3300025292 Bacteria 2169
460 Ga0209676_1037652 3300025292 Bacteria 1393
461 Ga0209676_1045732 3300025292 Bacteria 1189
462 Ga0209676_1122175 3300025292 Bacteria 520
463 Ga0209025_1001065 3300025294 Bacteria 39873
464 Ga0209025_1001409 3300025294 Bacteria 31873
465 Ga0209025_1001617 3300025294 Bacteria 28145
466 Ga0209025_1005090 3300025294 Bacteria 10938
467 Ga0209025_1010783 3300025294 Bacteria 6140
468 Ga0209025_1013211 3300025294 Bacteria 5211
469 Ga0209025_1014966 3300025294 Bacteria 4722
470 Ga0209025_1017071 3300025294 Bacteria 4224
471 Ga0209025_1023210 3300025294 Bacteria 3252
472 Ga0209025_1029599 3300025294 Bacteria 2644
473 Ga0209025_1032635 3300025294 Bacteria 2428
474 Ga0209025_1070074 3300025294 Bacteria 1250
475 Ga0209564_1000239 3300025295 Bacteria 119761
476 Ga0209564_1000662 3300025295 Bacteria 50934
477 Ga0209564_1000784 3300025295 Bacteria 44001
478 Ga0209564_1000890 3300025295 Bacteria 39405
479 Ga0209564_1008305 3300025295 Bacteria 5150
480 Ga0209564_1050603 3300025295 Bacteria 1015
481 Ga0209758_1000027 3300025297 Bacteria 549650
482 Ga0209758_1010200 3300025297 Bacteria 5668
483 Ga0209758_1024927 3300025297 Bacteria 2644
484 Ga0209758_1054541 3300025297 Bacteria 1365
485 Ga0209758_1058368 3300025297 Bacteria 1291
486 Ga0209758_1097385 3300025297 Bacteria 845
487 Ga0209050_1000003 3300025298 Bacteria 1609245
488 Ga0209050_1000007 3300025298 Bacteria 1187891
489 Ga0209050_1000954 3300025298 Bacteria 37580
490 Ga0209050_1004569 3300025298 Bacteria 9285
491 Ga0209050_1006735 3300025298 Bacteria 6709
492 Ga0209050_1016241 3300025298 Bacteria 3060
493 Ga0209050_1024718 3300025298 Bacteria 2067
494 Ga0209050_1059225 3300025298 Bacteria 915
495 Ga0209050_1096823 3300025298 Bacteria 592
496 Ga0209256_1000001 3300025299 Bacteria 2166974
497 Ga0209256_1000081 3300025299 Bacteria 222908
498 Ga0209256_1009348 3300025299 Bacteria 4319
499 Ga0209256_1021256 3300025299 Bacteria 1999
500 Ga0209256_1024404 3300025299 Bacteria 1781
501 Ga0207426_1000027 3300025302 Bacteria 513176
502 Ga0207426_1000061 3300025302 Bacteria 362507
503 Ga0207426_1003593 3300025302 Bacteria 8238
504 Ga0207426_1004649 3300025302 Bacteria 6602
505 Ga0207426_1077340 3300025302 Bacteria 911
506 Ga0209051_1000003 3300025303 Bacteria 1609245
507 Ga0209051_1000009 3300025303 Bacteria 706778
508 Ga0209051_1000055 3300025303 Bacteria 277194
509 Ga0209051_1000319 3300025303 Bacteria 72894
510 Ga0209051_1000619 3300025303 Bacteria 40839
511 Ga0209051_1005714 3300025303 Bacteria 7182
512 Ga0209051_1019880 3300025303 Bacteria 2916
513 Ga0209051_1050459 3300025303 Bacteria 1393
514 Ga0209051_1085050 3300025303 Bacteria 899
515 Ga0209257_1000018 3300025304 Bacteria 836016
516 Ga0209257_1000045 3300025304 Bacteria 484429
517 Ga0209257_1000873 3300025304 Bacteria 42738
518 Ga0209257_1007556 3300025304 Bacteria 6522
519 Ga0209257_1007934 3300025304 Bacteria 6227
520 Ga0209257_1008583 3300025304 Bacteria 5754
521 Ga0207656_10047010 3300025321 Bacteria 1854
522 Ga0207655_1001368 3300025728 Bacteria 22829
523 Ga0207713_1001542 3300025735 Bacteria 18104
524 Ga0207642_10527042 3300025899 Bacteria 727
525 Ga0207680_10441506 3300025903 Bacteria 923
526 Ga0207647_10015129 3300025904 Bacteria 5300
527 Ga0207647_10164889 3300025904 Bacteria 1292
528 Ga0207647_10288894 3300025904 Bacteria 935
529 Ga0207647_10763267 3300025904 Bacteria 523
530 Ga0207645_10331383 3300025907 Bacteria 1017
531 Ga0207643_11141600 3300025908 Bacteria 502
532 Ga0207705_10162860 3300025909 Bacteria 1676
533 Ga0207705_10221912 3300025909 Bacteria 1436
534 Ga0207705_10528849 3300025909 Bacteria 916
535 Ga0207705_11291761 3300025909 Bacteria 557
536 Ga0207684_11260217 3300025910 Bacteria 610
537 Ga0207707_10916240 3300025912 Bacteria 724
538 Ga0207695_10125685 3300025913 Bacteria 2527
539 Ga0207695_10190846 3300025913 Bacteria 1966
540 Ga0207695_10635882 3300025913 Bacteria 948
541 Ga0207695_11224963 3300025913 Bacteria 631
542 Ga0207671_10090182 3300025914 Bacteria 2308
543 Ga0207671_10393536 3300025914 Bacteria 1102
544 Ga0207660_10038245 3300025917 Bacteria 3349
545 Ga0207657_10229708 3300025919 Bacteria 1484
546 Ga0207657_10321706 3300025919 Bacteria 1223
547 Ga0207657_10488981 3300025919 Bacteria 964
548 Ga0207649_10258561 3300025920 Bacteria 1257
549 Ga0207652_10246622 3300025921 Bacteria 1610
550 Ga0207652_10265241 3300025921 Bacteria 1549
551 Ga0207681_10530770 3300025923 Bacteria 967
552 Ga0207694_10197807 3300025924 Bacteria 1634
553 Ga0207694_10347713 3300025924 Bacteria 1227
554 Ga0207694_10440520 3300025924 Bacteria 1087
555 Ga0207694_10857800 3300025924 Bacteria 767
556 Ga0207650_11409626 3300025925 Bacteria 593
557 Ga0207644_10022931 3300025931 Bacteria 4270
558 Ga0207690_10014545 3300025932 Bacteria 4753
559 Ga0207690_10184168 3300025932 Bacteria 1575
560 Ga0207706_10017147 3300025933 Bacteria 6531
561 Ga0207686_10149936 3300025934 Bacteria 1622
562 Ga0207709_10000230 3300025935 Bacteria 70768
563 Ga0207709_10002452 3300025935 Bacteria 11648
564 Ga0207709_10005451 3300025935 Bacteria 7228
565 Ga0207669_10489440 3300025937 Bacteria 982
566 Ga0207704_11228917 3300025938 Bacteria 639
567 Ga0207704_11918572 3300025938 Bacteria 509
568 Ga0207691_10422459 3300025940 Bacteria 1136
569 Ga0207711_10002819 3300025941 Bacteria 15267
570 Ga0207711_10068904 3300025941 Bacteria 3065
571 Ga0207711_10480700 3300025941 Bacteria 1157
572 Ga0207689_11653182 3300025942 Bacteria 532
573 Ga0207679_10008899 3300025945 Bacteria 6407
574 Ga0207667_10000524 3300025949 Bacteria 50648
575 Ga0207667_10061207 3300025949 Bacteria 3939
576 Ga0207667_10710000 3300025949 Bacteria 1007
577 Ga0207651_10346283 3300025960 Bacteria 1250
578 Ga0207651_10421612 3300025960 Bacteria 1139
579 Ga0207651_10546604 3300025960 Bacteria 1007
580 Ga0207651_11306657 3300025960 Bacteria 652
581 Ga0207712_12061780 3300025961 Bacteria 510
582 Ga0207640_10842984 3300025981 Bacteria 797
583 Ga0207658_10098455 3300025986 Bacteria 2285
584 Ga0207658_10438015 3300025986 Bacteria 1155
585 Ga0207658_10888663 3300025986 Bacteria 811
586 Ga0207703_12046243 3300026035 Bacteria 549
587 Ga0207639_10183989 3300026041 Bacteria 1779
588 Ga0207639_10399927 3300026041 Bacteria 1237
589 Ga0207639_10627406 3300026041 Bacteria 993
590 Ga0207678_10410907 3300026067 Bacteria 1173
591 Ga0207641_11070799 3300026088 Bacteria 804
592 Ga0207641_11134785 3300026088 Bacteria 781
593 Ga0207648_10442715 3300026089 Bacteria 1182
594 Ga0207648_10603645 3300026089 Bacteria 1012
595 Ga0207676_12084986 3300026095 Bacteria 566
596 Ga0207676_12407124 3300026095 Bacteria 524
597 Ga0207674_10901285 3300026116 Bacteria 852
598 Ga0207675_101388449 3300026118 Bacteria 723
599 Ga0207683_10070721 3300026121 Bacteria 3083
600 Ga0207683_10078360 3300026121 Bacteria 2928
601 Ga0207683_10873872 3300026121 Bacteria 835
602 Ga0207683_10878083 3300026121 Unclassified 833
603 Ga0207698_10817601 3300026142 Bacteria 935
604 Ga0207698_12304859 3300026142 Bacteria 550
605 Ga0209281_1030565 3300027111 Bacteria 966
606 Ga0209371_1000267 3300027312 Bacteria 61088
607 Ga0209371_1051233 3300027312 Bacteria 791
608 Ga0209282_1000133 3300027666 Bacteria 44707
609 Ga0209282_1403881 3300027666 Bacteria 535
610 Ga0209813_10066296 3300027866 Bacteria 1164
611 Ga0209813_10199242 3300027866 Bacteria 740
612 Ga0209974_10002433 3300027876 Bacteria 6736
613 Ga0207428_10223419 3300027907 Bacteria 1411
614 Ga0207428_10406977 3300027907 Bacteria 996
615 Ga0268266_10014251 3300028379 Bacteria 6837
616 Ga0307517_10447730 3300028786 Bacteria 670
617 Ga0307515_10000084 3300028794 Bacteria 221434
618 Ga0307515_10001286 3300028794 Bacteria 56985
619 Ga0265338_10000022 3300028800 Bacteria 308414
620 Ga0268256_1000238 3300030500 Bacteria 57894
621 Ga0268256_1057581 3300030500 Bacteria 791
622 Ga0307512_10443111 3300030522 Bacteria 527
623 Ga0316177_1041282 3300030731 Bacteria 765
624 Ga0316177_1204318 3300030731 Bacteria 771
625 Ga0316176_1023428 3300030732 Bacteria 1527
626 Ga0314311_1134334 3300030733 Bacteria 4782
627 Ga0316179_1116799 3300030734 Bacteria 921
628 Ga0316178_1006481 3300030735 Bacteria 3873
629 Ga0316180_1186828 3300030736 Bacteria 1216
630 Ga0316183_1029454 3300030742 Bacteria 2323
631 Ga0316181_1011855 3300030744 Bacteria 1460
632 Ga0316181_1039412 3300030744 Bacteria 1238
633 Ga0316182_1158883 3300030745 Bacteria 832
634 Ga0316182_1159626 3300030745 Bacteria 1354
635 Ga0265340_10046708 3300031247 Bacteria 2111
636 Ga0265327_10002745 3300031251 Bacteria 17906
637 Ga0265327_10003564 3300031251 Bacteria 14736
638 Ga0307513_10000012 3300031456 Bacteria 328865
639 Ga0307513_10000285 3300031456 Bacteria 73356
640 Ga0307513_10080379 3300031456 Bacteria 3363
641 Ga0307513_10097609 3300031456 Bacteria 2972
642 Ga0307513_10977074 3300031456 Bacteria 556
643 Ga0307513_11063927 3300031456 Bacteria 520
644 Ga0307408_100022449 3300031548 Bacteria 4288
645 Ga0307408_100144752 3300031548 Bacteria 1869
646 Ga0307408_100287070 3300031548 Bacteria 1373
647 Ga0307408_100306407 3300031548 Bacteria 1332
648 Ga0307408_100339824 3300031548 Bacteria 1270
649 Ga0307408_100344212 3300031548 Bacteria 1263
650 Ga0307408_100389606 3300031548 Bacteria 1193
651 Ga0307408_100422732 3300031548 Bacteria 1149
652 Ga0307408_100575839 3300031548 Bacteria 997
653 Ga0307408_100845409 3300031548 Bacteria 834
654 Ga0307408_100922902 3300031548 Bacteria 800
655 Ga0307408_101363430 3300031548 Bacteria 666
656 Ga0307408_101538920 3300031548 Bacteria 630
657 Ga0307514_10000319 3300031649 Bacteria 115327
658 Ga0307514_10077326 3300031649 Bacteria 2476
659 Ga0307516_10004265 3300031730 Bacteria 17778
660 Ga0307516_10005283 3300031730 Bacteria 15538
661 Ga0307516_10455501 3300031730 Bacteria 935
662 Ga0307405_10091953 3300031731 Bacteria 2011
663 Ga0307405_10152052 3300031731 Bacteria 1629
664 Ga0307405_10166096 3300031731 Bacteria 1569
665 Ga0307405_10796411 3300031731 Bacteria 791
666 Ga0307405_10960008 3300031731 Bacteria 727
667 Ga0307405_11057809 3300031731 Bacteria 695
668 Ga0307405_11221953 3300031731 Bacteria 651
669 Ga0307405_11310185 3300031731 Bacteria 630
670 Ga0307405_11609000 3300031731 Bacteria 573
671 Ga0307413_10989047 3300031824 Bacteria 720
672 Ga0307413_11164686 3300031824 Bacteria 669
673 Ga0307410_11495854 3300031852 Bacteria 595
674 Ga0307406_10057413 3300031901 Bacteria 2496
675 Ga0307406_10593293 3300031901 Bacteria 912
676 Ga0307406_10842744 3300031901 Bacteria 777
677 Ga0307406_11265238 3300031901 Bacteria 643
678 Ga0307406_11510198 3300031901 Bacteria 591
679 Ga0307406_11693511 3300031901 Bacteria 560
680 Ga0307407_10471517 3300031903 Bacteria 915
681 Ga0307407_11061265 3300031903 Bacteria 628
682 Ga0307412_10000024 3300031911 Bacteria 235467
683 Ga0307412_10022467 3300031911 Bacteria 3867
684 Ga0307412_10035354 3300031911 Bacteria 3191
685 Ga0307412_10045864 3300031911 Bacteria 2860
686 Ga0307412_10189537 3300031911 Bacteria 1553
687 Ga0307412_10641112 3300031911 Bacteria 905
688 Ga0307412_10969697 3300031911 Bacteria 749
689 Ga0307412_11369355 3300031911 Bacteria 639
690 Ga0307412_11491952 3300031911 Bacteria 614
691 Ga0307412_11539829 3300031911 Bacteria 605
692 Ga0307412_11888259 3300031911 Bacteria 551
693 Ga0307412_11984302 3300031911 Bacteria 538
694 Ga0307412_12069128 3300031911 Bacteria 528
695 Ga0307412_12255095 3300031911 Bacteria 507
