F494787

General Info

Members Datasets Scaffolds Average Seq Length
1564 573 3129 401

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0014163|Ga0453684_0014163_6214_7530
Length 438
Sequence LNQNNFDPQEDNHRSKFGTCFFLSLPPVGGEVWRGLQKNKIMKDKVVLAFSGGLDTSYCAKYLSVEKNLDVYTAIANTGGFTQSDLEAVEKKAYQLGAVKHVTLDVTDSYYEKSIKYMVFGNILRNNTYPISVSSERVFQAIAIIEYAKQIGAKYVAHGSTGAGNDQVRFDLTFQILAPEIGILTPTRDLELSRQEEIDYLKAHGVVADWKKMDYSINKGLWGTSIGGKETLKSNKTLPEEAYPSQLTQTEEKEITIDFIKGELKGVNGEVFENPVNAIRALEAVASPYAVGRDMHIGDTIIGIKGRVGFEAAAPIIAIKAHQMLEKHTLTKWQQYWKEQLGNWYGMFLHEALYFEPVMRDIEKFLEHSQENVTGKVIVKLKPYNFVLVGVESDHDLMRSEFGEYGEKNSAWTADDVKGFTKVLSTSLKIHNSVNHSF

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
103 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
150 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
223 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
224 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
230 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
236 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
244 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
245 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
259 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
260 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
275 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
276 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
277 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
278 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
279 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
280 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
281 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
282 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
283 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
284 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
285 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
286 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
287 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
290 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
294 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
305 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
319 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
320 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
321 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
322 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
327 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
364 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
382 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
383 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
384 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
385 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
386 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
387 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
388 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
389 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
390 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
391 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
392 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
393 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
394 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
395 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
396 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
397 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
398 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
399 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
400 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
401 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
405 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
408 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
409 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
410 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
413 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
414 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
415 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
416 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
417 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
418 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
419 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
420 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
421 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
422 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
423 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
424 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
425 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
426 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
427 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
428 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
429 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
430 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
431 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
432 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
433 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
434 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
435 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
436 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
437 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
438 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
439 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
440 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
441 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
442 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
443 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
444 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
445 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
446 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
447 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
448 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
449 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
450 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
451 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
452 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
453 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
454 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
455 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
456 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
457 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
458 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
459 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
460 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
461 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
462 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
463 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
464 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
465 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
466 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
467 2738541278 Niastella sp. CF465 Isolate Unclassified
468 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
469 2738541283 Pedobacter sp. OK701 Isolate Unclassified
470 2738541284 Pedobacter sp. YR016 Isolate Unclassified
471 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
472 2738541302 Pedobacter sp. CF074 Isolate Unclassified
473 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
474 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
475 2738543023 Pedobacter sp. OK628 Isolate Unclassified
476 2739367651 Pedobacter sp. OK291 Isolate Unclassified
477 2739367656 Pedobacter sp. CF523 Isolate Unclassified
478 2739367663 Pedobacter sp. YR510 Isolate Unclassified
479 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
480 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
481 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
482 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
483 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
484 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
485 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
486 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
487 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
488 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
489 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
490 2818991437 Pedobacter terrae 518 Isolate Unclassified
491 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
492 2818991444 Filimonas endophytica 3197 Isolate Unclassified
493 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
494 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
495 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
496 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
497 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
498 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
499 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
500 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
501 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
502 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
503 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
504 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
505 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
506 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
507 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
508 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
509 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
510 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
511 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
512 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
513 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
514 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
515 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
516 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
517 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
518 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
519 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
520 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
521 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
522 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
523 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
524 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
525 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
526 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
527 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
528 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
529 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
530 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
531 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
532 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
533 2914759650 Rhizosphaericola mali Isolate Rhizosphere
534 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
535 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
536 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
537 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
538 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
539 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
540 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
541 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
542 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
543 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
544 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
545 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
546 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
547 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
548 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
549 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
550 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
551 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
552 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
553 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
554 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
555 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
556 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
557 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
558 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
559 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
560 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
561 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
562 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
563 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
564 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
565 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
566 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
567 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
568 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
569 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
570 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
571 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
572 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
573 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.79
Metatranscriptomes 0.45
Isolates 8.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 7.1
Nodule 0.45
Rhizoplane 0.96
Rhizosphere 82.1
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0014163 3300044712 Bacteria 12809
2 SwRhRL2b_contig_1663676 2162886007 Bacteria 241831
3 SwRhRL2b_contig_3047449 2162886007 Bacteria 1886
4 JGI24740J21852_10004979 3300001979 Bacteria 5644
5 JGI24740J21852_10006938 3300001979 Bacteria 4650
6 JGI24739J22299_10004155 3300001989 Bacteria 5539
7 JGI24739J22299_10005815 3300001989 Bacteria 4671
8 JGI24737J22298_10002176 3300001990 Bacteria 6977
9 JGI24735J21928_10000002 3300002067 Bacteria 624895
10 JGI24751J29686_10001013 3300002459 Bacteria 6158
11 JGI25162J39368_1000024 3300002737 Bacteria 229507
12 JGI25162J39368_1001318 3300002737 Bacteria 13921
13 JGI25154J39366_1000047 3300002738 Bacteria 126449
14 JGI25158J39367_1004804 3300002739 Bacteria 2011
15 JGI25157J39369_1002465 3300002741 Bacteria 4569
16 JGI25164J39214_1000855 3300002772 Bacteria 10454
17 JGI25152J39213_1000007 3300002773 Bacteria 156012
18 JGI25150J39212_1000013 3300002774 Bacteria 182307
19 JGI25151J46595_10000004 3300003187 Bacteria 494006
20 JGI25406J46586_10007660 3300003203 Bacteria 4912
21 JGI25153J46596_10000004 3300003215 Bacteria 494006
22 JGI25153J46596_10007229 3300003215 Bacteria 5497
23 rootH1_10001629 3300003316 Bacteria 29048
24 rootH1_10073809 3300003316 Bacteria 8113
25 rootH1_10160863 3300003316 Bacteria 2958
26 rootH2_10003246 3300003320 Bacteria 168239
27 rootH2_10005719 3300003320 Bacteria 108734
28 rootH2_10006783 3300003320 Bacteria 50422
29 rootH2_10061691 3300003320 Bacteria 2691
30 rootL2_10006109 3300003322 Bacteria 15155
31 rootL2_10018664 3300003322 Bacteria 7331
32 rootL2_10048389 3300003322 Bacteria 6120
33 rootL2_10058703 3300003322 Bacteria 2463
34 rootL2_10100931 3300003322 Bacteria 1931
35 rootL2_10108093 3300003322 Bacteria 1470
36 rootL2_10338439 3300003322 Bacteria 3243
37 rootH1_10002666 3300003323 Bacteria 23641
38 rootH1_10010261 3300003323 Bacteria 16255
39 rootH1_10010262 3300003323 Bacteria 7405
40 rootH1_10029472 3300003323 Bacteria 17623
41 rootH1_10030425 3300003316 Bacteria 1369
42 rootH1_10030425 3300003323 Bacteria 4598
43 rootH1_10063152 3300003323 Bacteria 5945
44 rootH1_10082354 3300003323 Bacteria 3629
45 rootH1_10148113 3300003323 Bacteria 1718
46 rootH1_10230439 3300003323 Bacteria 4761
47 JGI25160J50197_1000981 3300003354 Bacteria 14875
48 JGI25160J50197_1006733 3300003354 Bacteria 4611
49 JGI25160J50197_1009613 3300003354 Bacteria 3569
50 Ga0006562J51391_1012235 3300003578 Bacteria 4418
51 Ga0006562J51391_1026618 3300003578 Bacteria 1873
52 Ga0055535_1001731 3300003761 Bacteria 9801
53 Ga0055542_1004590 3300003762 Bacteria 3311
54 Ga0055526_1008317 3300003771 Bacteria 5202
55 Ga0055536_1000010 3300003781 Bacteria 304614
56 Ga0055536_1001611 3300003781 Bacteria 13467
57 Ga0055528_1000701 3300003790 Bacteria 23758
58 Ga0055530_10000911 3300003791 Bacteria 24271
59 Ga0055530_10002214 3300003791 Bacteria 12844
60 Ga0055531_10000245 3300003794 Bacteria 59122
61 Ga0055531_10000435 3300003794 Bacteria 39538
62 Ga0058863_11371296 3300004799 Bacteria 2287
63 Ga0058862_12893042 3300004803 Bacteria 4420
64 Ga0065165_1000131 3300005262 Bacteria 128880
65 Ga0065165_1000725 3300005262 Bacteria 46083
66 Ga0065165_1001074 3300005262 Bacteria 32602
67 Ga0065714_10003996 3300005288 Bacteria 10318
68 Ga0065714_10007893 3300005288 Bacteria 4048
69 Ga0065714_10064770 3300005288 Bacteria 19370
70 Ga0065714_10067085 3300005288 Bacteria 5864
71 Ga0065714_10068951 3300005288 Bacteria 4451
72 Ga0065714_10081337 3300005288 Bacteria 2377
73 Ga0065704_10070136 3300005289 Bacteria 560402
74 Ga0065704_10070374 3300005289 Bacteria 28734
75 Ga0065704_10070934 3300005289 Bacteria 14451
76 Ga0065704_10071262 3300005289 Bacteria 12166
77 Ga0065704_10073279 3300005289 Bacteria 7354
78 Ga0065704_10074546 3300005289 Bacteria 6194
79 Ga0065704_10082725 3300005289 Bacteria 3559
80 Ga0065704_10084719 3300005289 Bacteria 3304
81 Ga0065704_10095111 3300005289 Bacteria 2505
82 Ga0065704_10098586 3300005289 Bacteria 2347
83 Ga0065712_10001912 3300005290 Bacteria 13957
84 Ga0065712_10099197 3300005290 Bacteria 2098
85 Ga0065715_10005294 3300005293 Bacteria 4057
86 Ga0065715_10088952 3300005293 Bacteria 20962
87 Ga0065715_10133208 3300005293 Bacteria 1976
88 Ga0065715_10165505 3300005293 Bacteria 1590
89 Ga0065707_10175618 3300005295 Bacteria 1453
90 Ga0070658_10000011 3300005327 Bacteria 294396
91 Ga0070658_10000515 3300005327 Bacteria 33566
92 Ga0070658_10008589 3300005327 Bacteria 8214
93 Ga0070658_10115992 3300005327 Bacteria 2222
