F494787
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1564 | 573 | 3129 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0014163|Ga0453684_0014163_6214_7530 |
| Length | 438 |
| Sequence | LNQNNFDPQEDNHRSKFGTCFFLSLPPVGGEVWRGLQKNKIMKDKVVLAFSGGLDTSYCAKYLSVEKNLDVYTAIANTGGFTQSDLEAVEKKAYQLGAVKHVTLDVTDSYYEKSIKYMVFGNILRNNTYPISVSSERVFQAIAIIEYAKQIGAKYVAHGSTGAGNDQVRFDLTFQILAPEIGILTPTRDLELSRQEEIDYLKAHGVVADWKKMDYSINKGLWGTSIGGKETLKSNKTLPEEAYPSQLTQTEEKEITIDFIKGELKGVNGEVFENPVNAIRALEAVASPYAVGRDMHIGDTIIGIKGRVGFEAAAPIIAIKAHQMLEKHTLTKWQQYWKEQLGNWYGMFLHEALYFEPVMRDIEKFLEHSQENVTGKVIVKLKPYNFVLVGVESDHDLMRSEFGEYGEKNSAWTADDVKGFTKVLSTSLKIHNSVNHSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 37 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 103 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 104 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 235 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 236 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 244 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 245 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 246 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 259 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 260 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 275 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 276 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 277 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 280 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 281 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 282 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 283 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 284 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 285 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 286 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 287 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 288 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 289 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 290 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 294 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 295 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 296 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 297 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 298 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 359 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 360 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 364 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 382 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 383 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 384 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 385 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 389 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 390 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 391 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 392 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 393 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 395 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 397 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 400 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 401 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 405 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 414 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 416 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 417 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 418 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 421 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 422 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 423 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 425 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 426 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 427 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 428 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 429 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 430 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 431 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 432 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 433 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 435 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 436 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 437 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 438 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 439 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 440 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 441 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 442 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 443 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 444 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 445 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 446 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 447 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 448 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 449 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 450 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 451 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 452 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 453 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 454 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 455 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 456 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 457 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 458 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 459 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 460 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 461 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 462 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 463 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 464 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 465 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 466 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 467 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 468 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 469 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 470 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 471 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 472 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 473 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 474 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 475 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 476 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 477 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 478 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 479 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 480 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 481 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 482 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 483 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 484 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 485 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 486 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 487 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 488 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 489 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 490 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 491 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 492 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 493 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 494 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 495 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 496 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 497 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 498 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 499 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 500 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 501 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 502 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 503 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 504 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 505 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 506 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 507 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 508 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 509 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 510 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 511 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 512 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 513 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 514 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 515 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 516 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 517 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 518 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 519 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 520 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 521 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 522 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 523 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 524 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 525 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 526 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 527 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 528 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 529 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 530 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 531 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 532 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 533 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 534 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 535 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 536 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 537 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 538 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 539 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 540 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 541 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 542 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 543 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 544 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 545 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 546 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 547 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 548 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 549 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 550 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 551 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 552 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 553 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 554 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 555 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 556 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 557 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 558 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 559 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 560 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 561 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 562 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 563 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 564 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 565 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 566 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 567 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 568 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 569 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 570 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 571 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 572 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 573 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.79 |
| Metatranscriptomes | 0.45 |
| Isolates | 8.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 7.1 |
| Nodule | 0.45 |
| Rhizoplane | 0.96 |
| Rhizosphere | 82.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0014163 | 3300044712 | Bacteria | 12809 |
| 2 | SwRhRL2b_contig_1663676 | 2162886007 | Bacteria | 241831 |
| 3 | SwRhRL2b_contig_3047449 | 2162886007 | Bacteria | 1886 |
| 4 | JGI24740J21852_10004979 | 3300001979 | Bacteria | 5644 |
| 5 | JGI24740J21852_10006938 | 3300001979 | Bacteria | 4650 |
| 6 | JGI24739J22299_10004155 | 3300001989 | Bacteria | 5539 |
| 7 | JGI24739J22299_10005815 | 3300001989 | Bacteria | 4671 |
| 8 | JGI24737J22298_10002176 | 3300001990 | Bacteria | 6977 |
| 9 | JGI24735J21928_10000002 | 3300002067 | Bacteria | 624895 |
| 10 | JGI24751J29686_10001013 | 3300002459 | Bacteria | 6158 |
| 11 | JGI25162J39368_1000024 | 3300002737 | Bacteria | 229507 |
| 12 | JGI25162J39368_1001318 | 3300002737 | Bacteria | 13921 |
| 13 | JGI25154J39366_1000047 | 3300002738 | Bacteria | 126449 |
| 14 | JGI25158J39367_1004804 | 3300002739 | Bacteria | 2011 |
| 15 | JGI25157J39369_1002465 | 3300002741 | Bacteria | 4569 |
| 16 | JGI25164J39214_1000855 | 3300002772 | Bacteria | 10454 |
| 17 | JGI25152J39213_1000007 | 3300002773 | Bacteria | 156012 |
| 18 | JGI25150J39212_1000013 | 3300002774 | Bacteria | 182307 |
| 19 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 20 | JGI25406J46586_10007660 | 3300003203 | Bacteria | 4912 |
| 21 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 22 | JGI25153J46596_10007229 | 3300003215 | Bacteria | 5497 |
| 23 | rootH1_10001629 | 3300003316 | Bacteria | 29048 |
| 24 | rootH1_10073809 | 3300003316 | Bacteria | 8113 |
| 25 | rootH1_10160863 | 3300003316 | Bacteria | 2958 |
| 26 | rootH2_10003246 | 3300003320 | Bacteria | 168239 |
| 27 | rootH2_10005719 | 3300003320 | Bacteria | 108734 |
| 28 | rootH2_10006783 | 3300003320 | Bacteria | 50422 |
| 29 | rootH2_10061691 | 3300003320 | Bacteria | 2691 |
| 30 | rootL2_10006109 | 3300003322 | Bacteria | 15155 |
| 31 | rootL2_10018664 | 3300003322 | Bacteria | 7331 |
| 32 | rootL2_10048389 | 3300003322 | Bacteria | 6120 |
| 33 | rootL2_10058703 | 3300003322 | Bacteria | 2463 |
| 34 | rootL2_10100931 | 3300003322 | Bacteria | 1931 |
| 35 | rootL2_10108093 | 3300003322 | Bacteria | 1470 |
| 36 | rootL2_10338439 | 3300003322 | Bacteria | 3243 |
| 37 | rootH1_10002666 | 3300003323 | Bacteria | 23641 |
| 38 | rootH1_10010261 | 3300003323 | Bacteria | 16255 |
| 39 | rootH1_10010262 | 3300003323 | Bacteria | 7405 |
| 40 | rootH1_10029472 | 3300003323 | Bacteria | 17623 |
| 41 | rootH1_10030425 | 3300003316 | Bacteria | 1369 |
| 42 | rootH1_10030425 | 3300003323 | Bacteria | 4598 |
| 43 | rootH1_10063152 | 3300003323 | Bacteria | 5945 |
| 44 | rootH1_10082354 | 3300003323 | Bacteria | 3629 |
| 45 | rootH1_10148113 | 3300003323 | Bacteria | 1718 |
| 46 | rootH1_10230439 | 3300003323 | Bacteria | 4761 |
| 47 | JGI25160J50197_1000981 | 3300003354 | Bacteria | 14875 |
| 48 | JGI25160J50197_1006733 | 3300003354 | Bacteria | 4611 |
| 49 | JGI25160J50197_1009613 | 3300003354 | Bacteria | 3569 |
| 50 | Ga0006562J51391_1012235 | 3300003578 | Bacteria | 4418 |
| 51 | Ga0006562J51391_1026618 | 3300003578 | Bacteria | 1873 |
| 52 | Ga0055535_1001731 | 3300003761 | Bacteria | 9801 |
| 53 | Ga0055542_1004590 | 3300003762 | Bacteria | 3311 |
| 54 | Ga0055526_1008317 | 3300003771 | Bacteria | 5202 |
| 55 | Ga0055536_1000010 | 3300003781 | Bacteria | 304614 |
| 56 | Ga0055536_1001611 | 3300003781 | Bacteria | 13467 |
| 57 | Ga0055528_1000701 | 3300003790 | Bacteria | 23758 |
| 58 | Ga0055530_10000911 | 3300003791 | Bacteria | 24271 |
| 59 | Ga0055530_10002214 | 3300003791 | Bacteria | 12844 |
| 60 | Ga0055531_10000245 | 3300003794 | Bacteria | 59122 |
| 61 | Ga0055531_10000435 | 3300003794 | Bacteria | 39538 |
| 62 | Ga0058863_11371296 | 3300004799 | Bacteria | 2287 |
| 63 | Ga0058862_12893042 | 3300004803 | Bacteria | 4420 |
| 64 | Ga0065165_1000131 | 3300005262 | Bacteria | 128880 |
| 65 | Ga0065165_1000725 | 3300005262 | Bacteria | 46083 |
| 66 | Ga0065165_1001074 | 3300005262 | Bacteria | 32602 |
| 67 | Ga0065714_10003996 | 3300005288 | Bacteria | 10318 |
| 68 | Ga0065714_10007893 | 3300005288 | Bacteria | 4048 |
| 69 | Ga0065714_10064770 | 3300005288 | Bacteria | 19370 |
| 70 | Ga0065714_10067085 | 3300005288 | Bacteria | 5864 |
| 71 | Ga0065714_10068951 | 3300005288 | Bacteria | 4451 |
| 72 | Ga0065714_10081337 | 3300005288 | Bacteria | 2377 |
| 73 | Ga0065704_10070136 | 3300005289 | Bacteria | 560402 |
| 74 | Ga0065704_10070374 | 3300005289 | Bacteria | 28734 |
| 75 | Ga0065704_10070934 | 3300005289 | Bacteria | 14451 |
| 76 | Ga0065704_10071262 | 3300005289 | Bacteria | 12166 |
| 77 | Ga0065704_10073279 | 3300005289 | Bacteria | 7354 |
| 78 | Ga0065704_10074546 | 3300005289 | Bacteria | 6194 |
| 79 | Ga0065704_10082725 | 3300005289 | Bacteria | 3559 |
| 80 | Ga0065704_10084719 | 3300005289 | Bacteria | 3304 |
| 81 | Ga0065704_10095111 | 3300005289 | Bacteria | 2505 |
| 82 | Ga0065704_10098586 | 3300005289 | Bacteria | 2347 |
| 83 | Ga0065712_10001912 | 3300005290 | Bacteria | 13957 |
| 84 | Ga0065712_10099197 | 3300005290 | Bacteria | 2098 |
| 85 | Ga0065715_10005294 | 3300005293 | Bacteria | 4057 |
| 86 | Ga0065715_10088952 | 3300005293 | Bacteria | 20962 |
| 87 | Ga0065715_10133208 | 3300005293 | Bacteria | 1976 |
| 88 | Ga0065715_10165505 | 3300005293 | Bacteria | 1590 |
| 89 | Ga0065707_10175618 | 3300005295 | Bacteria | 1453 |
| 90 | Ga0070658_10000011 | 3300005327 | Bacteria | 294396 |
| 91 | Ga0070658_10000515 | 3300005327 | Bacteria | 33566 |
| 92 | Ga0070658_10008589 | 3300005327 | Bacteria | 8214 |
| 93 | Ga0070658_10115992 | 3300005327 | Bacteria | 2222 |
| 94 | Ga0070658_10134793 | 3300005327 | Bacteria | 2059 |
| 95 | Ga0070658_10224479 | 3300005327 | Bacteria | 1589 |
| 96 | Ga0070658_10278492 | 3300005327 | Bacteria | 1423 |
| 97 | Ga0070676_10000277 | 3300005328 | Bacteria | 22624 |
| 98 | Ga0070676_10002355 | 3300005328 | Bacteria | 9671 |
| 99 | Ga0070676_10094701 | 3300005328 | Bacteria | 1835 |
| 100 | Ga0070683_100002536 | 3300005329 | Bacteria | 14576 |
| 101 | Ga0070683_100003504 | 3300005329 | Bacteria | 12763 |
| 102 | Ga0070683_100004268 | 3300005329 | Bacteria | 11731 |
| 103 | Ga0070683_100006103 | 3300005329 | Bacteria | 10103 |
| 104 | Ga0070683_100010704 | 3300005329 | Bacteria | 7886 |
| 105 | Ga0070683_100075911 | 3300005329 | Bacteria | 3141 |
| 106 | Ga0070690_100010328 | 3300005330 | Bacteria | 5430 |
| 107 | Ga0070690_100022642 | 3300005330 | Bacteria | 3845 |
| 108 | Ga0070670_100015632 | 3300005331 | Bacteria | 6517 |
| 109 | Ga0070670_100032500 | 3300005331 | Bacteria | 4494 |
| 110 | Ga0070670_100038445 | 3300005331 | Bacteria | 4115 |
| 111 | Ga0070670_100081448 | 3300005331 | Bacteria | 2781 |
| 112 | Ga0070670_100188523 | 3300005331 | Bacteria | 1791 |
| 113 | Ga0068869_100000827 | 3300005334 | Bacteria | 17676 |
| 114 | Ga0068869_100005917 | 3300005334 | Bacteria | 7728 |
| 115 | Ga0068869_100007558 | 3300005334 | Bacteria | 6955 |
| 116 | Ga0068869_100032239 | 3300005334 | Bacteria | 3691 |
| 117 | Ga0070666_10000323 | 3300005335 | Bacteria | 30548 |
| 118 | Ga0070666_10001233 | 3300005335 | Bacteria | 15463 |
| 119 | Ga0070666_10151143 | 3300005335 | Bacteria | 1620 |
| 120 | Ga0070666_10199298 | 3300005335 | Bacteria | 1408 |
| 121 | Ga0070680_100010203 | 3300005336 | Bacteria | 7242 |
| 122 | Ga0070680_100024474 | 3300005336 | Bacteria | 4824 |
| 123 | Ga0070680_100070642 | 3300005336 | Bacteria | 2868 |
| 124 | Ga0070680_100088593 | 3300005336 | Bacteria | 2560 |
| 125 | Ga0070680_100138593 | 3300005336 | Bacteria | 2039 |