696 Ga0307409_102366496 3300031995 Bacteria 560
697 Ga0307416_100089287 3300032002 Bacteria 2638
698 Ga0307416_100755407 3300032002 Bacteria 1065
699 Ga0307416_100903036 3300032002 Bacteria 983
700 Ga0307416_102006290 3300032002 Bacteria 681
701 Ga0307416_102419947 3300032002 Bacteria 624
702 Ga0307416_102935774 3300032002 Bacteria 570
703 Ga0307416_103070534 3300032002 Bacteria 559
704 Ga0307414_10077611 3300032004 Bacteria 2418
705 Ga0307414_10235109 3300032004 Bacteria 1513
706 Ga0307414_10677726 3300032004 Bacteria 932
707 Ga0307414_10701031 3300032004 Bacteria 916
708 Ga0307414_11025195 3300032004 Bacteria 760
709 Ga0307411_10194251 3300032005 Bacteria 1552
710 Ga0307411_10298354 3300032005 Bacteria 1291
711 Ga0307411_10624471 3300032005 Bacteria 929
712 Ga0307411_10695041 3300032005 Bacteria 885
713 Ga0307411_10701230 3300032005 Bacteria 882
714 Ga0307411_10747772 3300032005 Bacteria 856
715 Ga0307411_10871004 3300032005 Bacteria 798
716 Ga0307411_10961341 3300032005 Bacteria 762
717 Ga0307411_12063770 3300032005 Bacteria 533
718 Ga0307411_12097333 3300032005 Bacteria 529
719 Ga0307415_101845404 3300032126 Bacteria 586
720 Ga0373952_0202494 3300035092 Bacteria 582
721 Ga0395899_0000035 3300037312 Bacteria 295584
722 Ga0395899_0002970 3300037312 Bacteria 13578
723 Ga0395900_0000190 3300037418 Bacteria 98820
724 Ga0395900_0001100 3300037418 Bacteria 34383
725 Ga0395900_0044241 3300037418 Bacteria 4588
726 Ga0395900_0185326 3300037418 Bacteria 2113
727 Ga0395900_0834824 3300037418 Bacteria 848
728 Ga0395898_0000199 3300037466 Bacteria 154631
729 Ga0395898_0011627 3300037466 Bacteria 9135
730 Ga0395898_0064652 3300037466 Bacteria 3548
731 Ga0395905_0000041 3300037471 Bacteria 250958
732 Ga0395905_0030123 3300037471 Bacteria 5114
733 Ga0395905_0042337 3300037471 Bacteria 4273
734 Ga0395905_0052258 3300037471 Bacteria 3825
735 Ga0395905_0336351 3300037471 Bacteria 1401
736 Ga0395905_0425313 3300037471 Bacteria 1224
737 Ga0395905_0526805 3300037471 Bacteria 1082
738 Ga0395901_0000062 3300038443 Bacteria 150171
739 Ga0395901_0001105 3300038443 Bacteria 28682
740 Ga0395901_0073845 3300038443 Bacteria 3557
741 Ga0395901_0217320 3300038443 Bacteria 1998
742 Ga0395901_0293677 3300038443 Bacteria 1686
743 Ga0395901_0576659 3300038443 Bacteria 1137
744 Ga0436360_0553837 3300039438 Bacteria 1495
745 Ga0436361_0120393 3300039447 Bacteria 1104
746 Ga0436361_0171963 3300039447 Bacteria 777
747 Ga0436361_0355371 3300039447 Bacteria 1252
748 Ga0439436_0001379 3300041404 Bacteria 7004
749 Ga0439436_0046759 3300041404 Bacteria 1229
750 Ga0439436_0095607 3300041404 Bacteria 828
751 Ga0439436_0173445 3300041404 Bacteria 612
752 Ga0439438_105692 3300041405 Bacteria 681
753 Ga0439438_131656 3300041405 Bacteria 600
754 Ga0439439_0005352 3300041406 Bacteria 2928
755 Ga0439439_0077318 3300041406 Bacteria 897
756 Ga0439439_0087749 3300041406 Bacteria 847
757 Ga0439447_017937 3300041407 Bacteria 1919
758 Ga0439447_056389 3300041407 Bacteria 930
759 Ga0439447_069056 3300041407 Bacteria 823
760 Ga0439453_0112318 3300041408 Bacteria 617
761 Ga0439461_0007295 3300041410 Bacteria 1953
762 Ga0439461_0039529 3300041410 Bacteria 1014
763 Ga0439466_0002724 3300041411 Bacteria 6923
764 Ga0439466_0029059 3300041411 Bacteria 1904
765 Ga0439465_0000697 3300041413 Bacteria 10311
766 Ga0439465_0158898 3300041413 Bacteria 810
767 Ga0451791_0048952 3300041451 Bacteria 611
768 Ga0451791_0161335 3300041451 Bacteria 524
769 Ga0451791_0556048 3300041451 Bacteria 660
770 Ga0451795_0737557 3300041456 Bacteria 659
771 Ga0451798_0323142 3300041458 Bacteria 1102
772 Ga0451798_0874703 3300041458 Bacteria 1715
773 Ga0451800_1002931 3300041459 Bacteria 1095
774 Ga0451802_0951491 3300041460 Bacteria 699
775 Ga0451804_0177276 3300041463 Bacteria 1023
776 Ga0451807_0702505 3300041486 Bacteria 1137
777 Ga0451807_2769446 3300041486 Bacteria 799
778 Ga0451837_0270258 3300041494 Bacteria 725
779 Ga0451841_0605841 3300041498 Bacteria 730
780 Ga0451853_0781326 3300041512 Bacteria 856
781 Ga0451853_1406326 3300041512 Bacteria 1009
782 Ga0439431_0000916 3300041997 Bacteria 6385
783 Ga0439433_0000360 3300041999 Bacteria 8072
784 Ga0439442_043551 3300042002 Bacteria 945
785 Ga0439445_0000835 3300042004 Bacteria 6503
786 Ga0439432_003052 3300042006 Bacteria 6232
787 Ga0439432_041101 3300042006 Bacteria 1465
788 Ga0439432_058874 3300042006 Bacteria 1187
789 Ga0439432_095902 3300042006 Bacteria 890
790 Ga0439449_0001800 3300042007 Bacteria 8435
791 Ga0439449_0002084 3300042007 Bacteria 7861
792 Ga0439449_0003898 3300042007 Bacteria 5783
793 Ga0439449_0045493 3300042007 Bacteria 1626
794 Ga0439449_0117015 3300042007 Bacteria 989
795 Ga0439449_0129349 3300042007 Bacteria 938
796 Ga0439452_005500 3300042010 Bacteria 4070
797 Ga0439457_050696 3300042014 Bacteria 932
798 Ga0439457_148692 3300042014 Bacteria 563
799 Ga0439462_0010232 3300042015 Bacteria 2376
800 Ga0439462_0012214 3300042015 Bacteria 2193
801 Ga0439462_0016788 3300042015 Bacteria 1894
802 Ga0439462_0043086 3300042015 Bacteria 1206
803 Ga0450911_015379 3300042115 Bacteria 1014
804 Ga0450923_007796 3300042125 Bacteria 1824
805 Ga0450923_026232 3300042125 Bacteria 1166
806 Ga0450890_017336 3300042127 Bacteria 958
807 Ga0450897_002880 3300042128 Bacteria 1334
808 Ga0450892_031216 3300042130 Bacteria 560
809 Ga0450896_035602 3300042133 Bacteria 765
810 Ga0450896_073046 3300042133 Bacteria 570
811 Ga0450898_021840 3300042134 Bacteria 1130
812 Ga0450898_024326 3300042134 Bacteria 1082
813 Ga0450898_060237 3300042134 Bacteria 746
814 Ga0450899_056040 3300042135 Bacteria 508
815 Ga0450900_064598 3300042136 Bacteria 575
816 Ga0450903_028032 3300042138 Bacteria 855
817 Ga0450889_010034 3300042144 Bacteria 975
818 Ga0450906_057370 3300042145 Bacteria 690
819 Ga0450907_076734 3300042146 Bacteria 579
820 Ga0450910_029232 3300042147 Bacteria 860
821 Ga0439446_0030800 3300042156 Bacteria 1551
822 Ga0439458_0208192 3300042157 Bacteria 536
823 Ga0450908_027994 3300042184 Bacteria 982
824 Ga0450908_029324 3300042184 Bacteria 957
825 Ga0450909_018325 3300042185 Bacteria 1039
826 Ga0450909_025797 3300042185 Bacteria 885
827 Ga0439434_0006641 3300042435 Bacteria 3383
828 Ga0439434_0015679 3300042435 Bacteria 2260
829 Ga0439434_0239773 3300042435 Bacteria 618
830 Ga0439435_0122893 3300042436 Bacteria 815
831 Ga0439459_0126576 3300042438 Bacteria 649
832 Ga0439464_0045092 3300042439 Bacteria 1264
833 Ga0450916_071534 3300042530 Bacteria 580
834 Ga0450918_008838 3300042531 Bacteria 1767
835 Ga0450918_015446 3300042531 Bacteria 1327
836 Ga0450893_0008574 3300042532 Bacteria 1664
837 Ga0451577_0102644 3300042876 Bacteria 2555
838 Ga0466969_0001061 3300044656 Bacteria 14838
839 Ga0466969_0028559 3300044656 Bacteria 2851
840 Ga0466969_0044262 3300044656 Bacteria 2215
841 Ga0466969_0114007 3300044656 Bacteria 1263
842 Ga0466969_0164122 3300044656 Bacteria 1020
843 Ga0466972_0013487 3300044658 Bacteria 4103
844 Ga0466972_0083032 3300044658 Bacteria 1524
845 Ga0466973_0033105 3300044659 Bacteria 4926
846 Ga0466987_0380323 3300044665 Bacteria 776
847 Ga0466977_0003105 3300044666 Bacteria 7904
848 Ga0466980_0377899 3300044668 Bacteria 810
849 Ga0466978_0205280 3300044671 Bacteria 1172
850 Ga0453683_0001701 3300044673 Bacteria 18336
851 Ga0453683_0044583 3300044673 Bacteria 2782
852 Ga0466965_0000058 3300044683 Bacteria 36392
853 Ga0466965_0015986 3300044683 Bacteria 3565
854 Ga0466965_0027458 3300044683 Bacteria 2764
855 Ga0466965_0137171 3300044683 Bacteria 1272
856 Ga0466965_0382410 3300044683 Bacteria 775
857 Ga0466966_0000105 3300044684 Bacteria 51259
858 Ga0466966_0002891 3300044684 Bacteria 11322
859 Ga0466966_0003848 3300044684 Bacteria 9909
860 Ga0466966_0145163 3300044684 Bacteria 1449
861 Ga0466966_0169162 3300044684 Bacteria 1329
862 Ga0466966_0505440 3300044684 Bacteria 727
863 Ga0466961_0000830 3300044693 Bacteria 19308
864 Ga0466961_0003527 3300044693 Bacteria 9755
865 Ga0466961_0031401 3300044693 Bacteria 3414
866 Ga0466961_0060402 3300044693 Bacteria 2410
867 Ga0466961_0242885 3300044693 Bacteria 1107
868 Ga0466961_0367344 3300044693 Bacteria 875
869 Ga0466961_0473454 3300044693 Bacteria 757
870 Ga0466963_0001295 3300044694 Bacteria 13287
871 Ga0466963_0009593 3300044694 Bacteria 5833
872 Ga0466963_0011977 3300044694 Bacteria 5297
873 Ga0466964_0000916 3300044706 Bacteria 9690
874 Ga0466964_0143271 3300044706 Bacteria 1101
875 Ga0466964_0480707 3300044706 Bacteria 664
876 Ga0453684_0186703 3300044712 Bacteria 2428
877 Ga0466971_0000697 3300044719 Bacteria 13439
878 Ga0466971_0014817 3300044719 Bacteria 3431
879 Ga0466971_0164014 3300044719 Bacteria 1041
880 Ga0466968_0015116 3300044735 Bacteria 3058
881 Ga0466968_0134829 3300044735 Bacteria 1126
882 Ga0466968_0528445 3300044735 Bacteria 590
883 Ga0466970_0009409 3300044765 Bacteria 4939
884 Ga0466970_0069899 3300044765 Bacteria 1887
885 Ga0466970_0507568 3300044765 Bacteria 695
886 Ga0466970_0969497 3300044765 Bacteria 501
887 Ga0466957_0044912 3300044842 Bacteria 2678
888 Ga0466957_0055259 3300044842 Bacteria 2426
889 Ga0466957_0224488 3300044842 Bacteria 1241
890 Ga0466957_0778328 3300044842 Bacteria 679
891 Ga0466957_0799191 3300044842 Bacteria 670
892 Ga0466960_0047904 3300044901 Bacteria 2052
893 Ga0466960_0114997 3300044901 Bacteria 1402
894 Ga0466960_0238987 3300044901 Bacteria 1005
895 Ga0466959_0002991 3300045049 Bacteria 10920
896 Ga0466959_0019940 3300045049 Bacteria 4936
897 Ga0466959_0071272 3300045049 Bacteria 2516
898 Ga0466959_0350891 3300045049 Bacteria 1006
899 Ga0466959_0482242 3300045049 Bacteria 839
900 Ga0466959_0601687 3300045049 Bacteria 739
901 Ga0466959_0753550 3300045049 Bacteria 652
902 Ga0466959_0823296 3300045049 Bacteria 620
903 Ga0466959_1188036 3300045049 Bacteria 507
904 Ga0451576_0003667 3300045051 Bacteria 20840
905 Ga0451576_0039875 3300045051 Bacteria 4971
906 Ga0451576_1623204 3300045051 Bacteria 670
907 Ga0466958_0000397 3300045836 Bacteria 17823
908 Ga0466958_0003121 3300045836 Bacteria 8519
909 Ga0466958_0012111 3300045836 Bacteria 4876
910 Ga0466958_0180950 3300045836 Bacteria 1337
911 Ga0466958_1161891 3300045836 Bacteria 504
912 Ga0466967_0700689 3300045976 Bacteria 1003
913 Ga0495627_008497 3300046453 Bacteria 3845
914 Ga0495627_048891 3300046453 Bacteria 1278
915 Ga0495592_0008371 3300046454 Bacteria 7759
916 Ga0495592_0015483 3300046454 Bacteria 5785
917 Ga0495592_0024836 3300046454 Bacteria 4554
918 Ga0495592_0029704 3300046454 Bacteria 4138
919 Ga0495603_0014573 3300046455 Bacteria 4754
920 Ga0495603_0014730 3300046455 Bacteria 4729
921 Ga0495603_0018732 3300046455 Bacteria 4189
922 Ga0495603_0459911 3300046455 Bacteria 729
923 Ga0495603_0730520 3300046455 Bacteria 566
924 Ga0495590_0003526 3300046457 Bacteria 6377
925 Ga0495590_0014357 3300046457 Bacteria 2891
926 Ga0495590_0114282 3300046457 Bacteria 965
927 Ga0495591_006545 3300046458 Bacteria 5128
928 Ga0495629_0000699 3300046459 Bacteria 27173
929 Ga0495629_0004896 3300046459 Bacteria 10049
930 Ga0495629_0007518 3300046459 Bacteria 8034
931 Ga0495629_0014090 3300046459 Bacteria 5759
932 Ga0495629_0161581 3300046459 Bacteria 1556
933 Ga0495629_0293790 3300046459 Bacteria 1113
934 Ga0495638_0020717 3300046460 Bacteria 4341
935 Ga0495638_0025340 3300046460 Bacteria 3857
936 Ga0495641_0018430 3300046461 Bacteria 3602
937 Ga0495641_0032203 3300046461 Bacteria 2497