94 Ga0070658_10134793 3300005327 Bacteria 2059
95 Ga0070658_10224479 3300005327 Bacteria 1589
96 Ga0070658_10278492 3300005327 Bacteria 1423
97 Ga0070676_10000277 3300005328 Bacteria 22624
98 Ga0070676_10002355 3300005328 Bacteria 9671
99 Ga0070676_10094701 3300005328 Bacteria 1835
100 Ga0070683_100002536 3300005329 Bacteria 14576
101 Ga0070683_100003504 3300005329 Bacteria 12763
102 Ga0070683_100004268 3300005329 Bacteria 11731
103 Ga0070683_100006103 3300005329 Bacteria 10103
104 Ga0070683_100010704 3300005329 Bacteria 7886
105 Ga0070683_100075911 3300005329 Bacteria 3141
106 Ga0070690_100010328 3300005330 Bacteria 5430
107 Ga0070690_100022642 3300005330 Bacteria 3845
108 Ga0070670_100015632 3300005331 Bacteria 6517
109 Ga0070670_100032500 3300005331 Bacteria 4494
110 Ga0070670_100038445 3300005331 Bacteria 4115
111 Ga0070670_100081448 3300005331 Bacteria 2781
112 Ga0070670_100188523 3300005331 Bacteria 1791
113 Ga0068869_100000827 3300005334 Bacteria 17676
114 Ga0068869_100005917 3300005334 Bacteria 7728
115 Ga0068869_100007558 3300005334 Bacteria 6955
116 Ga0068869_100032239 3300005334 Bacteria 3691
117 Ga0070666_10000323 3300005335 Bacteria 30548
118 Ga0070666_10001233 3300005335 Bacteria 15463
119 Ga0070666_10151143 3300005335 Bacteria 1620
120 Ga0070666_10199298 3300005335 Bacteria 1408
121 Ga0070680_100010203 3300005336 Bacteria 7242
122 Ga0070680_100024474 3300005336 Bacteria 4824
123 Ga0070680_100070642 3300005336 Bacteria 2868
124 Ga0070680_100088593 3300005336 Bacteria 2560
125 Ga0070680_100138593 3300005336 Bacteria 2039
126 Ga0070680_100250961 3300005336 Bacteria 1496
127 Ga0070682_100000039 3300005337 Bacteria 144400
128 Ga0070682_100000625 3300005337 Bacteria 21518
129 Ga0070682_100009958 3300005337 Bacteria 5384
130 Ga0070682_100026312 3300005337 Bacteria 3481
131 Ga0068868_100004571 3300005338 Bacteria 9714
132 Ga0068868_100009633 3300005338 Bacteria 6967
133 Ga0068868_100035974 3300005338 Bacteria 3830
134 Ga0070660_100001306 3300005339 Bacteria 16984
135 Ga0070660_100002764 3300005339 Bacteria 12054
136 Ga0070660_100015693 3300005339 Bacteria 5477
137 Ga0070660_100130765 3300005339 Bacteria 2009
138 Ga0070689_100010555 3300005340 Bacteria 6584
139 Ga0070689_100028711 3300005340 Bacteria 4207
140 Ga0070689_100080880 3300005340 Bacteria 2550
141 Ga0070689_100299370 3300005340 Bacteria 1338
142 Ga0070691_10000660 3300005341 Bacteria 13368
143 Ga0070691_10020602 3300005341 Bacteria 3047
144 Ga0070687_100001432 3300005343 Bacteria 8384
145 Ga0070687_100069461 3300005343 Bacteria 1886
146 Ga0070661_100002636 3300005344 Bacteria 12270
147 Ga0070661_100010432 3300005344 Bacteria 6460
148 Ga0070661_100011068 3300005344 Bacteria 6283
149 Ga0070668_100004869 3300005347 Bacteria 9948
150 Ga0070668_100014483 3300005347 Bacteria 5895
151 Ga0070668_100023632 3300005347 Bacteria 4651
152 Ga0070668_100041596 3300005347 Bacteria 3521
153 Ga0070669_100057612 3300005353 Bacteria 2851
154 Ga0070669_100078997 3300005353 Bacteria 2446
155 Ga0070669_100174934 3300005353 Bacteria 1676
156 Ga0070669_100254111 3300005353 Bacteria 1400
157 Ga0070675_100003849 3300005354 Bacteria 11389
158 Ga0070675_100016358 3300005354 Bacteria 5886
159 Ga0070675_100036218 3300005354 Bacteria 4014
160 Ga0070675_100059652 3300005354 Bacteria 3148
161 Ga0070671_100019758 3300005355 Bacteria 5487
162 Ga0070671_100030050 3300005355 Bacteria 4483
163 Ga0070671_100061292 3300005355 Bacteria 3133
164 Ga0070671_100111333 3300005355 Bacteria 2300
165 Ga0070671_100124488 3300005355 Bacteria 2170
166 Ga0070673_100002393 3300005364 Bacteria 11418
167 Ga0070673_100003782 3300005364 Bacteria 9493
168 Ga0070673_100004396 3300005364 Bacteria 8911
169 Ga0070673_100012715 3300005364 Bacteria 5789
170 Ga0070673_100018686 3300005364 Bacteria 4959
171 Ga0070673_100149118 3300005364 Bacteria 1979
172 Ga0070688_100012071 3300005365 Bacteria 4826
173 Ga0070688_100026240 3300005365 Bacteria 3460
174 Ga0070659_100002083 3300005366 Bacteria 14235
175 Ga0070659_100003545 3300005366 Bacteria 11112
176 Ga0070659_100010122 3300005366 Bacteria 6941
177 Ga0070659_100018139 3300005366 Bacteria 5308
178 Ga0070667_100005690 3300005367 Bacteria 10406
179 Ga0070667_100068663 3300005367 Bacteria 3016
180 Ga0070667_100244374 3300005367 Bacteria 1603
181 Ga0070678_100004999 3300005456 Bacteria 7599
182 Ga0070678_100006236 3300005456 Bacteria 6976
183 Ga0070678_100018818 3300005456 Bacteria 4485
184 Ga0070678_100151126 3300005456 Bacteria 1870
185 Ga0070662_100000032 3300005457 Bacteria 78824
186 Ga0070662_100022191 3300005457 Bacteria 4342
187 Ga0070662_100030585 3300005457 Bacteria 3769
188 Ga0070662_100056919 3300005457 Bacteria 2839
189 Ga0070662_100059188 3300005457 Bacteria 2790
190 Ga0070662_100086776 3300005457 Bacteria 2341
191 Ga0070681_10017068 3300005458 Bacteria 7255
192 Ga0070681_10018726 3300005458 Bacteria 6929
193 Ga0070681_10034740 3300005458 Bacteria 5063
194 Ga0070681_10036428 3300005458 Bacteria 4940
195 Ga0070681_10064666 3300005458 Bacteria 3628
196 Ga0068867_100009759 3300005459 Bacteria 6765
197 Ga0068867_100010951 3300005459 Bacteria 6395
198 Ga0068867_100023644 3300005459 Bacteria 4400
199 Ga0068867_100033878 3300005459 Bacteria 3701
200 Ga0068867_100059230 3300005459 Bacteria 2839
201 Ga0068867_100163733 3300005459 Bacteria 1756
202 Ga0068867_100276500 3300005459 Unclassified 1375
203 Ga0070685_10048201 3300005466 Bacteria 2453
204 Ga0070685_10072252 3300005466 Bacteria 2047
205 Ga0070685_10117310 3300005466 Bacteria 1648
206 Ga0070698_100002644 3300005471 Bacteria 19745
207 Ga0070698_100016067 3300005471 Bacteria 7903
208 Ga0070679_100025505 3300005530 Bacteria 5802
209 Ga0070679_100030821 3300005530 Bacteria 5298
210 Ga0070679_100042499 3300005530 Bacteria 4527
211 Ga0070679_100042689 3300005530 Bacteria 4516
212 Ga0070679_100066869 3300005530 Bacteria 3584
213 Ga0070679_100111026 3300005530 Bacteria 2728
214 Ga0070684_100000097 3300005535 Bacteria 56477
215 Ga0070684_100011014 3300005535 Bacteria 7193
216 Ga0070684_100027061 3300005535 Bacteria 4836
217 Ga0070684_100036492 3300005535 Bacteria 4212
218 Ga0070684_100056838 3300005535 Bacteria 3416
219 Ga0068853_100004545 3300005539 Bacteria 10768
220 Ga0068853_100008299 3300005539 Bacteria 8339
221 Ga0068853_100008727 3300005539 Bacteria 8154
222 Ga0068853_100028221 3300005539 Bacteria 4719
223 Ga0068853_100057738 3300005539 Bacteria 3350
224 Ga0068853_100082062 3300005539 Bacteria 2823
225 Ga0068853_100105194 3300005539 Bacteria 2500
226 Ga0068853_100234405 3300005539 Bacteria 1680
227 Ga0070672_100000061 3300005543 Bacteria 49701
228 Ga0070672_100017587 3300005543 Bacteria 5150
229 Ga0070672_100050540 3300005543 Bacteria 3238
230 Ga0070686_100023709 3300005544 Bacteria 3671
231 Ga0070686_100048162 3300005544 Bacteria 2699
232 Ga0070693_100006957 3300005547 Bacteria 5503
233 Ga0070693_100117735 3300005547 Bacteria 1644
234 Ga0070665_100000002 3300005548 Bacteria 849037
235 Ga0070665_100000003 3300005548 Bacteria 811857
236 Ga0070665_100005248 3300005548 Bacteria 13397
237 Ga0070665_100008467 3300005548 Bacteria 10406
238 Ga0070665_100049998 3300005548 Bacteria 4195
239 Ga0070665_100311945 3300005548 Bacteria 1577
240 Ga0068855_100000042 3300005563 Bacteria 149332
241 Ga0068855_100000439 3300005563 Bacteria 51399
242 Ga0068855_100000508 3300005563 Bacteria 48055
243 Ga0068855_100011561 3300005563 Bacteria 10660
244 Ga0068855_100027104 3300005563 Bacteria 6856
245 Ga0068855_100032170 3300005563 Bacteria 6263
246 Ga0068855_100039110 3300005563 Bacteria 5631
247 Ga0068855_100048633 3300005563 Bacteria 5004
248 Ga0068855_100062885 3300005563 Bacteria 4333
249 Ga0068855_100066337 3300005563 Bacteria 4208
250 Ga0068855_100116249 3300005563 Bacteria 3066
251 Ga0068855_100152650 3300005563 Bacteria 2626
252 Ga0068855_100253898 3300005563 Bacteria 1961
253 Ga0068855_100282407 3300005563 Bacteria 1843
254 Ga0070664_100002153 3300005564 Bacteria 15793
255 Ga0070664_100003785 3300005564 Bacteria 12203
256 Ga0070664_100004253 3300005564 Bacteria 11514
257 Ga0070664_100022827 3300005564 Bacteria 5161
258 Ga0070664_100052278 3300005564 Bacteria 3460
259 Ga0068857_100001948 3300005577 Bacteria 16668
260 Ga0068857_100010962 3300005577 Bacteria 7888
261 Ga0068857_100025799 3300005577 Bacteria 5175
262 Ga0068857_100125503 3300005577 Bacteria 2313
263 Ga0068857_100137879 3300005577 Bacteria 2204
264 Ga0068857_100222750 3300005577 Bacteria 1723
265 Ga0068854_100007137 3300005578 Bacteria 7133
266 Ga0068854_100020090 3300005578 Bacteria 4511
267 Ga0068854_100054632 3300005578 Bacteria 2873
268 Ga0068856_100000794 3300005614 Bacteria 34105
269 Ga0068856_100024601 3300005614 Bacteria 5862
270 Ga0068856_100040048 3300005614 Bacteria 4601
271 Ga0068856_100113608 3300005614 Bacteria 2706
272 Ga0068856_100223899 3300005614 Bacteria 1896
273 Ga0070702_100051565 3300005615 Bacteria 2356
274 Ga0068852_100002452 3300005616 Bacteria 12774
275 Ga0068852_100010222 3300005616 Bacteria 6996
276 Ga0068852_100016457 3300005616 Bacteria 5768
277 Ga0068852_100024730 3300005616 Bacteria 4858
278 Ga0068852_100047320 3300005616 Bacteria 3669
279 Ga0068852_100080351 3300005616 Bacteria 2890
280 Ga0068859_100000106 3300005617 Bacteria 78128
281 Ga0068859_100007461 3300005617 Bacteria 11100
282 Ga0068859_100008808 3300005617 Bacteria 10188
283 Ga0068859_100080263 3300005617 Bacteria 3303
284 Ga0068859_100136898 3300005617 Bacteria 2522
285 Ga0068859_100305465 3300005617 Bacteria 1684
286 Ga0068864_100003370 3300005618 Bacteria 13210
287 Ga0068864_100011427 3300005618 Bacteria 7334
288 Ga0068864_100043993 3300005618 Bacteria 3825
289 Ga0068864_100111824 3300005618 Bacteria 2434
290 Ga0068861_100013324 3300005719 Bacteria 5753
291 Ga0068861_100034298 3300005719 Bacteria 3752
292 Ga0068861_100160171 3300005719 Unclassified 1856
293 Ga0068861_100268986 3300005719 Bacteria 1463
294 Ga0068851_10000465 3300005834 Bacteria 17865
295 Ga0068851_10047056 3300005834 Bacteria 2183
296 Ga0068851_10075702 3300005834 Bacteria 1749
297 Ga0068870_10028876 3300005840 Bacteria 2789
298 Ga0068870_10088051 3300005840 Bacteria 1730
299 Ga0068863_100001273 3300005841 Bacteria 25131
300 Ga0068863_100006081 3300005841 Bacteria 11840
301 Ga0068863_100011467 3300005841 Bacteria 8571
302 Ga0068863_100032496 3300005841 Bacteria 4975
303 Ga0068863_100048536 3300005841 Bacteria 4026
304 Ga0068863_100076978 3300005841 Bacteria 3156
305 Ga0068863_100177698 3300005841 Bacteria 2043
306 Ga0068863_100238773 3300005841 Bacteria 1754
307 Ga0068863_100302941 3300005841 Bacteria 1550
308 Ga0068858_100000930 3300005842 Bacteria 30365
309 Ga0068858_100006822 3300005842 Bacteria 11107
310 Ga0068858_100016470 3300005842 Bacteria 6941
311 Ga0068858_100149041 3300005842 Bacteria 2199
312 Ga0068860_100000003 3300005843 Bacteria 575741
313 Ga0068860_100003491 3300005843 Bacteria 16182
314 Ga0068860_100009409 3300005843 Bacteria 9711
315 Ga0068860_100011027 3300005843 Bacteria 8911
316 Ga0068860_100026307 3300005843 Bacteria 5610
317 Ga0068862_100006586 3300005844 Bacteria 9629
318 Ga0068862_100076920 3300005844 Bacteria 2889
319 Ga0068862_100142298 3300005844 Bacteria 2130
320 Ga0081540_1040101 3300005983 Unclassified 2445
321 Ga0081539_10001169 3300005985 Bacteria 47510
322 Ga0081539_10029490 3300005985 Bacteria 3426
323 Ga0075366_10001072 3300006195 Bacteria 13441
324 Ga0075366_10007887 3300006195 Bacteria 5889
325 Ga0075366_10009701 3300006195 Bacteria 5381
326 Ga0075366_10021500 3300006195 Bacteria 3750
327 Ga0075366_10021509 3300006195 Bacteria 3750
328 Ga0075366_10106071 3300006195 Bacteria 1689
329 Ga0097621_100000165 3300006237 Bacteria 41398
330 Ga0097621_100000531 3300006237 Bacteria 26760
331 Ga0097621_100006425 3300006237 Bacteria 8342
332 Ga0097621_100016683 3300006237 Bacteria 5559
333 Ga0097621_100068802 3300006237 Bacteria 2921
334 Ga0097621_100070099 3300006237 Bacteria 2894
335 Ga0097621_100109977 3300006237 Bacteria 2328
336 Ga0097621_100156438 3300006237 Bacteria 1957
337 Ga0068871_100000018 3300006358 Bacteria 89690
338 Ga0068871_100000042 3300006358 Bacteria 67951
339 Ga0068871_100001712 3300006358 Bacteria 14753
340 Ga0068871_100002324 3300006358 Bacteria 12946
341 Ga0068871_100002902 3300006358 Bacteria 11755
342 Ga0068871_100007826 3300006358 Bacteria 7657
343 Ga0068871_100012489 3300006358 Bacteria 6266
344 Ga0068871_100039588 3300006358 Bacteria 3772
345 Ga0075428_100004442 3300006844 Bacteria 15481
346 Ga0075428_100010463 3300006844 Bacteria 10305
347 Ga0075428_100011907 3300006844 Bacteria 9675
348 Ga0075430_100004975 3300006846 Bacteria 11184
349 Ga0075431_100026391 3300006847 Bacteria 5960
350 Ga0075429_100030837 3300006880 Bacteria 4659
351 Ga0075429_100071292 3300006880 Bacteria 3025
352 Ga0068865_100000396 3300006881 Bacteria 24307
353 Ga0068865_100001997 3300006881 Bacteria 12048
354 Ga0068865_100051065 3300006881 Bacteria 2860
355 Ga0097620_100000106 3300006931 Bacteria 78128
356 Ga0097620_100007461 3300006931 Bacteria 11100
357 Ga0097620_100008808 3300006931 Bacteria 10188
358 Ga0097620_100080264 3300006931 Bacteria 3303
359 Ga0097620_100136895 3300006931 Bacteria 2522
360 Ga0097620_100305481 3300006931 Bacteria 1684
361 Ga0099824_1002886 3300006942 Bacteria 25147
362 Ga0079104_1000179 3300006946 Bacteria 90381
363 Ga0099826_10037265 3300006948 Bacteria 3428
364 Ga0105251_10043569 3300009011 Bacteria 2172
365 Ga0105244_10000004 3300009036 Bacteria 492478
366 Ga0105244_10000011 3300009036 Bacteria 263939
367 Ga0105240_10000037 3300009093 Bacteria 270462
368 Ga0105240_10000237 3300009093 Bacteria 109895
369 Ga0105240_10000367 3300009093 Bacteria 84666
370 Ga0105240_10000487 3300009093 Bacteria 73453
371 Ga0105240_10005515 3300009093 Bacteria 18851
372 Ga0105240_10022011 3300009093 Bacteria 8465
373 Ga0105240_10039540 3300009093 Bacteria 6039
374 Ga0105240_10042495 3300009093 Bacteria 5791
375 Ga0105240_10043261 3300009093 Bacteria 5732
376 Ga0105240_10069454 3300009093 Bacteria 4360
377 Ga0105240_10104541 3300009093 Bacteria 3439
378 Ga0105240_10113999 3300009093 Bacteria 3266
379 Ga0105240_10181056 3300009093 Bacteria 2487
380 Ga0105240_10245699 3300009093 Bacteria 2073
381 Ga0111539_10014918 3300009094 Bacteria 9685
382 Ga0111539_10017967 3300009094 Bacteria 8760
383 Ga0111539_10066976 3300009094 Bacteria 4242
384 Ga0111539_10162149 3300009094 Bacteria 2615
385 Ga0105245_10173353 3300009098 Unclassified 2056
386 Ga0105247_10000918 3300009101 Bacteria 22128
387 Ga0105247_10011475 3300009101 Bacteria 5342
388 Ga0105247_10037908 3300009101 Bacteria 2941
389 Ga0114129_10012446 3300009147 Bacteria 12112
390 Ga0114129_10052518 3300009147 Bacteria 5720
391 Ga0105243_10000009 3300009148 Bacteria 354419
392 Ga0105243_10000145 3300009148 Bacteria 81468
393 Ga0105243_10172389 3300009148 Unclassified 1875
394 Ga0105241_10001462 3300009174 Bacteria 18113
395 Ga0105241_10002922 3300009174 Bacteria 12760
396 Ga0105241_10003042 3300009174 Bacteria 12514
397 Ga0105241_10005760 3300009174 Bacteria 9147
398 Ga0105241_10007004 3300009174 Bacteria 8292
399 Ga0105241_10030640 3300009174 Bacteria 4022
400 Ga0105241_10084882 3300009174 Bacteria 2487
401 Ga0105241_10114505 3300009174 Unclassified 2163
402 Ga0105242_10006535 3300009176 Bacteria 8974
403 Ga0105242_10036683 3300009176 Bacteria 3934
404 Ga0105242_10086686 3300009176 Bacteria 2628
405 Ga0105242_10121133 3300009176 Bacteria 2245
406 Ga0105248_10004482 3300009177 Bacteria 15453
407 Ga0105248_10032533 3300009177 Bacteria 5828
408 Ga0105248_10256759 3300009177 Unclassified 1967
409 Ga0105237_10000224 3300009545 Bacteria 79854
410 Ga0105237_10000729 3300009545 Bacteria 45381
411 Ga0105237_10000952 3300009545 Bacteria 38921
412 Ga0105237_10000963 3300009545 Bacteria 38740
413 Ga0105237_10001948 3300009545 Bacteria 26296
414 Ga0105237_10002321 3300009545 Bacteria 23628
415 Ga0105237_10003093 3300009545 Bacteria 20049
416 Ga0105237_10004043 3300009545 Bacteria 17124
417 Ga0105237_10008222 3300009545 Bacteria 11332
418 Ga0105237_10009903 3300009545 Bacteria 10175
419 Ga0105237_10019011 3300009545 Bacteria 7101
420 Ga0105237_10021687 3300009545 Bacteria 6601
421 Ga0105237_10033447 3300009545 Bacteria 5208
422 Ga0105237_10040318 3300009545 Bacteria 4710
423 Ga0105237_10179810 3300009545 Bacteria 2116
424 Ga0105237_10192111 3300009545 Bacteria 2041
425 Ga0105237_10217300 3300009545 Bacteria 1911
426 Ga0105237_10297085 3300009545 Bacteria 1618
427 Ga0105238_10004274 3300009551 Bacteria 14194
428 Ga0105238_10013318 3300009551 Bacteria 8298
429 Ga0105238_10037769 3300009551 Bacteria 4907
430 Ga0105238_10203974 3300009551 Bacteria 1953
431 Ga0105238_10279964 3300009551 Bacteria 1649
432 Ga0105249_10001226 3300009553 Bacteria 22548
433 Ga0105249_10002137 3300009553 Bacteria 17128
434 Ga0105249_10019422 3300009553 Bacteria 6064
435 Ga0105249_10021227 3300009553 Bacteria 5814
436 Ga0105249_10024010 3300009553 Bacteria 5476
437 Ga0105249_10035542 3300009553 Bacteria 4519
438 Ga0105249_10115485 3300009553 Bacteria 2543
439 Ga0105249_10180744 3300009553 Bacteria 2052
440 Ga0105249_10198919 3300009553 Bacteria 1960
441 Ga0105249_10315500 3300009553 Unclassified 1573
442 Ga0105239_10000002 3300010375 Bacteria 610298
443 Ga0105239_10000013 3300010375 Bacteria 327371
444 Ga0105239_10000283 3300010375 Bacteria 74612
445 Ga0105239_10001207 3300010375 Bacteria 35283
446 Ga0105239_10001438 3300010375 Bacteria 31747
447 Ga0105239_10003665 3300010375 Bacteria 18762
448 Ga0105239_10006888 3300010375 Bacteria 13111
449 Ga0105239_10024908 3300010375 Bacteria 6590
450 Ga0105239_10025175 3300010375 Bacteria 6554
451 Ga0105239_10061828 3300010375 Bacteria 4110
452 Ga0105239_10123544 3300010375 Bacteria 2876
453 Ga0105239_10150086 3300010375 Bacteria 2601
454 Ga0105239_10258859 3300010375 Bacteria 1955
455 Ga0105239_10291504 3300010375 Bacteria 1837
456 Ga0105239_10383807 3300010375 Bacteria 1588
457 Ga0157373_10000002 3300013100 Bacteria 750094
458 Ga0157373_10000005 3300013100 Bacteria 262158