| 126 | Ga0070680_100250961 | 3300005336 | Bacteria | 1496 |
| 127 | Ga0070682_100000039 | 3300005337 | Bacteria | 144400 |
| 128 | Ga0070682_100000625 | 3300005337 | Bacteria | 21518 |
| 129 | Ga0070682_100009958 | 3300005337 | Bacteria | 5384 |
| 130 | Ga0070682_100026312 | 3300005337 | Bacteria | 3481 |
| 131 | Ga0068868_100004571 | 3300005338 | Bacteria | 9714 |
| 132 | Ga0068868_100009633 | 3300005338 | Bacteria | 6967 |
| 133 | Ga0068868_100035974 | 3300005338 | Bacteria | 3830 |
| 134 | Ga0070660_100001306 | 3300005339 | Bacteria | 16984 |
| 135 | Ga0070660_100002764 | 3300005339 | Bacteria | 12054 |
| 136 | Ga0070660_100015693 | 3300005339 | Bacteria | 5477 |
| 137 | Ga0070660_100130765 | 3300005339 | Bacteria | 2009 |
| 138 | Ga0070689_100010555 | 3300005340 | Bacteria | 6584 |
| 139 | Ga0070689_100028711 | 3300005340 | Bacteria | 4207 |
| 140 | Ga0070689_100080880 | 3300005340 | Bacteria | 2550 |
| 141 | Ga0070689_100299370 | 3300005340 | Bacteria | 1338 |
| 142 | Ga0070691_10000660 | 3300005341 | Bacteria | 13368 |
| 143 | Ga0070691_10020602 | 3300005341 | Bacteria | 3047 |
| 144 | Ga0070687_100001432 | 3300005343 | Bacteria | 8384 |
| 145 | Ga0070687_100069461 | 3300005343 | Bacteria | 1886 |
| 146 | Ga0070661_100002636 | 3300005344 | Bacteria | 12270 |
| 147 | Ga0070661_100010432 | 3300005344 | Bacteria | 6460 |
| 148 | Ga0070661_100011068 | 3300005344 | Bacteria | 6283 |
| 149 | Ga0070668_100004869 | 3300005347 | Bacteria | 9948 |
| 150 | Ga0070668_100014483 | 3300005347 | Bacteria | 5895 |
| 151 | Ga0070668_100023632 | 3300005347 | Bacteria | 4651 |
| 152 | Ga0070668_100041596 | 3300005347 | Bacteria | 3521 |
| 153 | Ga0070669_100057612 | 3300005353 | Bacteria | 2851 |
| 154 | Ga0070669_100078997 | 3300005353 | Bacteria | 2446 |
| 155 | Ga0070669_100174934 | 3300005353 | Bacteria | 1676 |
| 156 | Ga0070669_100254111 | 3300005353 | Bacteria | 1400 |
| 157 | Ga0070675_100003849 | 3300005354 | Bacteria | 11389 |
| 158 | Ga0070675_100016358 | 3300005354 | Bacteria | 5886 |
| 159 | Ga0070675_100036218 | 3300005354 | Bacteria | 4014 |
| 160 | Ga0070675_100059652 | 3300005354 | Bacteria | 3148 |
| 161 | Ga0070671_100019758 | 3300005355 | Bacteria | 5487 |
| 162 | Ga0070671_100030050 | 3300005355 | Bacteria | 4483 |
| 163 | Ga0070671_100061292 | 3300005355 | Bacteria | 3133 |
| 164 | Ga0070671_100111333 | 3300005355 | Bacteria | 2300 |
| 165 | Ga0070671_100124488 | 3300005355 | Bacteria | 2170 |
| 166 | Ga0070673_100002393 | 3300005364 | Bacteria | 11418 |
| 167 | Ga0070673_100003782 | 3300005364 | Bacteria | 9493 |
| 168 | Ga0070673_100004396 | 3300005364 | Bacteria | 8911 |
| 169 | Ga0070673_100012715 | 3300005364 | Bacteria | 5789 |
| 170 | Ga0070673_100018686 | 3300005364 | Bacteria | 4959 |
| 171 | Ga0070673_100149118 | 3300005364 | Bacteria | 1979 |
| 172 | Ga0070688_100012071 | 3300005365 | Bacteria | 4826 |
| 173 | Ga0070688_100026240 | 3300005365 | Bacteria | 3460 |
| 174 | Ga0070659_100002083 | 3300005366 | Bacteria | 14235 |
| 175 | Ga0070659_100003545 | 3300005366 | Bacteria | 11112 |
| 176 | Ga0070659_100010122 | 3300005366 | Bacteria | 6941 |
| 177 | Ga0070659_100018139 | 3300005366 | Bacteria | 5308 |
| 178 | Ga0070667_100005690 | 3300005367 | Bacteria | 10406 |
| 179 | Ga0070667_100068663 | 3300005367 | Bacteria | 3016 |
| 180 | Ga0070667_100244374 | 3300005367 | Bacteria | 1603 |
| 181 | Ga0070678_100004999 | 3300005456 | Bacteria | 7599 |
| 182 | Ga0070678_100006236 | 3300005456 | Bacteria | 6976 |
| 183 | Ga0070678_100018818 | 3300005456 | Bacteria | 4485 |
| 184 | Ga0070678_100151126 | 3300005456 | Bacteria | 1870 |
| 185 | Ga0070662_100000032 | 3300005457 | Bacteria | 78824 |
| 186 | Ga0070662_100022191 | 3300005457 | Bacteria | 4342 |
| 187 | Ga0070662_100030585 | 3300005457 | Bacteria | 3769 |
| 188 | Ga0070662_100056919 | 3300005457 | Bacteria | 2839 |
| 189 | Ga0070662_100059188 | 3300005457 | Bacteria | 2790 |
| 190 | Ga0070662_100086776 | 3300005457 | Bacteria | 2341 |
| 191 | Ga0070681_10017068 | 3300005458 | Bacteria | 7255 |
| 192 | Ga0070681_10018726 | 3300005458 | Bacteria | 6929 |
| 193 | Ga0070681_10034740 | 3300005458 | Bacteria | 5063 |
| 194 | Ga0070681_10036428 | 3300005458 | Bacteria | 4940 |
| 195 | Ga0070681_10064666 | 3300005458 | Bacteria | 3628 |
| 196 | Ga0068867_100009759 | 3300005459 | Bacteria | 6765 |
| 197 | Ga0068867_100010951 | 3300005459 | Bacteria | 6395 |
| 198 | Ga0068867_100023644 | 3300005459 | Bacteria | 4400 |
| 199 | Ga0068867_100033878 | 3300005459 | Bacteria | 3701 |
| 200 | Ga0068867_100059230 | 3300005459 | Bacteria | 2839 |
| 201 | Ga0068867_100163733 | 3300005459 | Bacteria | 1756 |
| 202 | Ga0068867_100276500 | 3300005459 | Unclassified | 1375 |
| 203 | Ga0070685_10048201 | 3300005466 | Bacteria | 2453 |
| 204 | Ga0070685_10072252 | 3300005466 | Bacteria | 2047 |
| 205 | Ga0070685_10117310 | 3300005466 | Bacteria | 1648 |
| 206 | Ga0070698_100002644 | 3300005471 | Bacteria | 19745 |
| 207 | Ga0070698_100016067 | 3300005471 | Bacteria | 7903 |
| 208 | Ga0070679_100025505 | 3300005530 | Bacteria | 5802 |
| 209 | Ga0070679_100030821 | 3300005530 | Bacteria | 5298 |
| 210 | Ga0070679_100042499 | 3300005530 | Bacteria | 4527 |
| 211 | Ga0070679_100042689 | 3300005530 | Bacteria | 4516 |
| 212 | Ga0070679_100066869 | 3300005530 | Bacteria | 3584 |
| 213 | Ga0070679_100111026 | 3300005530 | Bacteria | 2728 |
| 214 | Ga0070684_100000097 | 3300005535 | Bacteria | 56477 |
| 215 | Ga0070684_100011014 | 3300005535 | Bacteria | 7193 |
| 216 | Ga0070684_100027061 | 3300005535 | Bacteria | 4836 |
| 217 | Ga0070684_100036492 | 3300005535 | Bacteria | 4212 |
| 218 | Ga0070684_100056838 | 3300005535 | Bacteria | 3416 |
| 219 | Ga0068853_100004545 | 3300005539 | Bacteria | 10768 |
| 220 | Ga0068853_100008299 | 3300005539 | Bacteria | 8339 |
| 221 | Ga0068853_100008727 | 3300005539 | Bacteria | 8154 |
| 222 | Ga0068853_100028221 | 3300005539 | Bacteria | 4719 |
| 223 | Ga0068853_100057738 | 3300005539 | Bacteria | 3350 |
| 224 | Ga0068853_100082062 | 3300005539 | Bacteria | 2823 |
| 225 | Ga0068853_100105194 | 3300005539 | Bacteria | 2500 |
| 226 | Ga0068853_100234405 | 3300005539 | Bacteria | 1680 |
| 227 | Ga0070672_100000061 | 3300005543 | Bacteria | 49701 |
| 228 | Ga0070672_100017587 | 3300005543 | Bacteria | 5150 |
| 229 | Ga0070672_100050540 | 3300005543 | Bacteria | 3238 |
| 230 | Ga0070686_100023709 | 3300005544 | Bacteria | 3671 |
| 231 | Ga0070686_100048162 | 3300005544 | Bacteria | 2699 |
| 232 | Ga0070693_100006957 | 3300005547 | Bacteria | 5503 |
| 233 | Ga0070693_100117735 | 3300005547 | Bacteria | 1644 |
| 234 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 235 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 236 | Ga0070665_100005248 | 3300005548 | Bacteria | 13397 |
| 237 | Ga0070665_100008467 | 3300005548 | Bacteria | 10406 |
| 238 | Ga0070665_100049998 | 3300005548 | Bacteria | 4195 |
| 239 | Ga0070665_100311945 | 3300005548 | Bacteria | 1577 |
| 240 | Ga0068855_100000042 | 3300005563 | Bacteria | 149332 |
| 241 | Ga0068855_100000439 | 3300005563 | Bacteria | 51399 |
| 242 | Ga0068855_100000508 | 3300005563 | Bacteria | 48055 |
| 243 | Ga0068855_100011561 | 3300005563 | Bacteria | 10660 |
| 244 | Ga0068855_100027104 | 3300005563 | Bacteria | 6856 |
| 245 | Ga0068855_100032170 | 3300005563 | Bacteria | 6263 |
| 246 | Ga0068855_100039110 | 3300005563 | Bacteria | 5631 |
| 247 | Ga0068855_100048633 | 3300005563 | Bacteria | 5004 |
| 248 | Ga0068855_100062885 | 3300005563 | Bacteria | 4333 |
| 249 | Ga0068855_100066337 | 3300005563 | Bacteria | 4208 |
| 250 | Ga0068855_100116249 | 3300005563 | Bacteria | 3066 |
| 251 | Ga0068855_100152650 | 3300005563 | Bacteria | 2626 |
| 252 | Ga0068855_100253898 | 3300005563 | Bacteria | 1961 |
| 253 | Ga0068855_100282407 | 3300005563 | Bacteria | 1843 |
| 254 | Ga0070664_100002153 | 3300005564 | Bacteria | 15793 |
| 255 | Ga0070664_100003785 | 3300005564 | Bacteria | 12203 |
| 256 | Ga0070664_100004253 | 3300005564 | Bacteria | 11514 |
| 257 | Ga0070664_100022827 | 3300005564 | Bacteria | 5161 |
| 258 | Ga0070664_100052278 | 3300005564 | Bacteria | 3460 |
| 259 | Ga0068857_100001948 | 3300005577 | Bacteria | 16668 |
| 260 | Ga0068857_100010962 | 3300005577 | Bacteria | 7888 |
| 261 | Ga0068857_100025799 | 3300005577 | Bacteria | 5175 |
| 262 | Ga0068857_100125503 | 3300005577 | Bacteria | 2313 |
| 263 | Ga0068857_100137879 | 3300005577 | Bacteria | 2204 |
| 264 | Ga0068857_100222750 | 3300005577 | Bacteria | 1723 |
| 265 | Ga0068854_100007137 | 3300005578 | Bacteria | 7133 |
| 266 | Ga0068854_100020090 | 3300005578 | Bacteria | 4511 |
| 267 | Ga0068854_100054632 | 3300005578 | Bacteria | 2873 |
| 268 | Ga0068856_100000794 | 3300005614 | Bacteria | 34105 |
| 269 | Ga0068856_100024601 | 3300005614 | Bacteria | 5862 |
| 270 | Ga0068856_100040048 | 3300005614 | Bacteria | 4601 |
| 271 | Ga0068856_100113608 | 3300005614 | Bacteria | 2706 |
| 272 | Ga0068856_100223899 | 3300005614 | Bacteria | 1896 |
| 273 | Ga0070702_100051565 | 3300005615 | Bacteria | 2356 |
| 274 | Ga0068852_100002452 | 3300005616 | Bacteria | 12774 |
| 275 | Ga0068852_100010222 | 3300005616 | Bacteria | 6996 |
| 276 | Ga0068852_100016457 | 3300005616 | Bacteria | 5768 |
| 277 | Ga0068852_100024730 | 3300005616 | Bacteria | 4858 |
| 278 | Ga0068852_100047320 | 3300005616 | Bacteria | 3669 |
| 279 | Ga0068852_100080351 | 3300005616 | Bacteria | 2890 |
| 280 | Ga0068859_100000106 | 3300005617 | Bacteria | 78128 |
| 281 | Ga0068859_100007461 | 3300005617 | Bacteria | 11100 |
| 282 | Ga0068859_100008808 | 3300005617 | Bacteria | 10188 |
| 283 | Ga0068859_100080263 | 3300005617 | Bacteria | 3303 |
| 284 | Ga0068859_100136898 | 3300005617 | Bacteria | 2522 |
| 285 | Ga0068859_100305465 | 3300005617 | Bacteria | 1684 |
| 286 | Ga0068864_100003370 | 3300005618 | Bacteria | 13210 |
| 287 | Ga0068864_100011427 | 3300005618 | Bacteria | 7334 |
| 288 | Ga0068864_100043993 | 3300005618 | Bacteria | 3825 |
| 289 | Ga0068864_100111824 | 3300005618 | Bacteria | 2434 |
| 290 | Ga0068861_100013324 | 3300005719 | Bacteria | 5753 |
| 291 | Ga0068861_100034298 | 3300005719 | Bacteria | 3752 |
| 292 | Ga0068861_100160171 | 3300005719 | Unclassified | 1856 |
| 293 | Ga0068861_100268986 | 3300005719 | Bacteria | 1463 |
| 294 | Ga0068851_10000465 | 3300005834 | Bacteria | 17865 |
| 295 | Ga0068851_10047056 | 3300005834 | Bacteria | 2183 |
| 296 | Ga0068851_10075702 | 3300005834 | Bacteria | 1749 |
| 297 | Ga0068870_10028876 | 3300005840 | Bacteria | 2789 |
| 298 | Ga0068870_10088051 | 3300005840 | Bacteria | 1730 |
| 299 | Ga0068863_100001273 | 3300005841 | Bacteria | 25131 |
| 300 | Ga0068863_100006081 | 3300005841 | Bacteria | 11840 |
| 301 | Ga0068863_100011467 | 3300005841 | Bacteria | 8571 |
| 302 | Ga0068863_100032496 | 3300005841 | Bacteria | 4975 |
| 303 | Ga0068863_100048536 | 3300005841 | Bacteria | 4026 |
| 304 | Ga0068863_100076978 | 3300005841 | Bacteria | 3156 |
| 305 | Ga0068863_100177698 | 3300005841 | Bacteria | 2043 |
| 306 | Ga0068863_100238773 | 3300005841 | Bacteria | 1754 |
| 307 | Ga0068863_100302941 | 3300005841 | Bacteria | 1550 |
| 308 | Ga0068858_100000930 | 3300005842 | Bacteria | 30365 |
| 309 | Ga0068858_100006822 | 3300005842 | Bacteria | 11107 |
| 310 | Ga0068858_100016470 | 3300005842 | Bacteria | 6941 |
| 311 | Ga0068858_100149041 | 3300005842 | Bacteria | 2199 |
| 312 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 313 | Ga0068860_100003491 | 3300005843 | Bacteria | 16182 |
| 314 | Ga0068860_100009409 | 3300005843 | Bacteria | 9711 |
| 315 | Ga0068860_100011027 | 3300005843 | Bacteria | 8911 |
| 316 | Ga0068860_100026307 | 3300005843 | Bacteria | 5610 |
| 317 | Ga0068862_100006586 | 3300005844 | Bacteria | 9629 |
| 318 | Ga0068862_100076920 | 3300005844 | Bacteria | 2889 |
| 319 | Ga0068862_100142298 | 3300005844 | Bacteria | 2130 |
| 320 | Ga0081540_1040101 | 3300005983 | Unclassified | 2445 |
| 321 | Ga0081539_10001169 | 3300005985 | Bacteria | 47510 |
| 322 | Ga0081539_10029490 | 3300005985 | Bacteria | 3426 |
| 323 | Ga0075366_10001072 | 3300006195 | Bacteria | 13441 |
| 324 | Ga0075366_10007887 | 3300006195 | Bacteria | 5889 |
| 325 | Ga0075366_10009701 | 3300006195 | Bacteria | 5381 |
| 326 | Ga0075366_10021500 | 3300006195 | Bacteria | 3750 |
| 327 | Ga0075366_10021509 | 3300006195 | Bacteria | 3750 |
| 328 | Ga0075366_10106071 | 3300006195 | Bacteria | 1689 |
| 329 | Ga0097621_100000165 | 3300006237 | Bacteria | 41398 |
| 330 | Ga0097621_100000531 | 3300006237 | Bacteria | 26760 |
| 331 | Ga0097621_100006425 | 3300006237 | Bacteria | 8342 |
| 332 | Ga0097621_100016683 | 3300006237 | Bacteria | 5559 |
| 333 | Ga0097621_100068802 | 3300006237 | Bacteria | 2921 |
| 334 | Ga0097621_100070099 | 3300006237 | Bacteria | 2894 |
| 335 | Ga0097621_100109977 | 3300006237 | Bacteria | 2328 |
| 336 | Ga0097621_100156438 | 3300006237 | Bacteria | 1957 |
| 337 | Ga0068871_100000018 | 3300006358 | Bacteria | 89690 |
| 338 | Ga0068871_100000042 | 3300006358 | Bacteria | 67951 |
| 339 | Ga0068871_100001712 | 3300006358 | Bacteria | 14753 |
| 340 | Ga0068871_100002324 | 3300006358 | Bacteria | 12946 |
| 341 | Ga0068871_100002902 | 3300006358 | Bacteria | 11755 |
| 342 | Ga0068871_100007826 | 3300006358 | Bacteria | 7657 |
| 343 | Ga0068871_100012489 | 3300006358 | Bacteria | 6266 |
| 344 | Ga0068871_100039588 | 3300006358 | Bacteria | 3772 |
| 345 | Ga0075428_100004442 | 3300006844 | Bacteria | 15481 |
| 346 | Ga0075428_100010463 | 3300006844 | Bacteria | 10305 |
| 347 | Ga0075428_100011907 | 3300006844 | Bacteria | 9675 |
| 348 | Ga0075430_100004975 | 3300006846 | Bacteria | 11184 |
| 349 | Ga0075431_100026391 | 3300006847 | Bacteria | 5960 |
| 350 | Ga0075429_100030837 | 3300006880 | Bacteria | 4659 |
| 351 | Ga0075429_100071292 | 3300006880 | Bacteria | 3025 |
| 352 | Ga0068865_100000396 | 3300006881 | Bacteria | 24307 |
| 353 | Ga0068865_100001997 | 3300006881 | Bacteria | 12048 |
| 354 | Ga0068865_100051065 | 3300006881 | Bacteria | 2860 |
| 355 | Ga0097620_100000106 | 3300006931 | Bacteria | 78128 |
| 356 | Ga0097620_100007461 | 3300006931 | Bacteria | 11100 |
| 357 | Ga0097620_100008808 | 3300006931 | Bacteria | 10188 |
| 358 | Ga0097620_100080264 | 3300006931 | Bacteria | 3303 |
| 359 | Ga0097620_100136895 | 3300006931 | Bacteria | 2522 |
| 360 | Ga0097620_100305481 | 3300006931 | Bacteria | 1684 |
| 361 | Ga0099824_1002886 | 3300006942 | Bacteria | 25147 |
| 362 | Ga0079104_1000179 | 3300006946 | Bacteria | 90381 |
| 363 | Ga0099826_10037265 | 3300006948 | Bacteria | 3428 |
| 364 | Ga0105251_10043569 | 3300009011 | Bacteria | 2172 |
| 365 | Ga0105244_10000004 | 3300009036 | Bacteria | 492478 |
| 366 | Ga0105244_10000011 | 3300009036 | Bacteria | 263939 |
| 367 | Ga0105240_10000037 | 3300009093 | Bacteria | 270462 |
| 368 | Ga0105240_10000237 | 3300009093 | Bacteria | 109895 |
| 369 | Ga0105240_10000367 | 3300009093 | Bacteria | 84666 |
| 370 | Ga0105240_10000487 | 3300009093 | Bacteria | 73453 |
| 371 | Ga0105240_10005515 | 3300009093 | Bacteria | 18851 |
| 372 | Ga0105240_10022011 | 3300009093 | Bacteria | 8465 |
| 373 | Ga0105240_10039540 | 3300009093 | Bacteria | 6039 |
| 374 | Ga0105240_10042495 | 3300009093 | Bacteria | 5791 |
| 375 | Ga0105240_10043261 | 3300009093 | Bacteria | 5732 |
| 376 | Ga0105240_10069454 | 3300009093 | Bacteria | 4360 |
| 377 | Ga0105240_10104541 | 3300009093 | Bacteria | 3439 |
| 378 | Ga0105240_10113999 | 3300009093 | Bacteria | 3266 |
| 379 | Ga0105240_10181056 | 3300009093 | Bacteria | 2487 |
| 380 | Ga0105240_10245699 | 3300009093 | Bacteria | 2073 |
| 381 | Ga0111539_10014918 | 3300009094 | Bacteria | 9685 |
| 382 | Ga0111539_10017967 | 3300009094 | Bacteria | 8760 |
| 383 | Ga0111539_10066976 | 3300009094 | Bacteria | 4242 |
| 384 | Ga0111539_10162149 | 3300009094 | Bacteria | 2615 |
| 385 | Ga0105245_10173353 | 3300009098 | Unclassified | 2056 |
| 386 | Ga0105247_10000918 | 3300009101 | Bacteria | 22128 |
| 387 | Ga0105247_10011475 | 3300009101 | Bacteria | 5342 |
| 388 | Ga0105247_10037908 | 3300009101 | Bacteria | 2941 |
| 389 | Ga0114129_10012446 | 3300009147 | Bacteria | 12112 |
| 390 | Ga0114129_10052518 | 3300009147 | Bacteria | 5720 |
| 391 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 392 | Ga0105243_10000145 | 3300009148 | Bacteria | 81468 |
| 393 | Ga0105243_10172389 | 3300009148 | Unclassified | 1875 |
| 394 | Ga0105241_10001462 | 3300009174 | Bacteria | 18113 |
| 395 | Ga0105241_10002922 | 3300009174 | Bacteria | 12760 |
| 396 | Ga0105241_10003042 | 3300009174 | Bacteria | 12514 |
| 397 | Ga0105241_10005760 | 3300009174 | Bacteria | 9147 |
| 398 | Ga0105241_10007004 | 3300009174 | Bacteria | 8292 |
| 399 | Ga0105241_10030640 | 3300009174 | Bacteria | 4022 |
| 400 | Ga0105241_10084882 | 3300009174 | Bacteria | 2487 |
| 401 | Ga0105241_10114505 | 3300009174 | Unclassified | 2163 |
| 402 | Ga0105242_10006535 | 3300009176 | Bacteria | 8974 |
| 403 | Ga0105242_10036683 | 3300009176 | Bacteria | 3934 |
| 404 | Ga0105242_10086686 | 3300009176 | Bacteria | 2628 |
| 405 | Ga0105242_10121133 | 3300009176 | Bacteria | 2245 |
| 406 | Ga0105248_10004482 | 3300009177 | Bacteria | 15453 |
| 407 | Ga0105248_10032533 | 3300009177 | Bacteria | 5828 |
| 408 | Ga0105248_10256759 | 3300009177 | Unclassified | 1967 |
| 409 | Ga0105237_10000224 | 3300009545 | Bacteria | 79854 |
| 410 | Ga0105237_10000729 | 3300009545 | Bacteria | 45381 |
| 411 | Ga0105237_10000952 | 3300009545 | Bacteria | 38921 |
| 412 | Ga0105237_10000963 | 3300009545 | Bacteria | 38740 |
| 413 | Ga0105237_10001948 | 3300009545 | Bacteria | 26296 |
| 414 | Ga0105237_10002321 | 3300009545 | Bacteria | 23628 |
| 415 | Ga0105237_10003093 | 3300009545 | Bacteria | 20049 |
| 416 | Ga0105237_10004043 | 3300009545 | Bacteria | 17124 |
| 417 | Ga0105237_10008222 | 3300009545 | Bacteria | 11332 |
| 418 | Ga0105237_10009903 | 3300009545 | Bacteria | 10175 |
| 419 | Ga0105237_10019011 | 3300009545 | Bacteria | 7101 |
| 420 | Ga0105237_10021687 | 3300009545 | Bacteria | 6601 |
| 421 | Ga0105237_10033447 | 3300009545 | Bacteria | 5208 |
| 422 | Ga0105237_10040318 | 3300009545 | Bacteria | 4710 |
| 423 | Ga0105237_10179810 | 3300009545 | Bacteria | 2116 |
| 424 | Ga0105237_10192111 | 3300009545 | Bacteria | 2041 |
| 425 | Ga0105237_10217300 | 3300009545 | Bacteria | 1911 |
| 426 | Ga0105237_10297085 | 3300009545 | Bacteria | 1618 |
| 427 | Ga0105238_10004274 | 3300009551 | Bacteria | 14194 |
| 428 | Ga0105238_10013318 | 3300009551 | Bacteria | 8298 |
| 429 | Ga0105238_10037769 | 3300009551 | Bacteria | 4907 |
| 430 | Ga0105238_10203974 | 3300009551 | Bacteria | 1953 |
| 431 | Ga0105238_10279964 | 3300009551 | Bacteria | 1649 |
| 432 | Ga0105249_10001226 | 3300009553 | Bacteria | 22548 |
| 433 | Ga0105249_10002137 | 3300009553 | Bacteria | 17128 |
| 434 | Ga0105249_10019422 | 3300009553 | Bacteria | 6064 |
| 435 | Ga0105249_10021227 | 3300009553 | Bacteria | 5814 |
| 436 | Ga0105249_10024010 | 3300009553 | Bacteria | 5476 |
| 437 | Ga0105249_10035542 | 3300009553 | Bacteria | 4519 |
| 438 | Ga0105249_10115485 | 3300009553 | Bacteria | 2543 |
| 439 | Ga0105249_10180744 | 3300009553 | Bacteria | 2052 |
| 440 | Ga0105249_10198919 | 3300009553 | Bacteria | 1960 |
| 441 | Ga0105249_10315500 | 3300009553 | Unclassified | 1573 |
| 442 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 443 | Ga0105239_10000013 | 3300010375 | Bacteria | 327371 |
| 444 | Ga0105239_10000283 | 3300010375 | Bacteria | 74612 |
| 445 | Ga0105239_10001207 | 3300010375 | Bacteria | 35283 |
| 446 | Ga0105239_10001438 | 3300010375 | Bacteria | 31747 |
| 447 | Ga0105239_10003665 | 3300010375 | Bacteria | 18762 |
| 448 | Ga0105239_10006888 | 3300010375 | Bacteria | 13111 |
| 449 | Ga0105239_10024908 | 3300010375 | Bacteria | 6590 |
| 450 | Ga0105239_10025175 | 3300010375 | Bacteria | 6554 |
| 451 | Ga0105239_10061828 | 3300010375 | Bacteria | 4110 |
| 452 | Ga0105239_10123544 | 3300010375 | Bacteria | 2876 |
| 453 | Ga0105239_10150086 | 3300010375 | Bacteria | 2601 |
| 454 | Ga0105239_10258859 | 3300010375 | Bacteria | 1955 |
| 455 | Ga0105239_10291504 | 3300010375 | Bacteria | 1837 |