938 Ga0495651_0010951 3300046462 Bacteria 6977
939 Ga0495651_0035257 3300046462 Bacteria 3897
940 Ga0495651_0096325 3300046462 Bacteria 2211
941 Ga0495651_0367885 3300046462 Bacteria 946
942 Ga0495651_0427811 3300046462 Bacteria 859
943 Ga0495651_0454344 3300046462 Bacteria 827
944 Ga0495651_0606477 3300046462 Bacteria 690
945 Ga0495651_0649296 3300046462 Bacteria 661
946 Ga0495653_0004371 3300046463 Bacteria 11421
947 Ga0495653_0019073 3300046463 Bacteria 5564
948 Ga0495653_0020344 3300046463 Bacteria 5381
949 Ga0495653_0023382 3300046463 Bacteria 4994
950 Ga0495653_0038116 3300046463 Bacteria 3773
951 Ga0495653_0041534 3300046463 Bacteria 3589
952 Ga0495653_0128482 3300046463 Bacteria 1797
953 Ga0495650_0005860 3300046471 Bacteria 7822
954 Ga0495650_0006791 3300046471 Bacteria 7061
955 Ga0495650_0069930 3300046471 Bacteria 1380
956 Ga0495650_0187419 3300046471 Bacteria 724
957 Ga0495580_0005845 3300046472 Bacteria 10092
958 Ga0495580_0015501 3300046472 Bacteria 5746
959 Ga0495580_0019975 3300046472 Bacteria 4965
960 Ga0495580_0035742 3300046472 Bacteria 3571
961 Ga0495580_0039103 3300046472 Bacteria 3394
962 Ga0495580_0046673 3300046472 Bacteria 3073
963 Ga0495580_0313640 3300046472 Bacteria 1066
964 Ga0495580_0642145 3300046472 Bacteria 698
965 Ga0495580_0780620 3300046472 Bacteria 620
966 Ga0495580_0935165 3300046472 Bacteria 555
967 Ga0495582_0006818 3300046473 Bacteria 6355
968 Ga0495582_0006929 3300046473 Bacteria 6302
969 Ga0495582_0021021 3300046473 Bacteria 3574
970 Ga0495605_0003385 3300046474 Bacteria 9515
971 Ga0495605_0052863 3300046474 Bacteria 1972
972 Ga0495605_0116674 3300046474 Bacteria 1213
973 Ga0495605_0209240 3300046474 Bacteria 847
974 Ga0495639_0007187 3300046475 Bacteria 4780
975 Ga0495662_0030353 3300046476 Bacteria 2609
976 Ga0495662_0033594 3300046476 Bacteria 2478
977 Ga0495664_0001134 3300046477 Bacteria 13822
978 Ga0495664_0032759 3300046477 Bacteria 3051
979 Ga0495664_0137099 3300046477 Bacteria 1483
980 Ga0495584_0381463 3300046491 Bacteria 716
981 Ga0495584_0582433 3300046491 Bacteria 570
982 Ga0495594_0066235 3300046499 Bacteria 2004
983 Ga0495596_0087053 3300046500 Bacteria 1212
984 Ga0495596_0132519 3300046500 Bacteria 967
985 Ga0495596_0189257 3300046500 Bacteria 800
986 Ga0495596_0240131 3300046500 Bacteria 703
987 Ga0495596_0260129 3300046500 Bacteria 673
988 Ga0495607_0195157 3300046501 Bacteria 1006
989 Ga0495607_0428878 3300046501 Bacteria 597
990 Ga0495583_0010369 3300046506 Bacteria 5440
991 Ga0495583_0125616 3300046506 Bacteria 1076
992 Ga0495606_0022364 3300046507 Bacteria 4608
993 Ga0495606_0051212 3300046507 Bacteria 2694
994 Ga0495606_0152487 3300046507 Bacteria 1355
995 Ga0495606_0323529 3300046507 Bacteria 828
996 Ga0495608_0000977 3300046511 Bacteria 20193
997 Ga0495608_0002097 3300046511 Bacteria 14364
998 Ga0495608_0006540 3300046511 Bacteria 8267
999 Ga0495608_0200744 3300046511 Bacteria 1257
1000 Ga0495610_0000715 3300046512 Bacteria 31576
1001 Ga0495610_0018746 3300046512 Bacteria 3894
1002 Ga0495616_0112983 3300046513 Bacteria 1260
1003 Ga0495618_0002666 3300046514 Bacteria 11372
1004 Ga0495618_0005178 3300046514 Bacteria 7969
1005 Ga0495618_0252310 3300046514 Bacteria 1106
1006 Ga0495618_0384772 3300046514 Bacteria 860
1007 Ga0495620_0027211 3300046515 Bacteria 2678
1008 Ga0495620_0053589 3300046515 Bacteria 1707
1009 Ga0495620_0109892 3300046515 Bacteria 1093
1010 Ga0495628_0001590 3300046516 Bacteria 20832
1011 Ga0495628_0027909 3300046516 Bacteria 4589
1012 Ga0495628_0062966 3300046516 Bacteria 2906
1013 Ga0495628_0075213 3300046516 Bacteria 2630
1014 Ga0495628_0264069 3300046516 Bacteria 1282
1015 Ga0495628_0510859 3300046516 Bacteria 866
1016 Ga0495628_0559908 3300046516 Bacteria 820
1017 Ga0495628_1045263 3300046516 Bacteria 560
1018 Ga0495630_0012575 3300046517 Bacteria 6151
1019 Ga0495630_0040223 3300046517 Bacteria 3494
1020 Ga0495630_0051980 3300046517 Bacteria 3067
1021 Ga0495630_1039274 3300046517 Bacteria 622
1022 Ga0495630_1126923 3300046517 Bacteria 594
1023 Ga0495631_0004184 3300046518 Bacteria 7719
1024 Ga0495632_0370925 3300046519 Bacteria 628
1025 Ga0495637_0033627 3300046520 Bacteria 2250
1026 Ga0495637_0059393 3300046520 Bacteria 1573
1027 Ga0495637_0061714 3300046520 Bacteria 1536
1028 Ga0495643_0069608 3300046522 Bacteria 1849
1029 Ga0495643_0206400 3300046522 Bacteria 940
1030 Ga0495644_0246061 3300046523 Bacteria 694
1031 Ga0495644_0367726 3300046523 Bacteria 567
1032 Ga0495648_0020262 3300046524 Bacteria 4643
1033 Ga0495648_0037684 3300046524 Bacteria 3103
1034 Ga0495648_0249495 3300046524 Bacteria 857
1035 Ga0495648_0302585 3300046524 Bacteria 748
1036 Ga0495663_0173443 3300046525 Bacteria 744
1037 Ga0495666_0002472 3300046526 Bacteria 9180
1038 Ga0495666_0016275 3300046526 Bacteria 3703
1039 Ga0495666_0026285 3300046526 Bacteria 2870
1040 Ga0495666_0117402 3300046526 Bacteria 1247
1041 Ga0495666_0260108 3300046526 Bacteria 790
1042 Ga0495666_0264378 3300046526 Bacteria 782
1043 Ga0495642_0036207 3300046528 Bacteria 1994
1044 Ga0495652_0009989 3300046529 Bacteria 8601
1045 Ga0495652_0024538 3300046529 Bacteria 5336
1046 Ga0495652_0045692 3300046529 Bacteria 3762
1047 Ga0495652_0047731 3300046529 Bacteria 3671
1048 Ga0495652_0280039 3300046529 Bacteria 1221
1049 Ga0495652_0783465 3300046529 Bacteria 636
1050 Ga0495654_0274783 3300046530 Bacteria 695
1051 Ga0495654_0430366 3300046530 Bacteria 521
1052 Ga0495665_0006454 3300046531 Bacteria 6332
1053 Ga0495665_0026900 3300046531 Bacteria 3088
1054 Ga0495665_0104699 3300046531 Bacteria 1484
1055 Ga0495665_0303959 3300046531 Bacteria 816
1056 Ga0495640_0000851 3300046533 Bacteria 23338
1057 Ga0495640_0004804 3300046533 Bacteria 10758
1058 Ga0495640_0016285 3300046533 Bacteria 5564
1059 Ga0495640_0409452 3300046533 Bacteria 832
1060 Ga0495586_0021076 3300046535 Bacteria 3473
1061 Ga0495586_0038693 3300046535 Bacteria 2562
1062 Ga0495586_0247494 3300046535 Bacteria 1017
1063 Ga0495586_0554778 3300046535 Bacteria 663
1064 Ga0495587_0000960 3300046536 Bacteria 18892
1065 Ga0495587_0011859 3300046536 Bacteria 5509
1066 Ga0495587_0361621 3300046536 Bacteria 808
1067 Ga0495598_0148486 3300046537 Bacteria 816
1068 Ga0495598_0163957 3300046537 Bacteria 784
1069 Ga0495609_0222275 3300046538 Bacteria 784
1070 Ga0495621_0005377 3300046539 Bacteria 3676
1071 Ga0495621_0021528 3300046539 Bacteria 2126
1072 Ga0495621_0095242 3300046539 Bacteria 1127
1073 Ga0495621_0105052 3300046539 Bacteria 1078
1074 Ga0495621_0154444 3300046539 Bacteria 904
1075 Ga0495597_0054590 3300046542 Bacteria 1754
1076 Ga0495597_0088918 3300046542 Bacteria 1313
1077 Ga0495645_0015174 3300046543 Bacteria 5477
1078 Ga0495645_0054506 3300046543 Bacteria 2905
1079 Ga0495645_0169307 3300046543 Bacteria 1504
1080 Ga0495645_0196372 3300046543 Bacteria 1372
1081 Ga0495645_0585237 3300046543 Bacteria 688
1082 Ga0495622_0000227 3300046557 Bacteria 44370
1083 Ga0495622_0039221 3300046557 Bacteria 2205
1084 Ga0495622_0196771 3300046557 Bacteria 899
1085 Ga0495622_0219706 3300046557 Bacteria 842
1086 Ga0495633_0299127 3300046558 Bacteria 731
1087 Ga0495667_0056929 3300046559 Bacteria 2570
1088 Ga0495667_0102806 3300046559 Bacteria 1848
1089 Ga0495656_0003255 3300046615 Bacteria 5478
1090 Ga0495656_0083694 3300046615 Bacteria 1445
1091 Ga0495656_0578374 3300046615 Bacteria 600
1092 Ga0495668_0111648 3300046616 Bacteria 1495
1093 Ga0495668_0322559 3300046616 Bacteria 847
1094 Ga0495634_0032070 3300046642 Bacteria 3615
1095 Ga0495634_0085634 3300046642 Bacteria 2053
1096 Ga0495634_0373293 3300046642 Bacteria 851
1097 Ga0495634_0519592 3300046642 Bacteria 696
1098 Ga0495611_0078845 3300046648 Bacteria 1512
1099 Ga0495611_0282706 3300046648 Bacteria 766
1100 Ga0495625_0000896 3300046660 Bacteria 40225
1101 Ga0495625_0098277 3300046660 Bacteria 2014
1102 Ga0495625_0195788 3300046660 Bacteria 1336
1103 Ga0495625_0371481 3300046660 Bacteria 899
1104 Ga0495625_0610611 3300046660 Bacteria 654
1105 Ga0495635_0004478 3300046663 Bacteria 9677
1106 Ga0495635_0102750 3300046663 Bacteria 1953
1107 Ga0495635_0147442 3300046663 Bacteria 1602
1108 Ga0495635_0356059 3300046663 Bacteria 976
1109 Ga0495661_0003464 3300046665 Bacteria 11647
1110 Ga0495661_0006964 3300046665 Bacteria 7904
1111 Ga0495661_0021872 3300046665 Bacteria 4163
1112 Ga0495588_0021438 3300046674 Bacteria 3183
1113 Ga0495588_0056225 3300046674 Bacteria 2031
1114 Ga0495588_0080144 3300046674 Bacteria 1704
1115 Ga0495588_0150641 3300046674 Bacteria 1229
1116 Ga0495657_0032871 3300046675 Bacteria 3616
1117 Ga0495657_0101119 3300046675 Bacteria 1837
1118 Ga0495657_0313682 3300046675 Bacteria 933
1119 Ga0495657_0828138 3300046675 Bacteria 528
1120 Ga0495599_0005836 3300046678 Bacteria 7394
1121 Ga0495599_0006011 3300046678 Bacteria 7303
1122 Ga0495599_0033983 3300046678 Bacteria 3205
1123 Ga0495599_0142099 3300046678 Bacteria 1489
1124 Ga0495599_0626782 3300046678 Bacteria 625
1125 Ga0495599_0835747 3300046678 Bacteria 524
1126 Ga0495623_0009259 3300046679 Bacteria 6393
1127 Ga0495623_0009921 3300046679 Bacteria 6168
1128 Ga0495623_0013984 3300046679 Bacteria 5199
1129 Ga0495623_0027409 3300046679 Bacteria 3666
1130 Ga0495623_0034735 3300046679 Bacteria 3233
1131 Ga0495646_0006968 3300046680 Bacteria 7176
1132 Ga0495646_0008406 3300046680 Bacteria 6557
1133 Ga0495646_0012704 3300046680 Bacteria 5350
1134 Ga0495646_0015901 3300046680 Bacteria 4776
1135 Ga0495646_0019173 3300046680 Bacteria 4332
1136 Ga0495646_0123552 3300046680 Bacteria 1463
1137 Ga0495646_0278287 3300046680 Bacteria 890
1138 Ga0495646_0477850 3300046680 Bacteria 641
1139 Ga0495646_0689624 3300046680 Bacteria 514
1140 Ga0495658_0377724 3300046683 Bacteria 902
1141 Ga0495658_0556919 3300046683 Bacteria 734
1142 Ga0495669_0071226 3300046684 Bacteria 1585
1143 Ga0495669_0131520 3300046684 Bacteria 1178
1144 Ga0495669_0326367 3300046684 Bacteria 741
1145 Ga0495669_0403404 3300046684 Bacteria 663
1146 Ga0495613_0000727 3300046689 Bacteria 25810
1147 Ga0495613_0075915 3300046689 Bacteria 2446
1148 Ga0495613_0095415 3300046689 Bacteria 2151
1149 Ga0495613_0124829 3300046689 Bacteria 1847
1150 Ga0495624_0002244 3300046690 Bacteria 14729
1151 Ga0495624_0009113 3300046690 Bacteria 6882
1152 Ga0495624_0015384 3300046690 Bacteria 5166
1153 Ga0495624_0018007 3300046690 Bacteria 4730
1154 Ga0495624_0020073 3300046690 Bacteria 4452
1155 Ga0495624_0035525 3300046690 Bacteria 3217
1156 Ga0495624_0434387 3300046690 Bacteria 787
1157 Ga0495624_0643852 3300046690 Bacteria 631
1158 Ga0495670_0477969 3300046691 Bacteria 676
1159 Ga0495671_0009212 3300046692 Bacteria 5519
1160 Ga0495671_0012054 3300046692 Bacteria 4727
1161 Ga0495671_0144411 3300046692 Bacteria 1159
1162 Ga0495671_0251807 3300046692 Bacteria 852
1163 Ga0495649_0015513 3300046694 Bacteria 4335
1164 Ga0495649_0053783 3300046694 Bacteria 2179
1165 Ga0495649_0095199 3300046694 Bacteria 1585
1166 Ga0495649_0121404 3300046694 Bacteria 1381
1167 Ga0495649_0355832 3300046694 Bacteria 739
1168 Ga0495589_0001853 3300046794 Bacteria 11990
1169 Ga0495589_0082302 3300046794 Bacteria 1565
1170 Ga0495589_0087777 3300046794 Bacteria 1510
1171 Ga0495600_0000837 3300046809 Bacteria 16388
1172 Ga0495600_0040137 3300046809 Bacteria 3048
1173 Ga0495600_0108769 3300046809 Bacteria 1805
1174 Ga0495600_0238148 3300046809 Bacteria 1160