459 Ga0157373_10000256 3300013100 Bacteria 43374
460 Ga0157373_10000936 3300013100 Bacteria 22553
461 Ga0157373_10001318 3300013100 Bacteria 18986
462 Ga0157373_10002482 3300013100 Bacteria 14050
463 Ga0157373_10003984 3300013100 Bacteria 11138
464 Ga0157373_10024469 3300013100 Bacteria 4373
465 Ga0157373_10025270 3300013100 Bacteria 4297
466 Ga0157373_10031635 3300013100 Bacteria 3808
467 Ga0157373_10032956 3300013100 Bacteria 3729
468 Ga0157373_10033565 3300013100 Bacteria 3691
469 Ga0157373_10087296 3300013100 Bacteria 2198
470 Ga0157373_10087541 3300013100 Bacteria 2194
471 Ga0157373_10219732 3300013100 Bacteria 1340
472 Ga0157371_10000046 3300013102 Bacteria 187304
473 Ga0157371_10000079 3300013102 Bacteria 152295
474 Ga0157371_10000216 3300013102 Bacteria 83975
475 Ga0157371_10000741 3300013102 Bacteria 38124
476 Ga0157371_10001331 3300013102 Bacteria 25968
477 Ga0157371_10002552 3300013102 Bacteria 17284
478 Ga0157371_10003861 3300013102 Bacteria 13371
479 Ga0157371_10011763 3300013102 Bacteria 6723
480 Ga0157371_10015344 3300013102 Bacteria 5750
481 Ga0157371_10017592 3300013102 Bacteria 5306
482 Ga0157371_10017639 3300013102 Bacteria 5296
483 Ga0157371_10018024 3300013102 Bacteria 5229
484 Ga0157371_10027826 3300013102 Bacteria 4097
485 Ga0157371_10040330 3300013102 Bacteria 3335
486 Ga0157371_10104115 3300013102 Bacteria 2014
487 Ga0157370_10001014 3300013104 Bacteria 35409
488 Ga0157370_10002361 3300013104 Bacteria 22770
489 Ga0157370_10003143 3300013104 Bacteria 19558
490 Ga0157370_10003236 3300013104 Bacteria 19218
491 Ga0157370_10003785 3300013104 Bacteria 17653
492 Ga0157370_10007303 3300013104 Bacteria 12057
493 Ga0157370_10017885 3300013104 Bacteria 7141
494 Ga0157370_10018487 3300013104 Bacteria 7006
495 Ga0157370_10020395 3300013104 Bacteria 6621
496 Ga0157370_10020909 3300013104 Bacteria 6528
497 Ga0157370_10022590 3300013104 Bacteria 6259
498 Ga0157370_10023049 3300013104 Bacteria 6188
499 Ga0157370_10030370 3300013104 Bacteria 5295
500 Ga0157370_10052885 3300013104 Bacteria 3875
501 Ga0157370_10074178 3300013104 Bacteria 3209
502 Ga0157370_10117145 3300013104 Bacteria 2488
503 Ga0157370_10120995 3300013104 Bacteria 2444
504 Ga0157370_10121149 3300013104 Bacteria 2442
505 Ga0157370_10179980 3300013104 Bacteria 1965
506 Ga0157370_10196518 3300013104 Bacteria 1872
507 Ga0157370_10208645 3300013104 Bacteria 1811
508 Ga0157370_10274035 3300013104 Bacteria 1559
509 Ga0157370_10277171 3300013104 Bacteria 1549
510 Ga0157369_10000046 3300013105 Bacteria 172851
511 Ga0157369_10002118 3300013105 Bacteria 23921
512 Ga0157369_10002262 3300013105 Bacteria 23146
513 Ga0157369_10009363 3300013105 Bacteria 11200
514 Ga0157369_10013763 3300013105 Bacteria 9145
515 Ga0157369_10019087 3300013105 Bacteria 7676
516 Ga0157369_10023605 3300013105 Bacteria 6850
517 Ga0157369_10026663 3300013105 Bacteria 6408
518 Ga0157369_10041152 3300013105 Bacteria 5044
519 Ga0157369_10061645 3300013105 Bacteria 4043
520 Ga0157369_10141071 3300013105 Unclassified 2550
521 Ga0157374_10000013 3300013296 Bacteria 461240
522 Ga0157374_10000348 3300013296 Bacteria 42744
523 Ga0157374_10003727 3300013296 Bacteria 12805
524 Ga0157374_10010061 3300013296 Bacteria 8119
525 Ga0157374_10010541 3300013296 Bacteria 7955
526 Ga0157374_10013448 3300013296 Bacteria 7142
527 Ga0157374_10019587 3300013296 Bacteria 5990
528 Ga0157374_10020034 3300013296 Bacteria 5930
529 Ga0157378_10000859 3300013297 Bacteria 28140
530 Ga0157378_10009983 3300013297 Bacteria 8279
531 Ga0157378_10018192 3300013297 Bacteria 6170
532 Ga0157378_10024509 3300013297 Bacteria 5310
533 Ga0157378_10035235 3300013297 Bacteria 4426
534 Ga0157378_10057795 3300013297 Bacteria 3458
535 Ga0157378_10084952 3300013297 Bacteria 2867
536 Ga0157378_10102551 3300013297 Bacteria 2613
537 Ga0163162_10000031 3300013306 Bacteria 157666
538 Ga0163162_10000037 3300013306 Bacteria 138420
539 Ga0163162_10000244 3300013306 Bacteria 49260
540 Ga0163162_10000952 3300013306 Bacteria 26875
541 Ga0163162_10001265 3300013306 Bacteria 23633
542 Ga0163162_10001894 3300013306 Bacteria 19706
543 Ga0163162_10002681 3300013306 Bacteria 16870
544 Ga0163162_10003934 3300013306 Bacteria 14252
545 Ga0163162_10011449 3300013306 Bacteria 8650
546 Ga0163162_10013001 3300013306 Bacteria 8123
547 Ga0163162_10041760 3300013306 Bacteria 4589
548 Ga0163162_10061943 3300013306 Bacteria 3780
549 Ga0163162_10109520 3300013306 Bacteria 2859
550 Ga0163162_10141494 3300013306 Bacteria 2520
551 Ga0163162_10177711 3300013306 Bacteria 2254
552 Ga0163162_10180543 3300013306 Bacteria 2237
553 Ga0163162_10304066 3300013306 Bacteria 1727
554 Ga0163162_10368026 3300013306 Bacteria 1570
555 Ga0163162_10385396 3300013306 Bacteria 1535
556 Ga0157372_10000001 3300013307 Bacteria 791349
557 Ga0157372_10000707 3300013307 Bacteria 36672
558 Ga0157372_10003090 3300013307 Bacteria 17926
559 Ga0157372_10005652 3300013307 Bacteria 13296
560 Ga0157372_10014060 3300013307 Bacteria 8549
561 Ga0157372_10018492 3300013307 Bacteria 7492
562 Ga0157372_10023207 3300013307 Bacteria 6723
563 Ga0157372_10038494 3300013307 Bacteria 5278
564 Ga0157372_10040958 3300013307 Bacteria 5120
565 Ga0157372_10051481 3300013307 Bacteria 4583
566 Ga0157372_10052820 3300013307 Bacteria 4527
567 Ga0157372_10071932 3300013307 Bacteria 3896
568 Ga0157372_10104350 3300013307 Bacteria 3240
569 Ga0157372_10117099 3300013307 Bacteria 3055
570 Ga0157372_10139872 3300013307 Bacteria 2788
571 Ga0157372_10304866 3300013307 Bacteria 1853
572 Ga0157372_10474873 3300013307 Bacteria 1458
573 Ga0157372_10547311 3300013307 Bacteria 1349
574 Ga0157375_10000182 3300013308 Bacteria 59120
575 Ga0157375_10000722 3300013308 Bacteria 29134
576 Ga0157375_10005427 3300013308 Bacteria 11084
577 Ga0157375_10023572 3300013308 Bacteria 5680
578 Ga0157375_10033488 3300013308 Bacteria 4883
579 Ga0157375_10043772 3300013308 Bacteria 4344
580 Ga0157375_10053361 3300013308 Bacteria 3977
581 Ga0157375_10108003 3300013308 Bacteria 2877
582 Ga0157375_10136084 3300013308 Bacteria 2581
583 Ga0157375_10137542 3300013308 Unclassified 2568
584 Ga0157375_10525828 3300013308 Bacteria 1346
585 Ga0163163_10000088 3300014325 Bacteria 101126
586 Ga0163163_10000272 3300014325 Bacteria 51699
587 Ga0163163_10000557 3300014325 Bacteria 32741
588 Ga0163163_10005005 3300014325 Bacteria 11420
589 Ga0163163_10069653 3300014325 Bacteria 3502
590 Ga0163163_10106889 3300014325 Bacteria 2825
591 Ga0163163_10193974 3300014325 Bacteria 2079
592 Ga0157380_10000165 3300014326 Bacteria 38063
593 Ga0157380_10005528 3300014326 Bacteria 8835
594 Ga0157380_10089543 3300014326 Bacteria 2535
595 Ga0182008_10000025 3300014497 Bacteria 191222
596 Ga0182008_10000037 3300014497 Bacteria 129884
597 Ga0182008_10000058 3300014497 Bacteria 100175
598 Ga0182008_10000208 3300014497 Bacteria 46272
599 Ga0157377_10006557 3300014745 Bacteria 5561
600 Ga0157377_10012438 3300014745 Bacteria 4279
601 Ga0157377_10081857 3300014745 Unclassified 1889
602 Ga0157379_10000103 3300014968 Bacteria 58102
603 Ga0157379_10018557 3300014968 Bacteria 6135
604 Ga0157379_10019354 3300014968 Bacteria 6012
605 Ga0157379_10082847 3300014968 Bacteria 2874
606 Ga0157379_10115491 3300014968 Bacteria 2413
607 Ga0157376_10000484 3300014969 Bacteria 25711
608 Ga0157376_10002418 3300014969 Bacteria 12621
609 Ga0157376_10003397 3300014969 Bacteria 10958
610 Ga0157376_10005152 3300014969 Bacteria 9116
611 Ga0157376_10045090 3300014969 Bacteria 3628
612 Ga0157376_10162598 3300014969 Bacteria 2025
613 Ga0182006_1000039 3300015261 Bacteria 211568
614 Ga0182006_1000333 3300015261 Bacteria 40401
615 Ga0182006_1000576 3300015261 Bacteria 27061
616 Ga0182006_1002025 3300015261 Bacteria 11378
617 Ga0182006_1003058 3300015261 Bacteria 8777
618 Ga0182006_1003255 3300015261 Bacteria 8413
619 Ga0182006_1007354 3300015261 Bacteria 5045
620 Ga0182006_1008043 3300015261 Bacteria 4791
621 Ga0182007_10000009 3300015262 Bacteria 316298
622 Ga0182007_10037797 3300015262 Bacteria 1620
623 Ga0182005_1000023 3300015265 Bacteria 246328
624 Ga0183373_1008 3300015682 Bacteria 255339
625 Ga0163161_10000007 3300017792 Bacteria 301614
626 Ga0163161_10000343 3300017792 Bacteria 39534
627 Ga0163161_10000628 3300017792 Bacteria 28142
628 Ga0163161_10001101 3300017792 Bacteria 20390
629 Ga0163161_10002195 3300017792 Bacteria 14086
630 Ga0163161_10015712 3300017792 Bacteria 5279
631 Ga0163161_10039788 3300017792 Bacteria 3377
632 Ga0163161_10051457 3300017792 Bacteria 2983
633 Ga0163161_10140016 3300017792 Unclassified 1831
634 Ga0163161_10196122 3300017792 Bacteria 1554
635 Ga0163161_10302341 3300017792 Bacteria 1260
636 Ga0206351_10868731 3300020077 Bacteria 3041
637 Ga0154015_1577688 3300020610 Bacteria 2133
638 Ga0213876_10002723 3300021384 Bacteria 10296
639 Ga0224712_10004532 3300022467 Bacteria 3757
640 Ga0209436_101725 3300025208 Bacteria 7199
641 Ga0207427_100103 3300025231 Bacteria 119618
642 Ga0209437_100017 3300025233 Bacteria 694471
643 Ga0209437_100101 3300025233 Bacteria 226668
644 Ga0209258_100068 3300025242 Bacteria 286288
645 Ga0207425_1000008 3300025245 Bacteria 618024
646 Ga0209646_1000003 3300025246 Bacteria 1160860
647 Ga0209646_1010115 3300025246 Bacteria 1485
648 Ga0209026_1000222 3300025250 Bacteria 77765
649 Ga0209026_1000244 3300025250 Bacteria 69490
650 Ga0209026_1001716 3300025250 Bacteria 9131
651 Ga0209026_1003574 3300025250 Bacteria 5024
652 Ga0209148_1000182 3300025254 Bacteria 123558
653 Ga0209129_1000042 3300025258 Bacteria 305537
654 Ga0209233_1000124 3300025261 Bacteria 226743
655 Ga0209233_1003362 3300025261 Bacteria 5655
656 Ga0209455_1005644 3300025272 Bacteria 3825
657 Ga0209673_1000194 3300025273 Bacteria 122640
658 Ga0209130_1002722 3300025284 Bacteria 8381
659 Ga0209675_1000935 3300025291 Bacteria 18609
660 Ga0209676_1000009 3300025292 Bacteria 981719
661 Ga0209676_1001085 3300025292 Bacteria 30593
662 Ga0209025_1000020 3300025294 Bacteria 618024
663 Ga0209564_1003234 3300025295 Bacteria 11407
664 Ga0209758_1000022 3300025297 Bacteria 618024
665 Ga0209758_1013178 3300025297 Bacteria 4540
666 Ga0209758_1016995 3300025297 Bacteria 3655
667 Ga0209758_1039628 3300025297 Bacteria 1789
668 Ga0209050_1000103 3300025298 Bacteria 229225
669 Ga0209050_1000136 3300025298 Bacteria 179113
670 Ga0209050_1005897 3300025298 Bacteria 7482
671 Ga0209050_1023844 3300025298 Bacteria 2137
672 Ga0207426_1000026 3300025302 Bacteria 515228
673 Ga0207426_1000341 3300025302 Bacteria 87735
674 Ga0207426_1000455 3300025302 Bacteria 64858
675 Ga0207426_1006168 3300025302 Bacteria 5273
676 Ga0209257_1000005 3300025304 Bacteria 1592528
677 Ga0209257_1000025 3300025304 Bacteria 724838
678 Ga0209257_1003301 3300025304 Bacteria 14056
679 Ga0207697_10058643 3300025315 Bacteria 1599
680 Ga0207656_10003369 3300025321 Bacteria 5487
681 Ga0207656_10078196 3300025321 Bacteria 1482
682 Ga0207655_1000008 3300025728 Bacteria 734289
683 Ga0207655_1000242 3300025728 Bacteria 89450
684 Ga0207713_1046416 3300025735 Bacteria 1766
685 Ga0207682_10013648 3300025893 Bacteria 3165
686 Ga0207682_10073287 3300025893 Bacteria 1454
687 Ga0207710_10001124 3300025900 Bacteria 13659
688 Ga0207688_10002010 3300025901 Bacteria 10907
689 Ga0207688_10018186 3300025901 Bacteria 3826
690 Ga0207680_10000125 3300025903 Bacteria 35925
691 Ga0207680_10004003 3300025903 Bacteria 6962
692 Ga0207680_10090488 3300025903 Bacteria 1945
693 Ga0207680_10114292 3300025903 Bacteria 1756
694 Ga0207647_10000104 3300025904 Bacteria 65696
695 Ga0207647_10005038 3300025904 Bacteria 9737
696 Ga0207647_10015091 3300025904 Bacteria 5307
697 Ga0207647_10021853 3300025904 Bacteria 4260
698 Ga0207647_10050404 3300025904 Bacteria 2577
699 Ga0207647_10075592 3300025904 Bacteria 2027
700 Ga0207645_10000650 3300025907 Bacteria 28882
701 Ga0207645_10000793 3300025907 Bacteria 26435
702 Ga0207645_10002278 3300025907 Bacteria 15224
703 Ga0207645_10010687 3300025907 Bacteria 6296
704 Ga0207645_10132455 3300025907 Bacteria 1623
705 Ga0207643_10003896 3300025908 Bacteria 8031
706 Ga0207643_10049960 3300025908 Bacteria 2371
707 Ga0207643_10068017 3300025908 Bacteria 2046
708 Ga0207705_10000015 3300025909 Bacteria 382901
709 Ga0207705_10015947 3300025909 Bacteria 5394
710 Ga0207705_10030739 3300025909 Bacteria 3833
711 Ga0207705_10043306 3300025909 Bacteria 3234
712 Ga0207705_10066747 3300025909 Bacteria 2603
713 Ga0207705_10168295 3300025909 Bacteria 1649
714 Ga0207654_10003790 3300025911 Bacteria 7624
715 Ga0207654_10012469 3300025911 Bacteria 4356
716 Ga0207654_10019327 3300025911 Bacteria 3594
717 Ga0207654_10031761 3300025911 Bacteria 2911
718 Ga0207654_10035887 3300025911 Bacteria 2766
719 Ga0207654_10054274 3300025911 Bacteria 2316
720 Ga0207707_10000160 3300025912 Bacteria 70695
721 Ga0207707_10027427 3300025912 Bacteria 4981
722 Ga0207707_10063492 3300025912 Bacteria 3214
723 Ga0207707_10080305 3300025912 Bacteria 2848
724 Ga0207695_10000013 3300025913 Bacteria 821265
725 Ga0207695_10000051 3300025913 Bacteria 399641
726 Ga0207695_10000056 3300025913 Bacteria 382433
727 Ga0207695_10000066 3300025913 Bacteria 334103
728 Ga0207695_10000081 3300025913 Bacteria 284797
729 Ga0207695_10000092 3300025913 Bacteria 270514
730 Ga0207695_10000156 3300025913 Bacteria 204576
731 Ga0207695_10000550 3300025913 Bacteria 77346
732 Ga0207695_10002404 3300025913 Bacteria 27705
733 Ga0207695_10005846 3300025913 Bacteria 16163
734 Ga0207695_10005995 3300025913 Bacteria 15895
735 Ga0207695_10006542 3300025913 Bacteria 15089
736 Ga0207695_10012058 3300025913 Bacteria 10392
737 Ga0207695_10016372 3300025913 Bacteria 8678
738 Ga0207695_10021656 3300025913 Bacteria 7328
739 Ga0207695_10042663 3300025913 Bacteria 4841
740 Ga0207695_10265002 3300025913 Bacteria 1615
741 Ga0207671_10000257 3300025914 Bacteria 79555
742 Ga0207671_10001789 3300025914 Bacteria 24075
743 Ga0207671_10002116 3300025914 Bacteria 21680
744 Ga0207671_10002707 3300025914 Bacteria 18581
745 Ga0207671_10003054 3300025914 Bacteria 17141
746 Ga0207671_10005700 3300025914 Bacteria 11378
747 Ga0207671_10005976 3300025914 Bacteria 11017
748 Ga0207671_10007245 3300025914 Bacteria 9660
749 Ga0207671_10145754 3300025914 Bacteria 1826
750 Ga0207671_10253396 3300025914 Bacteria 1384
751 Ga0207660_10001905 3300025917 Bacteria 13897
752 Ga0207660_10051818 3300025917 Bacteria 2919
753 Ga0207660_10074562 3300025917 Bacteria 2477
754 Ga0207662_10004278 3300025918 Bacteria 7493
755 Ga0207657_10001653 3300025919 Bacteria 24053
756 Ga0207657_10003392 3300025919 Bacteria 17025
757 Ga0207657_10015945 3300025919 Bacteria 7259
758 Ga0207657_10029952 3300025919 Bacteria 4946
759 Ga0207657_10042107 3300025919 Bacteria 4032
760 Ga0207657_10063853 3300025919 Bacteria 3146
761 Ga0207657_10232459 3300025919 Bacteria 1474
762 Ga0207649_10025366 3300025920 Bacteria 3455
763 Ga0207649_10029127 3300025920 Bacteria 3258
764 Ga0207649_10061177 3300025920 Bacteria 2369
765 Ga0207652_10000029 3300025921 Bacteria 149054
766 Ga0207652_10000115 3300025921 Bacteria 87927
767 Ga0207652_10000406 3300025921 Bacteria 44756
768 Ga0207652_10000961 3300025921 Bacteria 26939
769 Ga0207652_10039601 3300025921 Bacteria 4000
770 Ga0207652_10054962 3300025921 Bacteria 3423
771 Ga0207652_10067110 3300025921 Bacteria 3110
772 Ga0207681_10102685 3300025923 Bacteria 2065
773 Ga0207694_10006715 3300025924 Bacteria 8744
774 Ga0207694_10032448 3300025924 Bacteria 3998
775 Ga0207694_10220231 3300025924 Bacteria 1548
776 Ga0207650_10027506 3300025925 Bacteria 4072
777 Ga0207650_10032513 3300025925 Bacteria 3773
778 Ga0207650_10062568 3300025925 Bacteria 2781
779 Ga0207650_10093737 3300025925 Bacteria 2299
780 Ga0207650_10141491 3300025925 Bacteria 1892
781 Ga0207650_10150022 3300025925 Bacteria 1839
782 Ga0207659_10011402 3300025926 Bacteria 5614
783 Ga0207659_10014561 3300025926 Bacteria 5078
784 Ga0207659_10054617 3300025926 Bacteria 2853
785 Ga0207659_10102119 3300025926 Bacteria 2164
786 Ga0207687_10101975 3300025927 Unclassified 2113
787 Ga0207687_10258044 3300025927 Bacteria 1388
788 Ga0207644_10020232 3300025931 Bacteria 4523
789 Ga0207644_10052439 3300025931 Bacteria 2931
790 Ga0207644_10071229 3300025931 Bacteria 2543
791 Ga0207644_10167003 3300025931 Bacteria 1715
792 Ga0207690_10003150 3300025932 Bacteria 9903
793 Ga0207690_10060376 3300025932 Bacteria 2573
794 Ga0207690_10109253 3300025932 Bacteria 1989
795 Ga0207706_10000191 3300025933 Bacteria 68535
796 Ga0207706_10024864 3300025933 Bacteria 5368
797 Ga0207706_10106618 3300025933 Bacteria 2466
798 Ga0207686_10017976 3300025934 Bacteria 3995
799 Ga0207709_10000026 3300025935 Bacteria 354467
800 Ga0207709_10000365 3300025935 Bacteria 45523
801 Ga0207670_10005454 3300025936 Bacteria 6979
802 Ga0207670_10091135 3300025936 Bacteria 2155
803 Ga0207670_10106251 3300025936 Bacteria 2013
804 Ga0207669_10088178 3300025937 Bacteria 2011
805 Ga0207704_10000053 3300025938 Bacteria 79904
806 Ga0207704_10104416 3300025938 Bacteria 1898
807 Ga0207704_10150556 3300025938 Bacteria 1641
808 Ga0207691_10000154 3300025940 Bacteria 64281
809 Ga0207691_10005078 3300025940 Bacteria 12705
810 Ga0207691_10030946 3300025940 Bacteria 4998
811 Ga0207691_10059353 3300025940 Bacteria 3479
812 Ga0207691_10079855 3300025940 Bacteria 2943
813 Ga0207691_10083196 3300025940 Bacteria 2873
814 Ga0207691_10188552 3300025940 Bacteria 1799
815 Ga0207711_10025883 3300025941 Bacteria 4921
816 Ga0207711_10049439 3300025941 Bacteria 3601
817 Ga0207689_10000360 3300025942 Bacteria 42854
818 Ga0207689_10001010 3300025942 Bacteria 27038
819 Ga0207689_10006093 3300025942 Bacteria 10665
820 Ga0207689_10006592 3300025942 Bacteria 10237
821 Ga0207689_10011320 3300025942 Bacteria 7653
822 Ga0207689_10011416 3300025942 Bacteria 7613
823 Ga0207689_10012630 3300025942 Bacteria 7216
824 Ga0207689_10041818 3300025942 Bacteria 3792
825 Ga0207689_10094157 3300025942 Bacteria 2460
826 Ga0207689_10171472 3300025942 Bacteria 1789
827 Ga0207689_10190025 3300025942 Bacteria 1694