| 456 | Ga0105239_10383807 | 3300010375 | Bacteria | 1588 |
| 457 | Ga0157373_10000002 | 3300013100 | Bacteria | 750094 |
| 458 | Ga0157373_10000005 | 3300013100 | Bacteria | 262158 |
| 459 | Ga0157373_10000256 | 3300013100 | Bacteria | 43374 |
| 460 | Ga0157373_10000936 | 3300013100 | Bacteria | 22553 |
| 461 | Ga0157373_10001318 | 3300013100 | Bacteria | 18986 |
| 462 | Ga0157373_10002482 | 3300013100 | Bacteria | 14050 |
| 463 | Ga0157373_10003984 | 3300013100 | Bacteria | 11138 |
| 464 | Ga0157373_10024469 | 3300013100 | Bacteria | 4373 |
| 465 | Ga0157373_10025270 | 3300013100 | Bacteria | 4297 |
| 466 | Ga0157373_10031635 | 3300013100 | Bacteria | 3808 |
| 467 | Ga0157373_10032956 | 3300013100 | Bacteria | 3729 |
| 468 | Ga0157373_10033565 | 3300013100 | Bacteria | 3691 |
| 469 | Ga0157373_10087296 | 3300013100 | Bacteria | 2198 |
| 470 | Ga0157373_10087541 | 3300013100 | Bacteria | 2194 |
| 471 | Ga0157373_10219732 | 3300013100 | Bacteria | 1340 |
| 472 | Ga0157371_10000046 | 3300013102 | Bacteria | 187304 |
| 473 | Ga0157371_10000079 | 3300013102 | Bacteria | 152295 |
| 474 | Ga0157371_10000216 | 3300013102 | Bacteria | 83975 |
| 475 | Ga0157371_10000741 | 3300013102 | Bacteria | 38124 |
| 476 | Ga0157371_10001331 | 3300013102 | Bacteria | 25968 |
| 477 | Ga0157371_10002552 | 3300013102 | Bacteria | 17284 |
| 478 | Ga0157371_10003861 | 3300013102 | Bacteria | 13371 |
| 479 | Ga0157371_10011763 | 3300013102 | Bacteria | 6723 |
| 480 | Ga0157371_10015344 | 3300013102 | Bacteria | 5750 |
| 481 | Ga0157371_10017592 | 3300013102 | Bacteria | 5306 |
| 482 | Ga0157371_10017639 | 3300013102 | Bacteria | 5296 |
| 483 | Ga0157371_10018024 | 3300013102 | Bacteria | 5229 |
| 484 | Ga0157371_10027826 | 3300013102 | Bacteria | 4097 |
| 485 | Ga0157371_10040330 | 3300013102 | Bacteria | 3335 |
| 486 | Ga0157371_10104115 | 3300013102 | Bacteria | 2014 |
| 487 | Ga0157370_10001014 | 3300013104 | Bacteria | 35409 |
| 488 | Ga0157370_10002361 | 3300013104 | Bacteria | 22770 |
| 489 | Ga0157370_10003143 | 3300013104 | Bacteria | 19558 |
| 490 | Ga0157370_10003236 | 3300013104 | Bacteria | 19218 |
| 491 | Ga0157370_10003785 | 3300013104 | Bacteria | 17653 |
| 492 | Ga0157370_10007303 | 3300013104 | Bacteria | 12057 |
| 493 | Ga0157370_10017885 | 3300013104 | Bacteria | 7141 |
| 494 | Ga0157370_10018487 | 3300013104 | Bacteria | 7006 |
| 495 | Ga0157370_10020395 | 3300013104 | Bacteria | 6621 |
| 496 | Ga0157370_10020909 | 3300013104 | Bacteria | 6528 |
| 497 | Ga0157370_10022590 | 3300013104 | Bacteria | 6259 |
| 498 | Ga0157370_10023049 | 3300013104 | Bacteria | 6188 |
| 499 | Ga0157370_10030370 | 3300013104 | Bacteria | 5295 |
| 500 | Ga0157370_10052885 | 3300013104 | Bacteria | 3875 |
| 501 | Ga0157370_10074178 | 3300013104 | Bacteria | 3209 |
| 502 | Ga0157370_10117145 | 3300013104 | Bacteria | 2488 |
| 503 | Ga0157370_10120995 | 3300013104 | Bacteria | 2444 |
| 504 | Ga0157370_10121149 | 3300013104 | Bacteria | 2442 |
| 505 | Ga0157370_10179980 | 3300013104 | Bacteria | 1965 |
| 506 | Ga0157370_10196518 | 3300013104 | Bacteria | 1872 |
| 507 | Ga0157370_10208645 | 3300013104 | Bacteria | 1811 |
| 508 | Ga0157370_10274035 | 3300013104 | Bacteria | 1559 |
| 509 | Ga0157370_10277171 | 3300013104 | Bacteria | 1549 |
| 510 | Ga0157369_10000046 | 3300013105 | Bacteria | 172851 |
| 511 | Ga0157369_10002118 | 3300013105 | Bacteria | 23921 |
| 512 | Ga0157369_10002262 | 3300013105 | Bacteria | 23146 |
| 513 | Ga0157369_10009363 | 3300013105 | Bacteria | 11200 |
| 514 | Ga0157369_10013763 | 3300013105 | Bacteria | 9145 |
| 515 | Ga0157369_10019087 | 3300013105 | Bacteria | 7676 |
| 516 | Ga0157369_10023605 | 3300013105 | Bacteria | 6850 |
| 517 | Ga0157369_10026663 | 3300013105 | Bacteria | 6408 |
| 518 | Ga0157369_10041152 | 3300013105 | Bacteria | 5044 |
| 519 | Ga0157369_10061645 | 3300013105 | Bacteria | 4043 |
| 520 | Ga0157369_10141071 | 3300013105 | Unclassified | 2550 |
| 521 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 522 | Ga0157374_10000348 | 3300013296 | Bacteria | 42744 |
| 523 | Ga0157374_10003727 | 3300013296 | Bacteria | 12805 |
| 524 | Ga0157374_10010061 | 3300013296 | Bacteria | 8119 |
| 525 | Ga0157374_10010541 | 3300013296 | Bacteria | 7955 |
| 526 | Ga0157374_10013448 | 3300013296 | Bacteria | 7142 |
| 527 | Ga0157374_10019587 | 3300013296 | Bacteria | 5990 |
| 528 | Ga0157374_10020034 | 3300013296 | Bacteria | 5930 |
| 529 | Ga0157378_10000859 | 3300013297 | Bacteria | 28140 |
| 530 | Ga0157378_10009983 | 3300013297 | Bacteria | 8279 |
| 531 | Ga0157378_10018192 | 3300013297 | Bacteria | 6170 |
| 532 | Ga0157378_10024509 | 3300013297 | Bacteria | 5310 |
| 533 | Ga0157378_10035235 | 3300013297 | Bacteria | 4426 |
| 534 | Ga0157378_10057795 | 3300013297 | Bacteria | 3458 |
| 535 | Ga0157378_10084952 | 3300013297 | Bacteria | 2867 |
| 536 | Ga0157378_10102551 | 3300013297 | Bacteria | 2613 |
| 537 | Ga0163162_10000031 | 3300013306 | Bacteria | 157666 |
| 538 | Ga0163162_10000037 | 3300013306 | Bacteria | 138420 |
| 539 | Ga0163162_10000244 | 3300013306 | Bacteria | 49260 |
| 540 | Ga0163162_10000952 | 3300013306 | Bacteria | 26875 |
| 541 | Ga0163162_10001265 | 3300013306 | Bacteria | 23633 |
| 542 | Ga0163162_10001894 | 3300013306 | Bacteria | 19706 |
| 543 | Ga0163162_10002681 | 3300013306 | Bacteria | 16870 |
| 544 | Ga0163162_10003934 | 3300013306 | Bacteria | 14252 |
| 545 | Ga0163162_10011449 | 3300013306 | Bacteria | 8650 |
| 546 | Ga0163162_10013001 | 3300013306 | Bacteria | 8123 |
| 547 | Ga0163162_10041760 | 3300013306 | Bacteria | 4589 |
| 548 | Ga0163162_10061943 | 3300013306 | Bacteria | 3780 |
| 549 | Ga0163162_10109520 | 3300013306 | Bacteria | 2859 |
| 550 | Ga0163162_10141494 | 3300013306 | Bacteria | 2520 |
| 551 | Ga0163162_10177711 | 3300013306 | Bacteria | 2254 |
| 552 | Ga0163162_10180543 | 3300013306 | Bacteria | 2237 |
| 553 | Ga0163162_10304066 | 3300013306 | Bacteria | 1727 |
| 554 | Ga0163162_10368026 | 3300013306 | Bacteria | 1570 |
| 555 | Ga0163162_10385396 | 3300013306 | Bacteria | 1535 |
| 556 | Ga0157372_10000001 | 3300013307 | Bacteria | 791349 |
| 557 | Ga0157372_10000707 | 3300013307 | Bacteria | 36672 |
| 558 | Ga0157372_10003090 | 3300013307 | Bacteria | 17926 |
| 559 | Ga0157372_10005652 | 3300013307 | Bacteria | 13296 |
| 560 | Ga0157372_10014060 | 3300013307 | Bacteria | 8549 |
| 561 | Ga0157372_10018492 | 3300013307 | Bacteria | 7492 |
| 562 | Ga0157372_10023207 | 3300013307 | Bacteria | 6723 |
| 563 | Ga0157372_10038494 | 3300013307 | Bacteria | 5278 |
| 564 | Ga0157372_10040958 | 3300013307 | Bacteria | 5120 |
| 565 | Ga0157372_10051481 | 3300013307 | Bacteria | 4583 |
| 566 | Ga0157372_10052820 | 3300013307 | Bacteria | 4527 |
| 567 | Ga0157372_10071932 | 3300013307 | Bacteria | 3896 |
| 568 | Ga0157372_10104350 | 3300013307 | Bacteria | 3240 |
| 569 | Ga0157372_10117099 | 3300013307 | Bacteria | 3055 |
| 570 | Ga0157372_10139872 | 3300013307 | Bacteria | 2788 |
| 571 | Ga0157372_10304866 | 3300013307 | Bacteria | 1853 |
| 572 | Ga0157372_10474873 | 3300013307 | Bacteria | 1458 |
| 573 | Ga0157372_10547311 | 3300013307 | Bacteria | 1349 |
| 574 | Ga0157375_10000182 | 3300013308 | Bacteria | 59120 |
| 575 | Ga0157375_10000722 | 3300013308 | Bacteria | 29134 |
| 576 | Ga0157375_10005427 | 3300013308 | Bacteria | 11084 |
| 577 | Ga0157375_10023572 | 3300013308 | Bacteria | 5680 |
| 578 | Ga0157375_10033488 | 3300013308 | Bacteria | 4883 |
| 579 | Ga0157375_10043772 | 3300013308 | Bacteria | 4344 |
| 580 | Ga0157375_10053361 | 3300013308 | Bacteria | 3977 |
| 581 | Ga0157375_10108003 | 3300013308 | Bacteria | 2877 |
| 582 | Ga0157375_10136084 | 3300013308 | Bacteria | 2581 |
| 583 | Ga0157375_10137542 | 3300013308 | Unclassified | 2568 |
| 584 | Ga0157375_10525828 | 3300013308 | Bacteria | 1346 |
| 585 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 586 | Ga0163163_10000272 | 3300014325 | Bacteria | 51699 |
| 587 | Ga0163163_10000557 | 3300014325 | Bacteria | 32741 |
| 588 | Ga0163163_10005005 | 3300014325 | Bacteria | 11420 |
| 589 | Ga0163163_10069653 | 3300014325 | Bacteria | 3502 |
| 590 | Ga0163163_10106889 | 3300014325 | Bacteria | 2825 |
| 591 | Ga0163163_10193974 | 3300014325 | Bacteria | 2079 |
| 592 | Ga0157380_10000165 | 3300014326 | Bacteria | 38063 |
| 593 | Ga0157380_10005528 | 3300014326 | Bacteria | 8835 |
| 594 | Ga0157380_10089543 | 3300014326 | Bacteria | 2535 |
| 595 | Ga0182008_10000025 | 3300014497 | Bacteria | 191222 |
| 596 | Ga0182008_10000037 | 3300014497 | Bacteria | 129884 |
| 597 | Ga0182008_10000058 | 3300014497 | Bacteria | 100175 |
| 598 | Ga0182008_10000208 | 3300014497 | Bacteria | 46272 |
| 599 | Ga0157377_10006557 | 3300014745 | Bacteria | 5561 |
| 600 | Ga0157377_10012438 | 3300014745 | Bacteria | 4279 |
| 601 | Ga0157377_10081857 | 3300014745 | Unclassified | 1889 |
| 602 | Ga0157379_10000103 | 3300014968 | Bacteria | 58102 |
| 603 | Ga0157379_10018557 | 3300014968 | Bacteria | 6135 |
| 604 | Ga0157379_10019354 | 3300014968 | Bacteria | 6012 |
| 605 | Ga0157379_10082847 | 3300014968 | Bacteria | 2874 |
| 606 | Ga0157379_10115491 | 3300014968 | Bacteria | 2413 |
| 607 | Ga0157376_10000484 | 3300014969 | Bacteria | 25711 |
| 608 | Ga0157376_10002418 | 3300014969 | Bacteria | 12621 |
| 609 | Ga0157376_10003397 | 3300014969 | Bacteria | 10958 |
| 610 | Ga0157376_10005152 | 3300014969 | Bacteria | 9116 |
| 611 | Ga0157376_10045090 | 3300014969 | Bacteria | 3628 |
| 612 | Ga0157376_10162598 | 3300014969 | Bacteria | 2025 |
| 613 | Ga0182006_1000039 | 3300015261 | Bacteria | 211568 |
| 614 | Ga0182006_1000333 | 3300015261 | Bacteria | 40401 |
| 615 | Ga0182006_1000576 | 3300015261 | Bacteria | 27061 |
| 616 | Ga0182006_1002025 | 3300015261 | Bacteria | 11378 |
| 617 | Ga0182006_1003058 | 3300015261 | Bacteria | 8777 |
| 618 | Ga0182006_1003255 | 3300015261 | Bacteria | 8413 |
| 619 | Ga0182006_1007354 | 3300015261 | Bacteria | 5045 |
| 620 | Ga0182006_1008043 | 3300015261 | Bacteria | 4791 |
| 621 | Ga0182007_10000009 | 3300015262 | Bacteria | 316298 |
| 622 | Ga0182007_10037797 | 3300015262 | Bacteria | 1620 |
| 623 | Ga0182005_1000023 | 3300015265 | Bacteria | 246328 |
| 624 | Ga0183373_1008 | 3300015682 | Bacteria | 255339 |
| 625 | Ga0163161_10000007 | 3300017792 | Bacteria | 301614 |
| 626 | Ga0163161_10000343 | 3300017792 | Bacteria | 39534 |
| 627 | Ga0163161_10000628 | 3300017792 | Bacteria | 28142 |
| 628 | Ga0163161_10001101 | 3300017792 | Bacteria | 20390 |
| 629 | Ga0163161_10002195 | 3300017792 | Bacteria | 14086 |
| 630 | Ga0163161_10015712 | 3300017792 | Bacteria | 5279 |
| 631 | Ga0163161_10039788 | 3300017792 | Bacteria | 3377 |
| 632 | Ga0163161_10051457 | 3300017792 | Bacteria | 2983 |
| 633 | Ga0163161_10140016 | 3300017792 | Unclassified | 1831 |
| 634 | Ga0163161_10196122 | 3300017792 | Bacteria | 1554 |
| 635 | Ga0163161_10302341 | 3300017792 | Bacteria | 1260 |
| 636 | Ga0206351_10868731 | 3300020077 | Bacteria | 3041 |
| 637 | Ga0154015_1577688 | 3300020610 | Bacteria | 2133 |
| 638 | Ga0213876_10002723 | 3300021384 | Bacteria | 10296 |
| 639 | Ga0224712_10004532 | 3300022467 | Bacteria | 3757 |
| 640 | Ga0209436_101725 | 3300025208 | Bacteria | 7199 |
| 641 | Ga0207427_100103 | 3300025231 | Bacteria | 119618 |
| 642 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 643 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 644 | Ga0209258_100068 | 3300025242 | Bacteria | 286288 |
| 645 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 646 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 647 | Ga0209646_1010115 | 3300025246 | Bacteria | 1485 |
| 648 | Ga0209026_1000222 | 3300025250 | Bacteria | 77765 |
| 649 | Ga0209026_1000244 | 3300025250 | Bacteria | 69490 |
| 650 | Ga0209026_1001716 | 3300025250 | Bacteria | 9131 |
| 651 | Ga0209026_1003574 | 3300025250 | Bacteria | 5024 |
| 652 | Ga0209148_1000182 | 3300025254 | Bacteria | 123558 |
| 653 | Ga0209129_1000042 | 3300025258 | Bacteria | 305537 |
| 654 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 655 | Ga0209233_1003362 | 3300025261 | Bacteria | 5655 |
| 656 | Ga0209455_1005644 | 3300025272 | Bacteria | 3825 |
| 657 | Ga0209673_1000194 | 3300025273 | Bacteria | 122640 |
| 658 | Ga0209130_1002722 | 3300025284 | Bacteria | 8381 |
| 659 | Ga0209675_1000935 | 3300025291 | Bacteria | 18609 |
| 660 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 661 | Ga0209676_1001085 | 3300025292 | Bacteria | 30593 |
| 662 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 663 | Ga0209564_1003234 | 3300025295 | Bacteria | 11407 |
| 664 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 665 | Ga0209758_1013178 | 3300025297 | Bacteria | 4540 |
| 666 | Ga0209758_1016995 | 3300025297 | Bacteria | 3655 |
| 667 | Ga0209758_1039628 | 3300025297 | Bacteria | 1789 |
| 668 | Ga0209050_1000103 | 3300025298 | Bacteria | 229225 |
| 669 | Ga0209050_1000136 | 3300025298 | Bacteria | 179113 |
| 670 | Ga0209050_1005897 | 3300025298 | Bacteria | 7482 |
| 671 | Ga0209050_1023844 | 3300025298 | Bacteria | 2137 |
| 672 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 673 | Ga0207426_1000341 | 3300025302 | Bacteria | 87735 |
| 674 | Ga0207426_1000455 | 3300025302 | Bacteria | 64858 |
| 675 | Ga0207426_1006168 | 3300025302 | Bacteria | 5273 |
| 676 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 677 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 678 | Ga0209257_1003301 | 3300025304 | Bacteria | 14056 |
| 679 | Ga0207697_10058643 | 3300025315 | Bacteria | 1599 |
| 680 | Ga0207656_10003369 | 3300025321 | Bacteria | 5487 |
| 681 | Ga0207656_10078196 | 3300025321 | Bacteria | 1482 |
| 682 | Ga0207655_1000008 | 3300025728 | Bacteria | 734289 |
| 683 | Ga0207655_1000242 | 3300025728 | Bacteria | 89450 |
| 684 | Ga0207713_1046416 | 3300025735 | Bacteria | 1766 |
| 685 | Ga0207682_10013648 | 3300025893 | Bacteria | 3165 |
| 686 | Ga0207682_10073287 | 3300025893 | Bacteria | 1454 |
| 687 | Ga0207710_10001124 | 3300025900 | Bacteria | 13659 |
| 688 | Ga0207688_10002010 | 3300025901 | Bacteria | 10907 |
| 689 | Ga0207688_10018186 | 3300025901 | Bacteria | 3826 |
| 690 | Ga0207680_10000125 | 3300025903 | Bacteria | 35925 |
| 691 | Ga0207680_10004003 | 3300025903 | Bacteria | 6962 |
| 692 | Ga0207680_10090488 | 3300025903 | Bacteria | 1945 |
| 693 | Ga0207680_10114292 | 3300025903 | Bacteria | 1756 |
| 694 | Ga0207647_10000104 | 3300025904 | Bacteria | 65696 |
| 695 | Ga0207647_10005038 | 3300025904 | Bacteria | 9737 |
| 696 | Ga0207647_10015091 | 3300025904 | Bacteria | 5307 |
| 697 | Ga0207647_10021853 | 3300025904 | Bacteria | 4260 |
| 698 | Ga0207647_10050404 | 3300025904 | Bacteria | 2577 |
| 699 | Ga0207647_10075592 | 3300025904 | Bacteria | 2027 |
| 700 | Ga0207645_10000650 | 3300025907 | Bacteria | 28882 |
| 701 | Ga0207645_10000793 | 3300025907 | Bacteria | 26435 |
| 702 | Ga0207645_10002278 | 3300025907 | Bacteria | 15224 |
| 703 | Ga0207645_10010687 | 3300025907 | Bacteria | 6296 |
| 704 | Ga0207645_10132455 | 3300025907 | Bacteria | 1623 |
| 705 | Ga0207643_10003896 | 3300025908 | Bacteria | 8031 |
| 706 | Ga0207643_10049960 | 3300025908 | Bacteria | 2371 |
| 707 | Ga0207643_10068017 | 3300025908 | Bacteria | 2046 |
| 708 | Ga0207705_10000015 | 3300025909 | Bacteria | 382901 |
| 709 | Ga0207705_10015947 | 3300025909 | Bacteria | 5394 |
| 710 | Ga0207705_10030739 | 3300025909 | Bacteria | 3833 |
| 711 | Ga0207705_10043306 | 3300025909 | Bacteria | 3234 |
| 712 | Ga0207705_10066747 | 3300025909 | Bacteria | 2603 |
| 713 | Ga0207705_10168295 | 3300025909 | Bacteria | 1649 |
| 714 | Ga0207654_10003790 | 3300025911 | Bacteria | 7624 |
| 715 | Ga0207654_10012469 | 3300025911 | Bacteria | 4356 |
| 716 | Ga0207654_10019327 | 3300025911 | Bacteria | 3594 |
| 717 | Ga0207654_10031761 | 3300025911 | Bacteria | 2911 |
| 718 | Ga0207654_10035887 | 3300025911 | Bacteria | 2766 |
| 719 | Ga0207654_10054274 | 3300025911 | Bacteria | 2316 |
| 720 | Ga0207707_10000160 | 3300025912 | Bacteria | 70695 |
| 721 | Ga0207707_10027427 | 3300025912 | Bacteria | 4981 |
| 722 | Ga0207707_10063492 | 3300025912 | Bacteria | 3214 |
| 723 | Ga0207707_10080305 | 3300025912 | Bacteria | 2848 |
| 724 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 725 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 726 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 727 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 728 | Ga0207695_10000081 | 3300025913 | Bacteria | 284797 |
| 729 | Ga0207695_10000092 | 3300025913 | Bacteria | 270514 |
| 730 | Ga0207695_10000156 | 3300025913 | Bacteria | 204576 |
| 731 | Ga0207695_10000550 | 3300025913 | Bacteria | 77346 |
| 732 | Ga0207695_10002404 | 3300025913 | Bacteria | 27705 |
| 733 | Ga0207695_10005846 | 3300025913 | Bacteria | 16163 |
| 734 | Ga0207695_10005995 | 3300025913 | Bacteria | 15895 |
| 735 | Ga0207695_10006542 | 3300025913 | Bacteria | 15089 |
| 736 | Ga0207695_10012058 | 3300025913 | Bacteria | 10392 |
| 737 | Ga0207695_10016372 | 3300025913 | Bacteria | 8678 |
| 738 | Ga0207695_10021656 | 3300025913 | Bacteria | 7328 |
| 739 | Ga0207695_10042663 | 3300025913 | Bacteria | 4841 |
| 740 | Ga0207695_10265002 | 3300025913 | Bacteria | 1615 |
| 741 | Ga0207671_10000257 | 3300025914 | Bacteria | 79555 |
| 742 | Ga0207671_10001789 | 3300025914 | Bacteria | 24075 |
| 743 | Ga0207671_10002116 | 3300025914 | Bacteria | 21680 |
| 744 | Ga0207671_10002707 | 3300025914 | Bacteria | 18581 |
| 745 | Ga0207671_10003054 | 3300025914 | Bacteria | 17141 |
| 746 | Ga0207671_10005700 | 3300025914 | Bacteria | 11378 |
| 747 | Ga0207671_10005976 | 3300025914 | Bacteria | 11017 |
| 748 | Ga0207671_10007245 | 3300025914 | Bacteria | 9660 |
| 749 | Ga0207671_10145754 | 3300025914 | Bacteria | 1826 |
| 750 | Ga0207671_10253396 | 3300025914 | Bacteria | 1384 |
| 751 | Ga0207660_10001905 | 3300025917 | Bacteria | 13897 |
| 752 | Ga0207660_10051818 | 3300025917 | Bacteria | 2919 |
| 753 | Ga0207660_10074562 | 3300025917 | Bacteria | 2477 |
| 754 | Ga0207662_10004278 | 3300025918 | Bacteria | 7493 |
| 755 | Ga0207657_10001653 | 3300025919 | Bacteria | 24053 |
| 756 | Ga0207657_10003392 | 3300025919 | Bacteria | 17025 |
| 757 | Ga0207657_10015945 | 3300025919 | Bacteria | 7259 |
| 758 | Ga0207657_10029952 | 3300025919 | Bacteria | 4946 |
| 759 | Ga0207657_10042107 | 3300025919 | Bacteria | 4032 |
| 760 | Ga0207657_10063853 | 3300025919 | Bacteria | 3146 |
| 761 | Ga0207657_10232459 | 3300025919 | Bacteria | 1474 |
| 762 | Ga0207649_10025366 | 3300025920 | Bacteria | 3455 |
| 763 | Ga0207649_10029127 | 3300025920 | Bacteria | 3258 |
| 764 | Ga0207649_10061177 | 3300025920 | Bacteria | 2369 |
| 765 | Ga0207652_10000029 | 3300025921 | Bacteria | 149054 |
| 766 | Ga0207652_10000115 | 3300025921 | Bacteria | 87927 |
| 767 | Ga0207652_10000406 | 3300025921 | Bacteria | 44756 |
| 768 | Ga0207652_10000961 | 3300025921 | Bacteria | 26939 |
| 769 | Ga0207652_10039601 | 3300025921 | Bacteria | 4000 |
| 770 | Ga0207652_10054962 | 3300025921 | Bacteria | 3423 |
| 771 | Ga0207652_10067110 | 3300025921 | Bacteria | 3110 |
| 772 | Ga0207681_10102685 | 3300025923 | Bacteria | 2065 |
| 773 | Ga0207694_10006715 | 3300025924 | Bacteria | 8744 |
| 774 | Ga0207694_10032448 | 3300025924 | Bacteria | 3998 |
| 775 | Ga0207694_10220231 | 3300025924 | Bacteria | 1548 |
| 776 | Ga0207650_10027506 | 3300025925 | Bacteria | 4072 |
| 777 | Ga0207650_10032513 | 3300025925 | Bacteria | 3773 |
| 778 | Ga0207650_10062568 | 3300025925 | Bacteria | 2781 |
| 779 | Ga0207650_10093737 | 3300025925 | Bacteria | 2299 |
| 780 | Ga0207650_10141491 | 3300025925 | Bacteria | 1892 |
| 781 | Ga0207650_10150022 | 3300025925 | Bacteria | 1839 |
| 782 | Ga0207659_10011402 | 3300025926 | Bacteria | 5614 |
| 783 | Ga0207659_10014561 | 3300025926 | Bacteria | 5078 |
| 784 | Ga0207659_10054617 | 3300025926 | Bacteria | 2853 |
| 785 | Ga0207659_10102119 | 3300025926 | Bacteria | 2164 |
| 786 | Ga0207687_10101975 | 3300025927 | Unclassified | 2113 |
| 787 | Ga0207687_10258044 | 3300025927 | Bacteria | 1388 |
| 788 | Ga0207644_10020232 | 3300025931 | Bacteria | 4523 |