1175 Ga0495600_0300147 3300046809 Bacteria 1013
1176 Ga0495660_0096851 3300046810 Bacteria 1524
1177 Ga0495660_0207985 3300046810 Bacteria 930
1178 Ga0495660_0455873 3300046810 Bacteria 552
1179 Ga0495581_0000459 3300047315 Bacteria 20871
1180 Ga0495581_0013072 3300047315 Bacteria 4812
1181 Ga0495581_0237450 3300047315 Bacteria 1066
1182 Ga0495604_0001208 3300047317 Bacteria 21323
1183 Ga0495604_0017126 3300047317 Bacteria 5796
1184 Ga0495604_0025084 3300047317 Bacteria 4753
1185 Ga0495604_0063217 3300047317 Bacteria 2824
1186 Ga0495604_0100869 3300047317 Bacteria 2121
1187 Ga0495604_0229972 3300047317 Bacteria 1272
1188 Ga0495604_0432499 3300047317 Bacteria 862
1189 Ga0495604_0552236 3300047317 Bacteria 742
1190 Ga0495604_0639677 3300047317 Bacteria 679
1191 Ga0495674_0062259 3300047319 Bacteria 3249
1192 Ga0495674_0086127 3300047319 Bacteria 2690
1193 Ga0495674_0087641 3300047319 Bacteria 2664
1194 Ga0495674_0107707 3300047319 Bacteria 2365
1195 Ga0495674_0111436 3300047319 Bacteria 2319
1196 Ga0495674_0171456 3300047319 Bacteria 1810
1197 Ga0495674_0510485 3300047319 Bacteria 960
1198 Ga0495672_0032972 3300047320 Bacteria 3214
1199 Ga0495672_0060806 3300047320 Bacteria 2180
1200 Ga0495672_0216212 3300047320 Bacteria 949
1201 Ga0495672_0256739 3300047320 Bacteria 845
1202 Ga0495672_0539221 3300047320 Bacteria 513
1203 Ga0495676_0000690 3300047321 Bacteria 28135
1204 Ga0495676_0010669 3300047321 Bacteria 8321
1205 Ga0495676_0026895 3300047321 Bacteria 4942
1206 Ga0495676_0297396 3300047321 Bacteria 1089
1207 Ga0495676_0475453 3300047321 Bacteria 822
1208 Ga0495676_0659560 3300047321 Bacteria 678
1209 Ga0495676_0771182 3300047321 Bacteria 620
1210 Ga0495680_0001210 3300047322 Bacteria 28304
1211 Ga0495680_0005577 3300047322 Bacteria 11806
1212 Ga0495680_0010573 3300047322 Bacteria 8231
1213 Ga0495680_0021462 3300047322 Bacteria 5406
1214 Ga0495680_0537162 3300047322 Bacteria 789
1215 Ga0495683_0004492 3300047323 Bacteria 7903
1216 Ga0495683_0008226 3300047323 Bacteria 5592
1217 Ga0495683_0011154 3300047323 Bacteria 4736
1218 Ga0495683_0033199 3300047323 Bacteria 2627
1219 Ga0495683_0080549 3300047323 Bacteria 1588
1220 Ga0495683_0087622 3300047323 Bacteria 1512
1221 Ga0495683_0314224 3300047323 Bacteria 669
1222 Ga0495687_025522 3300047443 Bacteria 2791
1223 Ga0495687_027539 3300047443 Bacteria 2658
1224 Ga0495687_078157 3300047443 Bacteria 1304
1225 Ga0495687_098960 3300047443 Bacteria 1099
1226 Ga0495675_0004622 3300047444 Bacteria 8359
1227 Ga0495675_0006887 3300047444 Bacteria 6979
1228 Ga0495675_0011293 3300047444 Bacteria 5604
1229 Ga0495675_0088294 3300047444 Bacteria 1947
1230 Ga0495675_0857074 3300047444 Bacteria 500
1231 Ga0495677_0122407 3300047445 Bacteria 993
1232 Ga0495677_0253758 3300047445 Bacteria 688
1233 Ga0495677_0440598 3300047445 Bacteria 516
1234 Ga0495679_000782 3300047446 Bacteria 20150
1235 Ga0495679_001796 3300047446 Bacteria 11701
1236 Ga0495679_009381 3300047446 Bacteria 3920
1237 Ga0495679_048958 3300047446 Bacteria 1276
1238 Ga0495673_0016174 3300047469 Bacteria 3821
1239 Ga0495673_0026376 3300047469 Bacteria 2779
1240 Ga0495673_0289396 3300047469 Bacteria 589
1241 Ga0495681_0046925 3300047470 Bacteria 2057
1242 Ga0495681_0191278 3300047470 Bacteria 835
1243 Ga0495684_0019826 3300047471 Bacteria 5182
1244 Ga0495686_0031854 3300047472 Bacteria 3416
1245 Ga0495686_0033165 3300047472 Bacteria 3336
1246 Ga0495593_0004404 3300047673 Bacteria 8370
1247 Ga0495593_0026770 3300047673 Bacteria 3180
1248 Ga0495593_0047170 3300047673 Bacteria 2292
1249 Ga0495593_0065165 3300047673 Bacteria 1900
1250 Ga0495593_0104860 3300047673 Bacteria 1447
1251 Ga0495593_0120960 3300047673 Bacteria 1332
1252 Ga0495602_0004187 3300048088 Bacteria 15010
1253 Ga0495602_0006799 3300048088 Bacteria 12008
1254 Ga0495602_0026312 3300048088 Bacteria 5613
1255 Ga0495602_0066379 3300048088 Bacteria 3108
1256 Ga0495602_0114076 3300048088 Bacteria 2189
1257 Ga0495602_0125755 3300048088 Bacteria 2054
1258 Ga0495602_0173576 3300048088 Bacteria 1670
1259 Ga0495602_0238847 3300048088 Bacteria 1360
1260 Ga0495602_0373330 3300048088 Bacteria 1023
1261 Ga0495602_0551317 3300048088 Bacteria 799
1262 Ga0495614_0003278 3300048089 Bacteria 7230
1263 Ga0495614_0003316 3300048089 Bacteria 7200
1264 Ga0495614_0008194 3300048089 Bacteria 4648
1265 Ga0495614_0044355 3300048089 Bacteria 1907
1266 Ga0495614_0197018 3300048089 Bacteria 910
1267 Ga0495615_0287790 3300048090 Bacteria 529
1268 Ga0495615_0290350 3300048090 Bacteria 527
1269 Ga0495626_0021459 3300048091 Bacteria 3205
1270 Ga0495626_0035111 3300048091 Bacteria 2394
1271 Ga0496100_0007340 3300048903 Bacteria 6072
1272 Ga0496101_0010034 3300048904 Bacteria 6239
1273 Ga0496101_0031149 3300048904 Bacteria 3746
1274 Ga0496101_0134927 3300048904 Bacteria 1877
1275 Ga0496101_0470949 3300048904 Bacteria 992
1276 Ga0496102_0027035 3300048905 Bacteria 5123
1277 Ga0496102_0037838 3300048905 Bacteria 4353
1278 Ga0496102_0105008 3300048905 Bacteria 2628
1279 Ga0496102_0435824 3300048905 Bacteria 1230
1280 Ga0496102_0503617 3300048905 Bacteria 1133
1281 Ga0496102_0878975 3300048905 Bacteria 818
1282 Ga0496102_1194916 3300048905 Bacteria 680
1283 Ga0496103_0003901 3300048906 Bacteria 9069
1284 Ga0496103_0011464 3300048906 Bacteria 5253
1285 Ga0496103_0011709 3300048906 Bacteria 5203
1286 Ga0496103_0108330 3300048906 Bacteria 1763
1287 Ga0496103_0684404 3300048906 Bacteria 650
1288 Ga0496104_0013570 3300048907 Bacteria 7343
1289 Ga0496104_0020850 3300048907 Bacteria 6010
1290 Ga0496104_0243519 3300048907 Bacteria 1710
1291 Ga0496104_0666406 3300048907 Unclassified 949
1292 Ga0496105_0003439 3300048908 Bacteria 11726
1293 Ga0496105_0204184 3300048908 Bacteria 1612
1294 Ga0496106_0000029 3300048909 Bacteria 141097
1295 Ga0496106_0016044 3300048909 Bacteria 5538
1296 Ga0496106_0128344 3300048909 Bacteria 1987
1297 Ga0496107_0073245 3300048910 Bacteria 2491
1298 Ga0496107_0176569 3300048910 Bacteria 1586
1299 Ga0496107_0552325 3300048910 Bacteria 853
1300 Ga0496107_0740350 3300048910 Bacteria 722
1301 Ga0496108_0063024 3300048911 Bacteria 3122
1302 Ga0496108_0154733 3300048911 Bacteria 1980
1303 Ga0496108_1355200 3300048911 Bacteria 597
1304 Ga0496109_0773107 3300048912 Bacteria 898
1305 Ga0496109_1894690 3300048912 Bacteria 529
1306 Ga0496110_0139448 3300048913 Bacteria 2192
1307 Ga0496110_0201515 3300048913 Bacteria 1808
1308 Ga0496110_0705675 3300048913 Bacteria 910
1309 Ga0496111_0403099 3300048914 Bacteria 1010
1310 Ga0496112_0052273 3300048915 Bacteria 4009
1311 Ga0496112_0101870 3300048915 Bacteria 2841
1312 Ga0496112_0936938 3300048915 Bacteria 787
1313 Ga0496113_0020740 3300048916 Bacteria 4626
1314 Ga0496114_0289103 3300048917 Bacteria 1446
1315 Ga0496114_0391590 3300048917 Bacteria 1230
1316 Ga0496115_0464063 3300048918 Bacteria 1021
1317 Ga0496115_0486097 3300048918 Bacteria 994
1318 Ga0496116_0011329 3300048919 Bacteria 7395
1319 Ga0496116_0129945 3300048919 Bacteria 1438
1320 Ga0496116_0130601 3300048919 Bacteria 1433
1321 Ga0496116_0141146 3300048919 Bacteria 1355
1322 Ga0496116_0176674 3300048919 Bacteria 1149
1323 Ga0496116_0179001 3300048919 Bacteria 1138
1324 Ga0496116_0417694 3300048919 Bacteria 587
1325 Ga0496117_0024726 3300048920 Bacteria 4738
1326 Ga0496117_0028598 3300048920 Bacteria 4315
1327 Ga0496117_0048496 3300048920 Bacteria 3033
1328 Ga0496117_0097767 3300048920 Bacteria 1868
1329 Ga0496117_0119509 3300048920 Bacteria 1622
1330 Ga0496117_0174184 3300048920 Bacteria 1245
1331 Ga0496117_0212771 3300048920 Bacteria 1082
1332 Ga0496117_0230533 3300048920 Bacteria 1024
1333 Ga0496117_0373914 3300048920 Bacteria 728
1334 Ga0496118_0003596 3300048921 Bacteria 19293
1335 Ga0496118_0004215 3300048921 Bacteria 17260
1336 Ga0496118_0010125 3300048921 Bacteria 9371
1337 Ga0496118_0010300 3300048921 Bacteria 9272
1338 Ga0496118_0023632 3300048921 Bacteria 5331
1339 Ga0496118_0030038 3300048921 Bacteria 4545
1340 Ga0496118_0103671 3300048921 Bacteria 1912
1341 Ga0496118_0254597 3300048921 Bacteria 995
1342 Ga0496118_0372407 3300048921 Bacteria 753
1343 Ga0496118_0452901 3300048921 Bacteria 651
1344 Ga0496119_0060099 3300048922 Bacteria 2278
1345 Ga0496120_0086576 3300048923 Bacteria 1684
1346 Ga0496120_0314958 3300048923 Bacteria 713
1347 Ga0496121_0017765 3300048924 Bacteria 7232
1348 Ga0496121_0033036 3300048924 Bacteria 4691
1349 Ga0496121_0052767 3300048924 Bacteria 3410
1350 Ga0496121_0055271 3300048924 Bacteria 3309
1351 Ga0496121_0066491 3300048924 Bacteria 2927
1352 Ga0496121_0070584 3300048924 Bacteria 2813
1353 Ga0496121_0195498 3300048924 Bacteria 1446
1354 Ga0496121_0276966 3300048924 Bacteria 1150
1355 Ga0496121_0637886 3300048924 Bacteria 651
1356 Ga0496122_0064753 3300048925 Bacteria 2657
1357 Ga0496122_0191029 3300048925 Bacteria 1209
1358 Ga0496122_0446430 3300048925 Bacteria 643
1359 Ga0496122_0556998 3300048925 Bacteria 545
1360 Ga0496123_0049882 3300048926 Bacteria 2802
1361 Ga0496123_0053888 3300048926 Bacteria 2654
1362 Ga0496123_0170044 3300048926 Bacteria 1151
1363 Ga0496123_0272488 3300048926 Bacteria 823
1364 Ga0496124_0108059 3300048927 Bacteria 2244
1365 Ga0496124_0145910 3300048927 Bacteria 1862
1366 Ga0496124_0162783 3300048927 Bacteria 1737
1367 Ga0496124_0253740 3300048927 Bacteria 1299
1368 Ga0496124_0253926 3300048927 Bacteria 1298
1369 Ga0496125_0020173 3300048928 Bacteria 6264
1370 Ga0496125_0035025 3300048928 Bacteria 4414
1371 Ga0496125_0399100 3300048928 Bacteria 804
1372 Ga0496125_0663273 3300048928 Bacteria 559
1373 Ga0496125_0731488 3300048928 Bacteria 521
1374 Ga0496126_0000192 3300048929 Bacteria 136536
1375 Ga0496126_0015457 3300048929 Bacteria 7676
1376 Ga0496126_0019787 3300048929 Bacteria 6623
1377 Ga0501310_073528 3300049130 Bacteria 527
1378 Ga0495678_019117 3300049459 Bacteria 3065
1379 Ga0495678_040459 3300049459 Bacteria 1874
1380 Ga0495682_0043650 3300049460 Bacteria 1641
1381 Ga0495682_0051269 3300049460 Bacteria 1501
1382 Ga0495682_0065984 3300049460 Bacteria 1305
1383 Ga0495682_0184191 3300049460 Bacteria 742
1384 Ga0501031_0130976 3300049568 Bacteria 1639
1385 Ga0501032_0214316 3300049569 Bacteria 1255
1386 Ga0501032_0332404 3300049569 Bacteria 980
1387 Ga0501034_0965199 3300049571 Bacteria 737
1388 Ga0501036_0067942 3300049572 Bacteria 3016
1389 Ga0501037_0375569 3300049573 Bacteria 978
1390 Ga0501043_0141444 3300049579 Bacteria 1884
1391 Ga0501043_0546238 3300049579 Bacteria 861
1392 Ga0501046_0388601 3300049580 Bacteria 1009
1393 Ga0501046_0573466 3300049580 Bacteria 803
1394 Ga0501047_0048109 3300049581 Bacteria 4119
1395 Ga0501047_0787930 3300049581 Bacteria 766
1396 Ga0501047_0875914 3300049581 Bacteria 712
1397 Ga0501048_0923800 3300049582 Bacteria 628
1398 Ga0501249_011563 3300049679 Bacteria 1855
1399 Ga0501225_0090908 3300049705 Bacteria 884
1400 Ga0501262_000153 3300049759 Bacteria 8442
1401 Ga0501266_006089 3300049763 Bacteria 1500
1402 Ga0501035_0590911 3300049822 Bacteria 906
1403 Ga0501044_0127969 3300049823 Bacteria 2536
1404 Ga0501044_0154548 3300049823 Bacteria 2274
1405 Ga0501044_0344799 3300049823 Bacteria 1410
1406 Ga0501044_0457318 3300049823 Bacteria 1182
1407 Ga0501044_0615653 3300049823 Bacteria 978
1408 Ga0501044_1323512 3300049823 Bacteria 587
1409 Ga0501044_1448993 3300049823 Bacteria 552
1410 nmdc:mga03683_10250_c1 3300050489 Bacteria 3358