828 Ga0207661_10002590 3300025944 Bacteria 12431
829 Ga0207661_10018276 3300025944 Bacteria 5207
830 Ga0207661_10022471 3300025944 Bacteria 4752
831 Ga0207661_10314785 3300025944 Bacteria 1406
832 Ga0207679_10001022 3300025945 Bacteria 17875
833 Ga0207679_10006038 3300025945 Bacteria 7630
834 Ga0207679_10006841 3300025945 Bacteria 7230
835 Ga0207679_10026302 3300025945 Bacteria 4011
836 Ga0207667_10000037 3300025949 Bacteria 297252
837 Ga0207667_10001658 3300025949 Bacteria 28052
838 Ga0207667_10002366 3300025949 Bacteria 23615
839 Ga0207667_10005373 3300025949 Bacteria 15618
840 Ga0207667_10009017 3300025949 Bacteria 11800
841 Ga0207667_10009279 3300025949 Bacteria 11610
842 Ga0207667_10037027 3300025949 Bacteria 5220
843 Ga0207667_10043276 3300025949 Bacteria 4780
844 Ga0207667_10054870 3300025949 Bacteria 4191
845 Ga0207667_10057723 3300025949 Bacteria 4073
846 Ga0207667_10080369 3300025949 Bacteria 3378
847 Ga0207667_10092593 3300025949 Bacteria 3122
848 Ga0207667_10126280 3300025949 Bacteria 2635
849 Ga0207667_10168833 3300025949 Bacteria 2249
850 Ga0207651_10003771 3300025960 Bacteria 7507
851 Ga0207651_10008489 3300025960 Bacteria 5553
852 Ga0207651_10017358 3300025960 Bacteria 4251
853 Ga0207651_10065649 3300025960 Bacteria 2546
854 Ga0207712_10001164 3300025961 Bacteria 18264
855 Ga0207712_10001801 3300025961 Bacteria 14178
856 Ga0207712_10011162 3300025961 Bacteria 5720
857 Ga0207712_10025404 3300025961 Bacteria 3935
858 Ga0207712_10032321 3300025961 Bacteria 3531
859 Ga0207712_10050010 3300025961 Bacteria 2917
860 Ga0207712_10202644 3300025961 Bacteria 1574
861 Ga0207668_10001272 3300025972 Bacteria 15031
862 Ga0207668_10043236 3300025972 Bacteria 3056
863 Ga0207668_10181590 3300025972 Bacteria 1660
864 Ga0207640_10025871 3300025981 Bacteria 3558
865 Ga0207640_10091812 3300025981 Bacteria 2104
866 Ga0207658_10020272 3300025986 Bacteria 4603
867 Ga0207658_10035132 3300025986 Bacteria 3588
868 Ga0207658_10057653 3300025986 Bacteria 2887
869 Ga0207677_10001948 3300026023 Bacteria 10925
870 Ga0207677_10010537 3300026023 Bacteria 5236
871 Ga0207677_10067060 3300026023 Bacteria 2512
872 Ga0207677_10071853 3300026023 Bacteria 2444
873 Ga0207677_10202809 3300026023 Bacteria 1578
874 Ga0207703_10001922 3300026035 Bacteria 18410
875 Ga0207703_10026323 3300026035 Bacteria 4577
876 Ga0207703_10173273 3300026035 Unclassified 1899
877 Ga0207639_10001747 3300026041 Bacteria 14635
878 Ga0207639_10006469 3300026041 Bacteria 7969
879 Ga0207639_10018045 3300026041 Bacteria 5007
880 Ga0207639_10020682 3300026041 Bacteria 4714
881 Ga0207639_10049062 3300026041 Bacteria 3199
882 Ga0207639_10056788 3300026041 Bacteria 3002
883 Ga0207639_10080730 3300026041 Bacteria 2574
884 Ga0207639_10235946 3300026041 Bacteria 1588
885 Ga0207678_10094925 3300026067 Bacteria 2549
886 Ga0207702_10000201 3300026078 Bacteria 70471
887 Ga0207702_10024798 3300026078 Bacteria 4975
888 Ga0207702_10029614 3300026078 Bacteria 4557
889 Ga0207702_10076949 3300026078 Bacteria 2884
890 Ga0207641_10000082 3300026088 Bacteria 138385
891 Ga0207641_10003172 3300026088 Bacteria 14709
892 Ga0207641_10009438 3300026088 Bacteria 8039
893 Ga0207641_10015009 3300026088 Bacteria 6350
894 Ga0207641_10021690 3300026088 Bacteria 5278
895 Ga0207641_10082894 3300026088 Bacteria 2787
896 Ga0207641_10197553 3300026088 Bacteria 1852
897 Ga0207648_10000175 3300026089 Bacteria 66839
898 Ga0207648_10001709 3300026089 Bacteria 24030
899 Ga0207648_10002098 3300026089 Bacteria 21717
900 Ga0207648_10015449 3300026089 Bacteria 7022
901 Ga0207648_10019442 3300026089 Bacteria 6131
902 Ga0207648_10026330 3300026089 Bacteria 5170
903 Ga0207648_10049799 3300026089 Bacteria 3664
904 Ga0207648_10059413 3300026089 Bacteria 3335
905 Ga0207648_10064952 3300026089 Bacteria 3181
906 Ga0207648_10109467 3300026089 Bacteria 2425
907 Ga0207648_10129399 3300026089 Bacteria 2222
908 Ga0207676_10007584 3300026095 Bacteria 7700
909 Ga0207676_10007982 3300026095 Bacteria 7526
910 Ga0207676_10014437 3300026095 Bacteria 5683
911 Ga0207676_10042623 3300026095 Bacteria 3491
912 Ga0207676_10050937 3300026095 Bacteria 3231
913 Ga0207674_10003993 3300026116 Bacteria 17924
914 Ga0207674_10005014 3300026116 Bacteria 15819
915 Ga0207674_10005225 3300026116 Bacteria 15451
916 Ga0207674_10024952 3300026116 Bacteria 6381
917 Ga0207674_10069416 3300026116 Bacteria 3544
918 Ga0207674_10090955 3300026116 Bacteria 3043
919 Ga0207674_10134865 3300026116 Bacteria 2431
920 Ga0207674_10170481 3300026116 Bacteria 2130
921 Ga0207674_10260018 3300026116 Bacteria 1683
922 Ga0207675_100005095 3300026118 Bacteria 12643
923 Ga0207675_100025419 3300026118 Bacteria 5512
924 Ga0207675_100039652 3300026118 Bacteria 4395
925 Ga0207675_100199108 3300026118 Unclassified 1923
926 Ga0207675_100218011 3300026118 Bacteria 1838
927 Ga0207675_100258912 3300026118 Unclassified 1686
928 Ga0207675_100262591 3300026118 Bacteria 1674
929 Ga0207683_10000974 3300026121 Bacteria 26229
930 Ga0207683_10007830 3300026121 Bacteria 9145
931 Ga0207683_10041067 3300026121 Bacteria 4038
932 Ga0207683_10080928 3300026121 Bacteria 2882
933 Ga0207683_10187572 3300026121 Bacteria 1876
934 Ga0207698_10001166 3300026142 Bacteria 15330
935 Ga0207698_10004722 3300026142 Bacteria 8333
936 Ga0207698_10009220 3300026142 Bacteria 6279
937 Ga0207698_10073819 3300026142 Bacteria 2718
938 Ga0207698_10132043 3300026142 Bacteria 2136
939 Ga0207698_10174264 3300026142 Bacteria 1898
940 Ga0207698_10181498 3300026142 Unclassified 1865
941 Ga0209281_1000116 3300027111 Bacteria 209707
942 Ga0209489_117024 3300027361 Bacteria 3533
943 Ga0209282_1038144 3300027666 Bacteria 2882
944 Ga0209974_10037550 3300027876 Bacteria 1608
945 Ga0268266_10000018 3300028379 Bacteria 569141
946 Ga0268266_10000022 3300028379 Bacteria 508060
947 Ga0268266_10005211 3300028379 Bacteria 12231
948 Ga0268266_10005285 3300028379 Bacteria 12122
949 Ga0268265_10007650 3300028380 Bacteria 7291
950 Ga0268265_10102470 3300028380 Bacteria 2315
951 Ga0268265_10160055 3300028380 Bacteria 1911
952 Ga0268264_10000082 3300028381 Bacteria 246913
953 Ga0268264_10005842 3300028381 Bacteria 10425
954 Ga0268264_10005919 3300028381 Bacteria 10351
955 Ga0268264_10006777 3300028381 Bacteria 9622
956 Ga0268264_10011786 3300028381 Bacteria 7208
957 Ga0268264_10013496 3300028381 Bacteria 6727
958 Ga0268264_10059634 3300028381 Bacteria 3197
959 Ga0268264_10377511 3300028381 Bacteria 1357
960 Ga0265334_10008517 3300028573 Bacteria 4359
961 Ga0307517_10002197 3300028786 Bacteria 31568
962 Ga0307517_10006633 3300028786 Bacteria 17060
963 Ga0307515_10000001 3300028794 Bacteria 4259510
964 Ga0307515_10000061 3300028794 Bacteria 251841
965 Ga0307515_10000190 3300028794 Bacteria 150300
966 Ga0307515_10000927 3300028794 Bacteria 67260
967 Ga0307515_10001771 3300028794 Bacteria 48123
968 Ga0307515_10011605 3300028794 Bacteria 16701
969 Ga0307515_10177925 3300028794 Bacteria 2090
970 Ga0265338_10001011 3300028800 Bacteria 47254
971 Ga0265338_10143578 3300028800 Bacteria 1866
972 Ga0265324_10018826 3300029957 Bacteria 2491
973 Ga0307511_10000027 3300030521 Bacteria 109500
974 Ga0316177_1132213 3300030731 Bacteria 3865
975 Ga0316183_1068856 3300030742 Bacteria 6445
976 Ga0265327_10000048 3300031251 Bacteria 269173
977 Ga0265327_10000248 3300031251 Bacteria 107284
978 Ga0265327_10000272 3300031251 Bacteria 102100
979 Ga0265327_10000551 3300031251 Bacteria 64082
980 Ga0265327_10002514 3300031251 Bacteria 19140
981 Ga0265327_10003148 3300031251 Bacteria 16186
982 Ga0265327_10006450 3300031251 Bacteria 9375
983 Ga0265327_10009085 3300031251 Bacteria 7253
984 Ga0265327_10025709 3300031251 Bacteria 3427
985 Ga0265327_10085354 3300031251 Bacteria 1550
986 Ga0265327_10085890 3300031251 Bacteria 1544
987 Ga0307513_10033920 3300031456 Bacteria 5733
988 Ga0307509_10020755 3300031507 Bacteria 7452
989 Ga0307509_10036852 3300031507 Bacteria 5351
990 Ga0307509_10045900 3300031507 Bacteria 4707
991 Ga0307509_10174065 3300031507 Bacteria 2027
992 Ga0307408_100000310 3300031548 Bacteria 46693
993 Ga0307408_100000534 3300031548 Bacteria 32864
994 Ga0307408_100000564 3300031548 Bacteria 31968
995 Ga0307408_100040113 3300031548 Bacteria 3314
996 Ga0307408_100084815 3300031548 Bacteria 2377
997 Ga0265313_10042550 3300031595 Bacteria 2230
998 Ga0307508_10007752 3300031616 Bacteria 9980
999 Ga0316579_10088628 3300031691 Bacteria 1477
1000 Ga0316576_10047393 3300031727 Bacteria 3114
1001 Ga0316578_10044657 3300031728 Bacteria 2578
1002 Ga0316578_10057303 3300031728 Bacteria 2289
1003 Ga0316578_10123818 3300031728 Bacteria 1555
1004 Ga0307516_10000869 3300031730 Bacteria 41512
1005 Ga0307516_10059174 3300031730 Bacteria 3727
1006 Ga0307405_10000002 3300031731 Bacteria 575196
1007 Ga0307405_10000016 3300031731 Bacteria 197180
1008 Ga0307405_10014744 3300031731 Bacteria 4212
1009 Ga0307405_10137656 3300031731 Bacteria 1697
1010 Ga0316577_10114114 3300031733 Bacteria 1516
1011 Ga0307413_10000019 3300031824 Bacteria 45584
1012 Ga0307413_10002415 3300031824 Bacteria 7587
1013 Ga0307410_10000115 3300031852 Bacteria 28127
1014 Ga0307410_10142957 3300031852 Bacteria 1772
1015 Ga0307406_10000111 3300031901 Bacteria 46791
1016 Ga0307407_10000006 3300031903 Bacteria 218714
1017 Ga0307407_10001642 3300031903 Bacteria 8267
1018 Ga0307412_10000001 3300031911 Bacteria 822691
1019 Ga0307412_10000034 3300031911 Bacteria 206033
1020 Ga0307412_10000154 3300031911 Bacteria 49488
1021 Ga0307412_10003359 3300031911 Bacteria 8890
1022 Ga0307412_10237299 3300031911 Bacteria 1408
1023 Ga0307416_100000030 3300032002 Bacteria 162430
1024 Ga0307416_100000032 3300032002 Bacteria 156777
1025 Ga0307416_100025328 3300032002 Bacteria 4347
1026 Ga0307414_10000001 3300032004 Bacteria 1352954
1027 Ga0307414_10000127 3300032004 Bacteria 53237
1028 Ga0307414_10000392 3300032004 Bacteria 23857
1029 Ga0307414_10001064 3300032004 Bacteria 14054
1030 Ga0307414_10001471 3300032004 Bacteria 12250
1031 Ga0307414_10035636 3300032004 Bacteria 3313
1032 Ga0307414_10055020 3300032004 Bacteria 2784
1033 Ga0307414_10068187 3300032004 Bacteria 2551
1034 Ga0307414_10075521 3300032004 Bacteria 2446
1035 Ga0307414_10129539 3300032004 Bacteria 1956
1036 Ga0307414_10178501 3300032004 Bacteria 1705
1037 Ga0307411_10000013 3300032005 Bacteria 145335
1038 Ga0307411_10071513 3300032005 Bacteria 2352
1039 Ga0307415_100025409 3300032126 Bacteria 3716
1040 Ga0307415_100143214 3300032126 Bacteria 1829
1041 Ga0307507_10000064 3300033179 Bacteria 161226
1042 Ga0307510_10000328 3300033180 Bacteria 44214
1043 Ga0307510_10007920 3300033180 Bacteria 12650
1044 Ga0307510_10023468 3300033180 Bacteria 7150
1045 Ga0373936_0062866 3300035113 Bacteria 1519
1046 Ga0373955_0093023 3300035172 Bacteria 1721
1047 Ga0373955_0106131 3300035172 Bacteria 1619
1048 Ga0373924_0018705 3300035410 Bacteria 2674
1049 Ga0373927_0021777 3300035695 Bacteria 4201
1050 Ga0373937_0010206 3300036401 Bacteria 8196
1051 Ga0373937_0064488 3300036401 Bacteria 3370
1052 Ga0316582_0005102 3300036647 Bacteria 6721
1053 Ga0316584_0026927 3300036712 Bacteria 4228
1054 Ga0316584_0052520 3300036712 Bacteria 3048
1055 Ga0316584_0056089 3300036712 Bacteria 2950
1056 Ga0316584_0246152 3300036712 Bacteria 1307
1057 Ga0395899_0000033 3300037312 Bacteria 306589
1058 Ga0395899_0000411 3300037312 Bacteria 49949
1059 Ga0395899_0000435 3300037312 Bacteria 47985
1060 Ga0395899_0001077 3300037312 Bacteria 24592
1061 Ga0395899_0002144 3300037312 Bacteria 16228
1062 Ga0395899_0031560 3300037312 Bacteria 3981
1063 Ga0395899_0044380 3300037312 Bacteria 3312
1064 Ga0395899_0059981 3300037312 Bacteria 2803
1065 Ga0395900_0001393 3300037418 Bacteria 28920
1066 Ga0395900_0001452 3300037418 Bacteria 28269
1067 Ga0395900_0003225 3300037418 Bacteria 17664
1068 Ga0395900_0005622 3300037418 Bacteria 13110
1069 Ga0395900_0072380 3300037418 Bacteria 3544
1070 Ga0395900_0098786 3300037418 Bacteria 2999
1071 Ga0395900_0101122 3300037418 Bacteria 2960
1072 Ga0395900_0109400 3300037418 Bacteria 2839
1073 Ga0395900_0130510 3300037418 Bacteria 2575
1074 Ga0395898_0013831 3300037466 Bacteria 8295
1075 Ga0395898_0031676 3300037466 Bacteria 5281
1076 Ga0395898_0158125 3300037466 Bacteria 2167
1077 Ga0395905_0000998 3300037471 Bacteria 36231
1078 Ga0395905_0001914 3300037471 Bacteria 23897
1079 Ga0395905_0007067 3300037471 Bacteria 11222
1080 Ga0395905_0034426 3300037471 Bacteria 4756
1081 Ga0395901_0000789 3300038443 Bacteria 35205
1082 Ga0395901_0002351 3300038443 Bacteria 19230
1083 Ga0395901_0014642 3300038443 Bacteria 7970
1084 Ga0395901_0017854 3300038443 Bacteria 7241
1085 Ga0395901_0030985 3300038443 Bacteria 5513
1086 Ga0395901_0091000 3300038443 Bacteria 3193
1087 Ga0395901_0272603 3300038443 Bacteria 1759
1088 Ga0395901_0315933 3300038443 Bacteria 1617
1089 Ga0436365_0079092 3300039437 Bacteria 37171
1090 Ga0436361_0307685 3300039447 Bacteria 5871
1091 Ga0439439_0009748 3300041406 Bacteria 2290
1092 Ga0439447_003769 3300041407 Bacteria 5325
1093 Ga0439466_0015063 3300041411 Bacteria 2811
1094 Ga0451795_0356222 3300041456 Bacteria 2451
1095 Ga0451795_1501558 3300041456 Bacteria 2101
1096 Ga0451807_1155230 3300041486 Bacteria 1369
1097 Ga0451849_1009127 3300041505 Bacteria 1610
1098 Ga0451855_1236631 3300041511 Bacteria 3919
1099 Ga0451855_1803231 3300041511 Bacteria 1582
1100 Ga0439431_0000122 3300041997 Bacteria 13578
1101 Ga0439442_002574 3300042002 Bacteria 3560
1102 Ga0439445_0003161 3300042004 Bacteria 3689
1103 Ga0439448_0004334 3300042005 Bacteria 4001
1104 Ga0439449_0006488 3300042007 Bacteria 4471
1105 Ga0439455_0019582 3300042012 Bacteria 1597
1106 Ga0439457_007860 3300042014 Bacteria 2539
1107 Ga0439457_009122 3300042014 Bacteria 2317
1108 Ga0439462_0001515 3300042015 Bacteria 5197
1109 Ga0450923_001237 3300042125 Bacteria 3309
1110 Ga0450898_002493 3300042134 Bacteria 2569
1111 Ga0451577_0000042 3300042876 Bacteria 332086
1112 Ga0451577_0000418 3300042876 Bacteria 77022
1113 Ga0451577_0005315 3300042876 Bacteria 13237
1114 Ga0451577_0016491 3300042876 Bacteria 6840
1115 Ga0451577_0047761 3300042876 Bacteria 3826
1116 Ga0451577_0066330 3300042876 Bacteria 3220
1117 Ga0451577_0066793 3300042876 Bacteria 3207
1118 Ga0451577_0077739 3300042876 Bacteria 2959
1119 Ga0451577_0098078 3300042876 Bacteria 2617
1120 Ga0451577_0103906 3300042876 Bacteria 2539
1121 Ga0451577_0158178 3300042876 Unclassified 2040
1122 Ga0451577_0302681 3300042876 Bacteria 1449
1123 Ga0466969_0001347 3300044656 Bacteria 13251
1124 Ga0466972_0000001 3300044658 Bacteria 412457
1125 Ga0466972_0000280 3300044658 Bacteria 31990
1126 Ga0466972_0076144 3300044658 Bacteria 1598
1127 Ga0453683_0000286 3300044673 Bacteria 65332
1128 Ga0453683_0000572 3300044673 Bacteria 40700
1129 Ga0453683_0000680 3300044673 Bacteria 36070
1130 Ga0453683_0008542 3300044673 Bacteria 6870
1131 Ga0453683_0009555 3300044673 Bacteria 6470
1132 Ga0453683_0019047 3300044673 Bacteria 4400
1133 Ga0453683_0040595 3300044673 Bacteria 2921
1134 Ga0453683_0046010 3300044673 Bacteria 2736
1135 Ga0453683_0183173 3300044673 Bacteria 1328
1136 Ga0453684_0000452 3300044712 Bacteria 165844
1137 Ga0453684_0001009 3300044712 Bacteria 91051
1138 Ga0453684_0001431 3300044712 Bacteria 68233
1139 Ga0453684_0001697 3300044712 Bacteria 59504
1140 Ga0453684_0002271 3300044712 Bacteria 47454
1141 Ga0453684_0004934 3300044712 Bacteria 27202
1142 Ga0453684_0005946 3300044712 Bacteria 23666
1143 Ga0453684_0008008 3300044712 Bacteria 19130
1144 Ga0453684_0024385 3300044712 Bacteria 8842
1145 Ga0453684_0025246 3300044712 Bacteria 8636
1146 Ga0453684_0034365 3300044712 Bacteria 7038
1147 Ga0453684_0037166 3300044712 Bacteria 6689
1148 Ga0453684_0040283 3300044712 Bacteria 6349
1149 Ga0453684_0120207 3300044712 Bacteria 3173
1150 Ga0453684_0156804 3300044712 Bacteria 2698
1151 Ga0466971_0014790 3300044719 Bacteria 3434
1152 Ga0466968_0028469 3300044735 Bacteria 2304
1153 Ga0466970_0000495 3300044765 Bacteria 19372
1154 Ga0466957_0001670 3300044842 Bacteria 11655
1155 Ga0466957_0007722 3300044842 Bacteria 6085
1156 Ga0466959_0000004 3300045049 Bacteria 216815
1157 Ga0466959_0000446 3300045049 Bacteria 24054
1158 Ga0466959_0055794 3300045049 Bacteria 2883
1159 Ga0451576_0000002 3300045051 Bacteria 1670975
1160 Ga0451576_0000254 3300045051 Bacteria 131595
1161 Ga0451576_0000589 3300045051 Bacteria 77022
1162 Ga0451576_0001052 3300045051 Bacteria 50794
1163 Ga0451576_0005169 3300045051 Bacteria 16516
1164 Ga0451576_0009640 3300045051 Bacteria 11174
1165 Ga0451576_0044662 3300045051 Bacteria 4670
1166 Ga0451576_0047009 3300045051 Bacteria 4540
1167 Ga0451576_0059430 3300045051 Bacteria 3990
1168 Ga0451576_0072309 3300045051 Bacteria 3589
1169 Ga0451576_0087081 3300045051 Unclassified 3248
1170 Ga0451576_0111131 3300045051 Bacteria 2851
1171 Ga0451576_0152198 3300045051 Bacteria 2412
1172 Ga0466958_0082156 3300045836 Bacteria 1984
1173 Ga0495627_000034 3300046453 Bacteria 214913
1174 Ga0495627_006812 3300046453 Bacteria 4445
1175 Ga0495627_007928 3300046453 Bacteria 4023
1176 Ga0495627_045014 3300046453 Bacteria 1345
1177 Ga0495592_0163888 3300046454 Bacteria 1527
1178 Ga0495590_0005877 3300046457 Bacteria 4819
1179 Ga0495638_0000171 3300046460 Bacteria 101044
1180 Ga0495638_0018471 3300046460 Bacteria 4630
1181 Ga0495651_0045960 3300046462 Bacteria 3381
1182 Ga0495650_0000003 3300046471 Bacteria 900730
1183 Ga0495650_0021678 3300046471 Bacteria 3096
1184 Ga0495650_0051350 3300046471 Bacteria 1699
1185 Ga0495585_0000079 3300046492 Bacteria 100159
1186 Ga0495585_0000411 3300046492 Bacteria 41565
1187 Ga0495596_0000865 3300046500 Bacteria 18244
1188 Ga0495607_0011024 3300046501 Bacteria 6038
1189 Ga0495606_0000116 3300046507 Bacteria 134901
1190 Ga0495606_0011506 3300046507 Bacteria 7214
1191 Ga0495606_0012165 3300046507 Bacteria 6938
1192 Ga0495606_0014159 3300046507 Bacteria 6243
1193 Ga0495606_0017762 3300046507 Bacteria 5363
1194 Ga0495606_0023782 3300046507 Bacteria 4431
1195 Ga0495610_0000001 3300046512 Bacteria 1620061