| 789 | Ga0207644_10052439 | 3300025931 | Bacteria | 2931 |
| 790 | Ga0207644_10071229 | 3300025931 | Bacteria | 2543 |
| 791 | Ga0207644_10167003 | 3300025931 | Bacteria | 1715 |
| 792 | Ga0207690_10003150 | 3300025932 | Bacteria | 9903 |
| 793 | Ga0207690_10060376 | 3300025932 | Bacteria | 2573 |
| 794 | Ga0207690_10109253 | 3300025932 | Bacteria | 1989 |
| 795 | Ga0207706_10000191 | 3300025933 | Bacteria | 68535 |
| 796 | Ga0207706_10024864 | 3300025933 | Bacteria | 5368 |
| 797 | Ga0207706_10106618 | 3300025933 | Bacteria | 2466 |
| 798 | Ga0207686_10017976 | 3300025934 | Bacteria | 3995 |
| 799 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 800 | Ga0207709_10000365 | 3300025935 | Bacteria | 45523 |
| 801 | Ga0207670_10005454 | 3300025936 | Bacteria | 6979 |
| 802 | Ga0207670_10091135 | 3300025936 | Bacteria | 2155 |
| 803 | Ga0207670_10106251 | 3300025936 | Bacteria | 2013 |
| 804 | Ga0207669_10088178 | 3300025937 | Bacteria | 2011 |
| 805 | Ga0207704_10000053 | 3300025938 | Bacteria | 79904 |
| 806 | Ga0207704_10104416 | 3300025938 | Bacteria | 1898 |
| 807 | Ga0207704_10150556 | 3300025938 | Bacteria | 1641 |
| 808 | Ga0207691_10000154 | 3300025940 | Bacteria | 64281 |
| 809 | Ga0207691_10005078 | 3300025940 | Bacteria | 12705 |
| 810 | Ga0207691_10030946 | 3300025940 | Bacteria | 4998 |
| 811 | Ga0207691_10059353 | 3300025940 | Bacteria | 3479 |
| 812 | Ga0207691_10079855 | 3300025940 | Bacteria | 2943 |
| 813 | Ga0207691_10083196 | 3300025940 | Bacteria | 2873 |
| 814 | Ga0207691_10188552 | 3300025940 | Bacteria | 1799 |
| 815 | Ga0207711_10025883 | 3300025941 | Bacteria | 4921 |
| 816 | Ga0207711_10049439 | 3300025941 | Bacteria | 3601 |
| 817 | Ga0207689_10000360 | 3300025942 | Bacteria | 42854 |
| 818 | Ga0207689_10001010 | 3300025942 | Bacteria | 27038 |
| 819 | Ga0207689_10006093 | 3300025942 | Bacteria | 10665 |
| 820 | Ga0207689_10006592 | 3300025942 | Bacteria | 10237 |
| 821 | Ga0207689_10011320 | 3300025942 | Bacteria | 7653 |
| 822 | Ga0207689_10011416 | 3300025942 | Bacteria | 7613 |
| 823 | Ga0207689_10012630 | 3300025942 | Bacteria | 7216 |
| 824 | Ga0207689_10041818 | 3300025942 | Bacteria | 3792 |
| 825 | Ga0207689_10094157 | 3300025942 | Bacteria | 2460 |
| 826 | Ga0207689_10171472 | 3300025942 | Bacteria | 1789 |
| 827 | Ga0207689_10190025 | 3300025942 | Bacteria | 1694 |
| 828 | Ga0207661_10002590 | 3300025944 | Bacteria | 12431 |
| 829 | Ga0207661_10018276 | 3300025944 | Bacteria | 5207 |
| 830 | Ga0207661_10022471 | 3300025944 | Bacteria | 4752 |
| 831 | Ga0207661_10314785 | 3300025944 | Bacteria | 1406 |
| 832 | Ga0207679_10001022 | 3300025945 | Bacteria | 17875 |
| 833 | Ga0207679_10006038 | 3300025945 | Bacteria | 7630 |
| 834 | Ga0207679_10006841 | 3300025945 | Bacteria | 7230 |
| 835 | Ga0207679_10026302 | 3300025945 | Bacteria | 4011 |
| 836 | Ga0207667_10000037 | 3300025949 | Bacteria | 297252 |
| 837 | Ga0207667_10001658 | 3300025949 | Bacteria | 28052 |
| 838 | Ga0207667_10002366 | 3300025949 | Bacteria | 23615 |
| 839 | Ga0207667_10005373 | 3300025949 | Bacteria | 15618 |
| 840 | Ga0207667_10009017 | 3300025949 | Bacteria | 11800 |
| 841 | Ga0207667_10009279 | 3300025949 | Bacteria | 11610 |
| 842 | Ga0207667_10037027 | 3300025949 | Bacteria | 5220 |
| 843 | Ga0207667_10043276 | 3300025949 | Bacteria | 4780 |
| 844 | Ga0207667_10054870 | 3300025949 | Bacteria | 4191 |
| 845 | Ga0207667_10057723 | 3300025949 | Bacteria | 4073 |
| 846 | Ga0207667_10080369 | 3300025949 | Bacteria | 3378 |
| 847 | Ga0207667_10092593 | 3300025949 | Bacteria | 3122 |
| 848 | Ga0207667_10126280 | 3300025949 | Bacteria | 2635 |
| 849 | Ga0207667_10168833 | 3300025949 | Bacteria | 2249 |
| 850 | Ga0207651_10003771 | 3300025960 | Bacteria | 7507 |
| 851 | Ga0207651_10008489 | 3300025960 | Bacteria | 5553 |
| 852 | Ga0207651_10017358 | 3300025960 | Bacteria | 4251 |
| 853 | Ga0207651_10065649 | 3300025960 | Bacteria | 2546 |
| 854 | Ga0207712_10001164 | 3300025961 | Bacteria | 18264 |
| 855 | Ga0207712_10001801 | 3300025961 | Bacteria | 14178 |
| 856 | Ga0207712_10011162 | 3300025961 | Bacteria | 5720 |
| 857 | Ga0207712_10025404 | 3300025961 | Bacteria | 3935 |
| 858 | Ga0207712_10032321 | 3300025961 | Bacteria | 3531 |
| 859 | Ga0207712_10050010 | 3300025961 | Bacteria | 2917 |
| 860 | Ga0207712_10202644 | 3300025961 | Bacteria | 1574 |
| 861 | Ga0207668_10001272 | 3300025972 | Bacteria | 15031 |
| 862 | Ga0207668_10043236 | 3300025972 | Bacteria | 3056 |
| 863 | Ga0207668_10181590 | 3300025972 | Bacteria | 1660 |
| 864 | Ga0207640_10025871 | 3300025981 | Bacteria | 3558 |
| 865 | Ga0207640_10091812 | 3300025981 | Bacteria | 2104 |
| 866 | Ga0207658_10020272 | 3300025986 | Bacteria | 4603 |
| 867 | Ga0207658_10035132 | 3300025986 | Bacteria | 3588 |
| 868 | Ga0207658_10057653 | 3300025986 | Bacteria | 2887 |
| 869 | Ga0207677_10001948 | 3300026023 | Bacteria | 10925 |
| 870 | Ga0207677_10010537 | 3300026023 | Bacteria | 5236 |
| 871 | Ga0207677_10067060 | 3300026023 | Bacteria | 2512 |
| 872 | Ga0207677_10071853 | 3300026023 | Bacteria | 2444 |
| 873 | Ga0207677_10202809 | 3300026023 | Bacteria | 1578 |
| 874 | Ga0207703_10001922 | 3300026035 | Bacteria | 18410 |
| 875 | Ga0207703_10026323 | 3300026035 | Bacteria | 4577 |
| 876 | Ga0207703_10173273 | 3300026035 | Unclassified | 1899 |
| 877 | Ga0207639_10001747 | 3300026041 | Bacteria | 14635 |
| 878 | Ga0207639_10006469 | 3300026041 | Bacteria | 7969 |
| 879 | Ga0207639_10018045 | 3300026041 | Bacteria | 5007 |
| 880 | Ga0207639_10020682 | 3300026041 | Bacteria | 4714 |
| 881 | Ga0207639_10049062 | 3300026041 | Bacteria | 3199 |
| 882 | Ga0207639_10056788 | 3300026041 | Bacteria | 3002 |
| 883 | Ga0207639_10080730 | 3300026041 | Bacteria | 2574 |
| 884 | Ga0207639_10235946 | 3300026041 | Bacteria | 1588 |
| 885 | Ga0207678_10094925 | 3300026067 | Bacteria | 2549 |
| 886 | Ga0207702_10000201 | 3300026078 | Bacteria | 70471 |
| 887 | Ga0207702_10024798 | 3300026078 | Bacteria | 4975 |
| 888 | Ga0207702_10029614 | 3300026078 | Bacteria | 4557 |
| 889 | Ga0207702_10076949 | 3300026078 | Bacteria | 2884 |
| 890 | Ga0207641_10000082 | 3300026088 | Bacteria | 138385 |
| 891 | Ga0207641_10003172 | 3300026088 | Bacteria | 14709 |
| 892 | Ga0207641_10009438 | 3300026088 | Bacteria | 8039 |
| 893 | Ga0207641_10015009 | 3300026088 | Bacteria | 6350 |
| 894 | Ga0207641_10021690 | 3300026088 | Bacteria | 5278 |
| 895 | Ga0207641_10082894 | 3300026088 | Bacteria | 2787 |
| 896 | Ga0207641_10197553 | 3300026088 | Bacteria | 1852 |
| 897 | Ga0207648_10000175 | 3300026089 | Bacteria | 66839 |
| 898 | Ga0207648_10001709 | 3300026089 | Bacteria | 24030 |
| 899 | Ga0207648_10002098 | 3300026089 | Bacteria | 21717 |
| 900 | Ga0207648_10015449 | 3300026089 | Bacteria | 7022 |
| 901 | Ga0207648_10019442 | 3300026089 | Bacteria | 6131 |
| 902 | Ga0207648_10026330 | 3300026089 | Bacteria | 5170 |
| 903 | Ga0207648_10049799 | 3300026089 | Bacteria | 3664 |
| 904 | Ga0207648_10059413 | 3300026089 | Bacteria | 3335 |
| 905 | Ga0207648_10064952 | 3300026089 | Bacteria | 3181 |
| 906 | Ga0207648_10109467 | 3300026089 | Bacteria | 2425 |
| 907 | Ga0207648_10129399 | 3300026089 | Bacteria | 2222 |
| 908 | Ga0207676_10007584 | 3300026095 | Bacteria | 7700 |
| 909 | Ga0207676_10007982 | 3300026095 | Bacteria | 7526 |
| 910 | Ga0207676_10014437 | 3300026095 | Bacteria | 5683 |
| 911 | Ga0207676_10042623 | 3300026095 | Bacteria | 3491 |
| 912 | Ga0207676_10050937 | 3300026095 | Bacteria | 3231 |
| 913 | Ga0207674_10003993 | 3300026116 | Bacteria | 17924 |
| 914 | Ga0207674_10005014 | 3300026116 | Bacteria | 15819 |
| 915 | Ga0207674_10005225 | 3300026116 | Bacteria | 15451 |
| 916 | Ga0207674_10024952 | 3300026116 | Bacteria | 6381 |
| 917 | Ga0207674_10069416 | 3300026116 | Bacteria | 3544 |
| 918 | Ga0207674_10090955 | 3300026116 | Bacteria | 3043 |
| 919 | Ga0207674_10134865 | 3300026116 | Bacteria | 2431 |
| 920 | Ga0207674_10170481 | 3300026116 | Bacteria | 2130 |
| 921 | Ga0207674_10260018 | 3300026116 | Bacteria | 1683 |
| 922 | Ga0207675_100005095 | 3300026118 | Bacteria | 12643 |
| 923 | Ga0207675_100025419 | 3300026118 | Bacteria | 5512 |
| 924 | Ga0207675_100039652 | 3300026118 | Bacteria | 4395 |
| 925 | Ga0207675_100199108 | 3300026118 | Unclassified | 1923 |
| 926 | Ga0207675_100218011 | 3300026118 | Bacteria | 1838 |
| 927 | Ga0207675_100258912 | 3300026118 | Unclassified | 1686 |
| 928 | Ga0207675_100262591 | 3300026118 | Bacteria | 1674 |
| 929 | Ga0207683_10000974 | 3300026121 | Bacteria | 26229 |
| 930 | Ga0207683_10007830 | 3300026121 | Bacteria | 9145 |
| 931 | Ga0207683_10041067 | 3300026121 | Bacteria | 4038 |
| 932 | Ga0207683_10080928 | 3300026121 | Bacteria | 2882 |
| 933 | Ga0207683_10187572 | 3300026121 | Bacteria | 1876 |
| 934 | Ga0207698_10001166 | 3300026142 | Bacteria | 15330 |
| 935 | Ga0207698_10004722 | 3300026142 | Bacteria | 8333 |
| 936 | Ga0207698_10009220 | 3300026142 | Bacteria | 6279 |
| 937 | Ga0207698_10073819 | 3300026142 | Bacteria | 2718 |
| 938 | Ga0207698_10132043 | 3300026142 | Bacteria | 2136 |
| 939 | Ga0207698_10174264 | 3300026142 | Bacteria | 1898 |
| 940 | Ga0207698_10181498 | 3300026142 | Unclassified | 1865 |
| 941 | Ga0209281_1000116 | 3300027111 | Bacteria | 209707 |
| 942 | Ga0209489_117024 | 3300027361 | Bacteria | 3533 |
| 943 | Ga0209282_1038144 | 3300027666 | Bacteria | 2882 |
| 944 | Ga0209974_10037550 | 3300027876 | Bacteria | 1608 |
| 945 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 946 | Ga0268266_10000022 | 3300028379 | Bacteria | 508060 |
| 947 | Ga0268266_10005211 | 3300028379 | Bacteria | 12231 |
| 948 | Ga0268266_10005285 | 3300028379 | Bacteria | 12122 |
| 949 | Ga0268265_10007650 | 3300028380 | Bacteria | 7291 |
| 950 | Ga0268265_10102470 | 3300028380 | Bacteria | 2315 |
| 951 | Ga0268265_10160055 | 3300028380 | Bacteria | 1911 |
| 952 | Ga0268264_10000082 | 3300028381 | Bacteria | 246913 |
| 953 | Ga0268264_10005842 | 3300028381 | Bacteria | 10425 |
| 954 | Ga0268264_10005919 | 3300028381 | Bacteria | 10351 |
| 955 | Ga0268264_10006777 | 3300028381 | Bacteria | 9622 |
| 956 | Ga0268264_10011786 | 3300028381 | Bacteria | 7208 |
| 957 | Ga0268264_10013496 | 3300028381 | Bacteria | 6727 |
| 958 | Ga0268264_10059634 | 3300028381 | Bacteria | 3197 |
| 959 | Ga0268264_10377511 | 3300028381 | Bacteria | 1357 |
| 960 | Ga0265334_10008517 | 3300028573 | Bacteria | 4359 |
| 961 | Ga0307517_10002197 | 3300028786 | Bacteria | 31568 |
| 962 | Ga0307517_10006633 | 3300028786 | Bacteria | 17060 |
| 963 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 964 | Ga0307515_10000061 | 3300028794 | Bacteria | 251841 |
| 965 | Ga0307515_10000190 | 3300028794 | Bacteria | 150300 |
| 966 | Ga0307515_10000927 | 3300028794 | Bacteria | 67260 |
| 967 | Ga0307515_10001771 | 3300028794 | Bacteria | 48123 |
| 968 | Ga0307515_10011605 | 3300028794 | Bacteria | 16701 |
| 969 | Ga0307515_10177925 | 3300028794 | Bacteria | 2090 |
| 970 | Ga0265338_10001011 | 3300028800 | Bacteria | 47254 |
| 971 | Ga0265338_10143578 | 3300028800 | Bacteria | 1866 |
| 972 | Ga0265324_10018826 | 3300029957 | Bacteria | 2491 |
| 973 | Ga0307511_10000027 | 3300030521 | Bacteria | 109500 |
| 974 | Ga0316177_1132213 | 3300030731 | Bacteria | 3865 |
| 975 | Ga0316183_1068856 | 3300030742 | Bacteria | 6445 |
| 976 | Ga0265327_10000048 | 3300031251 | Bacteria | 269173 |
| 977 | Ga0265327_10000248 | 3300031251 | Bacteria | 107284 |
| 978 | Ga0265327_10000272 | 3300031251 | Bacteria | 102100 |
| 979 | Ga0265327_10000551 | 3300031251 | Bacteria | 64082 |
| 980 | Ga0265327_10002514 | 3300031251 | Bacteria | 19140 |
| 981 | Ga0265327_10003148 | 3300031251 | Bacteria | 16186 |
| 982 | Ga0265327_10006450 | 3300031251 | Bacteria | 9375 |
| 983 | Ga0265327_10009085 | 3300031251 | Bacteria | 7253 |
| 984 | Ga0265327_10025709 | 3300031251 | Bacteria | 3427 |
| 985 | Ga0265327_10085354 | 3300031251 | Bacteria | 1550 |
| 986 | Ga0265327_10085890 | 3300031251 | Bacteria | 1544 |
| 987 | Ga0307513_10033920 | 3300031456 | Bacteria | 5733 |
| 988 | Ga0307509_10020755 | 3300031507 | Bacteria | 7452 |
| 989 | Ga0307509_10036852 | 3300031507 | Bacteria | 5351 |
| 990 | Ga0307509_10045900 | 3300031507 | Bacteria | 4707 |
| 991 | Ga0307509_10174065 | 3300031507 | Bacteria | 2027 |
| 992 | Ga0307408_100000310 | 3300031548 | Bacteria | 46693 |
| 993 | Ga0307408_100000534 | 3300031548 | Bacteria | 32864 |
| 994 | Ga0307408_100000564 | 3300031548 | Bacteria | 31968 |
| 995 | Ga0307408_100040113 | 3300031548 | Bacteria | 3314 |
| 996 | Ga0307408_100084815 | 3300031548 | Bacteria | 2377 |
| 997 | Ga0265313_10042550 | 3300031595 | Bacteria | 2230 |
| 998 | Ga0307508_10007752 | 3300031616 | Bacteria | 9980 |
| 999 | Ga0316579_10088628 | 3300031691 | Bacteria | 1477 |
| 1000 | Ga0316576_10047393 | 3300031727 | Bacteria | 3114 |
| 1001 | Ga0316578_10044657 | 3300031728 | Bacteria | 2578 |
| 1002 | Ga0316578_10057303 | 3300031728 | Bacteria | 2289 |
| 1003 | Ga0316578_10123818 | 3300031728 | Bacteria | 1555 |
| 1004 | Ga0307516_10000869 | 3300031730 | Bacteria | 41512 |
| 1005 | Ga0307516_10059174 | 3300031730 | Bacteria | 3727 |
| 1006 | Ga0307405_10000002 | 3300031731 | Bacteria | 575196 |
| 1007 | Ga0307405_10000016 | 3300031731 | Bacteria | 197180 |
| 1008 | Ga0307405_10014744 | 3300031731 | Bacteria | 4212 |
| 1009 | Ga0307405_10137656 | 3300031731 | Bacteria | 1697 |
| 1010 | Ga0316577_10114114 | 3300031733 | Bacteria | 1516 |
| 1011 | Ga0307413_10000019 | 3300031824 | Bacteria | 45584 |
| 1012 | Ga0307413_10002415 | 3300031824 | Bacteria | 7587 |
| 1013 | Ga0307410_10000115 | 3300031852 | Bacteria | 28127 |
| 1014 | Ga0307410_10142957 | 3300031852 | Bacteria | 1772 |
| 1015 | Ga0307406_10000111 | 3300031901 | Bacteria | 46791 |
| 1016 | Ga0307407_10000006 | 3300031903 | Bacteria | 218714 |
| 1017 | Ga0307407_10001642 | 3300031903 | Bacteria | 8267 |
| 1018 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 1019 | Ga0307412_10000034 | 3300031911 | Bacteria | 206033 |
| 1020 | Ga0307412_10000154 | 3300031911 | Bacteria | 49488 |
| 1021 | Ga0307412_10003359 | 3300031911 | Bacteria | 8890 |
| 1022 | Ga0307412_10237299 | 3300031911 | Bacteria | 1408 |
| 1023 | Ga0307416_100000030 | 3300032002 | Bacteria | 162430 |
| 1024 | Ga0307416_100000032 | 3300032002 | Bacteria | 156777 |
| 1025 | Ga0307416_100025328 | 3300032002 | Bacteria | 4347 |
| 1026 | Ga0307414_10000001 | 3300032004 | Bacteria | 1352954 |
| 1027 | Ga0307414_10000127 | 3300032004 | Bacteria | 53237 |
| 1028 | Ga0307414_10000392 | 3300032004 | Bacteria | 23857 |
| 1029 | Ga0307414_10001064 | 3300032004 | Bacteria | 14054 |
| 1030 | Ga0307414_10001471 | 3300032004 | Bacteria | 12250 |
| 1031 | Ga0307414_10035636 | 3300032004 | Bacteria | 3313 |
| 1032 | Ga0307414_10055020 | 3300032004 | Bacteria | 2784 |
| 1033 | Ga0307414_10068187 | 3300032004 | Bacteria | 2551 |
| 1034 | Ga0307414_10075521 | 3300032004 | Bacteria | 2446 |
| 1035 | Ga0307414_10129539 | 3300032004 | Bacteria | 1956 |
| 1036 | Ga0307414_10178501 | 3300032004 | Bacteria | 1705 |
| 1037 | Ga0307411_10000013 | 3300032005 | Bacteria | 145335 |
| 1038 | Ga0307411_10071513 | 3300032005 | Bacteria | 2352 |
| 1039 | Ga0307415_100025409 | 3300032126 | Bacteria | 3716 |
| 1040 | Ga0307415_100143214 | 3300032126 | Bacteria | 1829 |
| 1041 | Ga0307507_10000064 | 3300033179 | Bacteria | 161226 |
| 1042 | Ga0307510_10000328 | 3300033180 | Bacteria | 44214 |
| 1043 | Ga0307510_10007920 | 3300033180 | Bacteria | 12650 |
| 1044 | Ga0307510_10023468 | 3300033180 | Bacteria | 7150 |
| 1045 | Ga0373936_0062866 | 3300035113 | Bacteria | 1519 |
| 1046 | Ga0373955_0093023 | 3300035172 | Bacteria | 1721 |
| 1047 | Ga0373955_0106131 | 3300035172 | Bacteria | 1619 |
| 1048 | Ga0373924_0018705 | 3300035410 | Bacteria | 2674 |
| 1049 | Ga0373927_0021777 | 3300035695 | Bacteria | 4201 |
| 1050 | Ga0373937_0010206 | 3300036401 | Bacteria | 8196 |
| 1051 | Ga0373937_0064488 | 3300036401 | Bacteria | 3370 |
| 1052 | Ga0316582_0005102 | 3300036647 | Bacteria | 6721 |
| 1053 | Ga0316584_0026927 | 3300036712 | Bacteria | 4228 |
| 1054 | Ga0316584_0052520 | 3300036712 | Bacteria | 3048 |
| 1055 | Ga0316584_0056089 | 3300036712 | Bacteria | 2950 |
| 1056 | Ga0316584_0246152 | 3300036712 | Bacteria | 1307 |
| 1057 | Ga0395899_0000033 | 3300037312 | Bacteria | 306589 |
| 1058 | Ga0395899_0000411 | 3300037312 | Bacteria | 49949 |
| 1059 | Ga0395899_0000435 | 3300037312 | Bacteria | 47985 |
| 1060 | Ga0395899_0001077 | 3300037312 | Bacteria | 24592 |
| 1061 | Ga0395899_0002144 | 3300037312 | Bacteria | 16228 |
| 1062 | Ga0395899_0031560 | 3300037312 | Bacteria | 3981 |
| 1063 | Ga0395899_0044380 | 3300037312 | Bacteria | 3312 |
| 1064 | Ga0395899_0059981 | 3300037312 | Bacteria | 2803 |
| 1065 | Ga0395900_0001393 | 3300037418 | Bacteria | 28920 |
| 1066 | Ga0395900_0001452 | 3300037418 | Bacteria | 28269 |
| 1067 | Ga0395900_0003225 | 3300037418 | Bacteria | 17664 |
| 1068 | Ga0395900_0005622 | 3300037418 | Bacteria | 13110 |
| 1069 | Ga0395900_0072380 | 3300037418 | Bacteria | 3544 |
| 1070 | Ga0395900_0098786 | 3300037418 | Bacteria | 2999 |
| 1071 | Ga0395900_0101122 | 3300037418 | Bacteria | 2960 |
| 1072 | Ga0395900_0109400 | 3300037418 | Bacteria | 2839 |
| 1073 | Ga0395900_0130510 | 3300037418 | Bacteria | 2575 |
| 1074 | Ga0395898_0013831 | 3300037466 | Bacteria | 8295 |
| 1075 | Ga0395898_0031676 | 3300037466 | Bacteria | 5281 |
| 1076 | Ga0395898_0158125 | 3300037466 | Bacteria | 2167 |
| 1077 | Ga0395905_0000998 | 3300037471 | Bacteria | 36231 |
| 1078 | Ga0395905_0001914 | 3300037471 | Bacteria | 23897 |
| 1079 | Ga0395905_0007067 | 3300037471 | Bacteria | 11222 |
| 1080 | Ga0395905_0034426 | 3300037471 | Bacteria | 4756 |
| 1081 | Ga0395901_0000789 | 3300038443 | Bacteria | 35205 |
| 1082 | Ga0395901_0002351 | 3300038443 | Bacteria | 19230 |
| 1083 | Ga0395901_0014642 | 3300038443 | Bacteria | 7970 |
| 1084 | Ga0395901_0017854 | 3300038443 | Bacteria | 7241 |
| 1085 | Ga0395901_0030985 | 3300038443 | Bacteria | 5513 |
| 1086 | Ga0395901_0091000 | 3300038443 | Bacteria | 3193 |
| 1087 | Ga0395901_0272603 | 3300038443 | Bacteria | 1759 |
| 1088 | Ga0395901_0315933 | 3300038443 | Bacteria | 1617 |
| 1089 | Ga0436365_0079092 | 3300039437 | Bacteria | 37171 |
| 1090 | Ga0436361_0307685 | 3300039447 | Bacteria | 5871 |
| 1091 | Ga0439439_0009748 | 3300041406 | Bacteria | 2290 |
| 1092 | Ga0439447_003769 | 3300041407 | Bacteria | 5325 |
| 1093 | Ga0439466_0015063 | 3300041411 | Bacteria | 2811 |
| 1094 | Ga0451795_0356222 | 3300041456 | Bacteria | 2451 |
| 1095 | Ga0451795_1501558 | 3300041456 | Bacteria | 2101 |
| 1096 | Ga0451807_1155230 | 3300041486 | Bacteria | 1369 |
| 1097 | Ga0451849_1009127 | 3300041505 | Bacteria | 1610 |
| 1098 | Ga0451855_1236631 | 3300041511 | Bacteria | 3919 |
| 1099 | Ga0451855_1803231 | 3300041511 | Bacteria | 1582 |
| 1100 | Ga0439431_0000122 | 3300041997 | Bacteria | 13578 |
| 1101 | Ga0439442_002574 | 3300042002 | Bacteria | 3560 |
| 1102 | Ga0439445_0003161 | 3300042004 | Bacteria | 3689 |
| 1103 | Ga0439448_0004334 | 3300042005 | Bacteria | 4001 |
| 1104 | Ga0439449_0006488 | 3300042007 | Bacteria | 4471 |
| 1105 | Ga0439455_0019582 | 3300042012 | Bacteria | 1597 |
| 1106 | Ga0439457_007860 | 3300042014 | Bacteria | 2539 |
| 1107 | Ga0439457_009122 | 3300042014 | Bacteria | 2317 |
| 1108 | Ga0439462_0001515 | 3300042015 | Bacteria | 5197 |
| 1109 | Ga0450923_001237 | 3300042125 | Bacteria | 3309 |
| 1110 | Ga0450898_002493 | 3300042134 | Bacteria | 2569 |
| 1111 | Ga0451577_0000042 | 3300042876 | Bacteria | 332086 |
| 1112 | Ga0451577_0000418 | 3300042876 | Bacteria | 77022 |
| 1113 | Ga0451577_0005315 | 3300042876 | Bacteria | 13237 |
| 1114 | Ga0451577_0016491 | 3300042876 | Bacteria | 6840 |
| 1115 | Ga0451577_0047761 | 3300042876 | Bacteria | 3826 |
| 1116 | Ga0451577_0066330 | 3300042876 | Bacteria | 3220 |
| 1117 | Ga0451577_0066793 | 3300042876 | Bacteria | 3207 |
| 1118 | Ga0451577_0077739 | 3300042876 | Bacteria | 2959 |
| 1119 | Ga0451577_0098078 | 3300042876 | Bacteria | 2617 |