1411 nmdc:mga03683_122491_c1 3300050489 Bacteria 1157
1412 nmdc:mga03683_132698_c1 3300050489 Bacteria 1115
1413 nmdc:mga03683_134288_c1 3300050489 Bacteria 1109
1414 nmdc:mga03683_55542_c1 3300050489 Bacteria 1663
1415 nmdc:mga03683_571549_c1 3300050489 Bacteria 552
1416 nmdc:mga03683_7155_c1 3300050489 Bacteria 3860
1417 nmdc:mga03n38_195531_c1 3300050490 Bacteria 1044
1418 nmdc:mga03n38_48437_c1 3300050490 Bacteria 1885
1419 nmdc:mga03n38_574910_c1 3300050490 Bacteria 640
1420 nmdc:mga03n38_728230_c1 3300050490 Bacteria 573
1421 nmdc:mga00v17_120674_c1 3300050491 Bacteria 1669
1422 nmdc:mga00v17_21047_c1 3300050491 Bacteria 1139
1423 nmdc:mga00v17_485302_c1 3300050491 Bacteria 801
1424 nmdc:mga00v17_78656_c1 3300050491 Bacteria 2055
1425 nmdc:mga00v17_869000_c1 3300050491 Bacteria 572
1426 nmdc:mga00v17_964515_c1 3300050491 Bacteria 538
1427 nmdc:mga0yw44_20195_c1 3300050492 Bacteria 3691
1428 nmdc:mga0yw44_24525_c1 3300050492 Bacteria 3415
1429 nmdc:mga0yw44_28625_c1 3300050492 Bacteria 3207
1430 nmdc:mga0yw44_58591_c1 3300050492 Bacteria 2353
1431 nmdc:mga0k408_120636_c1 3300050493 Bacteria 1553
1432 nmdc:mga0k408_175015_c1 3300050493 Bacteria 1279
1433 nmdc:mga0k408_31432_c1 3300050493 Bacteria 3031
1434 nmdc:mga0k408_41811_c1 3300050493 Bacteria 2639
1435 nmdc:mga0k408_425399_c1 3300050493 Bacteria 789
1436 nmdc:mga0k408_53897_c1 3300050493 Bacteria 2028
1437 nmdc:mga06z11_277517_c1 3300050494 Bacteria 992
1438 nmdc:mga06z11_57687_c1 3300050494 Bacteria 2012
1439 nmdc:mga06z11_939509_c1 3300050494 Bacteria 527
1440 nmdc:mga04h51_139923_c1 3300050495 Bacteria 917
1441 nmdc:mga04h51_36942_c1 3300050495 Bacteria 1574
1442 nmdc:mga07m45_132318_c1 3300050496 Bacteria 1443
1443 nmdc:mga07m45_348594_c1 3300050496 Bacteria 860
1444 nmdc:mga07m45_395746_c1 3300050496 Bacteria 802
1445 nmdc:mga07m45_4880_c1 3300050496 Bacteria 6606
1446 nmdc:mga07m45_49399_c1 3300050496 Bacteria 1878
1447 nmdc:mga07m45_499_c2 3300050496 Bacteria 3411
1448 nmdc:mga07m45_546254_c1 3300050496 Bacteria 670
1449 nmdc:mga07m45_5785_c1 3300050496 Bacteria 6194
1450 nmdc:mga07m45_8907_c1 3300050496 Bacteria 5182
1451 nmdc:mga07m45_91600_c1 3300050496 Bacteria 1742
1452 nmdc:mga09592_490666_c1 3300050508 Bacteria 1058
1453 nmdc:mga0qj67_534819_c1 3300050509 Bacteria 941
1454 nmdc:mga0sz30_158742_c1 3300050516 Bacteria 1001
1455 nmdc:mga0sz30_172506_c1 3300050516 Bacteria 959
1456 Ga0495601_0009150 3300053077 Bacteria 5850
1457 Ga0500610_0006171 3300053079 Bacteria 5001
1458 Ga0500610_0006176 3300053079 Bacteria 5000
1459 Ga0500610_0013178 3300053079 Bacteria 3837
1460 Ga0495655_0246682 3300053083 Bacteria 599
1461 Ga0495619_0853236 3300053085 Bacteria 614
1462 Ga0500643_026394 3300053087 Bacteria 1819
1463 Ga0500644_0002098 3300053088 Bacteria 5060
1464 Ga0500651_0000449 3300053093 Bacteria 21984
1465 Ga0500651_0027085 3300053093 Bacteria 3604
1466 Ga0500566_0022690 3300053094 Bacteria 3686
1467 Ga0500566_0235304 3300053094 Bacteria 901
1468 Ga0500641_0265634 3300053096 Bacteria 715
1469 Ga0500650_0290196 3300053098 Bacteria 726
1470 Ga0500560_065982 3300053107 Bacteria 1187
1471 Ga0500562_036326 3300053108 Bacteria 1306
1472 Ga0500569_099361 3300053109 Bacteria 952
1473 Ga0500571_000954 3300053110 Bacteria 12703
1474 Ga0500572_191414 3300053111 Bacteria 670
1475 Ga0500593_003907 3300053117 Bacteria 5717
1476 Ga0500593_008376 3300053117 Bacteria 4245
1477 Ga0500594_0030544 3300053118 Bacteria 1415
1478 Ga0500595_003291 3300053119 Bacteria 7612
1479 Ga0500597_116440 3300053120 Bacteria 1159
1480 Ga0500607_004990 3300053121 Bacteria 8825
1481 Ga0500607_166797 3300053121 Bacteria 998
1482 Ga0500608_004926 3300053122 Bacteria 5233
1483 Ga0500608_006421 3300053122 Bacteria 4786
1484 Ga0500626_083514 3300053128 Bacteria 1409
1485 Ga0500628_009378 3300053129 Bacteria 1724
1486 Ga0500652_389968 3300053131 Bacteria 518
1487 Ga0500655_000523 3300053133 Bacteria 7736
1488 Ga0500658_0002041 3300053134 Bacteria 7872
1489 Ga0500659_0332007 3300053135 Bacteria 672
1490 Ga0500561_0026946 3300053137 Bacteria 1413
1491 Ga0500574_000756 3300053141 Bacteria 4325
1492 Ga0500574_006374 3300053141 Bacteria 2370
1493 Ga0500586_167286 3300053145 Bacteria 742
1494 Ga0500588_0069659 3300053146 Bacteria 1150
1495 Ga0500604_0050128 3300053151 Bacteria 1286
1496 Ga0500616_0091761 3300053153 Bacteria 1503
1497 Ga0500619_001546 3300053154 Bacteria 4117
1498 Ga0500619_097310 3300053154 Bacteria 997
1499 Ga0500620_280797 3300053155 Bacteria 545
1500 Ga0500624_009867 3300053157 Bacteria 1365
1501 Ga0500627_0000962 3300053158 Bacteria 7800
1502 Ga0500633_0184266 3300053160 Bacteria 783
1503 Ga0500634_0006145 3300053161 Bacteria 5783
1504 Ga0500634_0013201 3300053161 Bacteria 4327
1505 Ga0500638_003903 3300053162 Bacteria 5628
1506 Ga0500636_0077064 3300053177 Bacteria 1926
1507 Ga0500625_149092 3300053729 Bacteria 884
1508 Ga0500645_002856 3300053730 Bacteria 7416
1509 Ga0500645_011518 3300053730 Bacteria 2884
1510 Ga0500645_013521 3300053730 Bacteria 2618
1511 Ga0500645_042612 3300053730 Bacteria 1338
1512 Ga0500565_006966 3300053734 Bacteria 1056
1513 Ga0500596_037598 3300053735 Bacteria 766
1514 Ga0500661_010597 3300055283 Bacteria 1677
1515 Ga0466962_0001204 3300061719 Bacteria 11881
1516 Ga0466962_0010772 3300061719 Bacteria 4394
1517 Ga0466962_0360735 3300061719 Bacteria 724
1518 Ga0466962_0637543 3300061719 Bacteria 544
1519 2501082222 2501025502 Bacteria 9641094
1520 2509128682 2508501125 Bacteria 7208311
1521 2510250893 2510065045 Bacteria 7761063
1522 2511086431 2510917013 Bacteria 9951648
1523 2512346213 2512047030 Bacteria 9031815
1524 2513960922 2513237151 Bacteria 6309801
1525 2514048113 2513237166 Bacteria 10373764
1526 2515679665 2515154122 Bacteria 8609520
1527 2515692518 2515154123 Bacteria 6387382
1528 2516020346 2515154189 Bacteria 9629850
1529 2527075159 2526164713 Bacteria 6780608
1530 2563062991 2562617112 Bacteria 10918404
1531 2713477190 2711768613 Bacteria 11048459
1532 2719640028 2718217991 Bacteria 7829542
1533 2738820769 2738541296 Bacteria 7285013
1534 2738833249 2738541298 Bacteria 7286732
1535 2738874777 2738541306 Bacteria 7284992
1536 2739186406 2738543002 Bacteria 7284546
1537 2739221375 2738543008 Bacteria 7282815
1538 2739252175 2738543013 Bacteria 5618633
1539 2746089644 2744054900 Bacteria 8399525
1540 2746097899 2744054901 Bacteria 8397047
1541 2753570346 2751185846 Bacteria 7242164
1542 2792836436 2791355137 Bacteria 9654227
1543 2819541476 2818991436 Bacteria 5376622
1544 2819620210 2818991450 Bacteria 6962147
1545 2883088896 2883087390 Bacteria 9532701
1546 2885278733 2885270888 Bacteria 9831543
1547 2900635047 2900634093 Bacteria 10263517
1548 2902689687 2902682994 Bacteria 8951596
1549 2904484925 2904483920 Bacteria 7545285
1550 2904617114 2904615490 Bacteria 10047340
1551 2919530648 2919527303 Bacteria 7718827
1552 2928110231 2928108538 Bacteria 7360024
1553 2928138635 2928135762 Bacteria 7259641
1554 2928505279 2928503688 Bacteria 7268108
1555 2945936946 2945934425 Bacteria 7444609
1556 2974322607 2974320154 Bacteria 4571377
1557 2990706329 2990703756 Bacteria 7715990
1558 642423150 641736151 Bacteria 7477263
1559 642592710 642555112 Bacteria 8676562
1560 642621372 642555113 Bacteria 8214658
1561 8003955446 8003955200 Bacteria 8601927
1562 8055268275 8055266321 Bacteria 7999742
1563 8055302407 8055301274 Bacteria 8587385
1564 Ga0395900_0375240
1565 JGI24740J21852_10004178
1566 JGI24739J22299_10002177
1567 JGI24739J22299_10052521
1568 JGI24737J22298_10080653
1569 JGI24737J22298_10134265
1570 JGI24735J21928_10007831
1571 JGI24735J21928_10053098
1572 JGI24738J21930_10020114
1573 JGI25155J39150_1000074
1574 JGI25156J39149_1000002
1575 JGI25156J39149_1000832
1576 JGI25156J39149_1001354
1577 JGI25156J39149_1002530
1578 JGI25154J39366_1000010
1579 JGI25157J39369_1000001
1580 JGI25163J39215_1004817
1581 JGI25152J39213_1004751
1582 JGI25152J39213_1018459
1583 JGI25150J39212_1001868
1584 JGI25159J45721_1000465
1585 JGI25159J45721_1005036
1586 JGI25159J45721_1008645
1587 JGI25159J45721_1010302
1588 JGI25151J46595_10004722
1589 JGI25151J46595_10007240
1590 JGI25151J46595_10011024
1591 JGI25151J46595_10025444
1592 JGI25151J46595_10048668
1593 JGI25151J46595_10055085
1594 JGI25151J46595_10055090
1595 JGI25151J46595_10095461
1596 JGI25165J46597_1000122
1597 JGI25165J46597_1003773
1598 JGI25153J46596_10010535
1599 JGI25153J46596_10017438
1600 JGI25153J46596_10045306
1601 rootH1_10067293
1602 rootH2_10162484
1603 rootL2_10092707
1604 rootL2_10160743
1605 rootH1_10248647
1606 JGI25160J50197_1000192
1607 JGI25160J50197_1007623
1608 JGI25160J50197_1017692
1609 JGI25160J50197_1033752
1610 JGI25160J50197_1036495
1611 JGI25161J50226_1000043
1612 JGI25161J50226_1001441
1613 JGI25161J50226_1004787
1614 Ga0006562J51391_1157498
1615 Ga0006562J51391_1157500
1616 Ga0006562J51391_1170727
1617 Ga0006562J51391_1170728
1618 Ga0055538_1000048
1619 Ga0055539_1000070
1620 Ga0055533_1000078
1621 Ga0055533_1000217
1622 Ga0055533_1001154
1623 Ga0055532_1000027
1624 Ga0055532_1003249
1625 Ga0055525_1000106
1626 Ga0055527_1000019
1627 Ga0055527_1001078
1628 Ga0055535_1000021
1629 Ga0055535_1000392
1630 Ga0055535_1002465
1631 Ga0055542_1000032
1632 Ga0055542_1000033
1633 Ga0055542_1001104
1634 Ga0055529_1000038
1635 Ga0055529_1001039
1636 Ga0055526_1003998
1637 Ga0055526_1004562
1638 Ga0055526_1010656
1639 Ga0055526_1011784
1640 Ga0055526_1085415
1641 Ga0055537_1000259
1642 Ga0055537_1001161
1643 Ga0055537_1004117
1644 Ga0055537_1004429
1645 Ga0055537_1012744
1646 Ga0055537_1012749
1647 Ga0055524_1000156
1648 Ga0055524_1008536
1649 Ga0055524_1009658
1650 Ga0055536_1000270
1651 Ga0055536_1003726
1652 Ga0055536_1008866
1653 Ga0055536_1009172
1654 Ga0055536_1072764
1655 Ga0055536_1102973
1656 Ga0055534_1001138
1657 Ga0055534_1004201
1658 Ga0055534_1005776
1659 Ga0055534_1006046
1660 Ga0055534_1016835
1661 Ga0055534_1018628
1662 Ga0055528_1002167
1663 Ga0055528_1008888
1664 Ga0055528_1012346
1665 Ga0055528_1012509
1666 Ga0055528_1027152
1667 Ga0055528_1027156
1668 Ga0055528_1042958
1669 Ga0055530_10000408
1670 Ga0055530_10003951
1671 Ga0055530_10009348
1672 Ga0055530_10052631
1673 Ga0055530_10066045
1674 Ga0055540_1000033
1675 Ga0055540_1003778
1676 Ga0055540_1004106
1677 Ga0055540_1004580
1678 Ga0055540_1007340
1679 Ga0055540_1019358
1680 Ga0055531_10000273
1681 Ga0055531_10004865
1682 Ga0055531_10009016
1683 Ga0055531_10011825
1684 Ga0055531_10018627
1685 Ga0055541_1000050
1686 Ga0055543_1000127
1687 Ga0055543_1003299
1688 Ga0055543_1003796
1689 Ga0055543_1060930
1690 Ga0065165_1009736
1691 Ga0065165_1018503
1692 Ga0065165_1021250
1693 Ga0065165_1024886
1694 Ga0065165_1025051
1695 Ga0065165_1034242
1696 Ga0065165_1040701
1697 Ga0065714_10090017
1698 Ga0065704_10193152
1699 Ga0070658_10706465
1700 Ga0070658_11158888
1701 Ga0070658_11689752
1702 Ga0070676_10341599
1703 Ga0070690_101777161
1704 Ga0070677_10179772
1705 Ga0070666_10137585
1706 Ga0070680_100154059
1707 Ga0070660_100063427
1708 Ga0070660_100168320
1709 Ga0070660_100595492
1710 Ga0070661_100083243
1711 Ga0070661_100299590
1712 Ga0070661_100328250
1713 Ga0070661_101265712
1714 Ga0070668_100235812
1715 Ga0070675_100168276
1716 Ga0070671_100012785
1717 Ga0070674_101416088
1718 Ga0070674_102189676
1719 Ga0070673_100233226
1720 Ga0070673_100434155
1721 Ga0070659_100018367
1722 Ga0070659_100218480