1196 Ga0495610_0000992 3300046512 Bacteria 26173
1197 Ga0495610_0001007 3300046512 Bacteria 25962
1198 Ga0495610_0004188 3300046512 Bacteria 10774
1199 Ga0495616_0008226 3300046513 Bacteria 6192
1200 Ga0495616_0043233 3300046513 Bacteria 2289
1201 Ga0495616_0113617 3300046513 Bacteria 1256
1202 Ga0495618_0121596 3300046514 Bacteria 1672
1203 Ga0495628_0009018 3300046516 Bacteria 8534
1204 Ga0495630_0064766 3300046517 Bacteria 2747
1205 Ga0495630_0078966 3300046517 Bacteria 2482
1206 Ga0495632_0023621 3300046519 Bacteria 3280
1207 Ga0495637_0003326 3300046520 Bacteria 8549
1208 Ga0495643_0000506 3300046522 Bacteria 48801
1209 Ga0495643_0003411 3300046522 Bacteria 11675
1210 Ga0495648_0000879 3300046524 Bacteria 31662
1211 Ga0495648_0002877 3300046524 Bacteria 15501
1212 Ga0495663_0000406 3300046525 Bacteria 15767
1213 Ga0495654_0000001 3300046530 Bacteria 1513197
1214 Ga0495665_0104353 3300046531 Bacteria 1487
1215 Ga0495586_0131063 3300046535 Bacteria 1404
1216 Ga0495587_0064905 3300046536 Bacteria 2133
1217 Ga0495609_0000025 3300046538 Bacteria 256898
1218 Ga0495609_0015343 3300046538 Bacteria 3587
1219 Ga0495621_0012524 3300046539 Bacteria 2645
1220 Ga0495622_0014656 3300046557 Bacteria 3642
1221 Ga0495622_0036520 3300046557 Bacteria 2291
1222 Ga0495622_0060076 3300046557 Bacteria 1760
1223 Ga0495633_0000056 3300046558 Bacteria 149334
1224 Ga0495633_0000057 3300046558 Bacteria 148536
1225 Ga0495633_0000344 3300046558 Bacteria 51775
1226 Ga0495668_0000021 3300046616 Bacteria 381308
1227 Ga0495668_0000257 3300046616 Bacteria 75166
1228 Ga0495668_0001099 3300046616 Bacteria 28007
1229 Ga0495668_0004989 3300046616 Bacteria 9180
1230 Ga0495625_0000159 3300046660 Bacteria 104355
1231 Ga0495625_0001186 3300046660 Bacteria 33408
1232 Ga0495625_0002144 3300046660 Bacteria 21944
1233 Ga0495625_0005105 3300046660 Bacteria 12142
1234 Ga0495625_0008186 3300046660 Bacteria 8953
1235 Ga0495625_0019973 3300046660 Bacteria 5182
1236 Ga0495625_0033793 3300046660 Bacteria 3777
1237 Ga0495625_0119956 3300046660 Bacteria 1790
1238 Ga0495635_0137075 3300046663 Bacteria 1668
1239 Ga0495661_0001360 3300046665 Bacteria 20657
1240 Ga0495661_0015325 3300046665 Bacteria 5118
1241 Ga0495658_0025645 3300046683 Bacteria 3153
1242 Ga0495613_0146383 3300046689 Bacteria 1686
1243 Ga0495671_0071739 3300046692 Bacteria 1701
1244 Ga0495649_0000003 3300046694 Bacteria 880817
1245 Ga0495672_0002547 3300047320 Bacteria 16619
1246 Ga0495672_0024143 3300047320 Bacteria 3923
1247 Ga0495672_0066796 3300047320 Bacteria 2050
1248 Ga0495680_0045059 3300047322 Bacteria 3485
1249 Ga0495687_000179 3300047443 Bacteria 92387
1250 Ga0495687_002135 3300047443 Bacteria 16518
1251 Ga0495687_002367 3300047443 Bacteria 15256
1252 Ga0495675_0107839 3300047444 Bacteria 1740
1253 Ga0495684_0015951 3300047471 Bacteria 5786
1254 Ga0495686_0000010 3300047472 Bacteria 573229
1255 Ga0495686_0000160 3300047472 Bacteria 128437
1256 Ga0495686_0000234 3300047472 Bacteria 101539
1257 Ga0495686_0000489 3300047472 Bacteria 58459
1258 Ga0495686_0001122 3300047472 Bacteria 31676
1259 Ga0495686_0002126 3300047472 Bacteria 19394
1260 Ga0495686_0012985 3300047472 Bacteria 5804
1261 Ga0495686_0066077 3300047472 Bacteria 2236
1262 Ga0495686_0082255 3300047472 Bacteria 1965
1263 Ga0495686_0117769 3300047472 Bacteria 1586
1264 Ga0495614_0030275 3300048089 Bacteria 2329
1265 Ga0496103_0054877 3300048906 Bacteria 2470
1266 Ga0496104_0376680 3300048907 Bacteria 1332
1267 Ga0496109_0164106 3300048912 Unclassified 2082
1268 Ga0496109_0340329 3300048912 Bacteria 1417
1269 Ga0496110_0086573 3300048913 Bacteria 2798
1270 Ga0496111_0087451 3300048914 Bacteria 2281
1271 Ga0496113_0198306 3300048916 Bacteria 1595
1272 Ga0496114_0000412 3300048917 Bacteria 31760
1273 Ga0496115_0005714 3300048918 Bacteria 9055
1274 Ga0496115_0027455 3300048918 Bacteria 4452
1275 Ga0496115_0088816 3300048918 Bacteria 2524
1276 Ga0496116_0000047 3300048919 Bacteria 315121
1277 Ga0496116_0000266 3300048919 Bacteria 91468
1278 Ga0496116_0034662 3300048919 Bacteria 3557
1279 Ga0496117_0000365 3300048920 Bacteria 78847
1280 Ga0496118_0000672 3300048921 Bacteria 55573
1281 Ga0496118_0052195 3300048921 Bacteria 3122
1282 Ga0496119_0000227 3300048922 Bacteria 78848
1283 Ga0496121_0001581 3300048924 Bacteria 37894
1284 Ga0496121_0010116 3300048924 Bacteria 10693
1285 Ga0496122_0000045 3300048925 Bacteria 279912
1286 Ga0496122_0000277 3300048925 Bacteria 114200
1287 Ga0496122_0000668 3300048925 Bacteria 69054
1288 Ga0496122_0000698 3300048925 Bacteria 66677
1289 Ga0496122_0004620 3300048925 Bacteria 16941
1290 Ga0496122_0024722 3300048925 Bacteria 5247
1291 Ga0496122_0064153 3300048925 Bacteria 2674
1292 Ga0496123_0000728 3300048926 Bacteria 53516
1293 Ga0496123_0018435 3300048926 Bacteria 5554
1294 Ga0496124_0008911 3300048927 Bacteria 10400
1295 Ga0496124_0094661 3300048927 Bacteria 2429
1296 Ga0496125_0000050 3300048928 Bacteria 286703
1297 Ga0496125_0001041 3300048928 Bacteria 42891
1298 Ga0496125_0001313 3300048928 Bacteria 36792
1299 Ga0496126_0002717 3300048929 Bacteria 23390
1300 Ga0496126_0003177 3300048929 Bacteria 21151
1301 Ga0496126_0004416 3300048929 Bacteria 16838
1302 Ga0501298_001720 3300049521 Bacteria 3239
1303 Ga0501299_014295 3300049522 Bacteria 1379
1304 Ga0501032_0003483 3300049569 Bacteria 12039
1305 Ga0501033_0088258 3300049570 Bacteria 2269
1306 Ga0501033_0137637 3300049570 Bacteria 1767
1307 Ga0501034_0012481 3300049571 Bacteria 8775
1308 Ga0501034_0023798 3300049571 Bacteria 6237
1309 Ga0501034_0176353 3300049571 Bacteria 2103
1310 Ga0501036_0001169 3300049572 Bacteria 19962
1311 Ga0501037_0008589 3300049573 Bacteria 7492
1312 Ga0501037_0027220 3300049573 Bacteria 4223
1313 Ga0501038_0025547 3300049574 Bacteria 5264
1314 Ga0501038_0142314 3300049574 Bacteria 1961
1315 Ga0501039_0012075 3300049575 Bacteria 6586
1316 Ga0501039_0066169 3300049575 Bacteria 2805
1317 Ga0501043_0003386 3300049579 Bacteria 13133
1318 Ga0501043_0025390 3300049579 Bacteria 4649
1319 Ga0501043_0035477 3300049579 Bacteria 3922
1320 Ga0501043_0052405 3300049579 Bacteria 3205
1321 Ga0501046_0032815 3300049580 Bacteria 4201
1322 Ga0501046_0032890 3300049580 Bacteria 4196
1323 Ga0501047_0030028 3300049581 Bacteria 5240
1324 Ga0501047_0278566 3300049581 Bacteria 1517
1325 Ga0501067_0006422 3300049583 Bacteria 6513
1326 Ga0501067_0006775 3300049583 Bacteria 6354
1327 Ga0501069_0025041 3300049585 Bacteria 3259
1328 Ga0501070_0050057 3300049586 Bacteria 3469
1329 Ga0501072_0196270 3300049588 Bacteria 1610
1330 Ga0501073_0000839 3300049589 Bacteria 21859
1331 Ga0501073_0082775 3300049589 Bacteria 2233
1332 Ga0501074_0019469 3300049590 Bacteria 4929
1333 Ga0501201_000519 3300049651 Bacteria 3571
1334 Ga0501207_000155 3300049654 Bacteria 6350
1335 Ga0501210_000224 3300049657 Bacteria 2337
1336 Ga0501217_000256 3300049661 Bacteria 8309
1337 Ga0501223_000278 3300049663 Bacteria 12853
1338 Ga0501223_000532 3300049663 Bacteria 9180
1339 Ga0501223_013191 3300049663 Bacteria 1647
1340 Ga0501233_009188 3300049668 Bacteria 1924
1341 Ga0501235_009750 3300049669 Bacteria 2101
1342 Ga0501240_001884 3300049673 Bacteria 2129
1343 Ga0501243_001134 3300049675 Bacteria 3784
1344 Ga0501249_000009 3300049679 Bacteria 173938
1345 Ga0501249_003392 3300049679 Bacteria 3195
1346 Ga0501257_002266 3300049686 Bacteria 4035
1347 Ga0501259_000291 3300049688 Bacteria 7912
1348 Ga0501261_001011 3300049690 Bacteria 3451
1349 Ga0501221_000194 3300049704 Bacteria 8527
1350 Ga0501225_0003187 3300049705 Bacteria 5012
1351 Ga0501245_009025 3300049708 Bacteria 1427
1352 Ga0501079_0036852 3300049741 Bacteria 3767
1353 Ga0501083_0003883 3300049744 Bacteria 10494
1354 Ga0501083_0007152 3300049744 Bacteria 7922
1355 Ga0501241_001025 3300049758 Bacteria 5911
1356 Ga0501241_003468 3300049758 Bacteria 2977
1357 Ga0501241_003584 3300049758 Bacteria 2930
1358 Ga0501241_004068 3300049758 Bacteria 2751
1359 Ga0501266_000005 3300049763 Bacteria 346750
1360 Ga0501280_000686 3300049776 Bacteria 7481
1361 Ga0501035_0010433 3300049822 Bacteria 8611
1362 Ga0501035_0085782 3300049822 Bacteria 2775
1363 Ga0501044_0004241 3300049823 Bacteria 16092
1364 Ga0501044_0121188 3300049823 Bacteria 2616
1365 Ga0501044_0129100 3300049823 Bacteria 2523
1366 Ga0501044_0130494 3300049823 Bacteria 2507
1367 Ga0501044_0175672 3300049823 Bacteria 2111
1368 Ga0501044_0251193 3300049823 Bacteria 1709
1369 Ga0501284_00072 3300050005 Bacteria 30088
1370 nmdc:mga0k408_102378_c1 3300050493 Bacteria 1689
1371 nmdc:mga0k408_16257_c1 3300050493 Bacteria 4126
1372 nmdc:mga0k408_2327_c1 3300050493 Bacteria 10111
1373 nmdc:mga0k408_2685_c2 3300050493 Bacteria 2779
1374 nmdc:mga0k408_27353_c1 3300050493 Bacteria 3239
1375 nmdc:mga0k408_7355_c1 3300050493 Bacteria 5881
1376 nmdc:mga05p37_40325_c1 3300050507 Bacteria 5733
1377 nmdc:mga05p37_91937_c1 3300050507 Bacteria 3738
1378 nmdc:mga09592_174604_c1 3300050508 Bacteria 1859
1379 nmdc:mga09592_66506_c1 3300050508 Bacteria 3055
1380 nmdc:mga0qj67_32376_c1 3300050509 Bacteria 4077
1381 nmdc:mga06r32_4922_c1 3300050510 Bacteria 12034
1382 nmdc:mga06r32_70338_c1 3300050510 Bacteria 3384
1383 nmdc:mga08y16_171069_c1 3300050511 Bacteria 2256
1384 nmdc:mga08y16_54887_c1 3300050511 Bacteria 4164
1385 nmdc:mga08y16_57072_c1 3300050511 Bacteria 4081
1386 nmdc:mga08y16_77453_c1 3300050511 Bacteria 3467
1387 Ga0495612_0047800 3300053078 Bacteria 1754
1388 Ga0500635_0000883 3300053080 Bacteria 7288
1389 Ga0500578_0000010 3300053086 Bacteria 217642
1390 Ga0500578_0155323 3300053086 Bacteria 1423
1391 Ga0500644_0000127 3300053088 Bacteria 46652
1392 Ga0500646_0004247 3300053090 Bacteria 3630
1393 Ga0500583_0000064 3300053092 Bacteria 66001
1394 Ga0500583_0008434 3300053092 Bacteria 3698
1395 Ga0500583_0016023 3300053092 Bacteria 2982
1396 Ga0500583_0023006 3300053092 Bacteria 2620
1397 Ga0500651_0000230 3300053093 Bacteria 34750
1398 Ga0500641_0000027 3300053096 Bacteria 106908
1399 Ga0500641_0000289 3300053096 Bacteria 18776
1400 Ga0500641_0001919 3300053096 Bacteria 7371
1401 Ga0500556_0014297 3300053104 Bacteria 2421
1402 Ga0500562_000053 3300053108 Bacteria 58984
1403 Ga0500607_021068 3300053121 Bacteria 3676
1404 Ga0500608_018150 3300053122 Bacteria 3207
1405 Ga0500618_000003 3300053125 Bacteria 338706
1406 Ga0500559_0098817 3300053136 Bacteria 1343
1407 Ga0500568_0001188 3300053139 Bacteria 17406
1408 Ga0500568_0003322 3300053139 Bacteria 9060
1409 Ga0500577_0002076 3300053142 Bacteria 5115
1410 Ga0500588_0001245 3300053146 Bacteria 4742
1411 Ga0500590_036340 3300053148 Bacteria 2546
1412 Ga0500604_0003342 3300053151 Bacteria 4314
1413 Ga0500616_0000037 3300053153 Bacteria 390473
1414 Ga0500616_0002187 3300053153 Bacteria 16855
1415 Ga0500622_0000141 3300053156 Bacteria 76332
1416 Ga0500622_0000155 3300053156 Bacteria 72050
1417 Ga0500622_0000258 3300053156 Bacteria 53957
1418 Ga0500622_0000481 3300053156 Bacteria 37439
1419 Ga0500622_0004074 3300053156 Bacteria 9383
1420 Ga0500622_0007189 3300053156 Bacteria 6343
1421 Ga0500622_0007499 3300053156 Bacteria 6192
1422 Ga0500622_0084009 3300053156 Bacteria 1590
1423 Ga0500624_000167 3300053157 Bacteria 26625
1424 Ga0500627_0004961 3300053158 Bacteria 4357
1425 Ga0500627_0075512 3300053158 Bacteria 1498
1426 Ga0500634_0024399 3300053161 Bacteria 3289
1427 Ga0500611_000004 3300053727 Bacteria 253326
1428 Ga0500661_004470 3300055283 Bacteria 2616
1429 2511234604 2511231000 Bacteria 4488346
1430 2513233497 2513020052 Bacteria 5120511
1431 2520878823 2519899754 Bacteria 5336938
1432 2522549498 2522125168 Bacteria 7376607
1433 2585144550 2582581278 Bacteria 5296881
1434 2585159122 2582581281 Bacteria 4487904
1435 2585163410 2582581282 Bacteria 4495830
1436 2585425261 2582581873 Bacteria 3032664
1437 2586210423 2585427687 Bacteria 5544917
1438 2587677211 2585428045 Bacteria 5203023
1439 2587749732 2585428060 Bacteria 5304711
1440 2587751805 2585428061 Bacteria 3939663
1441 2587865767 2585428095 Bacteria 3789702
1442 2587943928 2585428115 Bacteria 4420269
1443 2588208744 2585428182 Bacteria 5007281
1444 2588212546 2585428183 Bacteria 5166119
1445 2588220121 2585428184 Bacteria 4978681
1446 2588224917 2585428185 Bacteria 4969476
1447 2588231805 2585428187 Bacteria 4629388
1448 2588445873 2588253712 Bacteria 5403181
1449 2590602170 2588254255 Bacteria 5014294
1450 2590611466 2588254257 Bacteria 5436094
1451 2599478631 2599185184 Bacteria 6430550
1452 2644011466 2643221600 Bacteria 5530138
1453 2644369868 2643221667 Bacteria 5627472
1454 2644642290 2643221716 Bacteria 4986332
1455 2644685259 2643221725 Bacteria 5087956
1456 2722726235 2721755487 Bacteria 6357185
1457 2729201888 2728369107 Bacteria 5082720
1458 2738698530 2738541273 Bacteria 4048577
1459 2738724679 2738541278 Bacteria 9755573
1460 2738731945 2738541279 Bacteria 6149495
1461 2738755878 2738541283 Bacteria 7222293
1462 2738761462 2738541284 Bacteria 5199923
1463 2738764510 2738541285 Bacteria 6150075
1464 2738854136 2738541302 Bacteria 5944758
1465 2739213525 2738543007 Bacteria 6149845
1466 2739252856 2738543014 Bacteria 4048139
1467 2739303027 2738543023 Bacteria 6767879
1468 2739587620 2739367651 Bacteria 6359826
1469 2739614667 2739367656 Bacteria 5152243
1470 2739648076 2739367663 Bacteria 5040914
1471 2740000790 2739367857 Bacteria 5433684
1472 2740005606 2739367858 Bacteria 5432813
1473 2740033893 2739367866 Bacteria 4215900
1474 2740057089 2739367874 Bacteria 4872888
1475 2753672117 2751185877 Bacteria 4921427
1476 2765572118 2765235839 Bacteria 5314748
1477 2772603924 2772190705 Bacteria 4666226
1478 2776615907 2775506987 Bacteria 5373360
1479 2802654174 2802428842 Bacteria 4926114
1480 2816872329 2816332188 Bacteria 5133218
1481 2817415801 2816332280 Bacteria 5109718
1482 2819545527 2818991437 Bacteria 5805520
1483 2819572472 2818991442 Bacteria 8318214
1484 2819585917 2818991444 Bacteria 6968812
1485 2819680535 2818991460 Bacteria 7595395
1486 2821140143 2821136567 Bacteria 8080116
1487 2833642258 2833640130 Bacteria 4858325
1488 2839991375 2839989709 Bacteria 3773432
1489 2840677666 2840677318 Bacteria 2664183
1490 2842086517 2842083920 Bacteria 4857652
1491 2842724593 2842722452 Bacteria 6263924
1492 2842907174 2842903701 Bacteria 6986368
1493 2842911913 2842909656 Bacteria 6185908
1494 2849283552 2849281842 Bacteria 6065644
1495 2852623540 2852623160 Bacteria 4376875
1496 2852628109 2852627209 Bacteria 5896285
1497 2857614539 2857613821 Bacteria 4917088
1498 2857619078 2857618242 Bacteria 5635925
1499 2857630511 2857627736 Bacteria 5625397
1500 2871722952 2871720351 Bacteria 4862476
1501 2881360446 2881359912 Bacteria 4935907
1502 2881957556 2881955468 Bacteria 3545609
1503 2883071180 2883068021 Bacteria 6192739
1504 2884635190 2884634485 Bacteria 3928637
1505 2884798041 2884791551 Bacteria 8511252
1506 2884937559 2884933994 Bacteria 4535041
1507 2889292410 2889290771 Bacteria 5530962
1508 2890740744 2890737413 Bacteria 4269751
1509 2895501672 2895498888 Bacteria 5283788
1510 2896085484 2896085136 Bacteria 6129793
1511 2896113688 2896109856 Bacteria 7140722
1512 2896320786 2896317667 Bacteria 4606601
1513 2896345355 2896344016 Bacteria 3811746
1514 2898713935 2898713307 Bacteria 4110805
1515 2902050710 2902048731 Bacteria 4976191
1516 2903898590 2903895155 Bacteria 5258610
1517 2904419827 2904419702 Bacteria 5166287
1518 2904448022 2904445276 Bacteria 5310396
1519 2904472265 2904467357 Bacteria 8057758
1520 2904556616 2904555929 Bacteria 5218588
1521 2904782842 2904780799 Bacteria 5840761
1522 2906000612 2905999023 Bacteria 4591259
1523 2910247849 2910245624 Bacteria 6935613
1524 2911140313 2911138879 Bacteria 5811561
1525 2914763111 2914759650 Bacteria 4701441
1526 2919180453 2919177583 Bacteria 5641607
1527 2919188473 2919186247 Bacteria 6244071
1528 2919194059 2919191525 Bacteria 5765973
1529 2919400618 2919399522 Bacteria 5164947
1530 2919441315 2919437846 Bacteria 6199444
1531 2919512599 2919509842 Bacteria 4104664
1532 2919688422 2919683626 Bacteria 5534354
1533 2919693353 2919692658 Bacteria 5943958
1534 2928080311 2928078545 Bacteria 6534839
1535 2928149514 2928147474 Bacteria 6512076
1536 2929153045 2929150217 Bacteria 5462483
1537 2929159320 2929154850 Bacteria 6753285
1538 2929182829 2929177148 Bacteria 7883697
1539 2929244971 2929239360 Bacteria 7745570
1540 2929927224 2929921140 Bacteria 8649150
1541 2932083345 2932082852 Bacteria 6563563
1542 2939667442 2939664404 Bacteria 6364494
1543 2945927621 2945924605 Bacteria 4296724
1544 2945978784 2945977869 Bacteria 7777518
1545 2945998547 2945997725 Bacteria 6404843
1546 2946015351 2946013367 Bacteria 7766675
1547 2946020766 2946019816 Bacteria 4621265
1548 2954021014 2954016120 Bacteria 6446024
1549 2958460899 2958458903 Bacteria 5301041
1550 2958513425 2958512119 Bacteria 4528530
1551 2965323712 2965320100 Bacteria 3975600
1552 2977232886 2977232053 Bacteria 5485925
1553 2977246618 2977243572 Bacteria 4374394
1554 2977269710 2977268062 Bacteria 5243061
1555 2984575556 2984572630 Bacteria 4186940
1556 2984609009 2984606641 Bacteria 4186971
1557 2993373950 2993372514 Bacteria 4214139
1558 2993480851 2993480792 Bacteria 4022225
1559 3003234846 3003233435 Bacteria 4458031
1560 8003151102 8003151029 Bacteria 8187759
1561 8054308225 8054307821 Bacteria 5212224
1562 8055421477 8055419101 Bacteria 5289643
1563 8055591254 8055588893 Bacteria 3619545
1564 8055594050 8055592153 Bacteria 5961247
1565 8056441415 8056440228 Bacteria 4946504
1566 Ga0453684_0014163
1567 SwRhRL2b_contig_1663676
1568 SwRhRL2b_contig_3047449
1569 JGI24740J21852_10004979
1570 JGI24740J21852_10006938
1571 JGI24739J22299_10004155
1572 JGI24739J22299_10005815
1573 JGI24737J22298_10002176
1574 JGI24735J21928_10000002
1575 JGI24751J29686_10001013
1576 JGI25162J39368_1000024
1577 JGI25162J39368_1001318
1578 JGI25154J39366_1000047
1579 JGI25158J39367_1004804
1580 JGI25157J39369_1002465
1581 JGI25164J39214_1000855
1582 JGI25152J39213_1000007
1583 JGI25150J39212_1000013
1584 JGI25151J46595_10000004