| 1120 | Ga0451577_0103906 | 3300042876 | Bacteria | 2539 |
| 1121 | Ga0451577_0158178 | 3300042876 | Unclassified | 2040 |
| 1122 | Ga0451577_0302681 | 3300042876 | Bacteria | 1449 |
| 1123 | Ga0466969_0001347 | 3300044656 | Bacteria | 13251 |
| 1124 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 1125 | Ga0466972_0000280 | 3300044658 | Bacteria | 31990 |
| 1126 | Ga0466972_0076144 | 3300044658 | Bacteria | 1598 |
| 1127 | Ga0453683_0000286 | 3300044673 | Bacteria | 65332 |
| 1128 | Ga0453683_0000572 | 3300044673 | Bacteria | 40700 |
| 1129 | Ga0453683_0000680 | 3300044673 | Bacteria | 36070 |
| 1130 | Ga0453683_0008542 | 3300044673 | Bacteria | 6870 |
| 1131 | Ga0453683_0009555 | 3300044673 | Bacteria | 6470 |
| 1132 | Ga0453683_0019047 | 3300044673 | Bacteria | 4400 |
| 1133 | Ga0453683_0040595 | 3300044673 | Bacteria | 2921 |
| 1134 | Ga0453683_0046010 | 3300044673 | Bacteria | 2736 |
| 1135 | Ga0453683_0183173 | 3300044673 | Bacteria | 1328 |
| 1136 | Ga0453684_0000452 | 3300044712 | Bacteria | 165844 |
| 1137 | Ga0453684_0001009 | 3300044712 | Bacteria | 91051 |
| 1138 | Ga0453684_0001431 | 3300044712 | Bacteria | 68233 |
| 1139 | Ga0453684_0001697 | 3300044712 | Bacteria | 59504 |
| 1140 | Ga0453684_0002271 | 3300044712 | Bacteria | 47454 |
| 1141 | Ga0453684_0004934 | 3300044712 | Bacteria | 27202 |
| 1142 | Ga0453684_0005946 | 3300044712 | Bacteria | 23666 |
| 1143 | Ga0453684_0008008 | 3300044712 | Bacteria | 19130 |
| 1144 | Ga0453684_0024385 | 3300044712 | Bacteria | 8842 |
| 1145 | Ga0453684_0025246 | 3300044712 | Bacteria | 8636 |
| 1146 | Ga0453684_0034365 | 3300044712 | Bacteria | 7038 |
| 1147 | Ga0453684_0037166 | 3300044712 | Bacteria | 6689 |
| 1148 | Ga0453684_0040283 | 3300044712 | Bacteria | 6349 |
| 1149 | Ga0453684_0120207 | 3300044712 | Bacteria | 3173 |
| 1150 | Ga0453684_0156804 | 3300044712 | Bacteria | 2698 |
| 1151 | Ga0466971_0014790 | 3300044719 | Bacteria | 3434 |
| 1152 | Ga0466968_0028469 | 3300044735 | Bacteria | 2304 |
| 1153 | Ga0466970_0000495 | 3300044765 | Bacteria | 19372 |
| 1154 | Ga0466957_0001670 | 3300044842 | Bacteria | 11655 |
| 1155 | Ga0466957_0007722 | 3300044842 | Bacteria | 6085 |
| 1156 | Ga0466959_0000004 | 3300045049 | Bacteria | 216815 |
| 1157 | Ga0466959_0000446 | 3300045049 | Bacteria | 24054 |
| 1158 | Ga0466959_0055794 | 3300045049 | Bacteria | 2883 |
| 1159 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 1160 | Ga0451576_0000254 | 3300045051 | Bacteria | 131595 |
| 1161 | Ga0451576_0000589 | 3300045051 | Bacteria | 77022 |
| 1162 | Ga0451576_0001052 | 3300045051 | Bacteria | 50794 |
| 1163 | Ga0451576_0005169 | 3300045051 | Bacteria | 16516 |
| 1164 | Ga0451576_0009640 | 3300045051 | Bacteria | 11174 |
| 1165 | Ga0451576_0044662 | 3300045051 | Bacteria | 4670 |
| 1166 | Ga0451576_0047009 | 3300045051 | Bacteria | 4540 |
| 1167 | Ga0451576_0059430 | 3300045051 | Bacteria | 3990 |
| 1168 | Ga0451576_0072309 | 3300045051 | Bacteria | 3589 |
| 1169 | Ga0451576_0087081 | 3300045051 | Unclassified | 3248 |
| 1170 | Ga0451576_0111131 | 3300045051 | Bacteria | 2851 |
| 1171 | Ga0451576_0152198 | 3300045051 | Bacteria | 2412 |
| 1172 | Ga0466958_0082156 | 3300045836 | Bacteria | 1984 |
| 1173 | Ga0495627_000034 | 3300046453 | Bacteria | 214913 |
| 1174 | Ga0495627_006812 | 3300046453 | Bacteria | 4445 |
| 1175 | Ga0495627_007928 | 3300046453 | Bacteria | 4023 |
| 1176 | Ga0495627_045014 | 3300046453 | Bacteria | 1345 |
| 1177 | Ga0495592_0163888 | 3300046454 | Bacteria | 1527 |
| 1178 | Ga0495590_0005877 | 3300046457 | Bacteria | 4819 |
| 1179 | Ga0495638_0000171 | 3300046460 | Bacteria | 101044 |
| 1180 | Ga0495638_0018471 | 3300046460 | Bacteria | 4630 |
| 1181 | Ga0495651_0045960 | 3300046462 | Bacteria | 3381 |
| 1182 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 1183 | Ga0495650_0021678 | 3300046471 | Bacteria | 3096 |
| 1184 | Ga0495650_0051350 | 3300046471 | Bacteria | 1699 |
| 1185 | Ga0495585_0000079 | 3300046492 | Bacteria | 100159 |
| 1186 | Ga0495585_0000411 | 3300046492 | Bacteria | 41565 |
| 1187 | Ga0495596_0000865 | 3300046500 | Bacteria | 18244 |
| 1188 | Ga0495607_0011024 | 3300046501 | Bacteria | 6038 |
| 1189 | Ga0495606_0000116 | 3300046507 | Bacteria | 134901 |
| 1190 | Ga0495606_0011506 | 3300046507 | Bacteria | 7214 |
| 1191 | Ga0495606_0012165 | 3300046507 | Bacteria | 6938 |
| 1192 | Ga0495606_0014159 | 3300046507 | Bacteria | 6243 |
| 1193 | Ga0495606_0017762 | 3300046507 | Bacteria | 5363 |
| 1194 | Ga0495606_0023782 | 3300046507 | Bacteria | 4431 |
| 1195 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 1196 | Ga0495610_0000992 | 3300046512 | Bacteria | 26173 |
| 1197 | Ga0495610_0001007 | 3300046512 | Bacteria | 25962 |
| 1198 | Ga0495610_0004188 | 3300046512 | Bacteria | 10774 |
| 1199 | Ga0495616_0008226 | 3300046513 | Bacteria | 6192 |
| 1200 | Ga0495616_0043233 | 3300046513 | Bacteria | 2289 |
| 1201 | Ga0495616_0113617 | 3300046513 | Bacteria | 1256 |
| 1202 | Ga0495618_0121596 | 3300046514 | Bacteria | 1672 |
| 1203 | Ga0495628_0009018 | 3300046516 | Bacteria | 8534 |
| 1204 | Ga0495630_0064766 | 3300046517 | Bacteria | 2747 |
| 1205 | Ga0495630_0078966 | 3300046517 | Bacteria | 2482 |
| 1206 | Ga0495632_0023621 | 3300046519 | Bacteria | 3280 |
| 1207 | Ga0495637_0003326 | 3300046520 | Bacteria | 8549 |
| 1208 | Ga0495643_0000506 | 3300046522 | Bacteria | 48801 |
| 1209 | Ga0495643_0003411 | 3300046522 | Bacteria | 11675 |
| 1210 | Ga0495648_0000879 | 3300046524 | Bacteria | 31662 |
| 1211 | Ga0495648_0002877 | 3300046524 | Bacteria | 15501 |
| 1212 | Ga0495663_0000406 | 3300046525 | Bacteria | 15767 |
| 1213 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 1214 | Ga0495665_0104353 | 3300046531 | Bacteria | 1487 |
| 1215 | Ga0495586_0131063 | 3300046535 | Bacteria | 1404 |
| 1216 | Ga0495587_0064905 | 3300046536 | Bacteria | 2133 |
| 1217 | Ga0495609_0000025 | 3300046538 | Bacteria | 256898 |
| 1218 | Ga0495609_0015343 | 3300046538 | Bacteria | 3587 |
| 1219 | Ga0495621_0012524 | 3300046539 | Bacteria | 2645 |
| 1220 | Ga0495622_0014656 | 3300046557 | Bacteria | 3642 |
| 1221 | Ga0495622_0036520 | 3300046557 | Bacteria | 2291 |
| 1222 | Ga0495622_0060076 | 3300046557 | Bacteria | 1760 |
| 1223 | Ga0495633_0000056 | 3300046558 | Bacteria | 149334 |
| 1224 | Ga0495633_0000057 | 3300046558 | Bacteria | 148536 |
| 1225 | Ga0495633_0000344 | 3300046558 | Bacteria | 51775 |
| 1226 | Ga0495668_0000021 | 3300046616 | Bacteria | 381308 |
| 1227 | Ga0495668_0000257 | 3300046616 | Bacteria | 75166 |
| 1228 | Ga0495668_0001099 | 3300046616 | Bacteria | 28007 |
| 1229 | Ga0495668_0004989 | 3300046616 | Bacteria | 9180 |
| 1230 | Ga0495625_0000159 | 3300046660 | Bacteria | 104355 |
| 1231 | Ga0495625_0001186 | 3300046660 | Bacteria | 33408 |
| 1232 | Ga0495625_0002144 | 3300046660 | Bacteria | 21944 |
| 1233 | Ga0495625_0005105 | 3300046660 | Bacteria | 12142 |
| 1234 | Ga0495625_0008186 | 3300046660 | Bacteria | 8953 |
| 1235 | Ga0495625_0019973 | 3300046660 | Bacteria | 5182 |
| 1236 | Ga0495625_0033793 | 3300046660 | Bacteria | 3777 |
| 1237 | Ga0495625_0119956 | 3300046660 | Bacteria | 1790 |
| 1238 | Ga0495635_0137075 | 3300046663 | Bacteria | 1668 |
| 1239 | Ga0495661_0001360 | 3300046665 | Bacteria | 20657 |
| 1240 | Ga0495661_0015325 | 3300046665 | Bacteria | 5118 |
| 1241 | Ga0495658_0025645 | 3300046683 | Bacteria | 3153 |
| 1242 | Ga0495613_0146383 | 3300046689 | Bacteria | 1686 |
| 1243 | Ga0495671_0071739 | 3300046692 | Bacteria | 1701 |
| 1244 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 1245 | Ga0495672_0002547 | 3300047320 | Bacteria | 16619 |
| 1246 | Ga0495672_0024143 | 3300047320 | Bacteria | 3923 |
| 1247 | Ga0495672_0066796 | 3300047320 | Bacteria | 2050 |
| 1248 | Ga0495680_0045059 | 3300047322 | Bacteria | 3485 |
| 1249 | Ga0495687_000179 | 3300047443 | Bacteria | 92387 |
| 1250 | Ga0495687_002135 | 3300047443 | Bacteria | 16518 |
| 1251 | Ga0495687_002367 | 3300047443 | Bacteria | 15256 |
| 1252 | Ga0495675_0107839 | 3300047444 | Bacteria | 1740 |
| 1253 | Ga0495684_0015951 | 3300047471 | Bacteria | 5786 |
| 1254 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 1255 | Ga0495686_0000160 | 3300047472 | Bacteria | 128437 |
| 1256 | Ga0495686_0000234 | 3300047472 | Bacteria | 101539 |
| 1257 | Ga0495686_0000489 | 3300047472 | Bacteria | 58459 |
| 1258 | Ga0495686_0001122 | 3300047472 | Bacteria | 31676 |
| 1259 | Ga0495686_0002126 | 3300047472 | Bacteria | 19394 |
| 1260 | Ga0495686_0012985 | 3300047472 | Bacteria | 5804 |
| 1261 | Ga0495686_0066077 | 3300047472 | Bacteria | 2236 |
| 1262 | Ga0495686_0082255 | 3300047472 | Bacteria | 1965 |
| 1263 | Ga0495686_0117769 | 3300047472 | Bacteria | 1586 |
| 1264 | Ga0495614_0030275 | 3300048089 | Bacteria | 2329 |
| 1265 | Ga0496103_0054877 | 3300048906 | Bacteria | 2470 |
| 1266 | Ga0496104_0376680 | 3300048907 | Bacteria | 1332 |
| 1267 | Ga0496109_0164106 | 3300048912 | Unclassified | 2082 |
| 1268 | Ga0496109_0340329 | 3300048912 | Bacteria | 1417 |
| 1269 | Ga0496110_0086573 | 3300048913 | Bacteria | 2798 |
| 1270 | Ga0496111_0087451 | 3300048914 | Bacteria | 2281 |
| 1271 | Ga0496113_0198306 | 3300048916 | Bacteria | 1595 |
| 1272 | Ga0496114_0000412 | 3300048917 | Bacteria | 31760 |
| 1273 | Ga0496115_0005714 | 3300048918 | Bacteria | 9055 |
| 1274 | Ga0496115_0027455 | 3300048918 | Bacteria | 4452 |
| 1275 | Ga0496115_0088816 | 3300048918 | Bacteria | 2524 |
| 1276 | Ga0496116_0000047 | 3300048919 | Bacteria | 315121 |
| 1277 | Ga0496116_0000266 | 3300048919 | Bacteria | 91468 |
| 1278 | Ga0496116_0034662 | 3300048919 | Bacteria | 3557 |
| 1279 | Ga0496117_0000365 | 3300048920 | Bacteria | 78847 |
| 1280 | Ga0496118_0000672 | 3300048921 | Bacteria | 55573 |
| 1281 | Ga0496118_0052195 | 3300048921 | Bacteria | 3122 |
| 1282 | Ga0496119_0000227 | 3300048922 | Bacteria | 78848 |
| 1283 | Ga0496121_0001581 | 3300048924 | Bacteria | 37894 |
| 1284 | Ga0496121_0010116 | 3300048924 | Bacteria | 10693 |
| 1285 | Ga0496122_0000045 | 3300048925 | Bacteria | 279912 |
| 1286 | Ga0496122_0000277 | 3300048925 | Bacteria | 114200 |
| 1287 | Ga0496122_0000668 | 3300048925 | Bacteria | 69054 |
| 1288 | Ga0496122_0000698 | 3300048925 | Bacteria | 66677 |
| 1289 | Ga0496122_0004620 | 3300048925 | Bacteria | 16941 |
| 1290 | Ga0496122_0024722 | 3300048925 | Bacteria | 5247 |
| 1291 | Ga0496122_0064153 | 3300048925 | Bacteria | 2674 |
| 1292 | Ga0496123_0000728 | 3300048926 | Bacteria | 53516 |
| 1293 | Ga0496123_0018435 | 3300048926 | Bacteria | 5554 |
| 1294 | Ga0496124_0008911 | 3300048927 | Bacteria | 10400 |
| 1295 | Ga0496124_0094661 | 3300048927 | Bacteria | 2429 |
| 1296 | Ga0496125_0000050 | 3300048928 | Bacteria | 286703 |
| 1297 | Ga0496125_0001041 | 3300048928 | Bacteria | 42891 |
| 1298 | Ga0496125_0001313 | 3300048928 | Bacteria | 36792 |
| 1299 | Ga0496126_0002717 | 3300048929 | Bacteria | 23390 |
| 1300 | Ga0496126_0003177 | 3300048929 | Bacteria | 21151 |
| 1301 | Ga0496126_0004416 | 3300048929 | Bacteria | 16838 |
| 1302 | Ga0501298_001720 | 3300049521 | Bacteria | 3239 |
| 1303 | Ga0501299_014295 | 3300049522 | Bacteria | 1379 |
| 1304 | Ga0501032_0003483 | 3300049569 | Bacteria | 12039 |
| 1305 | Ga0501033_0088258 | 3300049570 | Bacteria | 2269 |
| 1306 | Ga0501033_0137637 | 3300049570 | Bacteria | 1767 |
| 1307 | Ga0501034_0012481 | 3300049571 | Bacteria | 8775 |
| 1308 | Ga0501034_0023798 | 3300049571 | Bacteria | 6237 |
| 1309 | Ga0501034_0176353 | 3300049571 | Bacteria | 2103 |
| 1310 | Ga0501036_0001169 | 3300049572 | Bacteria | 19962 |
| 1311 | Ga0501037_0008589 | 3300049573 | Bacteria | 7492 |
| 1312 | Ga0501037_0027220 | 3300049573 | Bacteria | 4223 |
| 1313 | Ga0501038_0025547 | 3300049574 | Bacteria | 5264 |
| 1314 | Ga0501038_0142314 | 3300049574 | Bacteria | 1961 |
| 1315 | Ga0501039_0012075 | 3300049575 | Bacteria | 6586 |
| 1316 | Ga0501039_0066169 | 3300049575 | Bacteria | 2805 |
| 1317 | Ga0501043_0003386 | 3300049579 | Bacteria | 13133 |
| 1318 | Ga0501043_0025390 | 3300049579 | Bacteria | 4649 |
| 1319 | Ga0501043_0035477 | 3300049579 | Bacteria | 3922 |
| 1320 | Ga0501043_0052405 | 3300049579 | Bacteria | 3205 |
| 1321 | Ga0501046_0032815 | 3300049580 | Bacteria | 4201 |
| 1322 | Ga0501046_0032890 | 3300049580 | Bacteria | 4196 |
| 1323 | Ga0501047_0030028 | 3300049581 | Bacteria | 5240 |
| 1324 | Ga0501047_0278566 | 3300049581 | Bacteria | 1517 |
| 1325 | Ga0501067_0006422 | 3300049583 | Bacteria | 6513 |
| 1326 | Ga0501067_0006775 | 3300049583 | Bacteria | 6354 |
| 1327 | Ga0501069_0025041 | 3300049585 | Bacteria | 3259 |
| 1328 | Ga0501070_0050057 | 3300049586 | Bacteria | 3469 |
| 1329 | Ga0501072_0196270 | 3300049588 | Bacteria | 1610 |
| 1330 | Ga0501073_0000839 | 3300049589 | Bacteria | 21859 |
| 1331 | Ga0501073_0082775 | 3300049589 | Bacteria | 2233 |
| 1332 | Ga0501074_0019469 | 3300049590 | Bacteria | 4929 |
| 1333 | Ga0501201_000519 | 3300049651 | Bacteria | 3571 |
| 1334 | Ga0501207_000155 | 3300049654 | Bacteria | 6350 |
| 1335 | Ga0501210_000224 | 3300049657 | Bacteria | 2337 |
| 1336 | Ga0501217_000256 | 3300049661 | Bacteria | 8309 |
| 1337 | Ga0501223_000278 | 3300049663 | Bacteria | 12853 |
| 1338 | Ga0501223_000532 | 3300049663 | Bacteria | 9180 |
| 1339 | Ga0501223_013191 | 3300049663 | Bacteria | 1647 |
| 1340 | Ga0501233_009188 | 3300049668 | Bacteria | 1924 |
| 1341 | Ga0501235_009750 | 3300049669 | Bacteria | 2101 |
| 1342 | Ga0501240_001884 | 3300049673 | Bacteria | 2129 |
| 1343 | Ga0501243_001134 | 3300049675 | Bacteria | 3784 |
| 1344 | Ga0501249_000009 | 3300049679 | Bacteria | 173938 |
| 1345 | Ga0501249_003392 | 3300049679 | Bacteria | 3195 |
| 1346 | Ga0501257_002266 | 3300049686 | Bacteria | 4035 |
| 1347 | Ga0501259_000291 | 3300049688 | Bacteria | 7912 |
| 1348 | Ga0501261_001011 | 3300049690 | Bacteria | 3451 |
| 1349 | Ga0501221_000194 | 3300049704 | Bacteria | 8527 |
| 1350 | Ga0501225_0003187 | 3300049705 | Bacteria | 5012 |
| 1351 | Ga0501245_009025 | 3300049708 | Bacteria | 1427 |
| 1352 | Ga0501079_0036852 | 3300049741 | Bacteria | 3767 |
| 1353 | Ga0501083_0003883 | 3300049744 | Bacteria | 10494 |
| 1354 | Ga0501083_0007152 | 3300049744 | Bacteria | 7922 |
| 1355 | Ga0501241_001025 | 3300049758 | Bacteria | 5911 |
| 1356 | Ga0501241_003468 | 3300049758 | Bacteria | 2977 |
| 1357 | Ga0501241_003584 | 3300049758 | Bacteria | 2930 |
| 1358 | Ga0501241_004068 | 3300049758 | Bacteria | 2751 |
| 1359 | Ga0501266_000005 | 3300049763 | Bacteria | 346750 |
| 1360 | Ga0501280_000686 | 3300049776 | Bacteria | 7481 |
| 1361 | Ga0501035_0010433 | 3300049822 | Bacteria | 8611 |
| 1362 | Ga0501035_0085782 | 3300049822 | Bacteria | 2775 |
| 1363 | Ga0501044_0004241 | 3300049823 | Bacteria | 16092 |
| 1364 | Ga0501044_0121188 | 3300049823 | Bacteria | 2616 |
| 1365 | Ga0501044_0129100 | 3300049823 | Bacteria | 2523 |
| 1366 | Ga0501044_0130494 | 3300049823 | Bacteria | 2507 |
| 1367 | Ga0501044_0175672 | 3300049823 | Bacteria | 2111 |
| 1368 | Ga0501044_0251193 | 3300049823 | Bacteria | 1709 |
| 1369 | Ga0501284_00072 | 3300050005 | Bacteria | 30088 |
| 1370 | nmdc:mga0k408_102378_c1 | 3300050493 | Bacteria | 1689 |
| 1371 | nmdc:mga0k408_16257_c1 | 3300050493 | Bacteria | 4126 |
| 1372 | nmdc:mga0k408_2327_c1 | 3300050493 | Bacteria | 10111 |
| 1373 | nmdc:mga0k408_2685_c2 | 3300050493 | Bacteria | 2779 |
| 1374 | nmdc:mga0k408_27353_c1 | 3300050493 | Bacteria | 3239 |
| 1375 | nmdc:mga0k408_7355_c1 | 3300050493 | Bacteria | 5881 |
| 1376 | nmdc:mga05p37_40325_c1 | 3300050507 | Bacteria | 5733 |
| 1377 | nmdc:mga05p37_91937_c1 | 3300050507 | Bacteria | 3738 |
| 1378 | nmdc:mga09592_174604_c1 | 3300050508 | Bacteria | 1859 |
| 1379 | nmdc:mga09592_66506_c1 | 3300050508 | Bacteria | 3055 |
| 1380 | nmdc:mga0qj67_32376_c1 | 3300050509 | Bacteria | 4077 |
| 1381 | nmdc:mga06r32_4922_c1 | 3300050510 | Bacteria | 12034 |
| 1382 | nmdc:mga06r32_70338_c1 | 3300050510 | Bacteria | 3384 |
| 1383 | nmdc:mga08y16_171069_c1 | 3300050511 | Bacteria | 2256 |
| 1384 | nmdc:mga08y16_54887_c1 | 3300050511 | Bacteria | 4164 |
| 1385 | nmdc:mga08y16_57072_c1 | 3300050511 | Bacteria | 4081 |
| 1386 | nmdc:mga08y16_77453_c1 | 3300050511 | Bacteria | 3467 |
| 1387 | Ga0495612_0047800 | 3300053078 | Bacteria | 1754 |
| 1388 | Ga0500635_0000883 | 3300053080 | Bacteria | 7288 |
| 1389 | Ga0500578_0000010 | 3300053086 | Bacteria | 217642 |
| 1390 | Ga0500578_0155323 | 3300053086 | Bacteria | 1423 |
| 1391 | Ga0500644_0000127 | 3300053088 | Bacteria | 46652 |
| 1392 | Ga0500646_0004247 | 3300053090 | Bacteria | 3630 |
| 1393 | Ga0500583_0000064 | 3300053092 | Bacteria | 66001 |
| 1394 | Ga0500583_0008434 | 3300053092 | Bacteria | 3698 |
| 1395 | Ga0500583_0016023 | 3300053092 | Bacteria | 2982 |
| 1396 | Ga0500583_0023006 | 3300053092 | Bacteria | 2620 |
| 1397 | Ga0500651_0000230 | 3300053093 | Bacteria | 34750 |
| 1398 | Ga0500641_0000027 | 3300053096 | Bacteria | 106908 |
| 1399 | Ga0500641_0000289 | 3300053096 | Bacteria | 18776 |
| 1400 | Ga0500641_0001919 | 3300053096 | Bacteria | 7371 |
| 1401 | Ga0500556_0014297 | 3300053104 | Bacteria | 2421 |
| 1402 | Ga0500562_000053 | 3300053108 | Bacteria | 58984 |
| 1403 | Ga0500607_021068 | 3300053121 | Bacteria | 3676 |
| 1404 | Ga0500608_018150 | 3300053122 | Bacteria | 3207 |
| 1405 | Ga0500618_000003 | 3300053125 | Bacteria | 338706 |
| 1406 | Ga0500559_0098817 | 3300053136 | Bacteria | 1343 |
| 1407 | Ga0500568_0001188 | 3300053139 | Bacteria | 17406 |
| 1408 | Ga0500568_0003322 | 3300053139 | Bacteria | 9060 |
| 1409 | Ga0500577_0002076 | 3300053142 | Bacteria | 5115 |
| 1410 | Ga0500588_0001245 | 3300053146 | Bacteria | 4742 |
| 1411 | Ga0500590_036340 | 3300053148 | Bacteria | 2546 |
| 1412 | Ga0500604_0003342 | 3300053151 | Bacteria | 4314 |
| 1413 | Ga0500616_0000037 | 3300053153 | Bacteria | 390473 |
| 1414 | Ga0500616_0002187 | 3300053153 | Bacteria | 16855 |
| 1415 | Ga0500622_0000141 | 3300053156 | Bacteria | 76332 |
| 1416 | Ga0500622_0000155 | 3300053156 | Bacteria | 72050 |
| 1417 | Ga0500622_0000258 | 3300053156 | Bacteria | 53957 |
| 1418 | Ga0500622_0000481 | 3300053156 | Bacteria | 37439 |
| 1419 | Ga0500622_0004074 | 3300053156 | Bacteria | 9383 |
| 1420 | Ga0500622_0007189 | 3300053156 | Bacteria | 6343 |
| 1421 | Ga0500622_0007499 | 3300053156 | Bacteria | 6192 |
| 1422 | Ga0500622_0084009 | 3300053156 | Bacteria | 1590 |
| 1423 | Ga0500624_000167 | 3300053157 | Bacteria | 26625 |
| 1424 | Ga0500627_0004961 | 3300053158 | Bacteria | 4357 |
| 1425 | Ga0500627_0075512 | 3300053158 | Bacteria | 1498 |
| 1426 | Ga0500634_0024399 | 3300053161 | Bacteria | 3289 |
| 1427 | Ga0500611_000004 | 3300053727 | Bacteria | 253326 |
| 1428 | Ga0500661_004470 | 3300055283 | Bacteria | 2616 |
| 1429 | 2511234604 | 2511231000 | Bacteria | 4488346 |
| 1430 | 2513233497 | 2513020052 | Bacteria | 5120511 |
| 1431 | 2520878823 | 2519899754 | Bacteria | 5336938 |
| 1432 | 2522549498 | 2522125168 | Bacteria | 7376607 |
| 1433 | 2585144550 | 2582581278 | Bacteria | 5296881 |
| 1434 | 2585159122 | 2582581281 | Bacteria | 4487904 |
| 1435 | 2585163410 | 2582581282 | Bacteria | 4495830 |
| 1436 | 2585425261 | 2582581873 | Bacteria | 3032664 |
| 1437 | 2586210423 | 2585427687 | Bacteria | 5544917 |
| 1438 | 2587677211 | 2585428045 | Bacteria | 5203023 |
| 1439 | 2587749732 | 2585428060 | Bacteria | 5304711 |
| 1440 | 2587751805 | 2585428061 | Bacteria | 3939663 |
| 1441 | 2587865767 | 2585428095 | Bacteria | 3789702 |
| 1442 | 2587943928 | 2585428115 | Bacteria | 4420269 |
| 1443 | 2588208744 | 2585428182 | Bacteria | 5007281 |
| 1444 | 2588212546 | 2585428183 | Bacteria | 5166119 |
| 1445 | 2588220121 | 2585428184 | Bacteria | 4978681 |
| 1446 | 2588224917 | 2585428185 | Bacteria | 4969476 |
| 1447 | 2588231805 | 2585428187 | Bacteria | 4629388 |
| 1448 | 2588445873 | 2588253712 | Bacteria | 5403181 |
| 1449 | 2590602170 | 2588254255 | Bacteria | 5014294 |
| 1450 | 2590611466 | 2588254257 | Bacteria | 5436094 |
| 1451 | 2599478631 | 2599185184 | Bacteria | 6430550 |
| 1452 | 2644011466 | 2643221600 | Bacteria | 5530138 |