1723 Ga0070667_100040522
1724 Ga0070667_100231746
1725 Ga0070667_100503547
1726 Ga0070667_100907643
1727 Ga0070714_100375116
1728 Ga0070714_101404219
1729 Ga0070710_11007259
1730 Ga0070710_11543109
1731 Ga0070711_101616090
1732 Ga0070663_100245416
1733 Ga0070678_100064383
1734 Ga0070678_100073147
1735 Ga0070678_100105961
1736 Ga0070678_100412401
1737 Ga0070678_100666988
1738 Ga0070678_101195886
1739 Ga0070662_100036495
1740 Ga0068867_100425325
1741 Ga0068867_101568078
1742 Ga0070685_10270880
1743 Ga0070685_10826288
1744 Ga0070707_100096851
1745 Ga0070698_100924580
1746 Ga0070679_100430201
1747 Ga0070679_101451882
1748 Ga0068853_100278882
1749 Ga0068853_100793031
1750 Ga0068853_100839791
1751 Ga0068853_101463820
1752 Ga0070672_100366925
1753 Ga0070665_100066688
1754 Ga0070665_100821073
1755 Ga0070665_101999792
1756 Ga0070665_102491187
1757 Ga0068855_100000737
1758 Ga0068855_100076757
1759 Ga0068855_100093546
1760 Ga0068855_100417759
1761 Ga0068855_101465270
1762 Ga0068855_101933906
1763 Ga0070664_100013869
1764 Ga0068857_100892206
1765 Ga0068857_102126836
1766 Ga0068854_101185487
1767 Ga0068856_100841290
1768 Ga0068852_101221107
1769 Ga0068852_101542359
1770 Ga0068866_10710379
1771 Ga0068851_10007730
1772 Ga0068851_10577226
1773 Ga0068863_101123379
1774 Ga0068863_101418965
1775 Ga0075365_10009476
1776 Ga0075365_10017566
1777 Ga0075365_10228304
1778 Ga0075365_10245891
1779 Ga0075365_10420339
1780 Ga0075365_11203830
1781 Ga0075368_10045821
1782 Ga0075368_10183590
1783 Ga0075363_100052346
1784 Ga0075363_100072252
1785 Ga0075363_100115150
1786 Ga0075363_100183871
1787 Ga0075363_100959450
1788 Ga0075363_100959451
1789 Ga0075364_10025580
1790 Ga0075364_10468983
1791 Ga0075364_11013112
1792 Ga0075432_10006000
1793 Ga0075432_10007261
1794 Ga0075432_10056602
1795 Ga0075362_10003943
1796 Ga0075362_10014025
1797 Ga0075362_10067478
1798 Ga0075362_10122063
1799 Ga0075362_10137647
1800 Ga0075362_10140701
1801 Ga0075362_10201601
1802 Ga0075362_10296782
1803 Ga0075362_10321744
1804 Ga0075362_10636868
1805 Ga0075367_10183859
1806 Ga0075367_10333240
1807 Ga0075369_10070632
1808 Ga0075369_10227473
1809 Ga0075366_10032783
1810 Ga0075366_10113454
1811 Ga0075366_10185666
1812 Ga0075366_10194858
1813 Ga0075366_10270166
1814 Ga0075366_10754209
1815 Ga0097621_100393880
1816 Ga0097621_100540092
1817 Ga0075370_10000322
1818 Ga0075370_10003243
1819 Ga0075370_10004735
1820 Ga0075370_10022587
1821 Ga0075370_10035851
1822 Ga0075370_10050403
1823 Ga0075370_10165389
1824 Ga0075370_10248670
1825 Ga0075431_101588388
1826 Ga0075429_100553458
1827 Ga0068865_100841441
1828 Ga0068865_101000971
1829 Ga0068865_101704897
1830 Ga0079104_1047926
1831 Ga0099826_10008499
1832 Ga0099826_10342267
1833 Ga0105251_10000134
1834 Ga0105251_10367650
1835 Ga0105244_10003000
1836 Ga0105244_10520543
1837 Ga0105240_10004043
1838 Ga0105240_10207199
1839 Ga0105240_10852164
1840 Ga0105245_10238339
1841 Ga0105245_10497804
1842 Ga0105243_10003757
1843 Ga0105243_10009638
1844 Ga0105243_10022421
1845 Ga0105243_10879036
1846 Ga0105241_10176388
1847 Ga0105242_11165371
1848 Ga0105242_11692939
1849 Ga0105248_10083825
1850 Ga0105248_11216745
1851 Ga0105237_10141822
1852 Ga0105237_10453383
1853 Ga0105237_11374432
1854 Ga0105237_11458129
1855 Ga0105238_10095250
1856 Ga0105238_10398710
1857 Ga0105238_10436156
1858 Ga0105238_10472465
1859 Ga0105238_10697818
1860 Ga0105239_10070385
1861 Ga0105239_10248446
1862 Ga0105239_10881047
1863 Ga0105246_10035641
1864 Ga0105246_10120637
1865 Ga0157347_1003287
1866 Ga0157347_1019559
1867 Ga0157326_1031246
1868 Ga0157373_10023683
1869 Ga0157373_10507222
1870 Ga0157373_10742706
1871 Ga0157373_10775436
1872 Ga0157371_10104204
1873 Ga0157370_10001130
1874 Ga0157370_10072460
1875 Ga0157370_10114119
1876 Ga0157370_10128583
1877 Ga0157370_10155730
1878 Ga0157370_10293566
1879 Ga0157370_10538982
1880 Ga0157370_11759732
1881 Ga0157369_10001199
1882 Ga0157369_10012328
1883 Ga0157369_10055356
1884 Ga0157369_10165285
1885 Ga0157369_10217194
1886 Ga0157369_12354772
1887 Ga0157378_12588545
1888 Ga0163162_10080040
1889 Ga0163162_10436581
1890 Ga0163162_12834001
1891 Ga0163162_13452651
1892 Ga0157372_10233361
1893 Ga0157372_10329234
1894 Ga0157372_11489577
1895 Ga0157375_10432526
1896 Ga0163163_10104437
1897 Ga0182008_10001340
1898 Ga0182008_10016053
1899 Ga0182008_10023775
1900 Ga0182008_10036324
1901 Ga0182008_10053246
1902 Ga0182008_10533825
1903 Ga0182008_10713512
1904 Ga0157376_11162427
1905 Ga0157376_11165887
1906 Ga0157376_12051813
1907 Ga0182006_1001145
1908 Ga0182006_1094962
1909 Ga0182006_1134847
1910 Ga0182006_1155318
1911 Ga0182007_10000512
1912 Ga0182007_10008474
1913 Ga0182007_10021431
1914 Ga0182007_10034980
1915 Ga0182007_10173045
1916 Ga0182005_1000637
1917 Ga0182005_1125498
1918 Ga0183362_10001
1919 Ga0183361_10013
1920 Ga0163161_10000166
1921 Ga0163161_10010657
1922 Ga0163161_10015236
1923 Ga0163161_10017854
1924 Ga0163161_10270716
1925 Ga0197907_11469637
1926 Ga0206356_10241440
1927 Ga0206349_1941556
1928 Ga0206350_10621348
1929 Ga0206354_10082792
1930 Ga0206353_10915309
1931 Ga0213872_10432679
1932 Ga0224712_10000080
1933 Ga0209435_100001
1934 Ga0209760_100758
1935 Ga0209436_103077
1936 Ga0209436_104293
1937 Ga0209436_107685
1938 Ga0209784_100062
1939 Ga0209566_100023
1940 Ga0209566_104089
1941 Ga0209674_100005
1942 Ga0209674_100040
1943 Ga0209674_100103
1944 Ga0209672_100001
1945 Ga0209672_100014
1946 Ga0209672_110041
1947 Ga0209672_113083
1948 Ga0209147_100001
1949 Ga0209147_100087
1950 Ga0209563_100096
1951 Ga0209563_105329
1952 Ga0207427_100852
1953 Ga0207427_101800
1954 Ga0209437_100146
1955 Ga0209258_100001
1956 Ga0209258_100040
1957 Ga0209258_100089
1958 Ga0207425_1000603
1959 Ga0207425_1001556
1960 Ga0207425_1003911
1961 Ga0207425_1010384
1962 Ga0209646_1000001
1963 Ga0209646_1014494
1964 Ga0209026_1000001
1965 Ga0209677_100058
1966 Ga0209148_1000003
1967 Ga0209148_1000035
1968 Ga0209148_1000097
1969 Ga0209148_1000553
1970 Ga0209759_1000001
1971 Ga0209759_1000188
1972 Ga0209759_1000284
1973 Ga0209759_1000519
1974 Ga0209129_1000071
1975 Ga0209129_1008455
1976 Ga0209129_1010324
1977 Ga0209129_1011881
1978 Ga0209129_1018181
1979 Ga0209129_1030174
1980 Ga0209233_1000043
1981 Ga0209233_1000159
1982 Ga0209233_1068469
1983 Ga0209565_1000120
1984 Ga0209565_1000326
1985 Ga0209565_1000774
1986 Ga0209565_1001593
1987 Ga0209565_1004359
1988 Ga0209565_1014786
1989 Ga0209565_1019567
1990 Ga0209565_1069613
1991 Ga0209455_1000001
1992 Ga0209455_1000200
1993 Ga0209673_1000030
1994 Ga0209673_1000099
1995 Ga0209673_1000839
1996 Ga0209673_1001338
1997 Ga0209673_1009171
1998 Ga0209673_1011116
1999 Ga0209673_1019100
2000 Ga0209673_1056619
2001 Ga0209130_1000041
2002 Ga0209130_1000456
2003 Ga0209130_1000952
2004 Ga0209130_1001771
2005 Ga0209130_1003498
2006 Ga0209130_1034515
2007 Ga0209675_1000054
2008 Ga0209675_1000290
2009 Ga0209675_1001678
2010 Ga0209675_1003556
2011 Ga0209675_1007178
2012 Ga0209675_1007222
2013 Ga0209675_1013320
2014 Ga0209675_1025130
2015 Ga0209675_1068071
2016 Ga0209676_1000005
2017 Ga0209676_1000054
2018 Ga0209676_1000260
2019 Ga0209676_1002320
2020 Ga0209676_1006861
2021 Ga0209676_1012219
2022 Ga0209676_1021448
2023 Ga0209676_1037652
2024 Ga0209676_1045732
2025 Ga0209676_1122175
2026 Ga0209025_1001065
2027 Ga0209025_1001409
2028 Ga0209025_1001617
2029 Ga0209025_1005090
2030 Ga0209025_1010783
2031 Ga0209025_1013211
2032 Ga0209025_1014966
2033 Ga0209025_1017071
2034 Ga0209025_1023210
2035 Ga0209025_1029599
2036 Ga0209025_1032635
2037 Ga0209025_1070074
2038 Ga0209564_1000239
2039 Ga0209564_1000662
2040 Ga0209564_1000784
2041 Ga0209564_1000890
2042 Ga0209564_1008305
2043 Ga0209564_1050603
2044 Ga0209758_1000027
2045 Ga0209758_1010200
2046 Ga0209758_1024927
2047 Ga0209758_1054541
2048 Ga0209758_1058368
2049 Ga0209758_1097385
2050 Ga0209050_1000003
2051 Ga0209050_1000007
2052 Ga0209050_1000954
2053 Ga0209050_1004569
2054 Ga0209050_1006735
2055 Ga0209050_1016241
2056 Ga0209050_1024718
2057 Ga0209050_1059225
2058 Ga0209050_1096823
2059 Ga0209256_1000001
2060 Ga0209256_1000081
2061 Ga0209256_1009348
2062 Ga0209256_1021256
2063 Ga0209256_1024404
2064 Ga0207426_1000027
2065 Ga0207426_1000061
2066 Ga0207426_1003593
2067 Ga0207426_1004649
2068 Ga0207426_1077340
2069 Ga0209051_1000003
2070 Ga0209051_1000009
2071 Ga0209051_1000055
2072 Ga0209051_1000319
2073 Ga0209051_1000619
2074 Ga0209051_1005714
2075 Ga0209051_1019880
2076 Ga0209051_1050459
2077 Ga0209051_1085050
2078 Ga0209257_1000018
2079 Ga0209257_1000045
2080 Ga0209257_1000873
2081 Ga0209257_1007556
2082 Ga0209257_1007934
2083 Ga0209257_1008583
2084 Ga0207656_10047010
2085 Ga0207655_1001368
2086 Ga0207713_1001542
2087 Ga0207642_10527042
2088 Ga0207680_10441506
2089 Ga0207647_10015129
2090 Ga0207647_10164889
2091 Ga0207647_10288894
2092 Ga0207647_10763267
2093 Ga0207645_10331383
2094 Ga0207643_11141600
2095 Ga0207705_10162860
2096 Ga0207705_10221912
2097 Ga0207705_10528849
2098 Ga0207705_11291761
2099 Ga0207684_11260217
2100 Ga0207707_10916240
2101 Ga0207695_10125685
2102 Ga0207695_10190846
2103 Ga0207695_10635882
2104 Ga0207695_11224963
2105 Ga0207671_10090182
2106 Ga0207671_10393536
2107 Ga0207660_10038245
2108 Ga0207657_10229708
2109 Ga0207657_10321706
2110 Ga0207657_10488981
2111 Ga0207649_10258561
2112 Ga0207652_10246622
2113 Ga0207652_10265241
2114 Ga0207681_10530770
2115 Ga0207694_10197807
2116 Ga0207694_10347713
2117 Ga0207694_10440520
2118 Ga0207694_10857800
2119 Ga0207650_11409626
2120 Ga0207644_10022931
2121 Ga0207690_10014545
2122 Ga0207690_10184168
2123 Ga0207706_10017147
2124 Ga0207686_10149936
2125 Ga0207709_10000230
2126 Ga0207709_10002452
2127 Ga0207709_10005451
2128 Ga0207669_10489440
2129 Ga0207704_11228917
2130 Ga0207704_11918572
2131 Ga0207691_10422459
2132 Ga0207711_10002819
2133 Ga0207711_10068904
2134 Ga0207711_10480700
2135 Ga0207689_11653182
2136 Ga0207679_10008899
2137 Ga0207667_10000524
2138 Ga0207667_10061207
2139 Ga0207667_10710000
2140 Ga0207651_10346283
2141 Ga0207651_10421612
2142 Ga0207651_10546604
2143 Ga0207651_11306657
2144 Ga0207712_12061780
2145 Ga0207640_10842984
2146 Ga0207658_10098455
2147 Ga0207658_10438015
2148 Ga0207658_10888663
2149 Ga0207703_12046243
2150 Ga0207639_10183989
2151 Ga0207639_10399927
2152 Ga0207639_10627406
2153 Ga0207678_10410907
2154 Ga0207641_11070799
2155 Ga0207641_11134785
2156 Ga0207648_10442715
2157 Ga0207648_10603645
2158 Ga0207676_12084986
2159 Ga0207676_12407124
2160 Ga0207674_10901285
2161 Ga0207675_101388449
2162 Ga0207683_10070721
2163 Ga0207683_10078360
2164 Ga0207683_10873872
2165 Ga0207683_10878083
2166 Ga0207698_10817601
2167 Ga0207698_12304859
2168 Ga0209281_1030565
2169 Ga0209371_1000267
2170 Ga0209371_1051233
2171 Ga0209282_1000133
2172 Ga0209282_1403881
2173 Ga0209813_10066296
2174 Ga0209813_10199242
2175 Ga0209974_10002433
2176 Ga0207428_10223419
2177 Ga0207428_10406977
2178 Ga0268266_10014251
2179 Ga0307517_10447730
2180 Ga0307515_10000084
2181 Ga0307515_10001286
2182 Ga0265338_10000022
2183 Ga0268256_1000238
2184 Ga0268256_1057581
2185 Ga0307512_10443111
2186 Ga0316177_1041282
2187 Ga0316177_1204318
2188 Ga0316176_1023428
2189 Ga0314311_1134334
2190 Ga0316179_1116799
2191 Ga0316178_1006481
2192 Ga0316180_1186828
2193 Ga0316183_1029454
2194 Ga0316181_1011855
2195 Ga0316181_1039412
2196 Ga0316182_1158883
2197 Ga0316182_1159626
2198 Ga0265340_10046708