1585 JGI25406J46586_10007660
1586 JGI25153J46596_10000004
1587 JGI25153J46596_10007229
1588 rootH1_10001629
1589 rootH1_10073809
1590 rootH1_10160863
1591 rootH2_10003246
1592 rootH2_10005719
1593 rootH2_10006783
1594 rootH2_10061691
1595 rootL2_10006109
1596 rootL2_10018664
1597 rootL2_10048389
1598 rootL2_10058703
1599 rootL2_10100931
1600 rootL2_10108093
1601 rootL2_10338439
1602 rootH1_10002666
1603 rootH1_10010261
1604 rootH1_10010262
1605 rootH1_10029472
1606 rootH1_10030425
1607 rootH1_10063152
1608 rootH1_10082354
1609 rootH1_10148113
1610 rootH1_10230439
1611 JGI25160J50197_1000981
1612 JGI25160J50197_1006733
1613 JGI25160J50197_1009613
1614 Ga0006562J51391_1012235
1615 Ga0006562J51391_1026618
1616 Ga0055535_1001731
1617 Ga0055542_1004590
1618 Ga0055526_1008317
1619 Ga0055536_1000010
1620 Ga0055536_1001611
1621 Ga0055528_1000701
1622 Ga0055530_10000911
1623 Ga0055530_10002214
1624 Ga0055531_10000245
1625 Ga0055531_10000435
1626 Ga0058863_11371296
1627 Ga0058862_12893042
1628 Ga0065165_1000131
1629 Ga0065165_1000725
1630 Ga0065165_1001074
1631 Ga0065714_10003996
1632 Ga0065714_10007893
1633 Ga0065714_10064770
1634 Ga0065714_10067085
1635 Ga0065714_10068951
1636 Ga0065714_10081337
1637 Ga0065704_10070136
1638 Ga0065704_10070374
1639 Ga0065704_10070934
1640 Ga0065704_10071262
1641 Ga0065704_10073279
1642 Ga0065704_10074546
1643 Ga0065704_10082725
1644 Ga0065704_10084719
1645 Ga0065704_10095111
1646 Ga0065704_10098586
1647 Ga0065712_10001912
1648 Ga0065712_10099197
1649 Ga0065715_10005294
1650 Ga0065715_10088952
1651 Ga0065715_10133208
1652 Ga0065715_10165505
1653 Ga0065707_10175618
1654 Ga0070658_10000011
1655 Ga0070658_10000515
1656 Ga0070658_10008589
1657 Ga0070658_10115992
1658 Ga0070658_10134793
1659 Ga0070658_10224479
1660 Ga0070658_10278492
1661 Ga0070676_10000277
1662 Ga0070676_10002355
1663 Ga0070676_10094701
1664 Ga0070683_100002536
1665 Ga0070683_100003504
1666 Ga0070683_100004268
1667 Ga0070683_100006103
1668 Ga0070683_100010704
1669 Ga0070683_100075911
1670 Ga0070690_100010328
1671 Ga0070690_100022642
1672 Ga0070670_100015632
1673 Ga0070670_100032500
1674 Ga0070670_100038445
1675 Ga0070670_100081448
1676 Ga0070670_100188523
1677 Ga0068869_100000827
1678 Ga0068869_100005917
1679 Ga0068869_100007558
1680 Ga0068869_100032239
1681 Ga0070666_10000323
1682 Ga0070666_10001233
1683 Ga0070666_10151143
1684 Ga0070666_10199298
1685 Ga0070680_100010203
1686 Ga0070680_100024474
1687 Ga0070680_100070642
1688 Ga0070680_100088593
1689 Ga0070680_100138593
1690 Ga0070680_100250961
1691 Ga0070682_100000039
1692 Ga0070682_100000625
1693 Ga0070682_100009958
1694 Ga0070682_100026312
1695 Ga0068868_100004571
1696 Ga0068868_100009633
1697 Ga0068868_100035974
1698 Ga0070660_100001306
1699 Ga0070660_100002764
1700 Ga0070660_100015693
1701 Ga0070660_100130765
1702 Ga0070689_100010555
1703 Ga0070689_100028711
1704 Ga0070689_100080880
1705 Ga0070689_100299370
1706 Ga0070691_10000660
1707 Ga0070691_10020602
1708 Ga0070687_100001432
1709 Ga0070687_100069461
1710 Ga0070661_100002636
1711 Ga0070661_100010432
1712 Ga0070661_100011068
1713 Ga0070668_100004869
1714 Ga0070668_100014483
1715 Ga0070668_100023632
1716 Ga0070668_100041596
1717 Ga0070669_100057612
1718 Ga0070669_100078997
1719 Ga0070669_100174934
1720 Ga0070669_100254111
1721 Ga0070675_100003849
1722 Ga0070675_100016358
1723 Ga0070675_100036218
1724 Ga0070675_100059652
1725 Ga0070671_100019758
1726 Ga0070671_100030050
1727 Ga0070671_100061292
1728 Ga0070671_100111333
1729 Ga0070671_100124488
1730 Ga0070673_100002393
1731 Ga0070673_100003782
1732 Ga0070673_100004396
1733 Ga0070673_100012715
1734 Ga0070673_100018686
1735 Ga0070673_100149118
1736 Ga0070688_100012071
1737 Ga0070688_100026240
1738 Ga0070659_100002083
1739 Ga0070659_100003545
1740 Ga0070659_100010122
1741 Ga0070659_100018139
1742 Ga0070667_100005690
1743 Ga0070667_100068663
1744 Ga0070667_100244374
1745 Ga0070678_100004999
1746 Ga0070678_100006236
1747 Ga0070678_100018818
1748 Ga0070678_100151126
1749 Ga0070662_100000032
1750 Ga0070662_100022191
1751 Ga0070662_100030585
1752 Ga0070662_100056919
1753 Ga0070662_100059188
1754 Ga0070662_100086776
1755 Ga0070681_10017068
1756 Ga0070681_10018726
1757 Ga0070681_10034740
1758 Ga0070681_10036428
1759 Ga0070681_10064666
1760 Ga0068867_100009759
1761 Ga0068867_100010951
1762 Ga0068867_100023644
1763 Ga0068867_100033878
1764 Ga0068867_100059230
1765 Ga0068867_100163733
1766 Ga0068867_100276500
1767 Ga0070685_10048201
1768 Ga0070685_10072252
1769 Ga0070685_10117310
1770 Ga0070698_100002644
1771 Ga0070698_100016067
1772 Ga0070679_100025505
1773 Ga0070679_100030821
1774 Ga0070679_100042499
1775 Ga0070679_100042689
1776 Ga0070679_100066869
1777 Ga0070679_100111026
1778 Ga0070684_100000097
1779 Ga0070684_100011014
1780 Ga0070684_100027061
1781 Ga0070684_100036492
1782 Ga0070684_100056838
1783 Ga0068853_100004545
1784 Ga0068853_100008299
1785 Ga0068853_100008727
1786 Ga0068853_100028221
1787 Ga0068853_100057738
1788 Ga0068853_100082062
1789 Ga0068853_100105194
1790 Ga0068853_100234405
1791 Ga0070672_100000061
1792 Ga0070672_100017587
1793 Ga0070672_100050540
1794 Ga0070686_100023709
1795 Ga0070686_100048162
1796 Ga0070693_100006957
1797 Ga0070693_100117735
1798 Ga0070665_100000002
1799 Ga0070665_100000003
1800 Ga0070665_100005248
1801 Ga0070665_100008467
1802 Ga0070665_100049998
1803 Ga0070665_100311945
1804 Ga0068855_100000042
1805 Ga0068855_100000439
1806 Ga0068855_100000508
1807 Ga0068855_100011561
1808 Ga0068855_100027104
1809 Ga0068855_100032170
1810 Ga0068855_100039110
1811 Ga0068855_100048633
1812 Ga0068855_100062885
1813 Ga0068855_100066337
1814 Ga0068855_100116249
1815 Ga0068855_100152650
1816 Ga0068855_100253898
1817 Ga0068855_100282407
1818 Ga0070664_100002153
1819 Ga0070664_100003785
1820 Ga0070664_100004253
1821 Ga0070664_100022827
1822 Ga0070664_100052278
1823 Ga0068857_100001948
1824 Ga0068857_100010962
1825 Ga0068857_100025799
1826 Ga0068857_100125503
1827 Ga0068857_100137879
1828 Ga0068857_100222750
1829 Ga0068854_100007137
1830 Ga0068854_100020090
1831 Ga0068854_100054632
1832 Ga0068856_100000794
1833 Ga0068856_100024601
1834 Ga0068856_100040048
1835 Ga0068856_100113608
1836 Ga0068856_100223899
1837 Ga0070702_100051565
1838 Ga0068852_100002452
1839 Ga0068852_100010222
1840 Ga0068852_100016457
1841 Ga0068852_100024730
1842 Ga0068852_100047320
1843 Ga0068852_100080351
1844 Ga0068859_100000106
1845 Ga0068859_100007461
1846 Ga0068859_100008808
1847 Ga0068859_100080263
1848 Ga0068859_100136898
1849 Ga0068859_100305465
1850 Ga0068864_100003370
1851 Ga0068864_100011427
1852 Ga0068864_100043993
1853 Ga0068864_100111824
1854 Ga0068861_100013324
1855 Ga0068861_100034298
1856 Ga0068861_100160171
1857 Ga0068861_100268986
1858 Ga0068851_10000465
1859 Ga0068851_10047056
1860 Ga0068851_10075702
1861 Ga0068870_10028876
1862 Ga0068870_10088051
1863 Ga0068863_100001273
1864 Ga0068863_100006081
1865 Ga0068863_100011467
1866 Ga0068863_100032496
1867 Ga0068863_100048536
1868 Ga0068863_100076978
1869 Ga0068863_100177698
1870 Ga0068863_100238773
1871 Ga0068863_100302941
1872 Ga0068858_100000930
1873 Ga0068858_100006822
1874 Ga0068858_100016470
1875 Ga0068858_100149041
1876 Ga0068860_100000003
1877 Ga0068860_100003491
1878 Ga0068860_100009409
1879 Ga0068860_100011027
1880 Ga0068860_100026307
1881 Ga0068862_100006586
1882 Ga0068862_100076920
1883 Ga0068862_100142298
1884 Ga0081540_1040101
1885 Ga0081539_10001169
1886 Ga0081539_10029490
1887 Ga0075366_10001072
1888 Ga0075366_10007887
1889 Ga0075366_10009701
1890 Ga0075366_10021500
1891 Ga0075366_10021509
1892 Ga0075366_10106071
1893 Ga0097621_100000165
1894 Ga0097621_100000531
1895 Ga0097621_100006425
1896 Ga0097621_100016683
1897 Ga0097621_100068802
1898 Ga0097621_100070099
1899 Ga0097621_100109977
1900 Ga0097621_100156438
1901 Ga0068871_100000018
1902 Ga0068871_100000042
1903 Ga0068871_100001712
1904 Ga0068871_100002324
1905 Ga0068871_100002902
1906 Ga0068871_100007826
1907 Ga0068871_100012489
1908 Ga0068871_100039588
1909 Ga0075428_100004442
1910 Ga0075428_100010463
1911 Ga0075428_100011907
1912 Ga0075430_100004975
1913 Ga0075431_100026391
1914 Ga0075429_100030837
1915 Ga0075429_100071292
1916 Ga0068865_100000396
1917 Ga0068865_100001997
1918 Ga0068865_100051065
1919 Ga0097620_100000106
1920 Ga0097620_100007461
1921 Ga0097620_100008808
1922 Ga0097620_100080264
1923 Ga0097620_100136895
1924 Ga0097620_100305481
1925 Ga0099824_1002886
1926 Ga0079104_1000179
1927 Ga0099826_10037265
1928 Ga0105251_10043569
1929 Ga0105244_10000004
1930 Ga0105244_10000011
1931 Ga0105240_10000037
1932 Ga0105240_10000237
1933 Ga0105240_10000367
1934 Ga0105240_10000487
1935 Ga0105240_10005515
1936 Ga0105240_10022011
1937 Ga0105240_10039540
1938 Ga0105240_10042495
1939 Ga0105240_10043261
1940 Ga0105240_10069454
1941 Ga0105240_10104541
1942 Ga0105240_10113999
1943 Ga0105240_10181056
1944 Ga0105240_10245699
1945 Ga0111539_10014918
1946 Ga0111539_10017967
1947 Ga0111539_10066976
1948 Ga0111539_10162149
1949 Ga0105245_10173353
1950 Ga0105247_10000918
1951 Ga0105247_10011475
1952 Ga0105247_10037908
1953 Ga0114129_10012446
1954 Ga0114129_10052518
1955 Ga0105243_10000009
1956 Ga0105243_10000145
1957 Ga0105243_10172389
1958 Ga0105241_10001462
1959 Ga0105241_10002922
1960 Ga0105241_10003042
1961 Ga0105241_10005760
1962 Ga0105241_10007004
1963 Ga0105241_10030640
1964 Ga0105241_10084882
1965 Ga0105241_10114505
1966 Ga0105242_10006535
1967 Ga0105242_10036683
1968 Ga0105242_10086686
1969 Ga0105242_10121133
1970 Ga0105248_10004482
1971 Ga0105248_10032533
1972 Ga0105248_10256759
1973 Ga0105237_10000224
1974 Ga0105237_10000729
1975 Ga0105237_10000952
1976 Ga0105237_10000963
1977 Ga0105237_10001948
1978 Ga0105237_10002321
1979 Ga0105237_10003093
1980 Ga0105237_10004043
1981 Ga0105237_10008222
1982 Ga0105237_10009903
1983 Ga0105237_10019011
1984 Ga0105237_10021687
1985 Ga0105237_10033447
1986 Ga0105237_10040318
1987 Ga0105237_10179810
1988 Ga0105237_10192111
1989 Ga0105237_10217300
1990 Ga0105237_10297085
1991 Ga0105238_10004274
1992 Ga0105238_10013318
1993 Ga0105238_10037769
1994 Ga0105238_10203974
1995 Ga0105238_10279964
1996 Ga0105249_10001226
1997 Ga0105249_10002137
1998 Ga0105249_10019422
1999 Ga0105249_10021227
2000 Ga0105249_10024010
2001 Ga0105249_10035542
2002 Ga0105249_10115485
2003 Ga0105249_10180744
2004 Ga0105249_10198919
2005 Ga0105249_10315500
2006 Ga0105239_10000002
2007 Ga0105239_10000013
2008 Ga0105239_10000283
2009 Ga0105239_10001207
2010 Ga0105239_10001438
2011 Ga0105239_10003665
2012 Ga0105239_10006888
2013 Ga0105239_10024908
2014 Ga0105239_10025175
2015 Ga0105239_10061828
2016 Ga0105239_10123544
2017 Ga0105239_10150086
2018 Ga0105239_10258859
2019 Ga0105239_10291504
2020 Ga0105239_10383807
2021 Ga0157373_10000002
2022 Ga0157373_10000005
2023 Ga0157373_10000256
2024 Ga0157373_10000936
2025 Ga0157373_10001318
2026 Ga0157373_10002482
2027 Ga0157373_10003984
2028 Ga0157373_10024469
2029 Ga0157373_10025270
2030 Ga0157373_10031635
2031 Ga0157373_10032956
2032 Ga0157373_10033565
2033 Ga0157373_10087296
2034 Ga0157373_10087541
2035 Ga0157373_10219732
2036 Ga0157371_10000046
2037 Ga0157371_10000079
2038 Ga0157371_10000216
2039 Ga0157371_10000741
2040 Ga0157371_10001331
2041 Ga0157371_10002552
2042 Ga0157371_10003861
2043 Ga0157371_10011763
2044 Ga0157371_10015344
2045 Ga0157371_10017592
2046 Ga0157371_10017639
2047 Ga0157371_10018024
2048 Ga0157371_10027826
2049 Ga0157371_10040330
2050 Ga0157371_10104115
2051 Ga0157370_10001014
2052 Ga0157370_10002361
2053 Ga0157370_10003143
2054 Ga0157370_10003236
2055 Ga0157370_10003785
2056 Ga0157370_10007303
2057 Ga0157370_10017885
2058 Ga0157370_10018487
2059 Ga0157370_10020395
2060 Ga0157370_10020909
2061 Ga0157370_10022590
2062 Ga0157370_10023049
2063 Ga0157370_10030370
2064 Ga0157370_10052885
2065 Ga0157370_10074178
2066 Ga0157370_10117145
2067 Ga0157370_10120995
2068 Ga0157370_10121149
2069 Ga0157370_10179980
2070 Ga0157370_10196518
2071 Ga0157370_10208645
2072 Ga0157370_10274035
2073 Ga0157370_10277171
2074 Ga0157369_10000046
2075 Ga0157369_10002118
2076 Ga0157369_10002262
2077 Ga0157369_10009363
2078 Ga0157369_10013763
2079 Ga0157369_10019087
2080 Ga0157369_10023605
2081 Ga0157369_10026663
2082 Ga0157369_10041152
2083 Ga0157369_10061645
2084 Ga0157369_10141071
2085 Ga0157374_10000013
2086 Ga0157374_10000348
2087 Ga0157374_10003727
2088 Ga0157374_10010061
2089 Ga0157374_10010541
2090 Ga0157374_10013448
2091 Ga0157374_10019587
2092 Ga0157374_10020034
2093 Ga0157378_10000859
2094 Ga0157378_10009983
2095 Ga0157378_10018192
2096 Ga0157378_10024509
2097 Ga0157378_10035235
2098 Ga0157378_10057795
2099 Ga0157378_10084952
2100 Ga0157378_10102551
2101 Ga0163162_10000031
2102 Ga0163162_10000037
2103 Ga0163162_10000244
2104 Ga0163162_10000952
2105 Ga0163162_10001265
2106 Ga0163162_10001894
2107 Ga0163162_10002681
2108 Ga0163162_10003934
2109 Ga0163162_10011449
2110 Ga0163162_10013001
2111 Ga0163162_10041760
2112 Ga0163162_10061943
2113 Ga0163162_10109520
2114 Ga0163162_10141494
2115 Ga0163162_10177711
2116 Ga0163162_10180543
2117 Ga0163162_10304066
2118 Ga0163162_10368026
2119 Ga0163162_10385396
2120 Ga0157372_10000001
2121 Ga0157372_10000707
2122 Ga0157372_10003090
2123 Ga0157372_10005652
2124 Ga0157372_10014060
2125 Ga0157372_10018492
2126 Ga0157372_10023207
2127 Ga0157372_10038494
2128 Ga0157372_10040958
2129 Ga0157372_10051481
2130 Ga0157372_10052820
2131 Ga0157372_10071932
2132 Ga0157372_10104350
2133 Ga0157372_10117099
2134 Ga0157372_10139872
2135 Ga0157372_10304866
2136 Ga0157372_10474873
2137 Ga0157372_10547311
2138 Ga0157375_10000182
2139 Ga0157375_10000722
2140 Ga0157375_10005427
2141 Ga0157375_10023572
2142 Ga0157375_10033488
2143 Ga0157375_10043772
2144 Ga0157375_10053361
2145 Ga0157375_10108003
2146 Ga0157375_10136084
2147 Ga0157375_10137542
2148 Ga0157375_10525828
2149 Ga0163163_10000088
2150 Ga0163163_10000272
2151 Ga0163163_10000557
2152 Ga0163163_10005005
2153 Ga0163163_10069653
2154 Ga0163163_10106889
2155 Ga0163163_10193974
2156 Ga0157380_10000165
2157 Ga0157380_10005528
2158 Ga0157380_10089543
2159 Ga0182008_10000025
2160 Ga0182008_10000037
2161 Ga0182008_10000058
2162 Ga0182008_10000208
2163 Ga0157377_10006557
2164 Ga0157377_10012438
2165 Ga0157377_10081857
2166 Ga0157379_10000103
2167 Ga0157379_10018557
2168 Ga0157379_10019354
2169 Ga0157379_10082847
2170 Ga0157379_10115491
2171 Ga0157376_10000484
2172 Ga0157376_10002418
2173 Ga0157376_10003397
2174 Ga0157376_10005152
2175 Ga0157376_10045090
2176 Ga0157376_10162598
2177 Ga0182006_1000039
2178 Ga0182006_1000333
2179 Ga0182006_1000576
2180 Ga0182006_1002025
2181 Ga0182006_1003058
2182 Ga0182006_1003255
2183 Ga0182006_1007354
2184 Ga0182006_1008043
2185 Ga0182007_10000009
2186 Ga0182007_10037797
2187 Ga0182005_1000023
2188 Ga0183373_1008
2189 Ga0163161_10000007
2190 Ga0163161_10000343
2191 Ga0163161_10000628
2192 Ga0163161_10001101
2193 Ga0163161_10002195
2194 Ga0163161_10015712
2195 Ga0163161_10039788
2196 Ga0163161_10051457
2197 Ga0163161_10140016
2198 Ga0163161_10196122
2199 Ga0163161_10302341
2200 Ga0206351_10868731
2201 Ga0154015_1577688
2202 Ga0213876_10002723
2203 Ga0224712_10004532
2204 Ga0209436_101725
2205 Ga0207427_100103
2206 Ga0209437_100017
2207 Ga0209437_100101
2208 Ga0209258_100068
2209 Ga0207425_1000008
2210 Ga0209646_1000003
2211 Ga0209646_1010115
2212 Ga0209026_1000222
2213 Ga0209026_1000244
2214 Ga0209026_1001716
2215 Ga0209026_1003574
2216 Ga0209148_1000182
2217 Ga0209129_1000042
2218 Ga0209233_1000124
2219 Ga0209233_1003362
2220 Ga0209455_1005644
2221 Ga0209673_1000194
2222 Ga0209130_1002722
2223 Ga0209675_1000935
2224 Ga0209676_1000009
2225 Ga0209676_1001085
2226 Ga0209025_1000020
2227 Ga0209564_1003234
2228 Ga0209758_1000022
2229 Ga0209758_1013178
2230 Ga0209758_1016995
2231 Ga0209758_1039628
2232 Ga0209050_1000103
2233 Ga0209050_1000136
2234 Ga0209050_1005897
2235 Ga0209050_1023844
2236 Ga0207426_1000026
2237 Ga0207426_1000341
2238 Ga0207426_1000455
2239 Ga0207426_1006168
2240 Ga0209257_1000005
2241 Ga0209257_1000025
2242 Ga0209257_1003301
2243 Ga0207697_10058643
2244 Ga0207656_10003369
2245 Ga0207656_10078196
2246 Ga0207655_1000008
2247 Ga0207655_1000242
2248 Ga0207713_1046416
2249 Ga0207682_10013648
2250 Ga0207682_10073287
2251 Ga0207710_10001124
2252 Ga0207688_10002010
2253 Ga0207688_10018186
2254 Ga0207680_10000125
2255 Ga0207680_10004003
2256 Ga0207680_10090488
2257 Ga0207680_10114292
2258 Ga0207647_10000104
2259 Ga0207647_10005038
2260 Ga0207647_10015091
2261 Ga0207647_10021853
2262 Ga0207647_10050404
2263 Ga0207647_10075592
2264 Ga0207645_10000650
2265 Ga0207645_10000793
2266 Ga0207645_10002278
2267 Ga0207645_10010687
2268 Ga0207645_10132455
2269 Ga0207643_10003896
2270 Ga0207643_10049960
2271 Ga0207643_10068017
2272 Ga0207705_10000015
2273 Ga0207705_10015947
2274 Ga0207705_10030739
2275 Ga0207705_10043306
2276 Ga0207705_10066747
2277 Ga0207705_10168295
2278 Ga0207654_10003790
2279 Ga0207654_10012469
2280 Ga0207654_10019327
2281 Ga0207654_10031761
2282 Ga0207654_10035887
2283 Ga0207654_10054274
2284 Ga0207707_10000160
2285 Ga0207707_10027427
2286 Ga0207707_10063492
2287 Ga0207707_10080305
2288 Ga0207695_10000013
2289 Ga0207695_10000051
2290 Ga0207695_10000056
2291 Ga0207695_10000066
2292 Ga0207695_10000081
2293 Ga0207695_10000092
2294 Ga0207695_10000156
2295 Ga0207695_10000550
2296 Ga0207695_10002404
2297 Ga0207695_10005846
2298 Ga0207695_10005995
2299 Ga0207695_10006542
2300 Ga0207695_10012058
2301 Ga0207695_10016372
2302 Ga0207695_10021656
2303 Ga0207695_10042663
2304 Ga0207695_10265002
2305 Ga0207671_10000257
2306 Ga0207671_10001789
2307 Ga0207671_10002116
2308 Ga0207671_10002707
2309 Ga0207671_10003054
2310 Ga0207671_10005700
2311 Ga0207671_10005976
2312 Ga0207671_10007245
2313 Ga0207671_10145754
2314 Ga0207671_10253396
2315 Ga0207660_10001905
2316 Ga0207660_10051818
2317 Ga0207660_10074562
2318 Ga0207662_10004278
2319 Ga0207657_10001653
2320 Ga0207657_10003392
2321 Ga0207657_10015945
2322 Ga0207657_10029952
2323 Ga0207657_10042107
2324 Ga0207657_10063853