| 1453 | 2644369868 | 2643221667 | Bacteria | 5627472 |
| 1454 | 2644642290 | 2643221716 | Bacteria | 4986332 |
| 1455 | 2644685259 | 2643221725 | Bacteria | 5087956 |
| 1456 | 2722726235 | 2721755487 | Bacteria | 6357185 |
| 1457 | 2729201888 | 2728369107 | Bacteria | 5082720 |
| 1458 | 2738698530 | 2738541273 | Bacteria | 4048577 |
| 1459 | 2738724679 | 2738541278 | Bacteria | 9755573 |
| 1460 | 2738731945 | 2738541279 | Bacteria | 6149495 |
| 1461 | 2738755878 | 2738541283 | Bacteria | 7222293 |
| 1462 | 2738761462 | 2738541284 | Bacteria | 5199923 |
| 1463 | 2738764510 | 2738541285 | Bacteria | 6150075 |
| 1464 | 2738854136 | 2738541302 | Bacteria | 5944758 |
| 1465 | 2739213525 | 2738543007 | Bacteria | 6149845 |
| 1466 | 2739252856 | 2738543014 | Bacteria | 4048139 |
| 1467 | 2739303027 | 2738543023 | Bacteria | 6767879 |
| 1468 | 2739587620 | 2739367651 | Bacteria | 6359826 |
| 1469 | 2739614667 | 2739367656 | Bacteria | 5152243 |
| 1470 | 2739648076 | 2739367663 | Bacteria | 5040914 |
| 1471 | 2740000790 | 2739367857 | Bacteria | 5433684 |
| 1472 | 2740005606 | 2739367858 | Bacteria | 5432813 |
| 1473 | 2740033893 | 2739367866 | Bacteria | 4215900 |
| 1474 | 2740057089 | 2739367874 | Bacteria | 4872888 |
| 1475 | 2753672117 | 2751185877 | Bacteria | 4921427 |
| 1476 | 2765572118 | 2765235839 | Bacteria | 5314748 |
| 1477 | 2772603924 | 2772190705 | Bacteria | 4666226 |
| 1478 | 2776615907 | 2775506987 | Bacteria | 5373360 |
| 1479 | 2802654174 | 2802428842 | Bacteria | 4926114 |
| 1480 | 2816872329 | 2816332188 | Bacteria | 5133218 |
| 1481 | 2817415801 | 2816332280 | Bacteria | 5109718 |
| 1482 | 2819545527 | 2818991437 | Bacteria | 5805520 |
| 1483 | 2819572472 | 2818991442 | Bacteria | 8318214 |
| 1484 | 2819585917 | 2818991444 | Bacteria | 6968812 |
| 1485 | 2819680535 | 2818991460 | Bacteria | 7595395 |
| 1486 | 2821140143 | 2821136567 | Bacteria | 8080116 |
| 1487 | 2833642258 | 2833640130 | Bacteria | 4858325 |
| 1488 | 2839991375 | 2839989709 | Bacteria | 3773432 |
| 1489 | 2840677666 | 2840677318 | Bacteria | 2664183 |
| 1490 | 2842086517 | 2842083920 | Bacteria | 4857652 |
| 1491 | 2842724593 | 2842722452 | Bacteria | 6263924 |
| 1492 | 2842907174 | 2842903701 | Bacteria | 6986368 |
| 1493 | 2842911913 | 2842909656 | Bacteria | 6185908 |
| 1494 | 2849283552 | 2849281842 | Bacteria | 6065644 |
| 1495 | 2852623540 | 2852623160 | Bacteria | 4376875 |
| 1496 | 2852628109 | 2852627209 | Bacteria | 5896285 |
| 1497 | 2857614539 | 2857613821 | Bacteria | 4917088 |
| 1498 | 2857619078 | 2857618242 | Bacteria | 5635925 |
| 1499 | 2857630511 | 2857627736 | Bacteria | 5625397 |
| 1500 | 2871722952 | 2871720351 | Bacteria | 4862476 |
| 1501 | 2881360446 | 2881359912 | Bacteria | 4935907 |
| 1502 | 2881957556 | 2881955468 | Bacteria | 3545609 |
| 1503 | 2883071180 | 2883068021 | Bacteria | 6192739 |
| 1504 | 2884635190 | 2884634485 | Bacteria | 3928637 |
| 1505 | 2884798041 | 2884791551 | Bacteria | 8511252 |
| 1506 | 2884937559 | 2884933994 | Bacteria | 4535041 |
| 1507 | 2889292410 | 2889290771 | Bacteria | 5530962 |
| 1508 | 2890740744 | 2890737413 | Bacteria | 4269751 |
| 1509 | 2895501672 | 2895498888 | Bacteria | 5283788 |
| 1510 | 2896085484 | 2896085136 | Bacteria | 6129793 |
| 1511 | 2896113688 | 2896109856 | Bacteria | 7140722 |
| 1512 | 2896320786 | 2896317667 | Bacteria | 4606601 |
| 1513 | 2896345355 | 2896344016 | Bacteria | 3811746 |
| 1514 | 2898713935 | 2898713307 | Bacteria | 4110805 |
| 1515 | 2902050710 | 2902048731 | Bacteria | 4976191 |
| 1516 | 2903898590 | 2903895155 | Bacteria | 5258610 |
| 1517 | 2904419827 | 2904419702 | Bacteria | 5166287 |
| 1518 | 2904448022 | 2904445276 | Bacteria | 5310396 |
| 1519 | 2904472265 | 2904467357 | Bacteria | 8057758 |
| 1520 | 2904556616 | 2904555929 | Bacteria | 5218588 |
| 1521 | 2904782842 | 2904780799 | Bacteria | 5840761 |
| 1522 | 2906000612 | 2905999023 | Bacteria | 4591259 |
| 1523 | 2910247849 | 2910245624 | Bacteria | 6935613 |
| 1524 | 2911140313 | 2911138879 | Bacteria | 5811561 |
| 1525 | 2914763111 | 2914759650 | Bacteria | 4701441 |
| 1526 | 2919180453 | 2919177583 | Bacteria | 5641607 |
| 1527 | 2919188473 | 2919186247 | Bacteria | 6244071 |
| 1528 | 2919194059 | 2919191525 | Bacteria | 5765973 |
| 1529 | 2919400618 | 2919399522 | Bacteria | 5164947 |
| 1530 | 2919441315 | 2919437846 | Bacteria | 6199444 |
| 1531 | 2919512599 | 2919509842 | Bacteria | 4104664 |
| 1532 | 2919688422 | 2919683626 | Bacteria | 5534354 |
| 1533 | 2919693353 | 2919692658 | Bacteria | 5943958 |
| 1534 | 2928080311 | 2928078545 | Bacteria | 6534839 |
| 1535 | 2928149514 | 2928147474 | Bacteria | 6512076 |
| 1536 | 2929153045 | 2929150217 | Bacteria | 5462483 |
| 1537 | 2929159320 | 2929154850 | Bacteria | 6753285 |
| 1538 | 2929182829 | 2929177148 | Bacteria | 7883697 |
| 1539 | 2929244971 | 2929239360 | Bacteria | 7745570 |
| 1540 | 2929927224 | 2929921140 | Bacteria | 8649150 |
| 1541 | 2932083345 | 2932082852 | Bacteria | 6563563 |
| 1542 | 2939667442 | 2939664404 | Bacteria | 6364494 |
| 1543 | 2945927621 | 2945924605 | Bacteria | 4296724 |
| 1544 | 2945978784 | 2945977869 | Bacteria | 7777518 |
| 1545 | 2945998547 | 2945997725 | Bacteria | 6404843 |
| 1546 | 2946015351 | 2946013367 | Bacteria | 7766675 |
| 1547 | 2946020766 | 2946019816 | Bacteria | 4621265 |
| 1548 | 2954021014 | 2954016120 | Bacteria | 6446024 |
| 1549 | 2958460899 | 2958458903 | Bacteria | 5301041 |
| 1550 | 2958513425 | 2958512119 | Bacteria | 4528530 |
| 1551 | 2965323712 | 2965320100 | Bacteria | 3975600 |
| 1552 | 2977232886 | 2977232053 | Bacteria | 5485925 |
| 1553 | 2977246618 | 2977243572 | Bacteria | 4374394 |
| 1554 | 2977269710 | 2977268062 | Bacteria | 5243061 |
| 1555 | 2984575556 | 2984572630 | Bacteria | 4186940 |
| 1556 | 2984609009 | 2984606641 | Bacteria | 4186971 |
| 1557 | 2993373950 | 2993372514 | Bacteria | 4214139 |
| 1558 | 2993480851 | 2993480792 | Bacteria | 4022225 |
| 1559 | 3003234846 | 3003233435 | Bacteria | 4458031 |
| 1560 | 8003151102 | 8003151029 | Bacteria | 8187759 |
| 1561 | 8054308225 | 8054307821 | Bacteria | 5212224 |
| 1562 | 8055421477 | 8055419101 | Bacteria | 5289643 |
| 1563 | 8055591254 | 8055588893 | Bacteria | 3619545 |
| 1564 | 8055594050 | 8055592153 | Bacteria | 5961247 |
| 1565 | 8056441415 | 8056440228 | Bacteria | 4946504 |
| 1566 | Ga0453684_0014163 | |||
| 1567 | SwRhRL2b_contig_1663676 | |||
| 1568 | SwRhRL2b_contig_3047449 | |||
| 1569 | JGI24740J21852_10004979 | |||
| 1570 | JGI24740J21852_10006938 | |||
| 1571 | JGI24739J22299_10004155 | |||
| 1572 | JGI24739J22299_10005815 | |||
| 1573 | JGI24737J22298_10002176 | |||
| 1574 | JGI24735J21928_10000002 | |||
| 1575 | JGI24751J29686_10001013 | |||
| 1576 | JGI25162J39368_1000024 | |||
| 1577 | JGI25162J39368_1001318 | |||
| 1578 | JGI25154J39366_1000047 | |||
| 1579 | JGI25158J39367_1004804 | |||
| 1580 | JGI25157J39369_1002465 | |||
| 1581 | JGI25164J39214_1000855 | |||
| 1582 | JGI25152J39213_1000007 | |||
| 1583 | JGI25150J39212_1000013 | |||
| 1584 | JGI25151J46595_10000004 | |||
| 1585 | JGI25406J46586_10007660 | |||
| 1586 | JGI25153J46596_10000004 | |||
| 1587 | JGI25153J46596_10007229 | |||
| 1588 | rootH1_10001629 | |||
| 1589 | rootH1_10073809 | |||
| 1590 | rootH1_10160863 | |||
| 1591 | rootH2_10003246 | |||
| 1592 | rootH2_10005719 | |||
| 1593 | rootH2_10006783 | |||
| 1594 | rootH2_10061691 | |||
| 1595 | rootL2_10006109 | |||
| 1596 | rootL2_10018664 | |||
| 1597 | rootL2_10048389 | |||
| 1598 | rootL2_10058703 | |||
| 1599 | rootL2_10100931 | |||
| 1600 | rootL2_10108093 | |||
| 1601 | rootL2_10338439 | |||
| 1602 | rootH1_10002666 | |||
| 1603 | rootH1_10010261 | |||
| 1604 | rootH1_10010262 | |||
| 1605 | rootH1_10029472 | |||
| 1606 | rootH1_10030425 | |||
| 1607 | rootH1_10063152 | |||
| 1608 | rootH1_10082354 | |||
| 1609 | rootH1_10148113 | |||
| 1610 | rootH1_10230439 | |||
| 1611 | JGI25160J50197_1000981 | |||
| 1612 | JGI25160J50197_1006733 | |||
| 1613 | JGI25160J50197_1009613 | |||
| 1614 | Ga0006562J51391_1012235 | |||
| 1615 | Ga0006562J51391_1026618 | |||
| 1616 | Ga0055535_1001731 | |||
| 1617 | Ga0055542_1004590 | |||
| 1618 | Ga0055526_1008317 | |||
| 1619 | Ga0055536_1000010 | |||
| 1620 | Ga0055536_1001611 | |||
| 1621 | Ga0055528_1000701 | |||
| 1622 | Ga0055530_10000911 | |||
| 1623 | Ga0055530_10002214 | |||
| 1624 | Ga0055531_10000245 | |||
| 1625 | Ga0055531_10000435 | |||
| 1626 | Ga0058863_11371296 | |||
| 1627 | Ga0058862_12893042 | |||
| 1628 | Ga0065165_1000131 | |||
| 1629 | Ga0065165_1000725 | |||
| 1630 | Ga0065165_1001074 | |||
| 1631 | Ga0065714_10003996 | |||
| 1632 | Ga0065714_10007893 | |||
| 1633 | Ga0065714_10064770 | |||
| 1634 | Ga0065714_10067085 | |||
| 1635 | Ga0065714_10068951 | |||
| 1636 | Ga0065714_10081337 | |||
| 1637 | Ga0065704_10070136 | |||
| 1638 | Ga0065704_10070374 | |||
| 1639 | Ga0065704_10070934 | |||
| 1640 | Ga0065704_10071262 | |||
| 1641 | Ga0065704_10073279 | |||
| 1642 | Ga0065704_10074546 | |||
| 1643 | Ga0065704_10082725 | |||
| 1644 | Ga0065704_10084719 | |||
| 1645 | Ga0065704_10095111 | |||
| 1646 | Ga0065704_10098586 | |||
| 1647 | Ga0065712_10001912 | |||
| 1648 | Ga0065712_10099197 | |||
| 1649 | Ga0065715_10005294 | |||
| 1650 | Ga0065715_10088952 | |||
| 1651 | Ga0065715_10133208 | |||
| 1652 | Ga0065715_10165505 | |||
| 1653 | Ga0065707_10175618 | |||
| 1654 | Ga0070658_10000011 | |||
| 1655 | Ga0070658_10000515 | |||
| 1656 | Ga0070658_10008589 | |||
| 1657 | Ga0070658_10115992 | |||
| 1658 | Ga0070658_10134793 | |||
| 1659 | Ga0070658_10224479 | |||
| 1660 | Ga0070658_10278492 | |||
| 1661 | Ga0070676_10000277 | |||
| 1662 | Ga0070676_10002355 | |||
| 1663 | Ga0070676_10094701 | |||
| 1664 | Ga0070683_100002536 | |||
| 1665 | Ga0070683_100003504 | |||
| 1666 | Ga0070683_100004268 | |||
| 1667 | Ga0070683_100006103 | |||
| 1668 | Ga0070683_100010704 | |||
| 1669 | Ga0070683_100075911 | |||
| 1670 | Ga0070690_100010328 | |||
| 1671 | Ga0070690_100022642 | |||
| 1672 | Ga0070670_100015632 | |||
| 1673 | Ga0070670_100032500 | |||
| 1674 | Ga0070670_100038445 | |||
| 1675 | Ga0070670_100081448 | |||
| 1676 | Ga0070670_100188523 | |||
| 1677 | Ga0068869_100000827 | |||
| 1678 | Ga0068869_100005917 | |||
| 1679 | Ga0068869_100007558 | |||
| 1680 | Ga0068869_100032239 | |||
| 1681 | Ga0070666_10000323 | |||
| 1682 | Ga0070666_10001233 | |||
| 1683 | Ga0070666_10151143 | |||
| 1684 | Ga0070666_10199298 | |||
| 1685 | Ga0070680_100010203 | |||
| 1686 | Ga0070680_100024474 | |||
| 1687 | Ga0070680_100070642 | |||
| 1688 | Ga0070680_100088593 | |||
| 1689 | Ga0070680_100138593 | |||
| 1690 | Ga0070680_100250961 | |||
| 1691 | Ga0070682_100000039 | |||
| 1692 | Ga0070682_100000625 | |||
| 1693 | Ga0070682_100009958 | |||
| 1694 | Ga0070682_100026312 | |||
| 1695 | Ga0068868_100004571 | |||
| 1696 | Ga0068868_100009633 | |||
| 1697 | Ga0068868_100035974 | |||
| 1698 | Ga0070660_100001306 | |||
| 1699 | Ga0070660_100002764 | |||
| 1700 | Ga0070660_100015693 | |||
| 1701 | Ga0070660_100130765 | |||
| 1702 | Ga0070689_100010555 | |||
| 1703 | Ga0070689_100028711 | |||
| 1704 | Ga0070689_100080880 | |||
| 1705 | Ga0070689_100299370 | |||
| 1706 | Ga0070691_10000660 | |||
| 1707 | Ga0070691_10020602 | |||
| 1708 | Ga0070687_100001432 | |||
| 1709 | Ga0070687_100069461 | |||
| 1710 | Ga0070661_100002636 | |||
| 1711 | Ga0070661_100010432 | |||
| 1712 | Ga0070661_100011068 | |||
| 1713 | Ga0070668_100004869 | |||
| 1714 | Ga0070668_100014483 | |||
| 1715 | Ga0070668_100023632 | |||
| 1716 | Ga0070668_100041596 | |||
| 1717 | Ga0070669_100057612 | |||
| 1718 | Ga0070669_100078997 | |||
| 1719 | Ga0070669_100174934 | |||
| 1720 | Ga0070669_100254111 | |||
| 1721 | Ga0070675_100003849 | |||
| 1722 | Ga0070675_100016358 | |||
| 1723 | Ga0070675_100036218 | |||
| 1724 | Ga0070675_100059652 | |||
| 1725 | Ga0070671_100019758 | |||
| 1726 | Ga0070671_100030050 | |||
| 1727 | Ga0070671_100061292 | |||
| 1728 | Ga0070671_100111333 | |||
| 1729 | Ga0070671_100124488 | |||
| 1730 | Ga0070673_100002393 | |||
| 1731 | Ga0070673_100003782 | |||
| 1732 | Ga0070673_100004396 | |||
| 1733 | Ga0070673_100012715 | |||
| 1734 | Ga0070673_100018686 | |||
| 1735 | Ga0070673_100149118 | |||
| 1736 | Ga0070688_100012071 | |||
| 1737 | Ga0070688_100026240 | |||
| 1738 | Ga0070659_100002083 | |||
| 1739 | Ga0070659_100003545 | |||
| 1740 | Ga0070659_100010122 | |||
| 1741 | Ga0070659_100018139 | |||
| 1742 | Ga0070667_100005690 | |||
| 1743 | Ga0070667_100068663 | |||
| 1744 | Ga0070667_100244374 | |||
| 1745 | Ga0070678_100004999 | |||
| 1746 | Ga0070678_100006236 | |||
| 1747 | Ga0070678_100018818 | |||
| 1748 | Ga0070678_100151126 | |||
| 1749 | Ga0070662_100000032 | |||
| 1750 | Ga0070662_100022191 | |||
| 1751 | Ga0070662_100030585 | |||
| 1752 | Ga0070662_100056919 | |||
| 1753 | Ga0070662_100059188 | |||
| 1754 | Ga0070662_100086776 | |||
| 1755 | Ga0070681_10017068 | |||
| 1756 | Ga0070681_10018726 | |||
| 1757 | Ga0070681_10034740 | |||
| 1758 | Ga0070681_10036428 | |||
| 1759 | Ga0070681_10064666 | |||
| 1760 | Ga0068867_100009759 | |||
| 1761 | Ga0068867_100010951 | |||
| 1762 | Ga0068867_100023644 | |||
| 1763 | Ga0068867_100033878 | |||
| 1764 | Ga0068867_100059230 | |||
| 1765 | Ga0068867_100163733 | |||
| 1766 | Ga0068867_100276500 | |||
| 1767 | Ga0070685_10048201 | |||
| 1768 | Ga0070685_10072252 | |||
| 1769 | Ga0070685_10117310 | |||
| 1770 | Ga0070698_100002644 | |||
| 1771 | Ga0070698_100016067 | |||
| 1772 | Ga0070679_100025505 | |||
| 1773 | Ga0070679_100030821 | |||
| 1774 | Ga0070679_100042499 | |||
| 1775 | Ga0070679_100042689 | |||
| 1776 | Ga0070679_100066869 | |||
| 1777 | Ga0070679_100111026 | |||
| 1778 | Ga0070684_100000097 | |||
| 1779 | Ga0070684_100011014 | |||
| 1780 | Ga0070684_100027061 | |||
| 1781 | Ga0070684_100036492 | |||
| 1782 | Ga0070684_100056838 | |||
| 1783 | Ga0068853_100004545 | |||
| 1784 | Ga0068853_100008299 | |||
| 1785 | Ga0068853_100008727 | |||
| 1786 | Ga0068853_100028221 | |||
| 1787 | Ga0068853_100057738 | |||
| 1788 | Ga0068853_100082062 | |||
| 1789 | Ga0068853_100105194 | |||
| 1790 | Ga0068853_100234405 | |||
| 1791 | Ga0070672_100000061 | |||
| 1792 | Ga0070672_100017587 | |||
| 1793 | Ga0070672_100050540 | |||
| 1794 | Ga0070686_100023709 | |||
| 1795 | Ga0070686_100048162 | |||
| 1796 | Ga0070693_100006957 | |||
| 1797 | Ga0070693_100117735 | |||
| 1798 | Ga0070665_100000002 | |||
| 1799 | Ga0070665_100000003 | |||
| 1800 | Ga0070665_100005248 | |||
| 1801 | Ga0070665_100008467 | |||
| 1802 | Ga0070665_100049998 | |||
| 1803 | Ga0070665_100311945 | |||
| 1804 | Ga0068855_100000042 | |||
| 1805 | Ga0068855_100000439 | |||
| 1806 | Ga0068855_100000508 | |||
| 1807 | Ga0068855_100011561 | |||
| 1808 | Ga0068855_100027104 | |||
| 1809 | Ga0068855_100032170 | |||
| 1810 | Ga0068855_100039110 | |||
| 1811 | Ga0068855_100048633 | |||
| 1812 | Ga0068855_100062885 | |||
| 1813 | Ga0068855_100066337 | |||
| 1814 | Ga0068855_100116249 | |||
| 1815 | Ga0068855_100152650 | |||
| 1816 | Ga0068855_100253898 | |||
| 1817 | Ga0068855_100282407 | |||
| 1818 | Ga0070664_100002153 | |||
| 1819 | Ga0070664_100003785 | |||
| 1820 | Ga0070664_100004253 | |||
| 1821 | Ga0070664_100022827 | |||
| 1822 | Ga0070664_100052278 | |||
| 1823 | Ga0068857_100001948 | |||
| 1824 | Ga0068857_100010962 | |||
| 1825 | Ga0068857_100025799 | |||
| 1826 | Ga0068857_100125503 | |||
| 1827 | Ga0068857_100137879 | |||
| 1828 | Ga0068857_100222750 | |||
| 1829 | Ga0068854_100007137 | |||
| 1830 | Ga0068854_100020090 | |||
| 1831 | Ga0068854_100054632 | |||
| 1832 | Ga0068856_100000794 | |||
| 1833 | Ga0068856_100024601 | |||
| 1834 | Ga0068856_100040048 | |||
| 1835 | Ga0068856_100113608 | |||
| 1836 | Ga0068856_100223899 | |||
| 1837 | Ga0070702_100051565 | |||
| 1838 | Ga0068852_100002452 | |||
| 1839 | Ga0068852_100010222 | |||
| 1840 | Ga0068852_100016457 | |||
| 1841 | Ga0068852_100024730 | |||
| 1842 | Ga0068852_100047320 | |||
| 1843 | Ga0068852_100080351 | |||
| 1844 | Ga0068859_100000106 | |||
| 1845 | Ga0068859_100007461 | |||
| 1846 | Ga0068859_100008808 | |||
| 1847 | Ga0068859_100080263 | |||
| 1848 | Ga0068859_100136898 | |||
| 1849 | Ga0068859_100305465 | |||
| 1850 | Ga0068864_100003370 | |||
| 1851 | Ga0068864_100011427 | |||
| 1852 | Ga0068864_100043993 | |||
| 1853 | Ga0068864_100111824 | |||
| 1854 | Ga0068861_100013324 | |||
| 1855 | Ga0068861_100034298 | |||
| 1856 | Ga0068861_100160171 | |||
| 1857 | Ga0068861_100268986 | |||
| 1858 | Ga0068851_10000465 | |||
| 1859 | Ga0068851_10047056 | |||
| 1860 | Ga0068851_10075702 | |||
| 1861 | Ga0068870_10028876 | |||
| 1862 | Ga0068870_10088051 | |||
| 1863 | Ga0068863_100001273 | |||
| 1864 | Ga0068863_100006081 | |||
| 1865 | Ga0068863_100011467 | |||
| 1866 | Ga0068863_100032496 | |||
| 1867 | Ga0068863_100048536 | |||
| 1868 | Ga0068863_100076978 | |||
| 1869 | Ga0068863_100177698 | |||
| 1870 | Ga0068863_100238773 | |||
| 1871 | Ga0068863_100302941 | |||
| 1872 | Ga0068858_100000930 | |||
| 1873 | Ga0068858_100006822 | |||
| 1874 | Ga0068858_100016470 | |||
| 1875 | Ga0068858_100149041 | |||
| 1876 | Ga0068860_100000003 | |||
| 1877 | Ga0068860_100003491 | |||
| 1878 | Ga0068860_100009409 | |||
| 1879 | Ga0068860_100011027 | |||
| 1880 | Ga0068860_100026307 | |||
| 1881 | Ga0068862_100006586 | |||
| 1882 | Ga0068862_100076920 | |||
| 1883 | Ga0068862_100142298 | |||
| 1884 | Ga0081540_1040101 | |||
| 1885 | Ga0081539_10001169 | |||
| 1886 | Ga0081539_10029490 | |||
| 1887 | Ga0075366_10001072 | |||
| 1888 | Ga0075366_10007887 | |||
| 1889 | Ga0075366_10009701 | |||
| 1890 | Ga0075366_10021500 | |||
| 1891 | Ga0075366_10021509 | |||
| 1892 | Ga0075366_10106071 | |||
| 1893 | Ga0097621_100000165 | |||
| 1894 | Ga0097621_100000531 | |||
| 1895 | Ga0097621_100006425 | |||
| 1896 | Ga0097621_100016683 | |||
| 1897 | Ga0097621_100068802 | |||
| 1898 | Ga0097621_100070099 | |||
| 1899 | Ga0097621_100109977 | |||
| 1900 | Ga0097621_100156438 | |||
| 1901 | Ga0068871_100000018 | |||
| 1902 | Ga0068871_100000042 | |||
| 1903 | Ga0068871_100001712 | |||
| 1904 | Ga0068871_100002324 | |||
| 1905 | Ga0068871_100002902 | |||
| 1906 | Ga0068871_100007826 | |||
| 1907 | Ga0068871_100012489 | |||
| 1908 | Ga0068871_100039588 | |||
| 1909 | Ga0075428_100004442 | |||
| 1910 | Ga0075428_100010463 | |||
| 1911 | Ga0075428_100011907 | |||
| 1912 | Ga0075430_100004975 | |||
| 1913 | Ga0075431_100026391 | |||
| 1914 | Ga0075429_100030837 | |||
| 1915 | Ga0075429_100071292 | |||
| 1916 | Ga0068865_100000396 | |||
| 1917 | Ga0068865_100001997 | |||
| 1918 | Ga0068865_100051065 | |||
| 1919 | Ga0097620_100000106 | |||
| 1920 | Ga0097620_100007461 | |||
| 1921 | Ga0097620_100008808 | |||
| 1922 | Ga0097620_100080264 | |||
| 1923 | Ga0097620_100136895 | |||
| 1924 | Ga0097620_100305481 | |||
| 1925 | Ga0099824_1002886 | |||
| 1926 | Ga0079104_1000179 | |||
| 1927 | Ga0099826_10037265 | |||
| 1928 | Ga0105251_10043569 | |||
| 1929 | Ga0105244_10000004 | |||
| 1930 | Ga0105244_10000011 | |||
| 1931 | Ga0105240_10000037 | |||
| 1932 | Ga0105240_10000237 | |||
| 1933 | Ga0105240_10000367 | |||
| 1934 | Ga0105240_10000487 | |||
| 1935 | Ga0105240_10005515 | |||
| 1936 | Ga0105240_10022011 | |||
| 1937 | Ga0105240_10039540 | |||
| 1938 | Ga0105240_10042495 | |||
| 1939 | Ga0105240_10043261 | |||
| 1940 | Ga0105240_10069454 | |||
| 1941 | Ga0105240_10104541 | |||
| 1942 | Ga0105240_10113999 | |||
| 1943 | Ga0105240_10181056 | |||
| 1944 | Ga0105240_10245699 | |||
| 1945 | Ga0111539_10014918 | |||
| 1946 | Ga0111539_10017967 | |||
| 1947 | Ga0111539_10066976 | |||
| 1948 | Ga0111539_10162149 | |||
| 1949 | Ga0105245_10173353 | |||
| 1950 | Ga0105247_10000918 | |||
| 1951 | Ga0105247_10011475 | |||
| 1952 | Ga0105247_10037908 | |||
| 1953 | Ga0114129_10012446 | |||
| 1954 | Ga0114129_10052518 | |||
| 1955 | Ga0105243_10000009 | |||
| 1956 | Ga0105243_10000145 | |||
| 1957 | Ga0105243_10172389 | |||
| 1958 | Ga0105241_10001462 | |||
| 1959 | Ga0105241_10002922 | |||
| 1960 | Ga0105241_10003042 | |||
| 1961 | Ga0105241_10005760 | |||
| 1962 | Ga0105241_10007004 | |||