2199 Ga0265327_10002745
2200 Ga0265327_10003564
2201 Ga0307513_10000012
2202 Ga0307513_10000285
2203 Ga0307513_10080379
2204 Ga0307513_10097609
2205 Ga0307513_10977074
2206 Ga0307513_11063927
2207 Ga0307408_100022449
2208 Ga0307408_100144752
2209 Ga0307408_100287070
2210 Ga0307408_100306407
2211 Ga0307408_100339824
2212 Ga0307408_100344212
2213 Ga0307408_100389606
2214 Ga0307408_100422732
2215 Ga0307408_100575839
2216 Ga0307408_100845409
2217 Ga0307408_100922902
2218 Ga0307408_101363430
2219 Ga0307408_101538920
2220 Ga0307514_10000319
2221 Ga0307514_10077326
2222 Ga0307516_10004265
2223 Ga0307516_10005283
2224 Ga0307516_10455501
2225 Ga0307405_10091953
2226 Ga0307405_10152052
2227 Ga0307405_10166096
2228 Ga0307405_10796411
2229 Ga0307405_10960008
2230 Ga0307405_11057809
2231 Ga0307405_11221953
2232 Ga0307405_11310185
2233 Ga0307405_11609000
2234 Ga0307413_10989047
2235 Ga0307413_11164686
2236 Ga0307410_11495854
2237 Ga0307406_10057413
2238 Ga0307406_10593293
2239 Ga0307406_10842744
2240 Ga0307406_11265238
2241 Ga0307406_11510198
2242 Ga0307406_11693511
2243 Ga0307407_10471517
2244 Ga0307407_11061265
2245 Ga0307412_10000024
2246 Ga0307412_10022467
2247 Ga0307412_10035354
2248 Ga0307412_10045864
2249 Ga0307412_10189537
2250 Ga0307412_10641112
2251 Ga0307412_10969697
2252 Ga0307412_11369355
2253 Ga0307412_11491952
2254 Ga0307412_11539829
2255 Ga0307412_11888259
2256 Ga0307412_11984302
2257 Ga0307412_12069128
2258 Ga0307412_12255095
2259 Ga0307409_102366496
2260 Ga0307416_100089287
2261 Ga0307416_100755407
2262 Ga0307416_100903036
2263 Ga0307416_102006290
2264 Ga0307416_102419947
2265 Ga0307416_102935774
2266 Ga0307416_103070534
2267 Ga0307414_10077611
2268 Ga0307414_10235109
2269 Ga0307414_10677726
2270 Ga0307414_10701031
2271 Ga0307414_11025195
2272 Ga0307411_10194251
2273 Ga0307411_10298354
2274 Ga0307411_10624471
2275 Ga0307411_10695041
2276 Ga0307411_10701230
2277 Ga0307411_10747772
2278 Ga0307411_10871004
2279 Ga0307411_10961341
2280 Ga0307411_12063770
2281 Ga0307411_12097333
2282 Ga0307415_101845404
2283 Ga0373952_0202494
2284 Ga0395899_0000035
2285 Ga0395899_0002970
2286 Ga0395900_0000190
2287 Ga0395900_0001100
2288 Ga0395900_0044241
2289 Ga0395900_0185326
2290 Ga0395900_0834824
2291 Ga0395898_0000199
2292 Ga0395898_0011627
2293 Ga0395898_0064652
2294 Ga0395905_0000041
2295 Ga0395905_0030123
2296 Ga0395905_0042337
2297 Ga0395905_0052258
2298 Ga0395905_0336351
2299 Ga0395905_0425313
2300 Ga0395905_0526805
2301 Ga0395901_0000062
2302 Ga0395901_0001105
2303 Ga0395901_0073845
2304 Ga0395901_0217320
2305 Ga0395901_0293677
2306 Ga0395901_0576659
2307 Ga0436360_0553837
2308 Ga0436361_0120393
2309 Ga0436361_0171963
2310 Ga0436361_0355371
2311 Ga0439436_0001379
2312 Ga0439436_0046759
2313 Ga0439436_0095607
2314 Ga0439436_0173445
2315 Ga0439438_105692
2316 Ga0439438_131656
2317 Ga0439439_0005352
2318 Ga0439439_0077318
2319 Ga0439439_0087749
2320 Ga0439447_017937
2321 Ga0439447_056389
2322 Ga0439447_069056
2323 Ga0439453_0112318
2324 Ga0439461_0007295
2325 Ga0439461_0039529
2326 Ga0439466_0002724
2327 Ga0439466_0029059
2328 Ga0439465_0000697
2329 Ga0439465_0158898
2330 Ga0451791_0048952
2331 Ga0451791_0161335
2332 Ga0451791_0556048
2333 Ga0451795_0737557
2334 Ga0451798_0323142
2335 Ga0451798_0874703
2336 Ga0451800_1002931
2337 Ga0451802_0951491
2338 Ga0451804_0177276
2339 Ga0451807_0702505
2340 Ga0451807_2769446
2341 Ga0451837_0270258
2342 Ga0451841_0605841
2343 Ga0451853_0781326
2344 Ga0451853_1406326
2345 Ga0439431_0000916
2346 Ga0439433_0000360
2347 Ga0439442_043551
2348 Ga0439445_0000835
2349 Ga0439432_003052
2350 Ga0439432_041101
2351 Ga0439432_058874
2352 Ga0439432_095902
2353 Ga0439449_0001800
2354 Ga0439449_0002084
2355 Ga0439449_0003898
2356 Ga0439449_0045493
2357 Ga0439449_0117015
2358 Ga0439449_0129349
2359 Ga0439452_005500
2360 Ga0439457_050696
2361 Ga0439457_148692
2362 Ga0439462_0010232
2363 Ga0439462_0012214
2364 Ga0439462_0016788
2365 Ga0439462_0043086
2366 Ga0450911_015379
2367 Ga0450923_007796
2368 Ga0450923_026232
2369 Ga0450890_017336
2370 Ga0450897_002880
2371 Ga0450892_031216
2372 Ga0450896_035602
2373 Ga0450896_073046
2374 Ga0450898_021840
2375 Ga0450898_024326
2376 Ga0450898_060237
2377 Ga0450899_056040
2378 Ga0450900_064598
2379 Ga0450903_028032
2380 Ga0450889_010034
2381 Ga0450906_057370
2382 Ga0450907_076734
2383 Ga0450910_029232
2384 Ga0439446_0030800
2385 Ga0439458_0208192
2386 Ga0450908_027994
2387 Ga0450908_029324
2388 Ga0450909_018325
2389 Ga0450909_025797
2390 Ga0439434_0006641
2391 Ga0439434_0015679
2392 Ga0439434_0239773
2393 Ga0439435_0122893
2394 Ga0439459_0126576
2395 Ga0439464_0045092
2396 Ga0450916_071534
2397 Ga0450918_008838
2398 Ga0450918_015446
2399 Ga0450893_0008574
2400 Ga0451577_0102644
2401 Ga0466969_0001061
2402 Ga0466969_0028559
2403 Ga0466969_0044262
2404 Ga0466969_0114007
2405 Ga0466969_0164122
2406 Ga0466972_0013487
2407 Ga0466972_0083032
2408 Ga0466973_0033105
2409 Ga0466987_0380323
2410 Ga0466977_0003105
2411 Ga0466980_0377899
2412 Ga0466978_0205280
2413 Ga0453683_0001701
2414 Ga0453683_0044583
2415 Ga0466965_0000058
2416 Ga0466965_0015986
2417 Ga0466965_0027458
2418 Ga0466965_0137171
2419 Ga0466965_0382410
2420 Ga0466966_0000105
2421 Ga0466966_0002891
2422 Ga0466966_0003848
2423 Ga0466966_0145163
2424 Ga0466966_0169162
2425 Ga0466966_0505440
2426 Ga0466961_0000830
2427 Ga0466961_0003527
2428 Ga0466961_0031401
2429 Ga0466961_0060402
2430 Ga0466961_0242885
2431 Ga0466961_0367344
2432 Ga0466961_0473454
2433 Ga0466963_0001295
2434 Ga0466963_0009593
2435 Ga0466963_0011977
2436 Ga0466964_0000916
2437 Ga0466964_0143271
2438 Ga0466964_0480707
2439 Ga0453684_0186703
2440 Ga0466971_0000697
2441 Ga0466971_0014817
2442 Ga0466971_0164014
2443 Ga0466968_0015116
2444 Ga0466968_0134829
2445 Ga0466968_0528445
2446 Ga0466970_0009409
2447 Ga0466970_0069899
2448 Ga0466970_0507568
2449 Ga0466970_0969497
2450 Ga0466957_0044912
2451 Ga0466957_0055259
2452 Ga0466957_0224488
2453 Ga0466957_0778328
2454 Ga0466957_0799191
2455 Ga0466960_0047904
2456 Ga0466960_0114997
2457 Ga0466960_0238987
2458 Ga0466959_0002991
2459 Ga0466959_0019940
2460 Ga0466959_0071272
2461 Ga0466959_0350891
2462 Ga0466959_0482242
2463 Ga0466959_0601687
2464 Ga0466959_0753550
2465 Ga0466959_0823296
2466 Ga0466959_1188036
2467 Ga0451576_0003667
2468 Ga0451576_0039875
2469 Ga0451576_1623204
2470 Ga0466958_0000397
2471 Ga0466958_0003121
2472 Ga0466958_0012111
2473 Ga0466958_0180950
2474 Ga0466958_1161891
2475 Ga0466967_0700689
2476 Ga0495627_008497
2477 Ga0495627_048891
2478 Ga0495592_0008371
2479 Ga0495592_0015483
2480 Ga0495592_0024836
2481 Ga0495592_0029704
2482 Ga0495603_0014573
2483 Ga0495603_0014730
2484 Ga0495603_0018732
2485 Ga0495603_0459911
2486 Ga0495603_0730520
2487 Ga0495590_0003526
2488 Ga0495590_0014357
2489 Ga0495590_0114282
2490 Ga0495591_006545
2491 Ga0495629_0000699
2492 Ga0495629_0004896
2493 Ga0495629_0007518
2494 Ga0495629_0014090
2495 Ga0495629_0161581
2496 Ga0495629_0293790
2497 Ga0495638_0020717
2498 Ga0495638_0025340
2499 Ga0495641_0018430
2500 Ga0495641_0032203
2501 Ga0495651_0010951
2502 Ga0495651_0035257
2503 Ga0495651_0096325
2504 Ga0495651_0367885
2505 Ga0495651_0427811
2506 Ga0495651_0454344
2507 Ga0495651_0606477
2508 Ga0495651_0649296
2509 Ga0495653_0004371
2510 Ga0495653_0019073
2511 Ga0495653_0020344
2512 Ga0495653_0023382
2513 Ga0495653_0038116
2514 Ga0495653_0041534
2515 Ga0495653_0128482
2516 Ga0495650_0005860
2517 Ga0495650_0006791
2518 Ga0495650_0069930
2519 Ga0495650_0187419
2520 Ga0495580_0005845
2521 Ga0495580_0015501
2522 Ga0495580_0019975
2523 Ga0495580_0035742
2524 Ga0495580_0039103
2525 Ga0495580_0046673
2526 Ga0495580_0313640
2527 Ga0495580_0642145
2528 Ga0495580_0780620
2529 Ga0495580_0935165
2530 Ga0495582_0006818
2531 Ga0495582_0006929
2532 Ga0495582_0021021
2533 Ga0495605_0003385
2534 Ga0495605_0052863
2535 Ga0495605_0116674
2536 Ga0495605_0209240
2537 Ga0495639_0007187
2538 Ga0495662_0030353
2539 Ga0495662_0033594
2540 Ga0495664_0001134
2541 Ga0495664_0032759
2542 Ga0495664_0137099
2543 Ga0495584_0381463
2544 Ga0495584_0582433
2545 Ga0495594_0066235
2546 Ga0495596_0087053
2547 Ga0495596_0132519
2548 Ga0495596_0189257
2549 Ga0495596_0240131
2550 Ga0495596_0260129
2551 Ga0495607_0195157
2552 Ga0495607_0428878
2553 Ga0495583_0010369
2554 Ga0495583_0125616
2555 Ga0495606_0022364
2556 Ga0495606_0051212
2557 Ga0495606_0152487
2558 Ga0495606_0323529
2559 Ga0495608_0000977
2560 Ga0495608_0002097
2561 Ga0495608_0006540
2562 Ga0495608_0200744
2563 Ga0495610_0000715
2564 Ga0495610_0018746
2565 Ga0495616_0112983
2566 Ga0495618_0002666
2567 Ga0495618_0005178
2568 Ga0495618_0252310
2569 Ga0495618_0384772
2570 Ga0495620_0027211
2571 Ga0495620_0053589
2572 Ga0495620_0109892
2573 Ga0495628_0001590
2574 Ga0495628_0027909
2575 Ga0495628_0062966
2576 Ga0495628_0075213
2577 Ga0495628_0264069
2578 Ga0495628_0510859
2579 Ga0495628_0559908
2580 Ga0495628_1045263
2581 Ga0495630_0012575
2582 Ga0495630_0040223
2583 Ga0495630_0051980
2584 Ga0495630_1039274
2585 Ga0495630_1126923
2586 Ga0495631_0004184
2587 Ga0495632_0370925
2588 Ga0495637_0033627
2589 Ga0495637_0059393
2590 Ga0495637_0061714
2591 Ga0495643_0069608
2592 Ga0495643_0206400
2593 Ga0495644_0246061
2594 Ga0495644_0367726
2595 Ga0495648_0020262
2596 Ga0495648_0037684
2597 Ga0495648_0249495
2598 Ga0495648_0302585
2599 Ga0495663_0173443
2600 Ga0495666_0002472
2601 Ga0495666_0016275
2602 Ga0495666_0026285
2603 Ga0495666_0117402
2604 Ga0495666_0260108
2605 Ga0495666_0264378
2606 Ga0495642_0036207
2607 Ga0495652_0009989
2608 Ga0495652_0024538
2609 Ga0495652_0045692
2610 Ga0495652_0047731
2611 Ga0495652_0280039
2612 Ga0495652_0783465
2613 Ga0495654_0274783
2614 Ga0495654_0430366
2615 Ga0495665_0006454
2616 Ga0495665_0026900
2617 Ga0495665_0104699
2618 Ga0495665_0303959
2619 Ga0495640_0000851
2620 Ga0495640_0004804
2621 Ga0495640_0016285
2622 Ga0495640_0409452
2623 Ga0495586_0021076
2624 Ga0495586_0038693
2625 Ga0495586_0247494
2626 Ga0495586_0554778
2627 Ga0495587_0000960
2628 Ga0495587_0011859
2629 Ga0495587_0361621
2630 Ga0495598_0148486
2631 Ga0495598_0163957
2632 Ga0495609_0222275
2633 Ga0495621_0005377
2634 Ga0495621_0021528
2635 Ga0495621_0095242
2636 Ga0495621_0105052
2637 Ga0495621_0154444
2638 Ga0495597_0054590
2639 Ga0495597_0088918
2640 Ga0495645_0015174
2641 Ga0495645_0054506
2642 Ga0495645_0169307
2643 Ga0495645_0196372
2644 Ga0495645_0585237
2645 Ga0495622_0000227
2646 Ga0495622_0039221
2647 Ga0495622_0196771
2648 Ga0495622_0219706
2649 Ga0495633_0299127
2650 Ga0495667_0056929
2651 Ga0495667_0102806
2652 Ga0495656_0003255
2653 Ga0495656_0083694
2654 Ga0495656_0578374
2655 Ga0495668_0111648
2656 Ga0495668_0322559
2657 Ga0495634_0032070
2658 Ga0495634_0085634
2659 Ga0495634_0373293
2660 Ga0495634_0519592
2661 Ga0495611_0078845
2662 Ga0495611_0282706
2663 Ga0495625_0000896
2664 Ga0495625_0098277
2665 Ga0495625_0195788
2666 Ga0495625_0371481
2667 Ga0495625_0610611
2668 Ga0495635_0004478
2669 Ga0495635_0102750
2670 Ga0495635_0147442
2671 Ga0495635_0356059
2672 Ga0495661_0003464
2673 Ga0495661_0006964
2674 Ga0495661_0021872
2675 Ga0495588_0021438
2676 Ga0495588_0056225
2677 Ga0495588_0080144
2678 Ga0495588_0150641
2679 Ga0495657_0032871
2680 Ga0495657_0101119
2681 Ga0495657_0313682
2682 Ga0495657_0828138
2683 Ga0495599_0005836
2684 Ga0495599_0006011
2685 Ga0495599_0033983
2686 Ga0495599_0142099