2325 Ga0207657_10232459
2326 Ga0207649_10025366
2327 Ga0207649_10029127
2328 Ga0207649_10061177
2329 Ga0207652_10000029
2330 Ga0207652_10000115
2331 Ga0207652_10000406
2332 Ga0207652_10000961
2333 Ga0207652_10039601
2334 Ga0207652_10054962
2335 Ga0207652_10067110
2336 Ga0207681_10102685
2337 Ga0207694_10006715
2338 Ga0207694_10032448
2339 Ga0207694_10220231
2340 Ga0207650_10027506
2341 Ga0207650_10032513
2342 Ga0207650_10062568
2343 Ga0207650_10093737
2344 Ga0207650_10141491
2345 Ga0207650_10150022
2346 Ga0207659_10011402
2347 Ga0207659_10014561
2348 Ga0207659_10054617
2349 Ga0207659_10102119
2350 Ga0207687_10101975
2351 Ga0207687_10258044
2352 Ga0207644_10020232
2353 Ga0207644_10052439
2354 Ga0207644_10071229
2355 Ga0207644_10167003
2356 Ga0207690_10003150
2357 Ga0207690_10060376
2358 Ga0207690_10109253
2359 Ga0207706_10000191
2360 Ga0207706_10024864
2361 Ga0207706_10106618
2362 Ga0207686_10017976
2363 Ga0207709_10000026
2364 Ga0207709_10000365
2365 Ga0207670_10005454
2366 Ga0207670_10091135
2367 Ga0207670_10106251
2368 Ga0207669_10088178
2369 Ga0207704_10000053
2370 Ga0207704_10104416
2371 Ga0207704_10150556
2372 Ga0207691_10000154
2373 Ga0207691_10005078
2374 Ga0207691_10030946
2375 Ga0207691_10059353
2376 Ga0207691_10079855
2377 Ga0207691_10083196
2378 Ga0207691_10188552
2379 Ga0207711_10025883
2380 Ga0207711_10049439
2381 Ga0207689_10000360
2382 Ga0207689_10001010
2383 Ga0207689_10006093
2384 Ga0207689_10006592
2385 Ga0207689_10011320
2386 Ga0207689_10011416
2387 Ga0207689_10012630
2388 Ga0207689_10041818
2389 Ga0207689_10094157
2390 Ga0207689_10171472
2391 Ga0207689_10190025
2392 Ga0207661_10002590
2393 Ga0207661_10018276
2394 Ga0207661_10022471
2395 Ga0207661_10314785
2396 Ga0207679_10001022
2397 Ga0207679_10006038
2398 Ga0207679_10006841
2399 Ga0207679_10026302
2400 Ga0207667_10000037
2401 Ga0207667_10001658
2402 Ga0207667_10002366
2403 Ga0207667_10005373
2404 Ga0207667_10009017
2405 Ga0207667_10009279
2406 Ga0207667_10037027
2407 Ga0207667_10043276
2408 Ga0207667_10054870
2409 Ga0207667_10057723
2410 Ga0207667_10080369
2411 Ga0207667_10092593
2412 Ga0207667_10126280
2413 Ga0207667_10168833
2414 Ga0207651_10003771
2415 Ga0207651_10008489
2416 Ga0207651_10017358
2417 Ga0207651_10065649
2418 Ga0207712_10001164
2419 Ga0207712_10001801
2420 Ga0207712_10011162
2421 Ga0207712_10025404
2422 Ga0207712_10032321
2423 Ga0207712_10050010
2424 Ga0207712_10202644
2425 Ga0207668_10001272
2426 Ga0207668_10043236
2427 Ga0207668_10181590
2428 Ga0207640_10025871
2429 Ga0207640_10091812
2430 Ga0207658_10020272
2431 Ga0207658_10035132
2432 Ga0207658_10057653
2433 Ga0207677_10001948
2434 Ga0207677_10010537
2435 Ga0207677_10067060
2436 Ga0207677_10071853
2437 Ga0207677_10202809
2438 Ga0207703_10001922
2439 Ga0207703_10026323
2440 Ga0207703_10173273
2441 Ga0207639_10001747
2442 Ga0207639_10006469
2443 Ga0207639_10018045
2444 Ga0207639_10020682
2445 Ga0207639_10049062
2446 Ga0207639_10056788
2447 Ga0207639_10080730
2448 Ga0207639_10235946
2449 Ga0207678_10094925
2450 Ga0207702_10000201
2451 Ga0207702_10024798
2452 Ga0207702_10029614
2453 Ga0207702_10076949
2454 Ga0207641_10000082
2455 Ga0207641_10003172
2456 Ga0207641_10009438
2457 Ga0207641_10015009
2458 Ga0207641_10021690
2459 Ga0207641_10082894
2460 Ga0207641_10197553
2461 Ga0207648_10000175
2462 Ga0207648_10001709
2463 Ga0207648_10002098
2464 Ga0207648_10015449
2465 Ga0207648_10019442
2466 Ga0207648_10026330
2467 Ga0207648_10049799
2468 Ga0207648_10059413
2469 Ga0207648_10064952
2470 Ga0207648_10109467
2471 Ga0207648_10129399
2472 Ga0207676_10007584
2473 Ga0207676_10007982
2474 Ga0207676_10014437
2475 Ga0207676_10042623
2476 Ga0207676_10050937
2477 Ga0207674_10003993
2478 Ga0207674_10005014
2479 Ga0207674_10005225
2480 Ga0207674_10024952
2481 Ga0207674_10069416
2482 Ga0207674_10090955
2483 Ga0207674_10134865
2484 Ga0207674_10170481
2485 Ga0207674_10260018
2486 Ga0207675_100005095
2487 Ga0207675_100025419
2488 Ga0207675_100039652
2489 Ga0207675_100199108
2490 Ga0207675_100218011
2491 Ga0207675_100258912
2492 Ga0207675_100262591
2493 Ga0207683_10000974
2494 Ga0207683_10007830
2495 Ga0207683_10041067
2496 Ga0207683_10080928
2497 Ga0207683_10187572
2498 Ga0207698_10001166
2499 Ga0207698_10004722
2500 Ga0207698_10009220
2501 Ga0207698_10073819
2502 Ga0207698_10132043
2503 Ga0207698_10174264
2504 Ga0207698_10181498
2505 Ga0209281_1000116
2506 Ga0209489_117024
2507 Ga0209282_1038144
2508 Ga0209974_10037550
2509 Ga0268266_10000018
2510 Ga0268266_10000022
2511 Ga0268266_10005211
2512 Ga0268266_10005285
2513 Ga0268265_10007650
2514 Ga0268265_10102470
2515 Ga0268265_10160055
2516 Ga0268264_10000082
2517 Ga0268264_10005842
2518 Ga0268264_10005919
2519 Ga0268264_10006777
2520 Ga0268264_10011786
2521 Ga0268264_10013496
2522 Ga0268264_10059634
2523 Ga0268264_10377511
2524 Ga0265334_10008517
2525 Ga0307517_10002197
2526 Ga0307517_10006633
2527 Ga0307515_10000001
2528 Ga0307515_10000061
2529 Ga0307515_10000190
2530 Ga0307515_10000927
2531 Ga0307515_10001771
2532 Ga0307515_10011605
2533 Ga0307515_10177925
2534 Ga0265338_10001011
2535 Ga0265338_10143578
2536 Ga0265324_10018826
2537 Ga0307511_10000027
2538 Ga0316177_1132213
2539 Ga0316183_1068856
2540 Ga0265327_10000048
2541 Ga0265327_10000248
2542 Ga0265327_10000272
2543 Ga0265327_10000551
2544 Ga0265327_10002514
2545 Ga0265327_10003148
2546 Ga0265327_10006450
2547 Ga0265327_10009085
2548 Ga0265327_10025709
2549 Ga0265327_10085354
2550 Ga0265327_10085890
2551 Ga0307513_10033920
2552 Ga0307509_10020755
2553 Ga0307509_10036852
2554 Ga0307509_10045900
2555 Ga0307509_10174065
2556 Ga0307408_100000310
2557 Ga0307408_100000534
2558 Ga0307408_100000564
2559 Ga0307408_100040113
2560 Ga0307408_100084815
2561 Ga0265313_10042550
2562 Ga0307508_10007752
2563 Ga0316579_10088628
2564 Ga0316576_10047393
2565 Ga0316578_10044657
2566 Ga0316578_10057303
2567 Ga0316578_10123818
2568 Ga0307516_10000869
2569 Ga0307516_10059174
2570 Ga0307405_10000002
2571 Ga0307405_10000016
2572 Ga0307405_10014744
2573 Ga0307405_10137656
2574 Ga0316577_10114114
2575 Ga0307413_10000019
2576 Ga0307413_10002415
2577 Ga0307410_10000115
2578 Ga0307410_10142957
2579 Ga0307406_10000111
2580 Ga0307407_10000006
2581 Ga0307407_10001642
2582 Ga0307412_10000001
2583 Ga0307412_10000034
2584 Ga0307412_10000154
2585 Ga0307412_10003359
2586 Ga0307412_10237299
2587 Ga0307416_100000030
2588 Ga0307416_100000032
2589 Ga0307416_100025328
2590 Ga0307414_10000001
2591 Ga0307414_10000127
2592 Ga0307414_10000392
2593 Ga0307414_10001064
2594 Ga0307414_10001471
2595 Ga0307414_10035636
2596 Ga0307414_10055020
2597 Ga0307414_10068187
2598 Ga0307414_10075521
2599 Ga0307414_10129539
2600 Ga0307414_10178501
2601 Ga0307411_10000013
2602 Ga0307411_10071513
2603 Ga0307415_100025409
2604 Ga0307415_100143214
2605 Ga0307507_10000064
2606 Ga0307510_10000328
2607 Ga0307510_10007920
2608 Ga0307510_10023468
2609 Ga0373936_0062866
2610 Ga0373955_0093023
2611 Ga0373955_0106131
2612 Ga0373924_0018705
2613 Ga0373927_0021777
2614 Ga0373937_0010206
2615 Ga0373937_0064488
2616 Ga0316582_0005102
2617 Ga0316584_0026927
2618 Ga0316584_0052520
2619 Ga0316584_0056089
2620 Ga0316584_0246152
2621 Ga0395899_0000033
2622 Ga0395899_0000411
2623 Ga0395899_0000435
2624 Ga0395899_0001077
2625 Ga0395899_0002144
2626 Ga0395899_0031560
2627 Ga0395899_0044380
2628 Ga0395899_0059981
2629 Ga0395900_0001393
2630 Ga0395900_0001452
2631 Ga0395900_0003225
2632 Ga0395900_0005622
2633 Ga0395900_0072380
2634 Ga0395900_0098786
2635 Ga0395900_0101122
2636 Ga0395900_0109400
2637 Ga0395900_0130510
2638 Ga0395898_0013831
2639 Ga0395898_0031676
2640 Ga0395898_0158125
2641 Ga0395905_0000998
2642 Ga0395905_0001914
2643 Ga0395905_0007067
2644 Ga0395905_0034426
2645 Ga0395901_0000789
2646 Ga0395901_0002351
2647 Ga0395901_0014642
2648 Ga0395901_0017854
2649 Ga0395901_0030985
2650 Ga0395901_0091000
2651 Ga0395901_0272603
2652 Ga0395901_0315933
2653 Ga0436365_0079092
2654 Ga0436361_0307685
2655 Ga0439439_0009748
2656 Ga0439447_003769
2657 Ga0439466_0015063
2658 Ga0451795_0356222
2659 Ga0451795_1501558
2660 Ga0451807_1155230
2661 Ga0451849_1009127
2662 Ga0451855_1236631
2663 Ga0451855_1803231
2664 Ga0439431_0000122
2665 Ga0439442_002574
2666 Ga0439445_0003161
2667 Ga0439448_0004334
2668 Ga0439449_0006488
2669 Ga0439455_0019582
2670 Ga0439457_007860
2671 Ga0439457_009122
2672 Ga0439462_0001515
2673 Ga0450923_001237
2674 Ga0450898_002493
2675 Ga0451577_0000042
2676 Ga0451577_0000418
2677 Ga0451577_0005315
2678 Ga0451577_0016491
2679 Ga0451577_0047761
2680 Ga0451577_0066330
2681 Ga0451577_0066793
2682 Ga0451577_0077739
2683 Ga0451577_0098078
2684 Ga0451577_0103906
2685 Ga0451577_0158178
2686 Ga0451577_0302681
2687 Ga0466969_0001347
2688 Ga0466972_0000001
2689 Ga0466972_0000280
2690 Ga0466972_0076144
2691 Ga0453683_0000286
2692 Ga0453683_0000572
2693 Ga0453683_0000680
2694 Ga0453683_0008542
2695 Ga0453683_0009555
2696 Ga0453683_0019047
2697 Ga0453683_0040595
2698 Ga0453683_0046010
2699 Ga0453683_0183173
2700 Ga0453684_0000452
2701 Ga0453684_0001009
2702 Ga0453684_0001431
2703 Ga0453684_0001697
2704 Ga0453684_0002271
2705 Ga0453684_0004934
2706 Ga0453684_0005946
2707 Ga0453684_0008008
2708 Ga0453684_0024385
2709 Ga0453684_0025246
2710 Ga0453684_0034365
2711 Ga0453684_0037166
2712 Ga0453684_0040283
2713 Ga0453684_0120207
2714 Ga0453684_0156804
2715 Ga0466971_0014790
2716 Ga0466968_0028469
2717 Ga0466970_0000495
2718 Ga0466957_0001670
2719 Ga0466957_0007722
2720 Ga0466959_0000004
2721 Ga0466959_0000446
2722 Ga0466959_0055794
2723 Ga0451576_0000002
2724 Ga0451576_0000254
2725 Ga0451576_0000589
2726 Ga0451576_0001052
2727 Ga0451576_0005169
2728 Ga0451576_0009640
2729 Ga0451576_0044662
2730 Ga0451576_0047009
2731 Ga0451576_0059430
2732 Ga0451576_0072309
2733 Ga0451576_0087081
2734 Ga0451576_0111131
2735 Ga0451576_0152198
2736 Ga0466958_0082156
2737 Ga0495627_000034
2738 Ga0495627_006812
2739 Ga0495627_007928
2740 Ga0495627_045014
2741 Ga0495592_0163888
2742 Ga0495590_0005877
2743 Ga0495638_0000171
2744 Ga0495638_0018471
2745 Ga0495651_0045960
2746 Ga0495650_0000003
2747 Ga0495650_0021678
2748 Ga0495650_0051350
2749 Ga0495585_0000079
2750 Ga0495585_0000411
2751 Ga0495596_0000865
2752 Ga0495607_0011024
2753 Ga0495606_0000116
2754 Ga0495606_0011506
2755 Ga0495606_0012165
2756 Ga0495606_0014159
2757 Ga0495606_0017762
2758 Ga0495606_0023782
2759 Ga0495610_0000001
2760 Ga0495610_0000992
2761 Ga0495610_0001007
2762 Ga0495610_0004188
2763 Ga0495616_0008226
2764 Ga0495616_0043233
2765 Ga0495616_0113617
2766 Ga0495618_0121596
2767 Ga0495628_0009018
2768 Ga0495630_0064766
2769 Ga0495630_0078966
2770 Ga0495632_0023621
2771 Ga0495637_0003326
2772 Ga0495643_0000506
2773 Ga0495643_0003411
2774 Ga0495648_0000879
2775 Ga0495648_0002877
2776 Ga0495663_0000406
2777 Ga0495654_0000001
2778 Ga0495665_0104353
2779 Ga0495586_0131063
2780 Ga0495587_0064905
2781 Ga0495609_0000025
2782 Ga0495609_0015343
2783 Ga0495621_0012524
2784 Ga0495622_0014656
2785 Ga0495622_0036520
2786 Ga0495622_0060076
2787 Ga0495633_0000056
2788 Ga0495633_0000057
2789 Ga0495633_0000344
2790 Ga0495668_0000021
2791 Ga0495668_0000257
2792 Ga0495668_0001099
2793 Ga0495668_0004989
2794 Ga0495625_0000159
2795 Ga0495625_0001186
2796 Ga0495625_0002144
2797 Ga0495625_0005105
2798 Ga0495625_0008186
2799 Ga0495625_0019973
2800 Ga0495625_0033793
2801 Ga0495625_0119956
2802 Ga0495635_0137075
2803 Ga0495661_0001360
2804 Ga0495661_0015325
2805 Ga0495658_0025645
2806 Ga0495613_0146383
2807 Ga0495671_0071739
2808 Ga0495649_0000003
2809 Ga0495672_0002547
2810 Ga0495672_0024143
2811 Ga0495672_0066796
2812 Ga0495680_0045059
2813 Ga0495687_000179
2814 Ga0495687_002135
2815 Ga0495687_002367
2816 Ga0495675_0107839
2817 Ga0495684_0015951
2818 Ga0495686_0000010
2819 Ga0495686_0000160
2820 Ga0495686_0000234
2821 Ga0495686_0000489
2822 Ga0495686_0001122
2823 Ga0495686_0002126
2824 Ga0495686_0012985
2825 Ga0495686_0066077
2826 Ga0495686_0082255
2827 Ga0495686_0117769
2828 Ga0495614_0030275
2829 Ga0496103_0054877
2830 Ga0496104_0376680
2831 Ga0496109_0164106
2832 Ga0496109_0340329
2833 Ga0496110_0086573
2834 Ga0496111_0087451
2835 Ga0496113_0198306
2836 Ga0496114_0000412
2837 Ga0496115_0005714
2838 Ga0496115_0027455
2839 Ga0496115_0088816
2840 Ga0496116_0000047
2841 Ga0496116_0000266
2842 Ga0496116_0034662
2843 Ga0496117_0000365
2844 Ga0496118_0000672
2845 Ga0496118_0052195
2846 Ga0496119_0000227
2847 Ga0496121_0001581
2848 Ga0496121_0010116
2849 Ga0496122_0000045
2850 Ga0496122_0000277
2851 Ga0496122_0000668
2852 Ga0496122_0000698
2853 Ga0496122_0004620
2854 Ga0496122_0024722
2855 Ga0496122_0064153
2856 Ga0496123_0000728
2857 Ga0496123_0018435
2858 Ga0496124_0008911
2859 Ga0496124_0094661
2860 Ga0496125_0000050
2861 Ga0496125_0001041
2862 Ga0496125_0001313
2863 Ga0496126_0002717
2864 Ga0496126_0003177
2865 Ga0496126_0004416
2866 Ga0501298_001720
2867 Ga0501299_014295
2868 Ga0501032_0003483
2869 Ga0501033_0088258
2870 Ga0501033_0137637
2871 Ga0501034_0012481
2872 Ga0501034_0023798
2873 Ga0501034_0176353
2874 Ga0501036_0001169
2875 Ga0501037_0008589
2876 Ga0501037_0027220
2877 Ga0501038_0025547
2878 Ga0501038_0142314
2879 Ga0501039_0012075
2880 Ga0501039_0066169
2881 Ga0501043_0003386
2882 Ga0501043_0025390
2883 Ga0501043_0035477
2884 Ga0501043_0052405
2885 Ga0501046_0032815
2886 Ga0501046_0032890
2887 Ga0501047_0030028
2888 Ga0501047_0278566
2889 Ga0501067_0006422
2890 Ga0501067_0006775
2891 Ga0501069_0025041
2892 Ga0501070_0050057
2893 Ga0501072_0196270
2894 Ga0501073_0000839
2895 Ga0501073_0082775
2896 Ga0501074_0019469
2897 Ga0501201_000519
2898 Ga0501207_000155
2899 Ga0501210_000224
2900 Ga0501217_000256
2901 Ga0501223_000278
2902 Ga0501223_000532
2903 Ga0501223_013191
2904 Ga0501233_009188
2905 Ga0501235_009750
2906 Ga0501240_001884
2907 Ga0501243_001134
2908 Ga0501249_000009
2909 Ga0501249_003392
2910 Ga0501257_002266
2911 Ga0501259_000291
2912 Ga0501261_001011
2913 Ga0501221_000194
2914 Ga0501225_0003187
2915 Ga0501245_009025
2916 Ga0501079_0036852
2917 Ga0501083_0003883
2918 Ga0501083_0007152
2919 Ga0501241_001025
2920 Ga0501241_003468
2921 Ga0501241_003584
2922 Ga0501241_004068
2923 Ga0501266_000005
2924 Ga0501280_000686
2925 Ga0501035_0010433
2926 Ga0501035_0085782
2927 Ga0501044_0004241
2928 Ga0501044_0121188
2929 Ga0501044_0129100
2930 Ga0501044_0130494
2931 Ga0501044_0175672
2932 Ga0501044_0251193
2933 Ga0501284_00072
2934 nmdc:mga0k408_102378_c1
2935 nmdc:mga0k408_16257_c1
2936 nmdc:mga0k408_2327_c1
2937 nmdc:mga0k408_2685_c2
2938 nmdc:mga0k408_27353_c1
2939 nmdc:mga0k408_7355_c1
2940 nmdc:mga05p37_40325_c1
2941 nmdc:mga05p37_91937_c1
2942 nmdc:mga09592_174604_c1
2943 nmdc:mga09592_66506_c1
2944 nmdc:mga0qj67_32376_c1
2945 nmdc:mga06r32_4922_c1
2946 nmdc:mga06r32_70338_c1
2947 nmdc:mga08y16_171069_c1
2948 nmdc:mga08y16_54887_c1
2949 nmdc:mga08y16_57072_c1
2950 nmdc:mga08y16_77453_c1
2951 Ga0495612_0047800
2952 Ga0500635_0000883
2953 Ga0500578_0000010
2954 Ga0500578_0155323
2955 Ga0500644_0000127
2956 Ga0500646_0004247
2957 Ga0500583_0000064
2958 Ga0500583_0008434
2959 Ga0500583_0016023
2960 Ga0500583_0023006
2961 Ga0500651_0000230
2962 Ga0500641_0000027
2963 Ga0500641_0000289
2964 Ga0500641_0001919
2965 Ga0500556_0014297
2966 Ga0500562_000053
2967 Ga0500607_021068
2968 Ga0500608_018150
2969 Ga0500618_000003
2970 Ga0500559_0098817
2971 Ga0500568_0001188
2972 Ga0500568_0003322
2973 Ga0500577_0002076
2974 Ga0500588_0001245
2975 Ga0500590_036340
2976 Ga0500604_0003342
2977 Ga0500616_0000037
2978 Ga0500616_0002187
2979 Ga0500622_0000141
2980 Ga0500622_0000155
2981 Ga0500622_0000258
2982 Ga0500622_0000481
2983 Ga0500622_0004074
2984 Ga0500622_0007189
2985 Ga0500622_0007499
2986 Ga0500622_0084009
2987 Ga0500624_000167
2988 Ga0500627_0004961
2989 Ga0500627_0075512
2990 Ga0500634_0024399
2991 Ga0500611_000004
2992 Ga0500661_004470
2993 2511234604
2994 2513233497
2995 2520878823
2996 2522549498
2997 2585144550
2998 2585159122
2999 2585163410
3000 2585425261
3001 2586210423
3002 2587677211
3003 2587749732
3004 2587751805
3005 2587865767
3006 2587943928
3007 2588208744
3008 2588212546
3009 2588220121
3010 2588224917
3011 2588231805
3012 2588445873
3013 2590602170
3014 2590611466
3015 2599478631
3016 2644011466
3017 2644369868
3018 2644642290
3019 2644685259
3020 2722726235
3021 2729201888
3022 2738698530
3023 2738724679
3024 2738731945
3025 2738755878
3026 2738761462
3027 2738764510
3028 2738854136
3029 2739213525
3030 2739252856
3031 2739303027
3032 2739587620
3033 2739614667
3034 2739648076
3035 2740000790
3036 2740005606
3037 2740033893
3038 2740057089
3039 2753672117
3040 2765572118
3041 2772603924
3042 2776615907
3043 2802654174
3044 2816872329
3045 2817415801
3046 2819545527
3047 2819572472
3048 2819585917
3049 2819680535
3050 2821140143
3051 2833642258
3052 2839991375
3053 2840677666
3054 2842086517
3055 2842724593
3056 2842907174
3057 2842911913
3058 2849283552
3059 2852623540
3060 2852628109
3061 2857614539
3062 2857619078
3063 2857630511
3064 2871722952
3065 2881360446
3066 2881957556
3067 2883071180
3068 2884635190
3069 2884798041
3070 2884937559
3071 2889292410
3072 2890740744
3073 2895501672
3074 2896085484
3075 2896113688
3076 2896320786
3077 2896345355
3078 2898713935
3079 2902050710
3080 2903898590
3081 2904419827
3082 2904448022
3083 2904472265
3084 2904556616
3085 2904782842
3086 2906000612
3087 2910247849
3088 2911140313
3089 2914763111
3090 2919180453
3091 2919188473
3092 2919194059
3093 2919400618
3094 2919441315
3095 2919512599
3096 2919688422
3097 2919693353
3098 2928080311
3099 2928149514
3100 2929153045
3101 2929159320
3102 2929182829
3103 2929244971
3104 2929927224
3105 2932083345
3106 2939667442
3107 2945927621
3108 2945978784
3109 2945998547
3110 2946015351
3111 2946020766
3112 2954021014
3113 2958460899
3114 2958513425
3115 2965323712
3116 2977232886
3117 2977246618
3118 2977269710
3119 2984575556
3120 2984609009
3121 2993373950
3122 2993480851
3123 3003234846
3124 8003151102
3125 8054308225
3126 8055421477
3127 8055591254
3128 8055594050
3129 8056441415