| 1963 | Ga0105241_10030640 | |||
| 1964 | Ga0105241_10084882 | |||
| 1965 | Ga0105241_10114505 | |||
| 1966 | Ga0105242_10006535 | |||
| 1967 | Ga0105242_10036683 | |||
| 1968 | Ga0105242_10086686 | |||
| 1969 | Ga0105242_10121133 | |||
| 1970 | Ga0105248_10004482 | |||
| 1971 | Ga0105248_10032533 | |||
| 1972 | Ga0105248_10256759 | |||
| 1973 | Ga0105237_10000224 | |||
| 1974 | Ga0105237_10000729 | |||
| 1975 | Ga0105237_10000952 | |||
| 1976 | Ga0105237_10000963 | |||
| 1977 | Ga0105237_10001948 | |||
| 1978 | Ga0105237_10002321 | |||
| 1979 | Ga0105237_10003093 | |||
| 1980 | Ga0105237_10004043 | |||
| 1981 | Ga0105237_10008222 | |||
| 1982 | Ga0105237_10009903 | |||
| 1983 | Ga0105237_10019011 | |||
| 1984 | Ga0105237_10021687 | |||
| 1985 | Ga0105237_10033447 | |||
| 1986 | Ga0105237_10040318 | |||
| 1987 | Ga0105237_10179810 | |||
| 1988 | Ga0105237_10192111 | |||
| 1989 | Ga0105237_10217300 | |||
| 1990 | Ga0105237_10297085 | |||
| 1991 | Ga0105238_10004274 | |||
| 1992 | Ga0105238_10013318 | |||
| 1993 | Ga0105238_10037769 | |||
| 1994 | Ga0105238_10203974 | |||
| 1995 | Ga0105238_10279964 | |||
| 1996 | Ga0105249_10001226 | |||
| 1997 | Ga0105249_10002137 | |||
| 1998 | Ga0105249_10019422 | |||
| 1999 | Ga0105249_10021227 | |||
| 2000 | Ga0105249_10024010 | |||
| 2001 | Ga0105249_10035542 | |||
| 2002 | Ga0105249_10115485 | |||
| 2003 | Ga0105249_10180744 | |||
| 2004 | Ga0105249_10198919 | |||
| 2005 | Ga0105249_10315500 | |||
| 2006 | Ga0105239_10000002 | |||
| 2007 | Ga0105239_10000013 | |||
| 2008 | Ga0105239_10000283 | |||
| 2009 | Ga0105239_10001207 | |||
| 2010 | Ga0105239_10001438 | |||
| 2011 | Ga0105239_10003665 | |||
| 2012 | Ga0105239_10006888 | |||
| 2013 | Ga0105239_10024908 | |||
| 2014 | Ga0105239_10025175 | |||
| 2015 | Ga0105239_10061828 | |||
| 2016 | Ga0105239_10123544 | |||
| 2017 | Ga0105239_10150086 | |||
| 2018 | Ga0105239_10258859 | |||
| 2019 | Ga0105239_10291504 | |||
| 2020 | Ga0105239_10383807 | |||
| 2021 | Ga0157373_10000002 | |||
| 2022 | Ga0157373_10000005 | |||
| 2023 | Ga0157373_10000256 | |||
| 2024 | Ga0157373_10000936 | |||
| 2025 | Ga0157373_10001318 | |||
| 2026 | Ga0157373_10002482 | |||
| 2027 | Ga0157373_10003984 | |||
| 2028 | Ga0157373_10024469 | |||
| 2029 | Ga0157373_10025270 | |||
| 2030 | Ga0157373_10031635 | |||
| 2031 | Ga0157373_10032956 | |||
| 2032 | Ga0157373_10033565 | |||
| 2033 | Ga0157373_10087296 | |||
| 2034 | Ga0157373_10087541 | |||
| 2035 | Ga0157373_10219732 | |||
| 2036 | Ga0157371_10000046 | |||
| 2037 | Ga0157371_10000079 | |||
| 2038 | Ga0157371_10000216 | |||
| 2039 | Ga0157371_10000741 | |||
| 2040 | Ga0157371_10001331 | |||
| 2041 | Ga0157371_10002552 | |||
| 2042 | Ga0157371_10003861 | |||
| 2043 | Ga0157371_10011763 | |||
| 2044 | Ga0157371_10015344 | |||
| 2045 | Ga0157371_10017592 | |||
| 2046 | Ga0157371_10017639 | |||
| 2047 | Ga0157371_10018024 | |||
| 2048 | Ga0157371_10027826 | |||
| 2049 | Ga0157371_10040330 | |||
| 2050 | Ga0157371_10104115 | |||
| 2051 | Ga0157370_10001014 | |||
| 2052 | Ga0157370_10002361 | |||
| 2053 | Ga0157370_10003143 | |||
| 2054 | Ga0157370_10003236 | |||
| 2055 | Ga0157370_10003785 | |||
| 2056 | Ga0157370_10007303 | |||
| 2057 | Ga0157370_10017885 | |||
| 2058 | Ga0157370_10018487 | |||
| 2059 | Ga0157370_10020395 | |||
| 2060 | Ga0157370_10020909 | |||
| 2061 | Ga0157370_10022590 | |||
| 2062 | Ga0157370_10023049 | |||
| 2063 | Ga0157370_10030370 | |||
| 2064 | Ga0157370_10052885 | |||
| 2065 | Ga0157370_10074178 | |||
| 2066 | Ga0157370_10117145 | |||
| 2067 | Ga0157370_10120995 | |||
| 2068 | Ga0157370_10121149 | |||
| 2069 | Ga0157370_10179980 | |||
| 2070 | Ga0157370_10196518 | |||
| 2071 | Ga0157370_10208645 | |||
| 2072 | Ga0157370_10274035 | |||
| 2073 | Ga0157370_10277171 | |||
| 2074 | Ga0157369_10000046 | |||
| 2075 | Ga0157369_10002118 | |||
| 2076 | Ga0157369_10002262 | |||
| 2077 | Ga0157369_10009363 | |||
| 2078 | Ga0157369_10013763 | |||
| 2079 | Ga0157369_10019087 | |||
| 2080 | Ga0157369_10023605 | |||
| 2081 | Ga0157369_10026663 | |||
| 2082 | Ga0157369_10041152 | |||
| 2083 | Ga0157369_10061645 | |||
| 2084 | Ga0157369_10141071 | |||
| 2085 | Ga0157374_10000013 | |||
| 2086 | Ga0157374_10000348 | |||
| 2087 | Ga0157374_10003727 | |||
| 2088 | Ga0157374_10010061 | |||
| 2089 | Ga0157374_10010541 | |||
| 2090 | Ga0157374_10013448 | |||
| 2091 | Ga0157374_10019587 | |||
| 2092 | Ga0157374_10020034 | |||
| 2093 | Ga0157378_10000859 | |||
| 2094 | Ga0157378_10009983 | |||
| 2095 | Ga0157378_10018192 | |||
| 2096 | Ga0157378_10024509 | |||
| 2097 | Ga0157378_10035235 | |||
| 2098 | Ga0157378_10057795 | |||
| 2099 | Ga0157378_10084952 | |||
| 2100 | Ga0157378_10102551 | |||
| 2101 | Ga0163162_10000031 | |||
| 2102 | Ga0163162_10000037 | |||
| 2103 | Ga0163162_10000244 | |||
| 2104 | Ga0163162_10000952 | |||
| 2105 | Ga0163162_10001265 | |||
| 2106 | Ga0163162_10001894 | |||
| 2107 | Ga0163162_10002681 | |||
| 2108 | Ga0163162_10003934 | |||
| 2109 | Ga0163162_10011449 | |||
| 2110 | Ga0163162_10013001 | |||
| 2111 | Ga0163162_10041760 | |||
| 2112 | Ga0163162_10061943 | |||
| 2113 | Ga0163162_10109520 | |||
| 2114 | Ga0163162_10141494 | |||
| 2115 | Ga0163162_10177711 | |||
| 2116 | Ga0163162_10180543 | |||
| 2117 | Ga0163162_10304066 | |||
| 2118 | Ga0163162_10368026 | |||
| 2119 | Ga0163162_10385396 | |||
| 2120 | Ga0157372_10000001 | |||
| 2121 | Ga0157372_10000707 | |||
| 2122 | Ga0157372_10003090 | |||
| 2123 | Ga0157372_10005652 | |||
| 2124 | Ga0157372_10014060 | |||
| 2125 | Ga0157372_10018492 | |||
| 2126 | Ga0157372_10023207 | |||
| 2127 | Ga0157372_10038494 | |||
| 2128 | Ga0157372_10040958 | |||
| 2129 | Ga0157372_10051481 | |||
| 2130 | Ga0157372_10052820 | |||
| 2131 | Ga0157372_10071932 | |||
| 2132 | Ga0157372_10104350 | |||
| 2133 | Ga0157372_10117099 | |||
| 2134 | Ga0157372_10139872 | |||
| 2135 | Ga0157372_10304866 | |||
| 2136 | Ga0157372_10474873 | |||
| 2137 | Ga0157372_10547311 | |||
| 2138 | Ga0157375_10000182 | |||
| 2139 | Ga0157375_10000722 | |||
| 2140 | Ga0157375_10005427 | |||
| 2141 | Ga0157375_10023572 | |||
| 2142 | Ga0157375_10033488 | |||
| 2143 | Ga0157375_10043772 | |||
| 2144 | Ga0157375_10053361 | |||
| 2145 | Ga0157375_10108003 | |||
| 2146 | Ga0157375_10136084 | |||
| 2147 | Ga0157375_10137542 | |||
| 2148 | Ga0157375_10525828 | |||
| 2149 | Ga0163163_10000088 | |||
| 2150 | Ga0163163_10000272 | |||
| 2151 | Ga0163163_10000557 | |||
| 2152 | Ga0163163_10005005 | |||
| 2153 | Ga0163163_10069653 | |||
| 2154 | Ga0163163_10106889 | |||
| 2155 | Ga0163163_10193974 | |||
| 2156 | Ga0157380_10000165 | |||
| 2157 | Ga0157380_10005528 | |||
| 2158 | Ga0157380_10089543 | |||
| 2159 | Ga0182008_10000025 | |||
| 2160 | Ga0182008_10000037 | |||
| 2161 | Ga0182008_10000058 | |||
| 2162 | Ga0182008_10000208 | |||
| 2163 | Ga0157377_10006557 | |||
| 2164 | Ga0157377_10012438 | |||
| 2165 | Ga0157377_10081857 | |||
| 2166 | Ga0157379_10000103 | |||
| 2167 | Ga0157379_10018557 | |||
| 2168 | Ga0157379_10019354 | |||
| 2169 | Ga0157379_10082847 | |||
| 2170 | Ga0157379_10115491 | |||
| 2171 | Ga0157376_10000484 | |||
| 2172 | Ga0157376_10002418 | |||
| 2173 | Ga0157376_10003397 | |||
| 2174 | Ga0157376_10005152 | |||
| 2175 | Ga0157376_10045090 | |||
| 2176 | Ga0157376_10162598 | |||
| 2177 | Ga0182006_1000039 | |||
| 2178 | Ga0182006_1000333 | |||
| 2179 | Ga0182006_1000576 | |||
| 2180 | Ga0182006_1002025 | |||
| 2181 | Ga0182006_1003058 | |||
| 2182 | Ga0182006_1003255 | |||
| 2183 | Ga0182006_1007354 | |||
| 2184 | Ga0182006_1008043 | |||
| 2185 | Ga0182007_10000009 | |||
| 2186 | Ga0182007_10037797 | |||
| 2187 | Ga0182005_1000023 | |||
| 2188 | Ga0183373_1008 | |||
| 2189 | Ga0163161_10000007 | |||
| 2190 | Ga0163161_10000343 | |||
| 2191 | Ga0163161_10000628 | |||
| 2192 | Ga0163161_10001101 | |||
| 2193 | Ga0163161_10002195 | |||
| 2194 | Ga0163161_10015712 | |||
| 2195 | Ga0163161_10039788 | |||
| 2196 | Ga0163161_10051457 | |||
| 2197 | Ga0163161_10140016 | |||
| 2198 | Ga0163161_10196122 | |||
| 2199 | Ga0163161_10302341 | |||
| 2200 | Ga0206351_10868731 | |||
| 2201 | Ga0154015_1577688 | |||
| 2202 | Ga0213876_10002723 | |||
| 2203 | Ga0224712_10004532 | |||
| 2204 | Ga0209436_101725 | |||
| 2205 | Ga0207427_100103 | |||
| 2206 | Ga0209437_100017 | |||
| 2207 | Ga0209437_100101 | |||
| 2208 | Ga0209258_100068 | |||
| 2209 | Ga0207425_1000008 | |||
| 2210 | Ga0209646_1000003 | |||
| 2211 | Ga0209646_1010115 | |||
| 2212 | Ga0209026_1000222 | |||
| 2213 | Ga0209026_1000244 | |||
| 2214 | Ga0209026_1001716 | |||
| 2215 | Ga0209026_1003574 | |||
| 2216 | Ga0209148_1000182 | |||
| 2217 | Ga0209129_1000042 | |||
| 2218 | Ga0209233_1000124 | |||
| 2219 | Ga0209233_1003362 | |||
| 2220 | Ga0209455_1005644 | |||
| 2221 | Ga0209673_1000194 | |||
| 2222 | Ga0209130_1002722 | |||
| 2223 | Ga0209675_1000935 | |||
| 2224 | Ga0209676_1000009 | |||
| 2225 | Ga0209676_1001085 | |||
| 2226 | Ga0209025_1000020 | |||
| 2227 | Ga0209564_1003234 | |||
| 2228 | Ga0209758_1000022 | |||
| 2229 | Ga0209758_1013178 | |||
| 2230 | Ga0209758_1016995 | |||
| 2231 | Ga0209758_1039628 | |||
| 2232 | Ga0209050_1000103 | |||
| 2233 | Ga0209050_1000136 | |||
| 2234 | Ga0209050_1005897 | |||
| 2235 | Ga0209050_1023844 | |||
| 2236 | Ga0207426_1000026 | |||
| 2237 | Ga0207426_1000341 | |||
| 2238 | Ga0207426_1000455 | |||
| 2239 | Ga0207426_1006168 | |||
| 2240 | Ga0209257_1000005 | |||
| 2241 | Ga0209257_1000025 | |||
| 2242 | Ga0209257_1003301 | |||
| 2243 | Ga0207697_10058643 | |||
| 2244 | Ga0207656_10003369 | |||
| 2245 | Ga0207656_10078196 | |||
| 2246 | Ga0207655_1000008 | |||
| 2247 | Ga0207655_1000242 | |||
| 2248 | Ga0207713_1046416 | |||
| 2249 | Ga0207682_10013648 | |||
| 2250 | Ga0207682_10073287 | |||
| 2251 | Ga0207710_10001124 | |||
| 2252 | Ga0207688_10002010 | |||
| 2253 | Ga0207688_10018186 | |||
| 2254 | Ga0207680_10000125 | |||
| 2255 | Ga0207680_10004003 | |||
| 2256 | Ga0207680_10090488 | |||
| 2257 | Ga0207680_10114292 | |||
| 2258 | Ga0207647_10000104 | |||
| 2259 | Ga0207647_10005038 | |||
| 2260 | Ga0207647_10015091 | |||
| 2261 | Ga0207647_10021853 | |||
| 2262 | Ga0207647_10050404 | |||
| 2263 | Ga0207647_10075592 | |||
| 2264 | Ga0207645_10000650 | |||
| 2265 | Ga0207645_10000793 | |||
| 2266 | Ga0207645_10002278 | |||
| 2267 | Ga0207645_10010687 | |||
| 2268 | Ga0207645_10132455 | |||
| 2269 | Ga0207643_10003896 | |||
| 2270 | Ga0207643_10049960 | |||
| 2271 | Ga0207643_10068017 | |||
| 2272 | Ga0207705_10000015 | |||
| 2273 | Ga0207705_10015947 | |||
| 2274 | Ga0207705_10030739 | |||
| 2275 | Ga0207705_10043306 | |||
| 2276 | Ga0207705_10066747 | |||
| 2277 | Ga0207705_10168295 | |||
| 2278 | Ga0207654_10003790 | |||
| 2279 | Ga0207654_10012469 | |||
| 2280 | Ga0207654_10019327 | |||
| 2281 | Ga0207654_10031761 | |||
| 2282 | Ga0207654_10035887 | |||
| 2283 | Ga0207654_10054274 | |||
| 2284 | Ga0207707_10000160 | |||
| 2285 | Ga0207707_10027427 | |||
| 2286 | Ga0207707_10063492 | |||
| 2287 | Ga0207707_10080305 | |||
| 2288 | Ga0207695_10000013 | |||
| 2289 | Ga0207695_10000051 | |||
| 2290 | Ga0207695_10000056 | |||
| 2291 | Ga0207695_10000066 | |||
| 2292 | Ga0207695_10000081 | |||
| 2293 | Ga0207695_10000092 | |||
| 2294 | Ga0207695_10000156 | |||
| 2295 | Ga0207695_10000550 | |||
| 2296 | Ga0207695_10002404 | |||
| 2297 | Ga0207695_10005846 | |||
| 2298 | Ga0207695_10005995 | |||
| 2299 | Ga0207695_10006542 | |||
| 2300 | Ga0207695_10012058 | |||
| 2301 | Ga0207695_10016372 | |||
| 2302 | Ga0207695_10021656 | |||
| 2303 | Ga0207695_10042663 | |||
| 2304 | Ga0207695_10265002 | |||
| 2305 | Ga0207671_10000257 | |||
| 2306 | Ga0207671_10001789 | |||
| 2307 | Ga0207671_10002116 | |||
| 2308 | Ga0207671_10002707 | |||
| 2309 | Ga0207671_10003054 | |||
| 2310 | Ga0207671_10005700 | |||
| 2311 | Ga0207671_10005976 | |||
| 2312 | Ga0207671_10007245 | |||
| 2313 | Ga0207671_10145754 | |||
| 2314 | Ga0207671_10253396 | |||
| 2315 | Ga0207660_10001905 | |||
| 2316 | Ga0207660_10051818 | |||
| 2317 | Ga0207660_10074562 | |||
| 2318 | Ga0207662_10004278 | |||
| 2319 | Ga0207657_10001653 | |||
| 2320 | Ga0207657_10003392 | |||
| 2321 | Ga0207657_10015945 | |||
| 2322 | Ga0207657_10029952 | |||
| 2323 | Ga0207657_10042107 | |||
| 2324 | Ga0207657_10063853 | |||
| 2325 | Ga0207657_10232459 | |||
| 2326 | Ga0207649_10025366 | |||
| 2327 | Ga0207649_10029127 | |||
| 2328 | Ga0207649_10061177 | |||
| 2329 | Ga0207652_10000029 | |||
| 2330 | Ga0207652_10000115 | |||
| 2331 | Ga0207652_10000406 | |||
| 2332 | Ga0207652_10000961 | |||
| 2333 | Ga0207652_10039601 | |||
| 2334 | Ga0207652_10054962 | |||
| 2335 | Ga0207652_10067110 | |||
| 2336 | Ga0207681_10102685 | |||
| 2337 | Ga0207694_10006715 | |||
| 2338 | Ga0207694_10032448 | |||
| 2339 | Ga0207694_10220231 | |||
| 2340 | Ga0207650_10027506 | |||
| 2341 | Ga0207650_10032513 | |||
| 2342 | Ga0207650_10062568 | |||
| 2343 | Ga0207650_10093737 | |||
| 2344 | Ga0207650_10141491 | |||
| 2345 | Ga0207650_10150022 | |||
| 2346 | Ga0207659_10011402 | |||
| 2347 | Ga0207659_10014561 | |||
| 2348 | Ga0207659_10054617 | |||
| 2349 | Ga0207659_10102119 | |||
| 2350 | Ga0207687_10101975 | |||
| 2351 | Ga0207687_10258044 | |||
| 2352 | Ga0207644_10020232 | |||
| 2353 | Ga0207644_10052439 | |||
| 2354 | Ga0207644_10071229 | |||
| 2355 | Ga0207644_10167003 | |||
| 2356 | Ga0207690_10003150 | |||
| 2357 | Ga0207690_10060376 | |||
| 2358 | Ga0207690_10109253 | |||
| 2359 | Ga0207706_10000191 | |||
| 2360 | Ga0207706_10024864 | |||
| 2361 | Ga0207706_10106618 | |||
| 2362 | Ga0207686_10017976 | |||
| 2363 | Ga0207709_10000026 | |||
| 2364 | Ga0207709_10000365 | |||
| 2365 | Ga0207670_10005454 | |||
| 2366 | Ga0207670_10091135 | |||
| 2367 | Ga0207670_10106251 | |||
| 2368 | Ga0207669_10088178 | |||
| 2369 | Ga0207704_10000053 | |||
| 2370 | Ga0207704_10104416 | |||
| 2371 | Ga0207704_10150556 | |||
| 2372 | Ga0207691_10000154 | |||
| 2373 | Ga0207691_10005078 | |||
| 2374 | Ga0207691_10030946 | |||
| 2375 | Ga0207691_10059353 | |||
| 2376 | Ga0207691_10079855 | |||
| 2377 | Ga0207691_10083196 | |||
| 2378 | Ga0207691_10188552 | |||
| 2379 | Ga0207711_10025883 | |||
| 2380 | Ga0207711_10049439 | |||
| 2381 | Ga0207689_10000360 | |||
| 2382 | Ga0207689_10001010 | |||
| 2383 | Ga0207689_10006093 | |||
| 2384 | Ga0207689_10006592 | |||
| 2385 | Ga0207689_10011320 | |||
| 2386 | Ga0207689_10011416 | |||
| 2387 | Ga0207689_10012630 | |||
| 2388 | Ga0207689_10041818 | |||
| 2389 | Ga0207689_10094157 | |||
| 2390 | Ga0207689_10171472 | |||
| 2391 | Ga0207689_10190025 | |||
| 2392 | Ga0207661_10002590 | |||
| 2393 | Ga0207661_10018276 | |||
| 2394 | Ga0207661_10022471 | |||
| 2395 | Ga0207661_10314785 | |||
| 2396 | Ga0207679_10001022 | |||
| 2397 | Ga0207679_10006038 | |||
| 2398 | Ga0207679_10006841 | |||
| 2399 | Ga0207679_10026302 | |||
| 2400 | Ga0207667_10000037 | |||
| 2401 | Ga0207667_10001658 | |||
| 2402 | Ga0207667_10002366 | |||
| 2403 | Ga0207667_10005373 | |||
| 2404 | Ga0207667_10009017 | |||
| 2405 | Ga0207667_10009279 | |||
| 2406 | Ga0207667_10037027 | |||
| 2407 | Ga0207667_10043276 | |||
| 2408 | Ga0207667_10054870 | |||
| 2409 | Ga0207667_10057723 | |||
| 2410 | Ga0207667_10080369 | |||
| 2411 | Ga0207667_10092593 | |||
| 2412 | Ga0207667_10126280 | |||
| 2413 | Ga0207667_10168833 | |||
| 2414 | Ga0207651_10003771 | |||
| 2415 | Ga0207651_10008489 | |||
| 2416 | Ga0207651_10017358 | |||
| 2417 | Ga0207651_10065649 | |||
| 2418 | Ga0207712_10001164 | |||
| 2419 | Ga0207712_10001801 | |||
| 2420 | Ga0207712_10011162 | |||
| 2421 | Ga0207712_10025404 | |||
| 2422 | Ga0207712_10032321 | |||
| 2423 | Ga0207712_10050010 | |||
| 2424 | Ga0207712_10202644 | |||
| 2425 | Ga0207668_10001272 | |||
| 2426 | Ga0207668_10043236 | |||
| 2427 | Ga0207668_10181590 | |||
| 2428 | Ga0207640_10025871 | |||
| 2429 | Ga0207640_10091812 | |||
| 2430 | Ga0207658_10020272 | |||
| 2431 | Ga0207658_10035132 | |||
| 2432 | Ga0207658_10057653 | |||
| 2433 | Ga0207677_10001948 | |||
| 2434 | Ga0207677_10010537 | |||
| 2435 | Ga0207677_10067060 | |||
| 2436 | Ga0207677_10071853 | |||
| 2437 | Ga0207677_10202809 | |||
| 2438 | Ga0207703_10001922 | |||
| 2439 | Ga0207703_10026323 | |||
| 2440 | Ga0207703_10173273 | |||
| 2441 | Ga0207639_10001747 | |||
| 2442 | Ga0207639_10006469 | |||
| 2443 | Ga0207639_10018045 | |||
| 2444 | Ga0207639_10020682 | |||
| 2445 | Ga0207639_10049062 | |||
| 2446 | Ga0207639_10056788 | |||
| 2447 | Ga0207639_10080730 | |||
| 2448 | Ga0207639_10235946 | |||
| 2449 | Ga0207678_10094925 | |||
| 2450 | Ga0207702_10000201 | |||
| 2451 | Ga0207702_10024798 | |||
| 2452 | Ga0207702_10029614 | |||
| 2453 | Ga0207702_10076949 | |||
| 2454 | Ga0207641_10000082 | |||
| 2455 | Ga0207641_10003172 | |||
| 2456 | Ga0207641_10009438 | |||
| 2457 | Ga0207641_10015009 | |||
| 2458 | Ga0207641_10021690 | |||
| 2459 | Ga0207641_10082894 | |||
| 2460 | Ga0207641_10197553 | |||
| 2461 | Ga0207648_10000175 | |||
| 2462 | Ga0207648_10001709 | |||
| 2463 | Ga0207648_10002098 | |||
| 2464 | Ga0207648_10015449 | |||
| 2465 | Ga0207648_10019442 | |||
| 2466 | Ga0207648_10026330 | |||
| 2467 | Ga0207648_10049799 | |||
| 2468 | Ga0207648_10059413 | |||
| 2469 | Ga0207648_10064952 | |||
| 2470 | Ga0207648_10109467 | |||
| 2471 | Ga0207648_10129399 | |||
| 2472 | Ga0207676_10007584 | |||
| 2473 | Ga0207676_10007982 | |||
| 2474 | Ga0207676_10014437 | |||
| 2475 | Ga0207676_10042623 | |||
| 2476 | Ga0207676_10050937 | |||
| 2477 | Ga0207674_10003993 | |||
| 2478 | Ga0207674_10005014 | |||
| 2479 | Ga0207674_10005225 | |||
| 2480 | Ga0207674_10024952 | |||
| 2481 | Ga0207674_10069416 | |||
| 2482 | Ga0207674_10090955 | |||
| 2483 | Ga0207674_10134865 | |||
| 2484 | Ga0207674_10170481 | |||
| 2485 | Ga0207674_10260018 | |||
| 2486 | Ga0207675_100005095 | |||
| 2487 | Ga0207675_100025419 | |||
| 2488 | Ga0207675_100039652 | |||
| 2489 | Ga0207675_100199108 | |||
| 2490 | Ga0207675_100218011 | |||
| 2491 | Ga0207675_100258912 | |||
| 2492 | Ga0207675_100262591 | |||
| 2493 | Ga0207683_10000974 | |||
| 2494 | Ga0207683_10007830 | |||
| 2495 | Ga0207683_10041067 | |||
| 2496 | Ga0207683_10080928 | |||
| 2497 | Ga0207683_10187572 | |||
| 2498 | Ga0207698_10001166 | |||
| 2499 | Ga0207698_10004722 | |||
| 2500 | Ga0207698_10009220 | |||
| 2501 | Ga0207698_10073819 | |||
| 2502 | Ga0207698_10132043 | |||
| 2503 | Ga0207698_10174264 | |||
| 2504 | Ga0207698_10181498 | |||
| 2505 | Ga0209281_1000116 | |||
| 2506 | Ga0209489_117024 | |||
| 2507 | Ga0209282_1038144 | |||
| 2508 | Ga0209974_10037550 | |||
| 2509 | Ga0268266_10000018 | |||
| 2510 | Ga0268266_10000022 | |||
| 2511 | Ga0268266_10005211 | |||
| 2512 | Ga0268266_10005285 | |||
| 2513 | Ga0268265_10007650 | |||
| 2514 | Ga0268265_10102470 | |||
| 2515 | Ga0268265_10160055 | |||
| 2516 | Ga0268264_10000082 | |||
| 2517 | Ga0268264_10005842 | |||
| 2518 | Ga0268264_10005919 | |||
| 2519 | Ga0268264_10006777 | |||
| 2520 | Ga0268264_10011786 | |||
| 2521 | Ga0268264_10013496 | |||
| 2522 | Ga0268264_10059634 | |||
| 2523 | Ga0268264_10377511 | |||
| 2524 | Ga0265334_10008517 | |||
| 2525 | Ga0307517_10002197 | |||
| 2526 | Ga0307517_10006633 | |||
| 2527 | Ga0307515_10000001 | |||
| 2528 | Ga0307515_10000061 | |||
| 2529 | Ga0307515_10000190 | |||
| 2530 | Ga0307515_10000927 | |||
| 2531 | Ga0307515_10001771 | |||
| 2532 | Ga0307515_10011605 | |||
| 2533 | Ga0307515_10177925 | |||
| 2534 | Ga0265338_10001011 | |||
| 2535 | Ga0265338_10143578 | |||
| 2536 | Ga0265324_10018826 | |||
| 2537 | Ga0307511_10000027 | |||
| 2538 | Ga0316177_1132213 | |||
| 2539 | Ga0316183_1068856 | |||
| 2540 | Ga0265327_10000048 | |||
| 2541 | Ga0265327_10000248 | |||
| 2542 | Ga0265327_10000272 | |||
| 2543 | Ga0265327_10000551 | |||
| 2544 | Ga0265327_10002514 | |||
| 2545 | Ga0265327_10003148 | |||
| 2546 | Ga0265327_10006450 | |||
| 2547 | Ga0265327_10009085 | |||
| 2548 | Ga0265327_10025709 | |||
| 2549 | Ga0265327_10085354 | |||
| 2550 | Ga0265327_10085890 | |||
| 2551 | Ga0307513_10033920 | |||
| 2552 | Ga0307509_10020755 | |||
| 2553 | Ga0307509_10036852 | |||
| 2554 | Ga0307509_10045900 | |||