2687 Ga0495599_0626782
2688 Ga0495599_0835747
2689 Ga0495623_0009259
2690 Ga0495623_0009921
2691 Ga0495623_0013984
2692 Ga0495623_0027409
2693 Ga0495623_0034735
2694 Ga0495646_0006968
2695 Ga0495646_0008406
2696 Ga0495646_0012704
2697 Ga0495646_0015901
2698 Ga0495646_0019173
2699 Ga0495646_0123552
2700 Ga0495646_0278287
2701 Ga0495646_0477850
2702 Ga0495646_0689624
2703 Ga0495658_0377724
2704 Ga0495658_0556919
2705 Ga0495669_0071226
2706 Ga0495669_0131520
2707 Ga0495669_0326367
2708 Ga0495669_0403404
2709 Ga0495613_0000727
2710 Ga0495613_0075915
2711 Ga0495613_0095415
2712 Ga0495613_0124829
2713 Ga0495624_0002244
2714 Ga0495624_0009113
2715 Ga0495624_0015384
2716 Ga0495624_0018007
2717 Ga0495624_0020073
2718 Ga0495624_0035525
2719 Ga0495624_0434387
2720 Ga0495624_0643852
2721 Ga0495670_0477969
2722 Ga0495671_0009212
2723 Ga0495671_0012054
2724 Ga0495671_0144411
2725 Ga0495671_0251807
2726 Ga0495649_0015513
2727 Ga0495649_0053783
2728 Ga0495649_0095199
2729 Ga0495649_0121404
2730 Ga0495649_0355832
2731 Ga0495589_0001853
2732 Ga0495589_0082302
2733 Ga0495589_0087777
2734 Ga0495600_0000837
2735 Ga0495600_0040137
2736 Ga0495600_0108769
2737 Ga0495600_0238148
2738 Ga0495600_0300147
2739 Ga0495660_0096851
2740 Ga0495660_0207985
2741 Ga0495660_0455873
2742 Ga0495581_0000459
2743 Ga0495581_0013072
2744 Ga0495581_0237450
2745 Ga0495604_0001208
2746 Ga0495604_0017126
2747 Ga0495604_0025084
2748 Ga0495604_0063217
2749 Ga0495604_0100869
2750 Ga0495604_0229972
2751 Ga0495604_0432499
2752 Ga0495604_0552236
2753 Ga0495604_0639677
2754 Ga0495674_0062259
2755 Ga0495674_0086127
2756 Ga0495674_0087641
2757 Ga0495674_0107707
2758 Ga0495674_0111436
2759 Ga0495674_0171456
2760 Ga0495674_0510485
2761 Ga0495672_0032972
2762 Ga0495672_0060806
2763 Ga0495672_0216212
2764 Ga0495672_0256739
2765 Ga0495672_0539221
2766 Ga0495676_0000690
2767 Ga0495676_0010669
2768 Ga0495676_0026895
2769 Ga0495676_0297396
2770 Ga0495676_0475453
2771 Ga0495676_0659560
2772 Ga0495676_0771182
2773 Ga0495680_0001210
2774 Ga0495680_0005577
2775 Ga0495680_0010573
2776 Ga0495680_0021462
2777 Ga0495680_0537162
2778 Ga0495683_0004492
2779 Ga0495683_0008226
2780 Ga0495683_0011154
2781 Ga0495683_0033199
2782 Ga0495683_0080549
2783 Ga0495683_0087622
2784 Ga0495683_0314224
2785 Ga0495687_025522
2786 Ga0495687_027539
2787 Ga0495687_078157
2788 Ga0495687_098960
2789 Ga0495675_0004622
2790 Ga0495675_0006887
2791 Ga0495675_0011293
2792 Ga0495675_0088294
2793 Ga0495675_0857074
2794 Ga0495677_0122407
2795 Ga0495677_0253758
2796 Ga0495677_0440598
2797 Ga0495679_000782
2798 Ga0495679_001796
2799 Ga0495679_009381
2800 Ga0495679_048958
2801 Ga0495673_0016174
2802 Ga0495673_0026376
2803 Ga0495673_0289396
2804 Ga0495681_0046925
2805 Ga0495681_0191278
2806 Ga0495684_0019826
2807 Ga0495686_0031854
2808 Ga0495686_0033165
2809 Ga0495593_0004404
2810 Ga0495593_0026770
2811 Ga0495593_0047170
2812 Ga0495593_0065165
2813 Ga0495593_0104860
2814 Ga0495593_0120960
2815 Ga0495602_0004187
2816 Ga0495602_0006799
2817 Ga0495602_0026312
2818 Ga0495602_0066379
2819 Ga0495602_0114076
2820 Ga0495602_0125755
2821 Ga0495602_0173576
2822 Ga0495602_0238847
2823 Ga0495602_0373330
2824 Ga0495602_0551317
2825 Ga0495614_0003278
2826 Ga0495614_0003316
2827 Ga0495614_0008194
2828 Ga0495614_0044355
2829 Ga0495614_0197018
2830 Ga0495615_0287790
2831 Ga0495615_0290350
2832 Ga0495626_0021459
2833 Ga0495626_0035111
2834 Ga0496100_0007340
2835 Ga0496101_0010034
2836 Ga0496101_0031149
2837 Ga0496101_0134927
2838 Ga0496101_0470949
2839 Ga0496102_0027035
2840 Ga0496102_0037838
2841 Ga0496102_0105008
2842 Ga0496102_0435824
2843 Ga0496102_0503617
2844 Ga0496102_0878975
2845 Ga0496102_1194916
2846 Ga0496103_0003901
2847 Ga0496103_0011464
2848 Ga0496103_0011709
2849 Ga0496103_0108330
2850 Ga0496103_0684404
2851 Ga0496104_0013570
2852 Ga0496104_0020850
2853 Ga0496104_0243519
2854 Ga0496104_0666406
2855 Ga0496105_0003439
2856 Ga0496105_0204184
2857 Ga0496106_0000029
2858 Ga0496106_0016044
2859 Ga0496106_0128344
2860 Ga0496107_0073245
2861 Ga0496107_0176569
2862 Ga0496107_0552325
2863 Ga0496107_0740350
2864 Ga0496108_0063024
2865 Ga0496108_0154733
2866 Ga0496108_1355200
2867 Ga0496109_0773107
2868 Ga0496109_1894690
2869 Ga0496110_0139448
2870 Ga0496110_0201515
2871 Ga0496110_0705675
2872 Ga0496111_0403099
2873 Ga0496112_0052273
2874 Ga0496112_0101870
2875 Ga0496112_0936938
2876 Ga0496113_0020740
2877 Ga0496114_0289103
2878 Ga0496114_0391590
2879 Ga0496115_0464063
2880 Ga0496115_0486097
2881 Ga0496116_0011329
2882 Ga0496116_0129945
2883 Ga0496116_0130601
2884 Ga0496116_0141146
2885 Ga0496116_0176674
2886 Ga0496116_0179001
2887 Ga0496116_0417694
2888 Ga0496117_0024726
2889 Ga0496117_0028598
2890 Ga0496117_0048496
2891 Ga0496117_0097767
2892 Ga0496117_0119509
2893 Ga0496117_0174184
2894 Ga0496117_0212771
2895 Ga0496117_0230533
2896 Ga0496117_0373914
2897 Ga0496118_0003596
2898 Ga0496118_0004215
2899 Ga0496118_0010125
2900 Ga0496118_0010300
2901 Ga0496118_0023632
2902 Ga0496118_0030038
2903 Ga0496118_0103671
2904 Ga0496118_0254597
2905 Ga0496118_0372407
2906 Ga0496118_0452901
2907 Ga0496119_0060099
2908 Ga0496120_0086576
2909 Ga0496120_0314958
2910 Ga0496121_0017765
2911 Ga0496121_0033036
2912 Ga0496121_0052767
2913 Ga0496121_0055271
2914 Ga0496121_0066491
2915 Ga0496121_0070584
2916 Ga0496121_0195498
2917 Ga0496121_0276966
2918 Ga0496121_0637886
2919 Ga0496122_0064753
2920 Ga0496122_0191029
2921 Ga0496122_0446430
2922 Ga0496122_0556998
2923 Ga0496123_0049882
2924 Ga0496123_0053888
2925 Ga0496123_0170044
2926 Ga0496123_0272488
2927 Ga0496124_0108059
2928 Ga0496124_0145910
2929 Ga0496124_0162783
2930 Ga0496124_0253740
2931 Ga0496124_0253926
2932 Ga0496125_0020173
2933 Ga0496125_0035025
2934 Ga0496125_0399100
2935 Ga0496125_0663273
2936 Ga0496125_0731488
2937 Ga0496126_0000192
2938 Ga0496126_0015457
2939 Ga0496126_0019787
2940 Ga0501310_073528
2941 Ga0495678_019117
2942 Ga0495678_040459
2943 Ga0495682_0043650
2944 Ga0495682_0051269
2945 Ga0495682_0065984
2946 Ga0495682_0184191
2947 Ga0501031_0130976
2948 Ga0501032_0214316
2949 Ga0501032_0332404
2950 Ga0501034_0965199
2951 Ga0501036_0067942
2952 Ga0501037_0375569
2953 Ga0501043_0141444
2954 Ga0501043_0546238
2955 Ga0501046_0388601
2956 Ga0501046_0573466
2957 Ga0501047_0048109
2958 Ga0501047_0787930
2959 Ga0501047_0875914
2960 Ga0501048_0923800
2961 Ga0501249_011563
2962 Ga0501225_0090908
2963 Ga0501262_000153
2964 Ga0501266_006089
2965 Ga0501035_0590911
2966 Ga0501044_0127969
2967 Ga0501044_0154548
2968 Ga0501044_0344799
2969 Ga0501044_0457318
2970 Ga0501044_0615653
2971 Ga0501044_1323512
2972 Ga0501044_1448993
2973 nmdc:mga03683_10250_c1
2974 nmdc:mga03683_122491_c1
2975 nmdc:mga03683_132698_c1
2976 nmdc:mga03683_134288_c1
2977 nmdc:mga03683_55542_c1
2978 nmdc:mga03683_571549_c1
2979 nmdc:mga03683_7155_c1
2980 nmdc:mga03n38_195531_c1
2981 nmdc:mga03n38_48437_c1
2982 nmdc:mga03n38_574910_c1
2983 nmdc:mga03n38_728230_c1
2984 nmdc:mga00v17_120674_c1
2985 nmdc:mga00v17_21047_c1
2986 nmdc:mga00v17_485302_c1
2987 nmdc:mga00v17_78656_c1
2988 nmdc:mga00v17_869000_c1
2989 nmdc:mga00v17_964515_c1
2990 nmdc:mga0yw44_20195_c1
2991 nmdc:mga0yw44_24525_c1
2992 nmdc:mga0yw44_28625_c1
2993 nmdc:mga0yw44_58591_c1
2994 nmdc:mga0k408_120636_c1
2995 nmdc:mga0k408_175015_c1
2996 nmdc:mga0k408_31432_c1
2997 nmdc:mga0k408_41811_c1
2998 nmdc:mga0k408_425399_c1
2999 nmdc:mga0k408_53897_c1
3000 nmdc:mga06z11_277517_c1
3001 nmdc:mga06z11_57687_c1
3002 nmdc:mga06z11_939509_c1
3003 nmdc:mga04h51_139923_c1
3004 nmdc:mga04h51_36942_c1
3005 nmdc:mga07m45_132318_c1
3006 nmdc:mga07m45_348594_c1
3007 nmdc:mga07m45_395746_c1
3008 nmdc:mga07m45_4880_c1
3009 nmdc:mga07m45_49399_c1
3010 nmdc:mga07m45_499_c2
3011 nmdc:mga07m45_546254_c1
3012 nmdc:mga07m45_5785_c1
3013 nmdc:mga07m45_8907_c1
3014 nmdc:mga07m45_91600_c1
3015 nmdc:mga09592_490666_c1
3016 nmdc:mga0qj67_534819_c1
3017 nmdc:mga0sz30_158742_c1
3018 nmdc:mga0sz30_172506_c1
3019 Ga0495601_0009150
3020 Ga0500610_0006171
3021 Ga0500610_0006176
3022 Ga0500610_0013178
3023 Ga0495655_0246682
3024 Ga0495619_0853236
3025 Ga0500643_026394
3026 Ga0500644_0002098
3027 Ga0500651_0000449
3028 Ga0500651_0027085
3029 Ga0500566_0022690
3030 Ga0500566_0235304
3031 Ga0500641_0265634
3032 Ga0500650_0290196
3033 Ga0500560_065982
3034 Ga0500562_036326
3035 Ga0500569_099361
3036 Ga0500571_000954
3037 Ga0500572_191414
3038 Ga0500593_003907
3039 Ga0500593_008376
3040 Ga0500594_0030544
3041 Ga0500595_003291
3042 Ga0500597_116440
3043 Ga0500607_004990
3044 Ga0500607_166797
3045 Ga0500608_004926
3046 Ga0500608_006421
3047 Ga0500626_083514
3048 Ga0500628_009378
3049 Ga0500652_389968
3050 Ga0500655_000523
3051 Ga0500658_0002041
3052 Ga0500659_0332007
3053 Ga0500561_0026946
3054 Ga0500574_000756
3055 Ga0500574_006374
3056 Ga0500586_167286
3057 Ga0500588_0069659
3058 Ga0500604_0050128
3059 Ga0500616_0091761
3060 Ga0500619_001546
3061 Ga0500619_097310
3062 Ga0500620_280797
3063 Ga0500624_009867
3064 Ga0500627_0000962
3065 Ga0500633_0184266
3066 Ga0500634_0006145
3067 Ga0500634_0013201
3068 Ga0500638_003903
3069 Ga0500636_0077064
3070 Ga0500625_149092
3071 Ga0500645_002856
3072 Ga0500645_011518
3073 Ga0500645_013521
3074 Ga0500645_042612
3075 Ga0500565_006966
3076 Ga0500596_037598
3077 Ga0500661_010597
3078 Ga0466962_0001204
3079 Ga0466962_0010772
3080 Ga0466962_0360735
3081 Ga0466962_0637543
3082 2501082222
3083 2509128682
3084 2510250893
3085 2511086431
3086 2512346213
3087 2513960922
3088 2514048113
3089 2515679665
3090 2515692518
3091 2516020346
3092 2527075159
3093 2563062991
3094 2713477190
3095 2719640028
3096 2738820769
3097 2738833249
3098 2738874777
3099 2739186406
3100 2739221375
3101 2739252175
3102 2746089644
3103 2746097899
3104 2753570346
3105 2792836436
3106 2819541476
3107 2819620210
3108 2883088896
3109 2885278733
3110 2900635047
3111 2902689687
3112 2904484925
3113 2904617114
3114 2919530648
3115 2928110231
3116 2928138635
3117 2928505279
3118 2945936946
3119 2974322607
3120 2990706329
3121 642423150
3122 642592710
3123 642621372
3124 8003955446
3125 8055268275
3126 8055302407

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

25

103

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8595 4 85
5djo-assembly1.cif.gz_A crystal structure of the cc1-fha tandem of kinesin-3 kif13a 0.8427 55 78
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.842 1 85
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8399 4 85
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8344 2 85
ID Description Score Start End Superfamily
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9068 3 85 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8857 3 85 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8792 4 82 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8582 4 82 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8552 1 85 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A4V2Q0Y1-F1-model_v4 Molybdopterin synthase subunit MoaD 1.005 1 85
AF-A0A226WK61-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaD 1.003 1 85
AF-A0A658R4Q9-F1-model_v4 Molybdopterin converting factor subunit 1 1.003 1 85
AF-A0A3A0F957-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 1.003 1 85 GO:0000166
GO:0006777
GO:1990133
AF-A0A4R5W6M9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 1.002 1 85 GO:0000166
GO:0006777
GO:1990133

Map