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00764

Arginosuc_synth

Arginosuccinate synthase N-terminal HUP domain

45

207

0.98

PF20979

Arginosuc_syn_C

Arginosuccinate synthase C-terminal domain

215

431

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kh1-assembly1.cif.gz_A crystal structure of thermus thermophilus hb8 argininosuccinate synthetase 0.9306 6 395
1kh1-assembly1.cif.gz_A crystal structure of thermus thermophilus hb8 argininosuccinate synthetase 0.9212 6 395
2nz2-assembly1.cif.gz_A crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline 0.9209 5 395
1kh2-assembly1.cif.gz_D crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with atp 0.916 6 395
1kh3-assembly1.cif.gz_B crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with inhibitor 0.9154 6 395
ID Description Score Start End Superfamily
af_A0A0R0IGZ2_74_244_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9368 176 342 3.90.1260.10
af_O94354_181_408_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9146 177 390 3.90.1260.10
af_A0A0R0IGZ2_74_244_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9106 176 342 3.90.1260.10
4xfjA02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9102 177 360 3.90.1260.10
af_Q60174_173_395_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9098 177 397 3.90.1260.10
ID Description Score Start End GO Terms
AF-A0A4Q5SHL1-F1-model_v4 Argininosuccinate synthase 0.9888 4 249 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A2E2FP73-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9817 4 396 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A4Q5SHL1-F1-model_v4 Argininosuccinate synthase 0.9809 4 249 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A3D2NCT4-F1-model_v4 deleted 0.9806 4 146
AF-A0A7X8WJU2-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9798 66 397 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526

Map