| 2555 | Ga0307509_10174065 | |||
| 2556 | Ga0307408_100000310 | |||
| 2557 | Ga0307408_100000534 | |||
| 2558 | Ga0307408_100000564 | |||
| 2559 | Ga0307408_100040113 | |||
| 2560 | Ga0307408_100084815 | |||
| 2561 | Ga0265313_10042550 | |||
| 2562 | Ga0307508_10007752 | |||
| 2563 | Ga0316579_10088628 | |||
| 2564 | Ga0316576_10047393 | |||
| 2565 | Ga0316578_10044657 | |||
| 2566 | Ga0316578_10057303 | |||
| 2567 | Ga0316578_10123818 | |||
| 2568 | Ga0307516_10000869 | |||
| 2569 | Ga0307516_10059174 | |||
| 2570 | Ga0307405_10000002 | |||
| 2571 | Ga0307405_10000016 | |||
| 2572 | Ga0307405_10014744 | |||
| 2573 | Ga0307405_10137656 | |||
| 2574 | Ga0316577_10114114 | |||
| 2575 | Ga0307413_10000019 | |||
| 2576 | Ga0307413_10002415 | |||
| 2577 | Ga0307410_10000115 | |||
| 2578 | Ga0307410_10142957 | |||
| 2579 | Ga0307406_10000111 | |||
| 2580 | Ga0307407_10000006 | |||
| 2581 | Ga0307407_10001642 | |||
| 2582 | Ga0307412_10000001 | |||
| 2583 | Ga0307412_10000034 | |||
| 2584 | Ga0307412_10000154 | |||
| 2585 | Ga0307412_10003359 | |||
| 2586 | Ga0307412_10237299 | |||
| 2587 | Ga0307416_100000030 | |||
| 2588 | Ga0307416_100000032 | |||
| 2589 | Ga0307416_100025328 | |||
| 2590 | Ga0307414_10000001 | |||
| 2591 | Ga0307414_10000127 | |||
| 2592 | Ga0307414_10000392 | |||
| 2593 | Ga0307414_10001064 | |||
| 2594 | Ga0307414_10001471 | |||
| 2595 | Ga0307414_10035636 | |||
| 2596 | Ga0307414_10055020 | |||
| 2597 | Ga0307414_10068187 | |||
| 2598 | Ga0307414_10075521 | |||
| 2599 | Ga0307414_10129539 | |||
| 2600 | Ga0307414_10178501 | |||
| 2601 | Ga0307411_10000013 | |||
| 2602 | Ga0307411_10071513 | |||
| 2603 | Ga0307415_100025409 | |||
| 2604 | Ga0307415_100143214 | |||
| 2605 | Ga0307507_10000064 | |||
| 2606 | Ga0307510_10000328 | |||
| 2607 | Ga0307510_10007920 | |||
| 2608 | Ga0307510_10023468 | |||
| 2609 | Ga0373936_0062866 | |||
| 2610 | Ga0373955_0093023 | |||
| 2611 | Ga0373955_0106131 | |||
| 2612 | Ga0373924_0018705 | |||
| 2613 | Ga0373927_0021777 | |||
| 2614 | Ga0373937_0010206 | |||
| 2615 | Ga0373937_0064488 | |||
| 2616 | Ga0316582_0005102 | |||
| 2617 | Ga0316584_0026927 | |||
| 2618 | Ga0316584_0052520 | |||
| 2619 | Ga0316584_0056089 | |||
| 2620 | Ga0316584_0246152 | |||
| 2621 | Ga0395899_0000033 | |||
| 2622 | Ga0395899_0000411 | |||
| 2623 | Ga0395899_0000435 | |||
| 2624 | Ga0395899_0001077 | |||
| 2625 | Ga0395899_0002144 | |||
| 2626 | Ga0395899_0031560 | |||
| 2627 | Ga0395899_0044380 | |||
| 2628 | Ga0395899_0059981 | |||
| 2629 | Ga0395900_0001393 | |||
| 2630 | Ga0395900_0001452 | |||
| 2631 | Ga0395900_0003225 | |||
| 2632 | Ga0395900_0005622 | |||
| 2633 | Ga0395900_0072380 | |||
| 2634 | Ga0395900_0098786 | |||
| 2635 | Ga0395900_0101122 | |||
| 2636 | Ga0395900_0109400 | |||
| 2637 | Ga0395900_0130510 | |||
| 2638 | Ga0395898_0013831 | |||
| 2639 | Ga0395898_0031676 | |||
| 2640 | Ga0395898_0158125 | |||
| 2641 | Ga0395905_0000998 | |||
| 2642 | Ga0395905_0001914 | |||
| 2643 | Ga0395905_0007067 | |||
| 2644 | Ga0395905_0034426 | |||
| 2645 | Ga0395901_0000789 | |||
| 2646 | Ga0395901_0002351 | |||
| 2647 | Ga0395901_0014642 | |||
| 2648 | Ga0395901_0017854 | |||
| 2649 | Ga0395901_0030985 | |||
| 2650 | Ga0395901_0091000 | |||
| 2651 | Ga0395901_0272603 | |||
| 2652 | Ga0395901_0315933 | |||
| 2653 | Ga0436365_0079092 | |||
| 2654 | Ga0436361_0307685 | |||
| 2655 | Ga0439439_0009748 | |||
| 2656 | Ga0439447_003769 | |||
| 2657 | Ga0439466_0015063 | |||
| 2658 | Ga0451795_0356222 | |||
| 2659 | Ga0451795_1501558 | |||
| 2660 | Ga0451807_1155230 | |||
| 2661 | Ga0451849_1009127 | |||
| 2662 | Ga0451855_1236631 | |||
| 2663 | Ga0451855_1803231 | |||
| 2664 | Ga0439431_0000122 | |||
| 2665 | Ga0439442_002574 | |||
| 2666 | Ga0439445_0003161 | |||
| 2667 | Ga0439448_0004334 | |||
| 2668 | Ga0439449_0006488 | |||
| 2669 | Ga0439455_0019582 | |||
| 2670 | Ga0439457_007860 | |||
| 2671 | Ga0439457_009122 | |||
| 2672 | Ga0439462_0001515 | |||
| 2673 | Ga0450923_001237 | |||
| 2674 | Ga0450898_002493 | |||
| 2675 | Ga0451577_0000042 | |||
| 2676 | Ga0451577_0000418 | |||
| 2677 | Ga0451577_0005315 | |||
| 2678 | Ga0451577_0016491 | |||
| 2679 | Ga0451577_0047761 | |||
| 2680 | Ga0451577_0066330 | |||
| 2681 | Ga0451577_0066793 | |||
| 2682 | Ga0451577_0077739 | |||
| 2683 | Ga0451577_0098078 | |||
| 2684 | Ga0451577_0103906 | |||
| 2685 | Ga0451577_0158178 | |||
| 2686 | Ga0451577_0302681 | |||
| 2687 | Ga0466969_0001347 | |||
| 2688 | Ga0466972_0000001 | |||
| 2689 | Ga0466972_0000280 | |||
| 2690 | Ga0466972_0076144 | |||
| 2691 | Ga0453683_0000286 | |||
| 2692 | Ga0453683_0000572 | |||
| 2693 | Ga0453683_0000680 | |||
| 2694 | Ga0453683_0008542 | |||
| 2695 | Ga0453683_0009555 | |||
| 2696 | Ga0453683_0019047 | |||
| 2697 | Ga0453683_0040595 | |||
| 2698 | Ga0453683_0046010 | |||
| 2699 | Ga0453683_0183173 | |||
| 2700 | Ga0453684_0000452 | |||
| 2701 | Ga0453684_0001009 | |||
| 2702 | Ga0453684_0001431 | |||
| 2703 | Ga0453684_0001697 | |||
| 2704 | Ga0453684_0002271 | |||
| 2705 | Ga0453684_0004934 | |||
| 2706 | Ga0453684_0005946 | |||
| 2707 | Ga0453684_0008008 | |||
| 2708 | Ga0453684_0024385 | |||
| 2709 | Ga0453684_0025246 | |||
| 2710 | Ga0453684_0034365 | |||
| 2711 | Ga0453684_0037166 | |||
| 2712 | Ga0453684_0040283 | |||
| 2713 | Ga0453684_0120207 | |||
| 2714 | Ga0453684_0156804 | |||
| 2715 | Ga0466971_0014790 | |||
| 2716 | Ga0466968_0028469 | |||
| 2717 | Ga0466970_0000495 | |||
| 2718 | Ga0466957_0001670 | |||
| 2719 | Ga0466957_0007722 | |||
| 2720 | Ga0466959_0000004 | |||
| 2721 | Ga0466959_0000446 | |||
| 2722 | Ga0466959_0055794 | |||
| 2723 | Ga0451576_0000002 | |||
| 2724 | Ga0451576_0000254 | |||
| 2725 | Ga0451576_0000589 | |||
| 2726 | Ga0451576_0001052 | |||
| 2727 | Ga0451576_0005169 | |||
| 2728 | Ga0451576_0009640 | |||
| 2729 | Ga0451576_0044662 | |||
| 2730 | Ga0451576_0047009 | |||
| 2731 | Ga0451576_0059430 | |||
| 2732 | Ga0451576_0072309 | |||
| 2733 | Ga0451576_0087081 | |||
| 2734 | Ga0451576_0111131 | |||
| 2735 | Ga0451576_0152198 | |||
| 2736 | Ga0466958_0082156 | |||
| 2737 | Ga0495627_000034 | |||
| 2738 | Ga0495627_006812 | |||
| 2739 | Ga0495627_007928 | |||
| 2740 | Ga0495627_045014 | |||
| 2741 | Ga0495592_0163888 | |||
| 2742 | Ga0495590_0005877 | |||
| 2743 | Ga0495638_0000171 | |||
| 2744 | Ga0495638_0018471 | |||
| 2745 | Ga0495651_0045960 | |||
| 2746 | Ga0495650_0000003 | |||
| 2747 | Ga0495650_0021678 | |||
| 2748 | Ga0495650_0051350 | |||
| 2749 | Ga0495585_0000079 | |||
| 2750 | Ga0495585_0000411 | |||
| 2751 | Ga0495596_0000865 | |||
| 2752 | Ga0495607_0011024 | |||
| 2753 | Ga0495606_0000116 | |||
| 2754 | Ga0495606_0011506 | |||
| 2755 | Ga0495606_0012165 | |||
| 2756 | Ga0495606_0014159 | |||
| 2757 | Ga0495606_0017762 | |||
| 2758 | Ga0495606_0023782 | |||
| 2759 | Ga0495610_0000001 | |||
| 2760 | Ga0495610_0000992 | |||
| 2761 | Ga0495610_0001007 | |||
| 2762 | Ga0495610_0004188 | |||
| 2763 | Ga0495616_0008226 | |||
| 2764 | Ga0495616_0043233 | |||
| 2765 | Ga0495616_0113617 | |||
| 2766 | Ga0495618_0121596 | |||
| 2767 | Ga0495628_0009018 | |||
| 2768 | Ga0495630_0064766 | |||
| 2769 | Ga0495630_0078966 | |||
| 2770 | Ga0495632_0023621 | |||
| 2771 | Ga0495637_0003326 | |||
| 2772 | Ga0495643_0000506 | |||
| 2773 | Ga0495643_0003411 | |||
| 2774 | Ga0495648_0000879 | |||
| 2775 | Ga0495648_0002877 | |||
| 2776 | Ga0495663_0000406 | |||
| 2777 | Ga0495654_0000001 | |||
| 2778 | Ga0495665_0104353 | |||
| 2779 | Ga0495586_0131063 | |||
| 2780 | Ga0495587_0064905 | |||
| 2781 | Ga0495609_0000025 | |||
| 2782 | Ga0495609_0015343 | |||
| 2783 | Ga0495621_0012524 | |||
| 2784 | Ga0495622_0014656 | |||
| 2785 | Ga0495622_0036520 | |||
| 2786 | Ga0495622_0060076 | |||
| 2787 | Ga0495633_0000056 | |||
| 2788 | Ga0495633_0000057 | |||
| 2789 | Ga0495633_0000344 | |||
| 2790 | Ga0495668_0000021 | |||
| 2791 | Ga0495668_0000257 | |||
| 2792 | Ga0495668_0001099 | |||
| 2793 | Ga0495668_0004989 | |||
| 2794 | Ga0495625_0000159 | |||
| 2795 | Ga0495625_0001186 | |||
| 2796 | Ga0495625_0002144 | |||
| 2797 | Ga0495625_0005105 | |||
| 2798 | Ga0495625_0008186 | |||
| 2799 | Ga0495625_0019973 | |||
| 2800 | Ga0495625_0033793 | |||
| 2801 | Ga0495625_0119956 | |||
| 2802 | Ga0495635_0137075 | |||
| 2803 | Ga0495661_0001360 | |||
| 2804 | Ga0495661_0015325 | |||
| 2805 | Ga0495658_0025645 | |||
| 2806 | Ga0495613_0146383 | |||
| 2807 | Ga0495671_0071739 | |||
| 2808 | Ga0495649_0000003 | |||
| 2809 | Ga0495672_0002547 | |||
| 2810 | Ga0495672_0024143 | |||
| 2811 | Ga0495672_0066796 | |||
| 2812 | Ga0495680_0045059 | |||
| 2813 | Ga0495687_000179 | |||
| 2814 | Ga0495687_002135 | |||
| 2815 | Ga0495687_002367 | |||
| 2816 | Ga0495675_0107839 | |||
| 2817 | Ga0495684_0015951 | |||
| 2818 | Ga0495686_0000010 | |||
| 2819 | Ga0495686_0000160 | |||
| 2820 | Ga0495686_0000234 | |||
| 2821 | Ga0495686_0000489 | |||
| 2822 | Ga0495686_0001122 | |||
| 2823 | Ga0495686_0002126 | |||
| 2824 | Ga0495686_0012985 | |||
| 2825 | Ga0495686_0066077 | |||
| 2826 | Ga0495686_0082255 | |||
| 2827 | Ga0495686_0117769 | |||
| 2828 | Ga0495614_0030275 | |||
| 2829 | Ga0496103_0054877 | |||
| 2830 | Ga0496104_0376680 | |||
| 2831 | Ga0496109_0164106 | |||
| 2832 | Ga0496109_0340329 | |||
| 2833 | Ga0496110_0086573 | |||
| 2834 | Ga0496111_0087451 | |||
| 2835 | Ga0496113_0198306 | |||
| 2836 | Ga0496114_0000412 | |||
| 2837 | Ga0496115_0005714 | |||
| 2838 | Ga0496115_0027455 | |||
| 2839 | Ga0496115_0088816 | |||
| 2840 | Ga0496116_0000047 | |||
| 2841 | Ga0496116_0000266 | |||
| 2842 | Ga0496116_0034662 | |||
| 2843 | Ga0496117_0000365 | |||
| 2844 | Ga0496118_0000672 | |||
| 2845 | Ga0496118_0052195 | |||
| 2846 | Ga0496119_0000227 | |||
| 2847 | Ga0496121_0001581 | |||
| 2848 | Ga0496121_0010116 | |||
| 2849 | Ga0496122_0000045 | |||
| 2850 | Ga0496122_0000277 | |||
| 2851 | Ga0496122_0000668 | |||
| 2852 | Ga0496122_0000698 | |||
| 2853 | Ga0496122_0004620 | |||
| 2854 | Ga0496122_0024722 | |||
| 2855 | Ga0496122_0064153 | |||
| 2856 | Ga0496123_0000728 | |||
| 2857 | Ga0496123_0018435 | |||
| 2858 | Ga0496124_0008911 | |||
| 2859 | Ga0496124_0094661 | |||
| 2860 | Ga0496125_0000050 | |||
| 2861 | Ga0496125_0001041 | |||
| 2862 | Ga0496125_0001313 | |||
| 2863 | Ga0496126_0002717 | |||
| 2864 | Ga0496126_0003177 | |||
| 2865 | Ga0496126_0004416 | |||
| 2866 | Ga0501298_001720 | |||
| 2867 | Ga0501299_014295 | |||
| 2868 | Ga0501032_0003483 | |||
| 2869 | Ga0501033_0088258 | |||
| 2870 | Ga0501033_0137637 | |||
| 2871 | Ga0501034_0012481 | |||
| 2872 | Ga0501034_0023798 | |||
| 2873 | Ga0501034_0176353 | |||
| 2874 | Ga0501036_0001169 | |||
| 2875 | Ga0501037_0008589 | |||
| 2876 | Ga0501037_0027220 | |||
| 2877 | Ga0501038_0025547 | |||
| 2878 | Ga0501038_0142314 | |||
| 2879 | Ga0501039_0012075 | |||
| 2880 | Ga0501039_0066169 | |||
| 2881 | Ga0501043_0003386 | |||
| 2882 | Ga0501043_0025390 | |||
| 2883 | Ga0501043_0035477 | |||
| 2884 | Ga0501043_0052405 | |||
| 2885 | Ga0501046_0032815 | |||
| 2886 | Ga0501046_0032890 | |||
| 2887 | Ga0501047_0030028 | |||
| 2888 | Ga0501047_0278566 | |||
| 2889 | Ga0501067_0006422 | |||
| 2890 | Ga0501067_0006775 | |||
| 2891 | Ga0501069_0025041 | |||
| 2892 | Ga0501070_0050057 | |||
| 2893 | Ga0501072_0196270 | |||
| 2894 | Ga0501073_0000839 | |||
| 2895 | Ga0501073_0082775 | |||
| 2896 | Ga0501074_0019469 | |||
| 2897 | Ga0501201_000519 | |||
| 2898 | Ga0501207_000155 | |||
| 2899 | Ga0501210_000224 | |||
| 2900 | Ga0501217_000256 | |||
| 2901 | Ga0501223_000278 | |||
| 2902 | Ga0501223_000532 | |||
| 2903 | Ga0501223_013191 | |||
| 2904 | Ga0501233_009188 | |||
| 2905 | Ga0501235_009750 | |||
| 2906 | Ga0501240_001884 | |||
| 2907 | Ga0501243_001134 | |||
| 2908 | Ga0501249_000009 | |||
| 2909 | Ga0501249_003392 | |||
| 2910 | Ga0501257_002266 | |||
| 2911 | Ga0501259_000291 | |||
| 2912 | Ga0501261_001011 | |||
| 2913 | Ga0501221_000194 | |||
| 2914 | Ga0501225_0003187 | |||
| 2915 | Ga0501245_009025 | |||
| 2916 | Ga0501079_0036852 | |||
| 2917 | Ga0501083_0003883 | |||
| 2918 | Ga0501083_0007152 | |||
| 2919 | Ga0501241_001025 | |||
| 2920 | Ga0501241_003468 | |||
| 2921 | Ga0501241_003584 | |||
| 2922 | Ga0501241_004068 | |||
| 2923 | Ga0501266_000005 | |||
| 2924 | Ga0501280_000686 | |||
| 2925 | Ga0501035_0010433 | |||
| 2926 | Ga0501035_0085782 | |||
| 2927 | Ga0501044_0004241 | |||
| 2928 | Ga0501044_0121188 | |||
| 2929 | Ga0501044_0129100 | |||
| 2930 | Ga0501044_0130494 | |||
| 2931 | Ga0501044_0175672 | |||
| 2932 | Ga0501044_0251193 | |||
| 2933 | Ga0501284_00072 | |||
| 2934 | nmdc:mga0k408_102378_c1 | |||
| 2935 | nmdc:mga0k408_16257_c1 | |||
| 2936 | nmdc:mga0k408_2327_c1 | |||
| 2937 | nmdc:mga0k408_2685_c2 | |||
| 2938 | nmdc:mga0k408_27353_c1 | |||
| 2939 | nmdc:mga0k408_7355_c1 | |||
| 2940 | nmdc:mga05p37_40325_c1 | |||
| 2941 | nmdc:mga05p37_91937_c1 | |||
| 2942 | nmdc:mga09592_174604_c1 | |||
| 2943 | nmdc:mga09592_66506_c1 | |||
| 2944 | nmdc:mga0qj67_32376_c1 | |||
| 2945 | nmdc:mga06r32_4922_c1 | |||
| 2946 | nmdc:mga06r32_70338_c1 | |||
| 2947 | nmdc:mga08y16_171069_c1 | |||
| 2948 | nmdc:mga08y16_54887_c1 | |||
| 2949 | nmdc:mga08y16_57072_c1 | |||
| 2950 | nmdc:mga08y16_77453_c1 | |||
| 2951 | Ga0495612_0047800 | |||
| 2952 | Ga0500635_0000883 | |||
| 2953 | Ga0500578_0000010 | |||
| 2954 | Ga0500578_0155323 | |||
| 2955 | Ga0500644_0000127 | |||
| 2956 | Ga0500646_0004247 | |||
| 2957 | Ga0500583_0000064 | |||
| 2958 | Ga0500583_0008434 | |||
| 2959 | Ga0500583_0016023 | |||
| 2960 | Ga0500583_0023006 | |||
| 2961 | Ga0500651_0000230 | |||
| 2962 | Ga0500641_0000027 | |||
| 2963 | Ga0500641_0000289 | |||
| 2964 | Ga0500641_0001919 | |||
| 2965 | Ga0500556_0014297 | |||
| 2966 | Ga0500562_000053 | |||
| 2967 | Ga0500607_021068 | |||
| 2968 | Ga0500608_018150 | |||
| 2969 | Ga0500618_000003 | |||
| 2970 | Ga0500559_0098817 | |||
| 2971 | Ga0500568_0001188 | |||
| 2972 | Ga0500568_0003322 | |||
| 2973 | Ga0500577_0002076 | |||
| 2974 | Ga0500588_0001245 | |||
| 2975 | Ga0500590_036340 | |||
| 2976 | Ga0500604_0003342 | |||
| 2977 | Ga0500616_0000037 | |||
| 2978 | Ga0500616_0002187 | |||
| 2979 | Ga0500622_0000141 | |||
| 2980 | Ga0500622_0000155 | |||
| 2981 | Ga0500622_0000258 | |||
| 2982 | Ga0500622_0000481 | |||
| 2983 | Ga0500622_0004074 | |||
| 2984 | Ga0500622_0007189 | |||
| 2985 | Ga0500622_0007499 | |||
| 2986 | Ga0500622_0084009 | |||
| 2987 | Ga0500624_000167 | |||
| 2988 | Ga0500627_0004961 | |||
| 2989 | Ga0500627_0075512 | |||
| 2990 | Ga0500634_0024399 | |||
| 2991 | Ga0500611_000004 | |||
| 2992 | Ga0500661_004470 | |||
| 2993 | 2511234604 | |||
| 2994 | 2513233497 | |||
| 2995 | 2520878823 | |||
| 2996 | 2522549498 | |||
| 2997 | 2585144550 | |||
| 2998 | 2585159122 | |||
| 2999 | 2585163410 | |||
| 3000 | 2585425261 | |||
| 3001 | 2586210423 | |||
| 3002 | 2587677211 | |||
| 3003 | 2587749732 | |||
| 3004 | 2587751805 | |||
| 3005 | 2587865767 | |||
| 3006 | 2587943928 | |||
| 3007 | 2588208744 | |||
| 3008 | 2588212546 | |||
| 3009 | 2588220121 | |||
| 3010 | 2588224917 | |||
| 3011 | 2588231805 | |||
| 3012 | 2588445873 | |||
| 3013 | 2590602170 | |||
| 3014 | 2590611466 | |||
| 3015 | 2599478631 | |||
| 3016 | 2644011466 | |||
| 3017 | 2644369868 | |||
| 3018 | 2644642290 | |||
| 3019 | 2644685259 | |||
| 3020 | 2722726235 | |||
| 3021 | 2729201888 | |||
| 3022 | 2738698530 | |||
| 3023 | 2738724679 | |||
| 3024 | 2738731945 | |||
| 3025 | 2738755878 | |||
| 3026 | 2738761462 | |||
| 3027 | 2738764510 | |||
| 3028 | 2738854136 | |||
| 3029 | 2739213525 | |||
| 3030 | 2739252856 | |||
| 3031 | 2739303027 | |||
| 3032 | 2739587620 | |||
| 3033 | 2739614667 | |||
| 3034 | 2739648076 | |||
| 3035 | 2740000790 | |||
| 3036 | 2740005606 | |||
| 3037 | 2740033893 | |||
| 3038 | 2740057089 | |||
| 3039 | 2753672117 | |||
| 3040 | 2765572118 | |||
| 3041 | 2772603924 | |||
| 3042 | 2776615907 | |||
| 3043 | 2802654174 | |||
| 3044 | 2816872329 | |||
| 3045 | 2817415801 | |||
| 3046 | 2819545527 | |||
| 3047 | 2819572472 | |||
| 3048 | 2819585917 | |||
| 3049 | 2819680535 | |||
| 3050 | 2821140143 | |||
| 3051 | 2833642258 | |||
| 3052 | 2839991375 | |||
| 3053 | 2840677666 | |||
| 3054 | 2842086517 | |||
| 3055 | 2842724593 | |||
| 3056 | 2842907174 | |||
| 3057 | 2842911913 | |||
| 3058 | 2849283552 | |||
| 3059 | 2852623540 | |||
| 3060 | 2852628109 | |||
| 3061 | 2857614539 | |||
| 3062 | 2857619078 | |||
| 3063 | 2857630511 | |||
| 3064 | 2871722952 | |||
| 3065 | 2881360446 | |||
| 3066 | 2881957556 | |||
| 3067 | 2883071180 | |||
| 3068 | 2884635190 | |||
| 3069 | 2884798041 | |||
| 3070 | 2884937559 | |||
| 3071 | 2889292410 | |||
| 3072 | 2890740744 | |||
| 3073 | 2895501672 | |||
| 3074 | 2896085484 | |||
| 3075 | 2896113688 | |||
| 3076 | 2896320786 | |||
| 3077 | 2896345355 | |||
| 3078 | 2898713935 | |||
| 3079 | 2902050710 | |||
| 3080 | 2903898590 | |||
| 3081 | 2904419827 | |||
| 3082 | 2904448022 | |||
| 3083 | 2904472265 | |||
| 3084 | 2904556616 | |||
| 3085 | 2904782842 | |||
| 3086 | 2906000612 | |||
| 3087 | 2910247849 | |||
| 3088 | 2911140313 | |||
| 3089 | 2914763111 | |||
| 3090 | 2919180453 | |||
| 3091 | 2919188473 | |||
| 3092 | 2919194059 | |||
| 3093 | 2919400618 | |||
| 3094 | 2919441315 | |||
| 3095 | 2919512599 | |||
| 3096 | 2919688422 | |||
| 3097 | 2919693353 | |||
| 3098 | 2928080311 | |||
| 3099 | 2928149514 | |||
| 3100 | 2929153045 | |||
| 3101 | 2929159320 | |||
| 3102 | 2929182829 | |||
| 3103 | 2929244971 | |||
| 3104 | 2929927224 | |||
| 3105 | 2932083345 | |||
| 3106 | 2939667442 | |||
| 3107 | 2945927621 | |||
| 3108 | 2945978784 | |||
| 3109 | 2945998547 | |||
| 3110 | 2946015351 | |||
| 3111 | 2946020766 | |||
| 3112 | 2954021014 | |||
| 3113 | 2958460899 | |||
| 3114 | 2958513425 | |||
| 3115 | 2965323712 | |||
| 3116 | 2977232886 | |||
| 3117 | 2977246618 | |||
| 3118 | 2977269710 | |||
| 3119 | 2984575556 | |||
| 3120 | 2984609009 | |||
| 3121 | 2993373950 | |||
| 3122 | 2993480851 | |||
| 3123 | 3003234846 | |||
| 3124 | 8003151102 | |||
| 3125 | 8054308225 | |||
| 3126 | 8055421477 | |||
| 3127 | 8055591254 | |||
| 3128 | 8055594050 | |||
| 3129 | 8056441415 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kh1-assembly1.cif.gz_A | crystal structure of thermus thermophilus hb8 argininosuccinate synthetase | 0.9306 | 6 | 395 |
| 1kh1-assembly1.cif.gz_A | crystal structure of thermus thermophilus hb8 argininosuccinate synthetase | 0.9212 | 6 | 395 |
| 2nz2-assembly1.cif.gz_A | crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline | 0.9209 | 5 | 395 |
| 1kh2-assembly1.cif.gz_D | crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with atp | 0.916 | 6 | 395 |
| 1kh3-assembly1.cif.gz_B | crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with inhibitor | 0.9154 | 6 | 395 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0IGZ2_74_244_3.90.1260.10 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9368 | 176 | 342 | 3.90.1260.10 |
| af_O94354_181_408_3.90.1260.10 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9146 | 177 | 390 | 3.90.1260.10 |
| af_A0A0R0IGZ2_74_244_3.90.1260.10 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9106 | 176 | 342 | 3.90.1260.10 |
| 4xfjA02 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9102 | 177 | 360 | 3.90.1260.10 |
| af_Q60174_173_395_3.90.1260.10 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9098 | 177 | 397 | 3.90.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5SHL1-F1-model_v4 | Argininosuccinate synthase | 0.9888 | 4 | 249 |
GO:0000050
GO:0000053 GO:0004055 GO:0005524 GO:0005737 GO:0006526 |
| AF-A0A2E2FP73-F1-model_v4 | argininosuccinate synthase (EC 6.3.4.5) | 0.9817 | 4 | 396 |
GO:0000050
GO:0000053 GO:0004055 GO:0005524 GO:0005737 GO:0006526 |
| AF-A0A4Q5SHL1-F1-model_v4 | Argininosuccinate synthase | 0.9809 | 4 | 249 |
GO:0000050
GO:0000053 GO:0004055 GO:0005524 GO:0005737 GO:0006526 |
| AF-A0A3D2NCT4-F1-model_v4 | deleted | 0.9806 | 4 | 146 |
|
| AF-A0A7X8WJU2-F1-model_v4 | argininosuccinate synthase (EC 6.3.4.5) | 0.9798 | 66 | 397 |
GO:0000050
GO:0000053 GO:0004055 GO:0005524 GO:0005737 GO:0006526 |